2XV2A

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caahaam), chemically reduced, ph4.2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
124
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKGEQYMFFCAAHAAMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Metal-Binding Loop Length is a Determinant of the Pka of a Histidine Ligand at a Type 1 Copper Site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 28
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xv2A00
3ERXA 3CDZB 2P80D 2VW6A 1E67A 5I5JA 1AR1B 4F7KA 2PP7A 2WSDA 4BWUA 3GDCA 1NICA 2B3IA 2P80A 3GYRA 3U25A 1AZCA 4E9SA 1KDJA 1PZBA 1WS8A 2OV0A 1OV8A 4KO5A 4FAAB 3ASNB 1KGYE 1W8EA 2TSAA 4G71B 4UF7C 4DP1X 2QDVA 4E9QA 4YSOA 5B1AB 2N0MA 2QT6A 4A2FA 3CVCA 3S3DB 1SFDA 1PZCA 5B3SB 2J57A 3FQ1A 1GY2A 1W6WA 3CZUB 1FWXA 3GXUB 3X1NA 2OCCB 4PCYA 2GIMA 2IH9A 1EHKB 3ASOB 3MX0B 4W9ZA 2PPAA 3AY2A 4YSQA 4MFHA 1ZDQA 3S8FB 3OM3B 3QJRB 2MTAA 2PPEA 5LDUA 3PAVA 2EIMB 2XVBA 1SNRA 1L9PA 2HZHA 5B7MA 1J9RA 4WKXA 1RZPA 2IAAC 2OJ1A 1J5DA 1FA4A 4DP6X 4A2EA 2CCWA 3FSAA 1I53A 2XWZA 1F56A 1L9TA 4HHGA 4NAJA 3AZUA 3FT0A 1OCZB 1J9TA 3OMIB 1BXAA 2XXGA 2FQGA 4HAKA 3PAUA 3DKHA 4WTQA 1V54B 2BWDA 4KOCA 4Q89A 4GY4A 4DP5X 2TSBA 1KYAA 1URIA 1ZPUA 2QDWA 2XXFA 2BP0A 3JT2A 1J5CA 1W6LA 1A4BA 1WA1X 1R1CA 1OCRB 3QJUB 2UXFA 1PLCA 1PF3A 2EILB 1GS6X 4FA7B 1WA0X 4N8UA 1GY1A 1PY0A 2BP8A 5B1BB 2DWTA 1A65A 1SF3A 2MRYA 3NJHA 2BP0B 2BZCA 1J9QA 2ZOOA 1QLEB 4DPBX 5PAZA 4JHUA 4A2DA 1MZYA 4BWTA 4YSEA 1MG2C 1RCYA 3WNJA 2X87A 1A4CA 2FNWA 2XV0A 1X9RA 1XMEB 3N2JA 2HRHA 3ABMB 2VMJA 4KO9A 4Q8BA 2VM4A 4YVUA 3S3BB 3V9EA 4G7QB 3PLYA 4G7RB 2DY2A 3UGEA 2J56A 2BP8B 1ILUA 2H47C 3V9CA 5I6MA 1HFUA 1GS7A 2J55A 2BWIA 1A4AA 3QJTB 4G72B 4NERA 5I5MA 2YXWA 1IC0A 2YAQA 4HCIA 4JKNA 4A67A 4QLWA 3WI9A 2XX1A 1M9WA 2ZXWB 1ZIBA 4HCFA 3IBOA 1AAJA 1ETJA 3X2QB 4AKOA 1IBZA 3CG8A 2JKWA 1JXGA 1AS6A 1JZJA 1TEFA 1AG6A 1E5YA 3NJKA 1SF5A 2FJSA 3FSZA 3NYKA 3FQ2A 1RKRA 3IN0A 4G7SB 1KCBA 1EZLA 3NJNA 3NT0A 1PAZA 2I7OA 2CJ3A 1JXFA 1IKOP 3QJQB 4GP4B 4HCGA 1J9SA 2BW5A 3UABA 1UATA 1BQKA 1L9QA 2CAKA 4RH4A 2DWSA 5TK2A 2UXVA 3BVDB 4YSRA 4NB7A 3NSYA 1JOIA 4F2EA 3BQVA 1GYCA 2Q9OA 3CVDA 2R7EA 5D4JA 2GI0A 2I85A 1BQRA 3FYEB 3T6ZA 2I7SA 5A7EA 1AZRA 4UAHA 4AKPA 2HX9A 2ZONA 1AG0A 1QNIA 1SFHA 2HX7A 5D4HA 1L9OA 3SQRA 1SHXA 2Y1AA 2BZ7A 5B1JA 4E9RA 2HRGA 2EIJB 4BDVA 3PAZA 1PZAA 2R7EB 3QJVB 1PMYA 1IUZA 2XV2A 1NWOA 3SBQA 1AZUA 3OQRA 1FFTB 3PXLA 3FSVA 2VM3A 3NP4A 2W8CA 2WO2B 1AOZA 2GBAA 3OMNB 2IWEA 1HAUA 5F7AA 1N70A 4YSSA 2UX7A 3D12B 3DTUB 5IY5B 2FT8A 2XU9A 4F2FA 4HZ1A 4BDVB 1XB6A 2FQFA 4KNTA 2XLLA 4AX3A 3KW8A 3FPYA 4KO7A 3PPSA 5E9NA 3OD3A 4GXFA 3TU6A 4HALA 3UADA 4M4RB 1JZIA 4K9JA 2X88A 3H4HA 4E9VA 4CSZA 3EH5B 3TA4D 2IDSA 2EINB 2EIKB 1A3ZA 1JZGA 3X1BA 3NJFA 1JXDA 1GS8A 2IWFA 3UAAA 1AZNA 2PCFA 5AZUA 5I6PA 1JERA 3TASA 3IE9A 1SJMA 3QQXA 4A2HA 1OE2A 2H5UA 3G5WA 5I5IA 2PP9A 4ENZA 3WIAA 3IEAA 1WA2X 2YAEA 1JZFA 3H4FA 4JHVA 3ABGA 2HX8A 1PNCA 1L9RA 1XB3A 2IDFA 1TU2A 1BEXA 3TBCA 3ABLB 4AKQA 2JXMA 2DYRB 3WKPA 1WS7A 5AKRA 4ZK8A 4BK5C 4TXVB 2PLTA 3WKQA 3X1GA 3T6WA 4E9XA 4AZUA 2BHFA 1KBWA 3EF4A 1CYXA 1NWPA 2FQEA 4X4KA 3X1EA 4YSPA 2RACA 1E30A 1ID2A 4L0PB 2B08A 4BWWA 4W1TA 2J5WA 4AI7A 1NZRA 2YQBA 3S3CB 3L45A 2ZWNA 3UAEA 3SBRA 1IBYA 1V10A 3FU8A 2GC7C 1DYZA 5I26A 5F7BA 1NIFA 2XX0A 2UXGA 1AQ8A 1AIZA 4P5SA 2GC4C 3NJLA 2IH8A 2H3XC 1ILSA 1NPNA 4KOBA 1DZ0A 3RYMA 3DIVA 3T9WA 2YAFA 1AS7A 3T6VA 3QJSB 3TBBA 4DP2X 2AFNA 2VSMB 5I6KA 3NP3A 3T6XA 4UANA 1OCOB 2DV6A 4CSPA 5B7FA 4BXSV 1TEGA 4YSCA 2BO0A 1KCWA 2PPFA 2AANA 1JZEA 2VSKB 2W88A 4PAZA 1NPJA 1JVOA 5ANHA 5I6OA 3MBWB 3NSFA 1ASOA 2VN3A 2VW4A 2BW4A 5I28A 2GSMB 1M56B 4GP8B 4YVNA 2YARA 4A68A 1VLXA 2AZUA 1ZDSA 4GP5B 1BYOA 4DP9X 5FC9A 1ASQA 2E86A 1MG3C 1MDAA 2HLEB 5B1JC 3ZIYA 3FU9A 7PCYA 2PPDA 3CVBA 3JTBA 2YAMA 3HEIB 2DYSB 1ADWA 2FT6A 1GSKA 3NSCA 1PLBA 3NJIA 4DPCX 1OCCB 1GW0A 1X9UA 1PCSA 4HIPA 3H56A 4E9WA 4DP4X 4GYBA 3NJMA 2PP8A 2XV3A 2FTAA 3ZDWA 3AW5A 1NIDA 4KNSA 2YAHA 4DP0X 1NIBA 1SDDA 4DPAX 1MZZA 1KDIA 4KO6A 1N68A 2IDTA 6PCYA 1ET7A 3NJGA 2FQDA 2WO3B 4M3HA 2XYBA 2LLNA 2HXAA 1CUOA 2XUWA 1NINA 1JZHA 1ET5A 1GR7A 2IDQA 3EH3B 4YL4A 5EHFA 2GHZA 2AVFA 2Q5BA 3S8GB 2Y69B 1HAWA 3FS9A 1SDDB 1ET8A 1BAWA 1XB8A 3AG3B 1RZQA 4DP7X 1AACA 3AG2B 3EHBB 3ABKB 5PCYA 5AFAA 1T5KA 2NRDA 1V55B 2CBPA 2CUAA 1SHWA 5TK4A 4A66A 1ZV2A 1OE3A 1TKWA 1CYWA 1E5ZA 1B3IA 2PPCA 8PAZA 3WG7B 2FT7A 3FQYA 1NDTA 2PCYA 2FWLB 3FSWA 2VW7A 3ZX1A 9PCYA 1AANA 2YXVA 4KNUA 1BYPA 4HHWA 4YSDA 1OE1A 4DP8X 1PNDA 3QPKA 2IDUA 1WAEA 1ZIAA 2YAPA 3HB3B 3C75A 2CALA 5I6NA 7PAZA 1L9SA 3X1FA 2QPEB 1BQ5A 2GB2A 5B7EA 3AG1B 5D4IA 4EF3A 3NSDA 3EH4B 3WNIA 3OMAB 1NIEA 1ASPA 3PCYA 1AS8A 1E65A 1BXUA 4YSTA 3FU7A 1CC3A 2JFCA 4QKTA 1OF0A 3ZBMA 4BXVA 2AZAA 3AG4B 1AZBA 1BXVA 5I6LA 6PAZA 4E9YA 2A3TA 4E9TA 3SBPA 4A2GA 4YSUA 1JVLA 3CDZA 2IWKA 3NJJA 3UACA 2YAOA 2UXTA 5B1KA 1M57B 1PLAA 3FU7B 3IN2A 3KW7A 1OOWA 4N4YB 4G70B 4P5RA 1NTDA 1CURA 3FPXA 4YSAA 3N55A 1A8ZA 2QPDB 1NIAA 1KV7A 1QHQA 3T71A 1YLBB 3FYIB 2UX6A 1KBVA
chains in the Genus database with same CATH superfamily
1JVKA 4UV7H 2X4RA 2QV2A 4GT0A 4MASA 4OQTH 2JI2A 4LDEB 1WDAA 3TL5A 1QEWA 3RVUC 3QDGB 4IRZL 5CWSB 3UC0H 2UWEE 2I27N 3MUY1 4ATWA 5C0CA 1WS8A 1RUKH 4MNQD 3L7EA 2F15A 4K8RC 1YEFL 1SXSA 5IQ7L 2E7DA 2BSSB 2WAHA 2D4FA 1SOSA 2V5RA 4ETQB 3SN6N 3TBVA 4CJ0A 4E5XG 3TVMA 5JW5B 1TVHA 2YFOA 3A67H 1GIGH 1C1EH 4N3UA 2EH8H 5HHQA 2V37A 4N25A 3IPBA 4M3KB 4Y4FD 1W6WA 1WWAX 2XQ0A 1C5DB 1LDPL 3KJ4C 4S1SH 2W1NA 1XVSA 3W3BA 3ETBF 4MMZB 2ZCHH 1PKQB 2CHDA 4UIKH 1FVCA 4O02B 3OM3B 3P2DA 4ONFL 1E5CA 4E41E 1OM9A 1BMGA 3AXIA 2O26U 4OBRA 5E9AA 5GS2D 3DX3A 4G6JH 4NT6A 3AADB 4L3CA 3X12B 1J9RA 4A6YL 2E46A 2E7LC 1NLBL 2H32A 3RPBA 5CCHE 3FSAA 1L9TA 1FFRA 1DHKA 4ELMA 5BOZG 4JFDE 4LP4A 1LK3H 5AB9A 2B4CL 1HIMH 4MMXB 1UWGH 4RGMC 1NAMH 3DKHA 2X4QB 2J25A 1MUJB 2V3EA 3GSWA 5AB0A 2FB4L 5IW6B 2TSBA 5I73B 2XZAH 3WYRA 2YSTA 5E5UB 3LHPH 4CC4C 3SPJA 1HINL 4OIIL 4RGNB 3MRGB 4QXGL 4OI9A 3V0EA 8FABB 3GZKA 4JFUA 3RWDA 4FA7B 2DTML 1RK0B 1VF5C 5HGDB 1WAAA 4RIRA 2J1KA 4FG4A 1OLLA 4YPJA 1G7IB 2BP8A 1RUPH 1U9KA 4LPWA 1QOKA 4KK8C 4PN6A 2CRYA 1G6RB 3B3IA 1BF8A 4Y7OC 2IQ9H 4PVNA 5C0ND 5JXED 1G4RA 4MA1C 3QFJD 1NANI 5IB3B 1CVRA 4XVTH 1I7ZB 4WI6A 4JMXA 3PP3K 3PXJA 1BDYA 3U4EA 3WO3B 2OW7A 1KBGL 4Y5VA 2WCPA 1YSOA 3IAPA 1KG0A 3RGBA 1JYXA 1NBYB 2QQLH 5JYMA 5GZOD 3CUPA 3MLTA 2OR7A 2VDMB 5FGSA 1OAZH 2J56A 1O6SB 2X4SA 1BPVA 2OSWA 3ARBB 3T0EC 3FRUA 2WVVB 1IAIM 4L1SA 4X6DE 1JZ2A 4Y5XC 3F05A 4PD4K 2YRLA 3NJVA 3BXNA 4EUPA 2A6DB 1D5BA 1G0YR 1K2DA 3L3OB 1L0QA 2ITDB 1OXYA 3CG8A 4RX4A 3G6AA 1A3LL 2DQGL 1X5YA 4G1EA 3JWOC 1JZJA 2DM2A 1F45A 1EHNA 1JGLL 4OF6A 4TQIA 3FT3A 3WO4C 3WEMA 1MIEH 4K3GA 5KVFL 2QPFA 1FZOB 3V10A 1PAZA 2I7OA 1RUAL 1GC1H 1QKZH 2EDJA 3MNZA 3CC5A 3E2HC 5E03A 2APSA 1SOQA 4JQVA 5D7LD 4W81A 4N0FA 1CXKA 4KKAD 1H6FA 1A7RH 4AY0A 2HVKA 4ODSL 1FDLH 4PREB 4I5BA 1S7VB 1QR1B 1RJLB 3BUYB 3BQVA 1PEZA 1KCSH 3O2WL 1EFQA 4MXVE 4Y5YB 5D4JA 2Q6WA 5JPMC 5EBWB 3V5HB 3FYEB 3ULUE 3NIDF 5E08H 2G3ZA 4BELD 5K59E 4NPYB 4AKPA 1FNFA 4E0RA 4WUKL 2DZEA 4A6YB 4G6MH 2HX7A 1L9OA 2G4EA 2G0LA 2OM5A 1KUMA 3OKLA 1MPAL 5JR1L 3Q1SH 4BFEA 3CSYB 2E5EA 3KL0A 1DTUA 2QL1A 3CD4A 4GAAA 5L88L 4P2OA 2DRUA 2HT3D 1MRFL 2AQTA 4Q58C 1QSFB 3WFHA 1HL8A 1KPRB 3A3YB 2C3HA 3ZT6A 3UTTA 1IUZA 2EZ0D 4MTMA 5H35B 1I8MA 2NQDA 1T83A 4GFXA 1DDHB 2WO2B 3K8LA 5D1QB 2XTLA 4HJ0D 1ZT7A 3KNBA 5KSVB 2VLKE 5C7XH 3EH2A 4EI6B 4QYAA 2WINA 4FNPA 2KC0A 5DF0A 1G7PB 3O6LH 4J28A 2FQFA 2XN2A 1IJ9A 3O6FB 4LU5H 4R90H 3DNKA 5AOZA 4GBXB 4P5MA 4OLZH 4PRPD 3V0VB 5KSBE 3C60B 2YIHA 4KJPD 1K4DB 2UWEF 3RWJA 3SGEI 1HOEA 5F93C 2XBZA 3NCYS 2YGVA 3EH5B 1F2XK 4WW2A 3ZZQA 3E6FA 4X4YA 2BOLA 2PYFA 2AJSL 2ZXQA 5C0AB 1XEUA 2AQ1A 1CE1L 3FCTB 3N44F 4Y9EA 1I82A 4KZCA 4J8RA 4PR5A 5DJ0A 2FO4B 3S5LG 5A2BA 4P05A 5ICXA 1VADA 2QKIC 2NY6C 2VDQH 3MV8E 1AZNA 3PWLA 3GSUB 3G5XA 5DR5H 3BPOB 4KK6C 5CILL 5T1LD 4ZTEA 5I24A 3PL6A 5AVUB 3T1WA 4I89A 1U3HA 3C8KA 3LIZL 1AY1H 4N2AA 1QEXA 2VJ8A 4IIQC 1RZJL 4QYOB 1O5PA 3TIEA 1LK2A 2FSEB 1D2PA 1FG2A 3RZWA 3QHZH 3R19A 5FO7A 2F74A 5HGGS 43C9B 3Q2WA 4GO6B 4OZ4B 1ZK9A 1CGTA 2ADJA 1TO4A 1VZHA 4JPSA 4DO6A 3MCKB 1BVNP 4XXWA 1M42A 5E1GA 4V1DB 4X4KA 3SHSA 4HHAA 5D8JL 4BFKA 3QIUB 3VXTA 1T7YA 1I7UA 1CFSA 2W0FB 3GMLB 4KX9A 4UV4L 4Y2DB 4CDHA 4BWWA 1QASA 4KFZC 2MCPL 4AG4H 2CO2A 1NZRA 4GEIA 3L45A 4PQXA 3S3CB 2ZYSA 1IEBA 3S36L 3SGJA 3RJDA 3VI3B 4PBXA 3P4OB 5C97A 3R1GL 1UJ3A 2EKJA 4OSUL 5I8CB 2HRPL 4P5SA 1TZOA 1JG9A 1NBQA 4NZDA 5TQ2L 4BQ8A 5KAQG 3IMWA 4XRCB 1E4WH 3LEVH 3MCLL 4POZC 4D0CA 1NPNA 1R5VB 5MP6L 1CICB 1DE4A 1WSST 3A6OA 3MTRA 5DJ8A 1J5OH 1M2OA 5EU3B 4A39A 2PWDA 4QTHA 5IHUL 1J18A 4LLMA 4H1LG 1UGNA 3UZEA 4ZMXA 3HRZA 3IDIB 3SPCA 3GSNA 1XGYL 3MLRL 4NQDA 5ETUB 2TRHA 2XCMC 3KJ6H 4G80B 4Z7VB 3RY6C 3TV3H 3I9GH 3VRIA 1MCJA 4KKPA 4HDIB 4QHPA 1WF5A 1FZMB 1H8OA 4X98B 3WN5C 1YC7A 3STZA 5JHLH 3LNIA 2WZ5A 4U1JB 5ALBL 2EVJA 2L3BA 3ZKND 3CZGA 1A9BB 2QTVA 3SE9H 4GKZA 2YMOA 1JWSB 4K2UL 2H9GB 3CVIH 3MU3A 4J2QA 3B2VL 4CNIB 2IMMA 2BOBB 1YNLL 1MCBA 4IHOB 3DGGB 1MRCH 4LHUG 4X6DF 3DPBA 4NENA 1MJJA 3JTBA 2BSRB 1P7HL 3J27A 2BSED 1ADWA 3VH8G 4PY8J 3CPUA 4YHMH 3NZSA 4HQQL 1CLYL 5I30H 2UZXA 4MNQA 2X4UA 4NLAA 4ES9A 2NLJB 3DYOA 4PCKA 2AXFB 1UD8A 4XE5B 3FZUC 3AW5A 4H8WH 1AGFA 4J8QA 5D6DA 2HUHA 2APFA 1FL5A 2YAHA 2VXUH 5J12C 5C1MB 2YSSB 4FQ1H 2W5PA 4OZFA 3EHBD 4HIIA 3NACH 5K1JA 2GI7A 5JHDD 1MFEL 2F6AA 3CZFA 4XNZC 2WKOF 4ZPTA 3WTTA 5MHSE 1VACA 1ZA6A 2MNUA 5LGYA 3C5ZB 5C09E 5LXVA 1FAKT 1XD0A 4L4VB 2JJSA 3OLGA 1JK9B 1H8SA 1Q9WB 2OS7A 1PS3A 2Z8RA 3NBNA 1JF6A 3DDFA 4EN3D 2J1WA 1XF2A 4K3EH 4RMTA 4MXVF 3ARSA 5E7FA 3PWPA 1QFWH 1YJDH 4N0YH 3DURB 4HEPG 1CFVL 5HDBE 1M3JA 1MLBB 3PGDB 3QXDA 5DZLA 5K59F 1EUTA 4LOFA 1BQHG 4JCWA 2VL4A 4IHBA 5BO1H 1A7BA 5GRUL 2BMKB 4UOQA 2NNXA 4IBVA 3PGFL 4FHBD 4LPXA 4L18A 1DZBA 5F96H 4ZFZA 3WFCH 2EDOA 5EFIA 1ZV2A 3PWJA 2YK1H 3EFDH 1BSIA 1DLHA 3CHSA 1ZGLA 5IVZA 1DVYA 1ULVA 4GQZA 4I0KA 4OGYL 4ZZFA 1T0MB 5CEXB 1FJ1B 1J0JA 2R2BB 5FUCE 4FYSA 5GPRA 4IMKC 5FA4A 2K70A 4YUEL 1JHLL 2KL6A 2OTWA 3KLDA 4ZQKB 2CKBL 5CZVL 2ZXEB 4I48B 1A9EB 3IAQA 1NDMB 2PABA 2VDRL 4XC3H 4LLUA 3D08A 4AE1A 4CC1A 5KSBF 2WBJA 3NIFB 3X3FL 1L9SA 4J3TA 4KKCC 2GB2A 1HHJB 2ID5A 1WBYB 3QXTA 3ZGIA 5KANI 1MY7A 1T6VN 3OXSB 3SO3C 3IFPB 1ADQL 5F1IB 2YFNA 3OPZH 5CP3A 2VR3A 3FB8A 1WFJA 3EF7A 3QFJA 4F7TB 1N8ZB 1DJZA 1S7UB 1YMMA 4PMEA 4XMVA 3B7YA 3MBEB 4XOBA 3CN1A 5J13C 3RURA 4N0CC 4PWFA 3GSQB 5D5MF 2BY0A 3PQYB 1YUHB 2A3TA 5B8CA 2DQHH 3EJSA 2NUTA 3TN0C 5DEGA 4S1QL 2WCSA 2HKAA 3MLSL 2DEYX 1X7SA 2G75A 3UJIL 4OM1L 2PR4H 4N4YB 3MJGX 1XMWA 5LQBH 3TP4A 2R27A 4PV1C 2UYLA 4CAGA 3IGLA 1EEZA 2VC2B 4GSXA 2XZZA 2Y5TB 4NP4L 4PB9L 3O2DH 2VZOA 4JO8A 1TZIA 3TBYA 3NA9H 3IDJB 2K7QA 4JPKH 3Q9QA 3GXMA 5DZPA 3QRGH 4KHTL 4APQA 1YUKB 4EI5D 4GW5A 3EOBA 5B3NA 3U25A 5D7LA 1BFTA 1R24B 3MGAA 4GG8B 3GMMB 3LMJL 4GAGL 1A4JB 2ZX9A 1RXLA 4D7BA 5DHYB 2QVIA 2A4ZA 1USZA 3DX8A 5JIMA 3S34H 5FYLE 5H37A 3O4OC 4UF7C 1S7QA 1KEMH 3GBNL 4LCIL 4J3BA 4CSTA 2GK0A 4IMLA 2XZCH 3U79A 2X6CA 4H8HA 4OLVL 1M7IA 1N0XH 3RVTC 4PS7A 1NFKA 1UGKA 4JM2C 4LSUL 4UOZA 5ESAB 4FNLL 1MJ8L 5C3LD 1SN2A 4QNPE 4PRBB 1NCDH 4OT1H 5D96C 4N8VG 5GGVY 3RA7L 3WNPA 1M1XA 1WRFA 1ZRUA 3ASOB 3MX0B 5FCSH 3AY2A 1KENL 2V2WA 1OGTB 1ZDQA 3LKQA 4QRPE 1ZWIB 3QEHB 3VG0L 1OB0A 2LAGB 4OFPA 4PJBA 5LXGL 4MKMA 4YHIA 1JWMA 5IJKA 3ATEA 3QB7C 4LSQH 5ADOL 4XHJD 1RZFL 1DN0A 1OT4A 3CX5J 4ZS6D 4LARH 1K4CA 1KWGA 2BCKA 2OMXB 4HPOL 2EVFA 2CKBB 4H8WC 4QLRA 3LZRA 2V17H 1YN6B 3FONB 3ZDZB 1EPFA 2KQNA 5F71A 4LLDB 4X0NA 3L1EA 4Q89A 3EO0B 4XBEL 2ZKHH 1JD9A 3S96B 4AMXA 3B7RL 4PRPE 4PWGA 2YKLL 4Z7NE 3HZKB 3GJFA 3ZE1E 2IPKA 4U6VL 1A4BA 4RLDA 4BKLB 4BINA 1NC2A 1R1CA 3GBML 1FGNL 3VCLB 4JDVA 3TT1L 3WUWB 2XZQH 3KPSD 3TEXA 3LXAA 5HYFA 2J88H 1R6VA 1YJDC 1XIWC 5CZXC 2X28A 1C5BL 4PJXA 1I8IB 2BHYA 1AHWA 4XCNB 1H6UA 2FSDA 2J1ZA 2ZG3A 4AQAB 2NXZB 1JRHH 2ZOOA 2DF3A 4GS7C 1KCRH 1FIGL 1DJYA 1RMFL 4KXZI 4LPVA 4ILDA 4CVUA 2XV0A 2NW2A 4EXPX 4LHQB 5F7MC 5HDBF 1T1WB 4FLSA 3MRFB 4X5LA 4MXQC 3CCHA 4OUUA 4I2XA 4Y4HB 1PL3A 5IQLA 1KJ2A 3DBXB 1TR7A 3ESPA 4P2YA 3APNA 2OMTA 1H9DA 2FNBA 2CNYA 4ZS7H 3MUZ1 3UZVB 2CGYA 1SJVA 3C5JB 1S78D 1JPEA 3CX2A 4PJ5D 5DYFA 4GXUN 2B16A 3HG4A 1YEEL 4YXLL 4X0KA 5C8JA 1BZ9B 1MWAH 2FZ3A 4PUBH 3ULVD 1OHQA 5EIQA 3IVKB 1BG1A 5DS2A 4JGUA 2FGWH 4FG2A 1FZKB 3L54A 4G7SB 4U3HA 2WNXA 1QD0A 5LGJA 1Q8MA 4M43H 1MAJA 5DMGC 3QNXB 1D5MB 1JXFA 4Y1AD 4WHYH 2VKXA 1CFNB 4NI3A 1DCEA 3Q8BA 2N3JA 1M71B 4MA3A 1T7ZA 2NXYC 2CLVA 3QUML 4PJDB 1U3YA 3FT2B 5C07A 2SEBA 3NJXA 4KWUA 5DQJA 4ZMPA 4NB7A 4Q9QL 5DK3A 1E8XA 3BMVA 4N6QA 3CHRA 4UZGA 1U58B 3QEQA 1AKJD 3I3DA 3SKJL 5DEZA 2H1XA 2EXWC 1JNHA 3A6BL 1FO0L 1JV2B 1VZIA 1JWUA 2EACA 2I7SA 2B1OA 3BH9B 3ISWA 4N24A 5GGQH 3OX8A 5IJVB 4OAWA 1BVLB 3S4SG 3BKJL 4YZWA 3KCPA 5J89A 1MDTA 1MCLA 1E5UI 1TSRA 4NO0D 4BDVA 4DERA 4YC2B 1KLGA 5CFHA 5D2NA 1PSKL 5TF1L 3RFZC 3IF1B 1A6ZB 1PJ9A 3QUYA 2QTEA 1WEJH 4U2YA 1I4FB 2Y7QA 4GKNB 5FA3A 4PJIF 1S9XA 1FFTB 1VFOA 4IRSB 4U1SB 4Z7UB 4ZRGA 2C4XA 5DD1H 1H6TA 4IRJD 4GRWH 4NKOA 4QJ3B 2IWEA 2M2DA 5A7BA 3DXAD 2YLHA 1GAFH 1CFMA 3Q8AA 4K4KA 5IY5B 1G7HB 4N0UB 4DETA 4F15B 3QAZB 1N9PA 4LPYA 1OQXA 3DJRA 3TV8A 2PKDA 2VWEE 5KYNA 2FHBA 4JO3L 5GS1B 2YQ3A 4WJ5A 1HXYB 3BZ5A 1OARL 2F5AH 3MRIB 4NDMA 2IANB 4DZBB 2XWBB 3UADA 5ECJE 4X7TB 2X88A 3D18A 4LEXL 3BC9A 4FQCH 4P23C 3QQ4A 4JCMA 5JHDE 3KMDA 1J48A 3WJLC 4PGCB 2EIKB 3K2MC 3V5KA 5I1IL 5DJ2B 5FYJD 3K5RA 5E94A 5IFHH 5DZOA 2VRKA 3FHQA 3V0DA 5TDOB 1JPTH 2IPTH 4KTDH 5BXFA 2AI0L 5E23A 4G82A 5AYUL 2HVBA 2JCCB 4DUXA 4NUGL 3K6DA 1SJMA 4UQAA 5GRWA 4X4MA 1LE5A 3BDBA 4QNPF 4DTGL 1NC4B 4PJCB 2NR6C 3IEAA 2PO6B 1JZFA 4M8VA 4Q4IA 3ABGA 1WCBA 3MGOA 1ZLSH 3D3VB 1UACH 2H3NB 2X0WA 1OAYL 4YBLB 2LV4A 3M8OH 4RMVA 1HILB 5C2BL 1HDMB 2RH0A 5AKRA 4AZ8B 1QFHA 1Q72H 4GSQA 4PJGE 1MI5E 5EC1A 3OJMB 1JZ3A 3HG0A 4I18A 3JVGA 4HS8L 5ERWA 4OZGA 5HHNB 3G08A 2CSPA 3MJ9A 1C5CH 5CP7B 5DJCB 3GK8L 1G7JA 4Q6YA 4RA0C 2H45A 4FQXB 1I3VA 1R3LB 2EDXA 4HZLA 1F8TH 2R51A 4YHNA 1GZQB 3U36B 4L0PB 2PWEA 5AW4B 3PU7A 3O3AA 2C9XA 5F7UA 5DC2A 3VMPA 1QPKA 2ZUVA 2B1AL 4AI7A 4F20A 3MBXH 1N64L 5FKAB 1JFHA 3HHMA 5E1HB 5JW3H 3HI1A 2ED8A 1TTAA 5I26A 2VXVL 5KOVC 2YBRA 3RVWD 5CCGE 1ITBB 2XX0A 3RGHA 3VI4B 2OK0L 3WXWL 5F1NA 1RHHA 4ADJA 1PQZB 1Y1UA 4JQXA 4Y2LA 3ZE1F 5LLIC 3MBWA 1MCPL 1ZS2A 5EV7A 1QUPA 2DYPA 3VWKC 1LEGB 2ERJC 3I2CH 3HCVA 4XXCA 4WDIA 2VSMB 3QORD 1H5BC 3H9HB 4ZUVA 4YL9A 3TBSB 3N85L 5AB1A 4AT6A 2K1MA 3MPCA 1IAIH 4AL8L 2VSKB 4FNUA 1URLA 4K94H 2D03H 3TT3H 1NPJA 2NQCA 2P43B 4M7LH 2IAMB 4ZO6A 4AV0A 2P5WE 4ENED 2XTJD 1PZSA 2VE6A 3O9WC 5D7IE 1FLRL 1UTDA 4GP8B 4QGTA 3EYSL 1D5IH 2X4NA 1I7RA 3UPRB 3PP4L 1K8DA 2HLAA 4I9WD 3T0VA 4GP5B 4TVPD 5CLZA 5C0RL 2ZSWA 4YEFA 2DWXA 3WFEL 1AD0A 1JPGA 4K73A 4Q52A 4K3JH 3HLAB 2WKLA 1HZLA 5I8EA 2E7BA 1Y6MR 1I9JH 2P24A 4DKAA 1UXWA 3D39D 3BLKA 1BIIB 4HKZB 5BRZD 1W8OA 1DVFC 1X9UA 4HIPA 1RURL 3QQ3A 2MOQA 2IFGA 2NY4C 2XV3A 5DO8A 3SDAA 3WLBB 2ITCB 2R4SH 2VN4A 3BIKA 3GF8A 1JNNL 4RFNB 1IGYA 4XNMB 4IGBB 1E2ZA 4P3CH 2ED6A 2Y36H 1J5IA 3DJSA 4X8XA 2R56L 4M62L 2APBA 1WV7T 2NT0A 1THAA 3TJEH 5EN2A 4GW4A 1QI3A 2E75C 4PG9A 4D0BA 1JZHA 4U6XB 1JUFA 2DN7A 3CFQA 4NC1C 3PY9A 2AMGA 3EADA 1BD2E 1J87A 4Z95H 5IJBC 3SODB 1T03H 4PHXA 1NEPA 1ZTXE 4AV5A 4RRPA 2WNWA 4NQCA 4PRDB 5D4QA 4MD4B 5ITFA 1DQDH 3KEDA 4ZNCD 1ZMYA 2VR8A 4RAVA 2O5ZH 1MFCH 4MA8L 1SHWA 4NQUA 4WI9A 1MIMH 3BP4A 1I3RA 2CLRB 5C0IB 1V7MH 3D51A 3QXWA 5LNDA 4JL1A 2F1AA 3BD3A 4UU9A 4KMQA 5IROD 5EIIA 5DJXA 2C1PB 4Q9RH 1K6QH 1OAJA 1RUML 2K8QA 1JK8A 3ZX1A 4K5MA 1OD9A 3MV7B 4PPTA 5T3ZH 3HG1E 1X9LA 4PVLA 2CCVA 2ZXBA 3CC1A 4LCYB 3WAJA 2LFGA 4LCCA 4C56A 2OI9C 1F3DJ 5AW7B 3EYOB 4MJ6B 3CVHL 3V0AC 1OB1A 2OTUB 4KK8D 3GIZH 4L8SB 1QSVA 4DQOL 4Z23A 1I3GL 3MKGA 1R4XA 1BQ5A 1DSFH 3A0OA 1X44A 2JSFA 3AS0A 3KPSE 4HWBH 2Z31A 3QJXA 2DMCA 1BOYA 1NIEA 3ZKXB 3BI9X 1AGEB 4PTTB 1E65A 4XAKD 4ZZKA 2FAUA 4NOFA 1E50A 3MJ7A 1HE7A 1VGEL 1AD9B 4R7DB 4D94A 1P9MC 5JHAA 3ZTNH 1IFRA 4F7PB 1BXVA 3GXFA 4MJHA 3E9UA 3HHSB 4U4BA 4YAQA 1D9KD 3FT4A 2X9XA 4OGAD 1FH2A 3UCQA 1QRKA 3RWCB 5DD6A 4YSUA 4O02H 3DVNB 4WO4B 5KN5A 4GOSA 2HJFA 4TQ8A 1X4ZA 5E9DA 3HC2A 1E9OA 4RZCB 3VNYA 3JV6A 2F5BH 2OMVB 2AV7B 4PJ5A 4ZPVA 5AW8B 4PJGF 4C8XA 1DEEA 4Q56A 2H3KA 2GBUA 5HYQB 3ATAA 4NCDA 3B7SA 4P2RB 2JB5L 2N1KA 1FYTE 2YPVA 3FQRA 3RPIB 4JFOB 5D1XD 3GSXB 3FB5B 4K55A 3ERXA 1OCWH 3TIDB 4UNUA 3EXLA 1AGCB 1CD8A 2XRAL 3WXVH 1XSIA 2P8MA 3OXRA 3NPSB 1A7PH 5I1JL 1KIUA 3K6OA 3PABA 3P3RA 5MENA 2I60H 4ZMLA 1YAZA 4FYQA 4K71B 1LEKA 4PJ9A 4N2GA 1T89A 4Y1AE 2JELH 3HKFA 5IFAH 1L4IA 4OJCA 3LS5L 3FULA 1KTCA 1MHCA 4XPAL 4I1RA 1AJ7H 1JHTB 2X4RB 1AKJA 1BOGA 4K94C 4C4BA 4C59B 4HC1A 3IXAA 3K2IA 2QQKL 1G6RH 5F7KC 4GT7A 5BOJA 5C0CB 1IFHL 3DROA 3L7EB 2ZJSH 1MOEA 4TUOA 3GD1C 5C0BD 3SDCA 3QZMA 4YSQA 3TBVB 1P84K 2MSPA 1OALA 5JOPE 1BM3H 5HDWA 3TVMB 5CD5C 1TVHB 5D7IF 2CLZA 4FXLA 2VDMH 4G8GE 1L7TL 5J56B 3QRBA 5HHQB 3ARDD 5EIVA 2XA8H 4G6KH 2ZIDA 2QVTA 2NW3A 1U8KA 1HZHH 3DXAA 3EXJA 2E6QA 1BAFH 4LEEA 2X05A 3GZPA 1I9IH 5HDLA 3ZE2B 4JANA 3QT2A 4IS6A 1J0ZA 4PHZA 4G6FB 2O6PA 1FVCB 3BOVA 3QI9D 3ZQWA 4XCFH 2Y2YA 4NT6B 1NOFA 3OC5A 4L3CB 5KVGE 4B9IA 4TTDC 2FJGA 5EH1A 2BP0A 2H32B 3N9GL 1ED3A 1QFWI 2A9BA 4RDQF 1HNYA 4PLKC 4LASL 1KJVA 1OCRB 5AL0A 3WKML 4ELMB 2R9HD 5CCKH 4G5ZH 1OOAA 4KK6D 3S98A 1CFQA 1WD8A 2J6EL 1EDYA 3GSWB 5G4OA 3WUZA 2ENYA 5BQ7A 1J0IA 5IMOA 4U1IA 1A7NH 1J1XL 1OANA 1QLEB 1UEMA 1Z9NA 5CHNA 3D07A 4Q2ZA 5D2LE 3ZE0E 3OGOE 3QUHA 4YK4C 3ZRFC 4FNRA 3RWDB 4XPTL 2HRHA 1O7DC 4RIRB 1ORQA 3U46A 5KZCD 3RU8L 4BK4A 4RFOH 3WFBH 4JR9H 4UTCA 2BP8B 2NY3C 2EC9U 4XCCL 1Z0NA 5DEFB 4AJ0A 3B3IB 4W9JC 4G72B 4UDTA 4QAMB 3SE4A 3FCUB 1WZ1L 1MHEA 4MJJA 3LRSA 3ZU8A 1I85C 2JCWA 4L4TD 4U7KA 4RA3A 4RMUA 3U4EB 1E6JH 4Y5VB 4OFVA 4QWWD 1KG0B 3BIAX 3EJQA 5F7EL 3ELQA 3CUPB 3MLTB 2X4SB 4X7SL 1E5YA 1T1YA 2BIPA 3FSZA 4OIIH 3FRUB 5HYJA 5IUCA 3UDWC 1TG8A 2WAQA 3DX1A 4QRTA 1QG3A 2DTMH 3NFNA 1F90H 3CLEL 4M9PA 3EBGA 1IKOP 3TLRA 3BXNB 4RWHA 4EUPB 1A6UL 3QORA 1CPUA 1D5BB 1K2DB 4NKQB 3TO4C 1KYDA 3G6AB 5AW2B 4G1EB 3BUTA 4NUMA 4WTXA 1AXSA 5CJQL 3HW7A 5D7SH 4D3CL 3FT3B 4P48A 3SGKC 3IJYA 4MMZC 3DX7A 1E9PA 1OZUA 2GI0A 1IGMH 4XCEA 4L05A 3MNZB 3CC5B 3T6ZA 2GW5A 3TPKA 1QACA 3NCBB 3Q9PA 4G8FA 4J4PA 4N0FB 3WFDH 3KPRE 4CBPA 3DSFH 4UCFA 2XTJE 2HVKB 3QARA 4NQSA 5D4HA 1IRAY 2OL3A 1OM3H 4ZXBA 4I5BB 1P4UA 4PD4J 5EZLB 5ANMA 3ESVF 2G3XA 3Q05A 3O41A 4EOWL 4EIBA 4I9WE 5F1OB 2Q6WB 3QXAA 3D39A 3B3BA 5IB5A 4F5CA 4YHPA 5BUAA 3BSGA 1NCWH 4IDJL 2G9KA 3FZUD 3HC3L 4D8PA 1QHPA 1QMUA 5G4NA 5TE4L 5I73C 3DK0A 4E0RB 3VD9A 4TUKH 1R3HA 3GSNL 4XMWA 1G7MA 3X11A 5BRZE 3OKLB 3QO1A 4HZAA 3VD4A 4XWGL 5FGCE 1WPCA 3KLLA 4QRRE 4RGNC 2Y7SA 5FGBA 4P2OB 3ULVF 2NNRA 3WFHB 3HI6L 5KVDE 2VZSA 5I0ZA 1IFGA 4JPVH 3UTTB 2XN9D 3M7FB 4W70A 5EDXA 1OSEA 3LNDA 4ODWA 1XR9A 1I8MB 3UTZA 2O5NA 4HIJA 1ZT7B 5T5NF 3KNBB 3QJHA 2AXGA 3DIFA 3CZSA 1CTNA 4ABVA 2WINB 5AW3B 3WDIA 2GFBA 4TNVF 2F8IA 3WN6A 1TMCB 2E6JA 2WGXA 4OKDA 4N2BA 1MFVA 5SV3A 3UTSE 3ZMRA 1GS8A 4MQ7A 4P5MB 1R34A 3MODL 5FS5A 4D9LL 3QQXA 2H5UA 4IEFA 3RWJB 2PTTA 1MPAH 4LB8A 4QXWA 3DVIA 1GL4B 3GM0A 3ARBC 5J1SC 1RFDL 3A22A 5EOCH 4WW2B 5L88H 3E6FB 1IQDA 1WGOA 2AQSA 2PYFB 1MRFH 2ARWA 2BSDA 4KKQA 1KIQA 2R0LL 2R0ZL 1J05A 3N6YA 3UG3A 5DJ0B 2DQIH 1WS7A 1NAKH 2ZYHA 4J8RB 4PR5B 1QSEA 3L3OC 3VSUA 5ICXB 4G7YL 5IROA 1VADB 3W38A 4BK5C 2XIBA 4HUWA 3Q13A 4FFTA 1AH1A 1INDH 3OKMA 3PWLB 1IC5L 3G5XB 4AZUA 2MMXA 2HT2C 3II1A 4NWUH 3PL6B 4BFBD 3KXFA 1U3HB 3C8KB 4HF5L 4HJGA 4DN4H 1W8NA 4UTAA 2V5SA 4KKCD 3TIEB 1LK2B 4FG6C 1FG2B 1T2QH 3ECQA 5FO7B 4MCZA 2F74B 4HULB 2PMZA 1JRHI 5DWUH 2ADJB 1AP2A 4P2AA 5IBUG 2X3AA 1AQ8A 1P1VA 4MZIA 1LD9A 5I0XA 3NJLA 2QHRL 3B9AA 3APDA 4W93A 4HHAB 4Z5RA 2C9VA 3JTSA 1XCQA 1GGUA 5AVRB 1I7UB 1CFSB 3VXTB 4GW1A 4DK5A 1UM5L 5GHWL 3ZHFA 3P3SA 3WD5L 2VLLA 3OLIA 4JEGB 5FYKE 2GVYA 4N0CD 1INEL 5D7JA 3BW9A 3MZTA 2E74C 1Y1DA 2WTOA 2VSCA 1IEBB 1K9TA 4WNJA 4BGLA 5J6HA 2ZF8A 2EXYC 2LLGA 1UJ3B 3GPSA 1D9KA 1MWOA 3FO9A 1U3ZA 4KH2A 3T0EE 3H2WA 1SY6L 3NCJL 4D0CB 1KC5L 5TE6L 5D2LF 1OF2A 2G9HA 1JCVA 4B7IA 4ERSH 1DE4B 2YKKA 4TL5A 5DJ8B 5DT1H 4MAUH 3HMWH 4DFIA 5D1QC 1IBFA 2VITA 3GT6A 4R97B 4QTHB 4XBMA 4LLMB 3GO1H 3HRZB 1W72A 1NCUA 1BYOA 2HJKB 1EJOL 3GSNB 4WTZG 4XP6H 5D1XA 1C12A 1DL7L 4NQDB 5AW9B 3S6CA 7PCYA 3CK0L 1U4FA 1F3JA 5FOJA 2ZAIA 3NCCB 3O6FC 3VRIB 4GBXC 5LKNA 1P4IL 3T65A 3C60C 3STZB 3X14A 4E41A 3Q8CA 4C4KT 2X6MA 2ZAGA 1VFUA 4K3HA 1QPXA 5CLYA 4GKZB 4EIUA 1EJ8A 1KN2L 5EUKA 5KG9A 3U0WL 1I9RL 3FFCE 1UKTA 1P5UC 1RIVH 2KDYA 3G04A 2ZCKH 4DPAX 1EX0A 4DKFH 4JM2D 3DPBB 4NENB 1MJJB 4WFEE 4JFDA 1CLZL 2P48B 2NYKA 1BG9A 4TUJA 2EO1A 4KX8A 3F7PC 4M3HA 2UZXB 2LLNA 2HXAA 3BPOC 4IOFD 2X4UB 3QYCA 4MNQB 1AQMA 1L0PA 4Z7QE 5C0BA 1AGFB 4YHOH 1FL5B 2ZWLT 1NCHA 5DZJA 2DQCL 1A8JH 4OZHE 2TAAA 4OZFB 1NFDA 3ASWA 2OR9L 4HIIB 5SV4A 2N7SA 2B59A 1E2WA 1W15A 3GMOA 4K7PY 4ZMZA 2VRAA 2OZ4L 1QATA 3ARDA 3CZFB 4NZTL 3UEZA 3B2VH 4ZPTB 3QNYB 1VACB 1TQBB 1ZA6B 3I6SA 5HHOD 2BZDA 2ZTBA 5AFAA 5ICZA 5JW4R 1B4TA 3QIUC 2Y23A 3LS4L 3VFNA 4C4KO 2X2JA 4Y2DC 1XF2B 2A4EA 2MNJB 1YEGL 4ZFGH 3PWPB 1DFXA 1U8QA 4HQQH 3OR6A 4WWID 3QI9A 4L37A 3T09A 2VC2H 3QXDB 2KT6A 5JW4N 1CXIA 2VW7A 5C71A 1RAMA 4XNYL 1GPOL 4GJTB 4UBDD 4RSYA 4FLOA 3UAJA 4ZFZB 1PNDA 5EFIB 3PWJB 1XIWD 4KU1A 5CZXD 3ARYA 4HX1A 5DI8A 3IXTA 4W9LC 2NDFA 3L4YA 4WV1B 1DLHB 1MFEH 1OAQL 5C0JA 5IVZB 5TJWK 3X1FA 3QYMA 2QPEB 1KB9K 2C5DC 1ML0A 4ODVH 2QELA 2O6DA 1X5JA 3WSQL 4FTVD 1OD7A 4JY5H 5JDSA 1F4YH 4HS3A 4OGQC 4O4YH 5FA4B 2OTWB 3R0MA 2WZPA 4L3EE 4U05A 1BXUA 1KLFA 2C9SA 4LLUB 4GUPA 4XWOC 1F58L 1NUDA 2WBJB 1XSKA 1XHHA 1N26A 5GRUH 5JOFA 4DVBA 3PGFH 2GAZA 3F6LA 3D4ZA 3IM1A 1UA7A 4D9QE 4FG0A 3VO0A 3UACA 2IBZY 4OLYL 3QFJB 1THCA 4UOW1 1GYWA 2I26N 4XVSL 1MFBH 1YMMB 3F7YA 3MRDA 4HFWA 5IT2L 3MOQA 2GSGA 5GISL 4YUEH 2AEPH 1JHLH 1A8ZA 1T7WA 4L4TE 2CKBH 5J06A 2VLJE 5FB8A 1ZS8A 4TPRL 5B8CB 2NUTB 2K8MA 3VQLA 5E5LA 4HAFA 5DEGB 3WDJA 3EOAA 4MS8D 4WEMB 4AMWA 1EGJA 3CLFL 3X3FH 3VXSA 1R33A 1PFOA 2G75B 4LPTA 4TQEH 3ML9A 1IAII 5JO5A 3B1TA 1K5WA 3EJZC 3QR1A 1LMIA 3C5ZC 4XI5D 2UYLB 1KJ2L 1EEZB 4GMSL 1HNGA 2VLKA 3TBYB 4LHUD 4DP1X 1TZIB 4FCAA 4G8EA 2Q8AL 3L3HA 4YHZL 5B1AB 1WFMA 4UINH 1V3KA 4APQB 1TVDA 1SFDA 3EOBB 4GW5B 1G43A 4RGOL 5D7LB 4Z7OB 2XHNA 4OCXH 4KXCA 3WY4A 2DD8H 3DX8B 2WLYA 2BNRD 4AENA 1N4XL 3DGDA 4YDNA 1S7QB 4JGJA 1ZTMA 5L2KD 1IM9D 1HWWA 2NQ3A 2GK0B 4IMLB 1UXSA 4M4PA 2A38A 2MTAA 3P4LA 5L8KB 3HZYA 1QWHA 4JO1L 1M7IB 1E9QA 4ZD3L 2W80C 2PTUA 1WICA 4H5SA 5EF2A 3FMGL 1RZPA 4PB9H 2HFTA 4YDKL 4F9PA 1NCAL 2CCWA 4JRXD 1M1XB 3VTTA 3A4DA 1IBDA 4GKSA 2PWGA 3QUKA 2V2WB 4PRIE 3UBHA 4BZ2H 2ZZUT 4XMLH 3LKQB 2B0SH 2Q3AA 3AQZA 5DJZA 3LH2L 2QQNL 3DK2A 3LMJH 4PJBB 1YEWA 1F2QA 4GAGH 3WBDA 4P23D 2XN9A 3KDPB 3RG1C 4YHIB 1IC4H 1JWMB 1W0YT 3V0WL 5ID1A 1SYVA 2XXFA 3H3PL 4YE4L 1DN0B 5MEPA 3W0WD 1K4CB 5JIKA 2BCKB 1BFOA 2YZ1A 3CN0A 3U7YL 5E2JA 4U3XA 2DIEA 1S6NA 3EJJX 1O6VA 3P69A 1WBZA 2H0FA 3L1OL 3MBEC 3TBWA 4BUHA 5KJRL 5B1BB 5DTFA 5T3XD 3II3A 4TTGA 4WGWB 1DUYA 3WJMA 2BZCA 3GJFB 4Z7QF 3EOTL 2YPLD 2IPKB 3DJTA 2D7TH 3O3DA 3QDJE 5HVHC 1XH2A 1NC2B 1WT5C 2FDBP 2GY5A 2XYCA 2HWZL 5C7ZA 4JDVB 2C4FU 3N2JA 4HD9A 4Q8BA 1RZKL 1DQML 2WUBH 1RZFH 1XD1A 3MRKA 2YD3A 1GMIA 4PJXB 4BQCA 5F9DC 1UZ8A 1AHWB 4IYKA 5DMKA 2BWIA 3B7TA 4M8RA 3RGVA 5FF6A 3IE4A 4XNQA 1ZE3H 1IKNC 3UYRL 1OP5K 1CIUA 1G9ML 1YNKH 5BVJA 2J5LB 3J07A 3EJYD 2NW2B 3S5ZA 4ZW7A 3CCHB 1IE5A 4OUUB 4I2XB 1AFVL 1KJ2B 4XVJH 1A6WL 5I6XB 3VWKD 2OMTB 3WNMA 4JFXA 3CPLA 4PV8A 3MRHA 5D72H 1KULA 4GP4B 4ZMWA 4PJFA 4MJIE 1FYHB 3WNLA 5C8JB 1NUGA 4X0KB 5IW1A 2FZ3B 3BH8A 5TFSH 3MJ9L 1QBBA 4PJHA 5BUGA 1DQJA 1JFQL 3MXWH 4X6CE 2BIOA 5E4EB 3BN9D 4I77L 5MEOA 4PSPA 5LGJB 3FOLA 5TPWL 3W9EA 4O00A 1GJUA 1ZGLM 4HUMB 3HFFA 4DGYH 5EUOF 4MA3B 2CLVB 4DN3H 5ISZE 5C07B 2SEBB 3QA3A 5DC0A 5DQJB 1IC7L 4WJG3 2QSVA 4WTWA 1JN6A 1BEYL 1H9VA 2O93L 1DVFD 3QEQB 4PYHA 3CFIC 2VUKA 4NQED 3UTPD 4QCIA 3CMOL 1A14H 2NY4D 1JNHB 5FEBA 4XP5L 4MHHG 1JWUB 3OQRA 4P5TA 3IGAA 7FABH 4N2NA 4GIAA 3OX8B 2EDEA 1JP5A 1J1PL 4GAFB 3PJSA 4OAWB 3JT0A 4N5UA 2VKWA 3KS0J 4PVMA 2GBTA 3WY1A 3NEOA 3DOHA 3F65A 4JFEE 2XU9A 5I16A 3HLKA 4QTIH 4BDVB 3OZKA 2OMYA 1KLGB 1BJ1J 5D2NB 1SOXA 3VDBA 3KAAA 3QUYB 2V7HA 2V9RA 4F91B 2Y7QB 2N7AA 1XSJA 5FA3B 4HOWA 1S9XB 4HYTB 1EO8H 3DI3B 4Y4KD 5BNXD 3QUXA 4NKOB 4HWEH 3NAAH 2NXZC 1UOWA 3CZKA 1PW3A 2QLVB 4PP1C 3ZR5A 2VO5A 1OAKL 2FBOJ 3SKJH 1U8NA 4CRPA 1L0XA 1EAOA 1NDGA 4KY2A 3A5VA 3MLYL 5AW6B 2WZAA 4F8NA 4M7JH 4WJ5B 3LJ3A 3MLZL 4NDMB 2ZUWA 3MNMA 2V33A 1UA3A 2YUWA 4M1DH 3D18B 2W9DH 2ZYRA 4PBVC 4Y9CA 1O5DT 3D85A 5HHOA 3QQ4B 3WEOA 2AQNA 1BM7A 2AQQA 2FBRA 2ATKA 5TF1H 3V5KB 3S5LA 5E94B 4NJ9L 3WL9A 5JIPA 1RK7A 4MRBA 5BXFB 1OZTG 4ZK8A 4UTBA 3TYGL 3FB6A 3ZGHA 5L4FA 5L4MA 3WKQA 2XIIA 3GHEL 3QFGA 5DK0A 4PI0A 1LE5B 2YD2A 3MACH 3F58L 1YYMH 3X1EA 3U4BL 1WCBB 2OQJA 2RACA 3MGOB 2B08A 3IKKA 3QO0A 4GG6E 3ENEA 4W1TA 2VDNL 5SWSD 1U41A 5DUMH 1YYCA 3M88A 3N43B 3BAXA 4FXKA 3S8WA 1GZHA 5EC1B 5GRXG 2IVFC 3K2UL 4I18B 5ESVA 4BFJA 5ERWB 4OZGB 3G08B 1NCGA 2YD0A 1G7JB 4HZLB 2YA1A 4HK3N 5SWZD 4EJ1C 4YHNB 1XBRA 4XNBA 2VIRA 2AI0H 3O3AB 4GI6A 5AYUH 5BZXA 3N40F 5LBVA 5I76A 4UT9H 1AS7A 4MB1A 3SY6A 1ACCA 1EFXD 1TETL 3NP3A 4JQIH 5FUOH 2D73A 4HIXL 3SBWC 5GRZA 3HI1B 2NY7H 1ACYH 2DV6A 5B7FA 3BKCL 1V8HA 1RULH 3CQFA 2YBRB 4Y16D 1USQA 2EE0A 4FZEL 5GGRY 2RA1A 3H42H 5C6WH 1OAYH 5F1NB 1RHHB 1WGVA 3AT8A 2W88A 1BMZA 4YC2C 1JVOA 5EU4A 3IFOA 3MBWB 1GGBH 1I8AA 1ASOA 4B97A 2DYPB 3GI8L 1L6PA 2BW4A 2ZQKA 1KFAL 1ZE3C 4IRSC 3HCVB 4WDIB 3APCA 4ZUVB 3GK8H 4JFSA 3VB8A 2BY2A 1BQLL 3LH9A 5FC9A 1DUZA 2E86A 1A7QL 1MG3C 2IC2A 3ARFC 4KMTL 5HDQH 2A0LC 4M1GL 3ZIYA 4F15C 3QAZC 4UUJA 5HBBA 3OV6A 2W60A 2VE6B 1JAEA 2R83A 2MPAL 2K4AA 2E9WA 4IW4C 4HISA 2MTPA 2X4NB 1I7RB 3TM6A 3UXFA 3EBHA 2MIZA 1K8DB 2HLAB 4M6NL 3AM8A 4LVEA 5IEHA 1NMBH 1KIRA 2Z0UA 2ZSWB 4PJAE 1AD0B 1JPGB 2DQTH 1NIBA 1VCAA 3L4VA 2GJ6D 1OTUD 5I8EB 2P24B 5E56A 1UXWB 1H3UA 3BIBX 4JFFD 2A74A 4EKXA 3NJGA 2FQDA 4G3YH 1BZOA 3QQ3B 2DJMA 5LAPA 4KRMB 1RJZA 2PO6C 1GR7A 2YPVL 2D3VA 3MHZA 3SDAB 3BIKB 2GHZA 1T0PB 1AO7E 1IGYB 3DI2B 4YBLC 3REVA 3AUVA 5CD5D 1P53A 3N04A 1J9CT 1IM9A 1FLRH 2XV6B 4OCSL 1Y18A 3EUUA 32C2A 1IGIH 1DQIA 5JIHA 2BS8A 5EN2B 4GW4B 4PG9B 1FH5H 1QFOA 5K93A 2CO6A 2ZX6A 4HWUA 4ZTOL 1CJYA 1P4LA 2DWEA 3UTQA 3ZPDA 4D0BB 3APMA 5PCYA 4XOEA 1JUFB 1CTMA 4FQXC 5IB1A 4A66A 4J3OG 1TZGH 1MHHA 1WFOA 1FVDA 4U6HA 2G5BA 1TKWA 1F1AA 4FTDA 4HEPA 2VDNB 5CEYA 1KN4H 2BIHA 4HC1L 2VDPB 4AUJA 4JRXE 1YQVH 3VFPA 3MYJA 3D9AH 2F7IA 4MX7A 4JZOA 4MDJA 1V3MA 4NQCB 5IHLB 2FWLB 5ITFB 3LNFA 5LDSA 2ISDA 1MREL 4XN4A 4KNUA 3NPZB 4LPUA 3D48R 5B1CA 5CLWA 1NLDH 1YYLL 4RAVB 1IMHC 5I19L 4LL4A 1B6DA 3BP4B 1I3RB 3LZLA 3HB3B 1IILE 3L4WA 4GQRA 4NRZA 3RNKA 4IKLA 5HXMA 2LTQB 4UU9B 2HSIA 3HS9A 5EIIB 5DJXB 3UYOD 5EF1A 4JM2F 3AG1B 4PIRF 3DPDA 1JK8B 2EECA 2BSBA 4R4FL 2X6BA 2DDQH 5IUSA 2IAMC 5FK9A 1KOAA 1IGTA 4LCCB 4C56B 4EUPG 1QABA 4FN0A 4QHKJ 1IQWH 5BMFL 4L5FH 3W2DL 3T77A 1KXTA 2COVD 2UZIL 3TCLA 3K80A 1OB1B 2NY3D 2YPLE 4I8DA 3U9PH 1FIEA 3HS0A 1X6LA 2HH0H 3PDOA 3P11H 2DW5A 3MUHL 2WWMC 4I3RH 2Z31B 1TJIH 2PWHA 4FCHA 4UB0H 3SYQA 4A63A 4A7GF 1F4XL 4PJ6A 3T0WA 2VXQH 4M8UA 4GUQA 1PLAA 4Z7AA 3AROA 4TYUA 2VZVA 2VUOA 4PMFA 3MJ7B 4TULL 3GINA 2VAAA 4KK5C 5C0DA 5E6UB 2DLTA 3BO8A 1VIWA 2YA2A 4QIRA 2QPDB 4RFNC 2ICCA 4YAQB 3U1QA 3F01A 2VN6A 3FT4B 3F6JA 1X5IA 5T1DL 2IOMA 5CEZL 4WY7H 5DD6B 4XPGL 4ZUWA 1H3PL 2VW6A 4JG0H 3ARGA 2Q8BH 3AGWA 2E9JA 2HJFB 4N2KA 5E9DB 3VD5A 3VTAA 1E9OB 5KN5B 4OIAA 2VXSH 4TQHA 4DQOH 4RVBA 4HMCA 4X5XA 4PJ5B 4ZPVB 5E1AA 3WTXA 4W9CC 1NBVL 2VERA 1DEEB 3FQUA 3KBPA 3QULA 3QPXL 5CN2A 4GB9A 3V4PA 5ESQA 4Z3JA 4L8CA 1KGYE 3FQRB 2XJLA 1AVAA 3K4ZA 3UGUA 5KS9F 4OI7A 4NQQA 4NZ8A 1YHPA 4YOKA 4CDGC 3NIGB 5DJAA 2WLKA 2P8MB 3OXRB 4QXVA 1VGEH 3JZ7A 4TV3A 2CPCA 1KIUB 3PABB 5MENB 2EDNA 4X7CC 1LEKB 2NSXA 4PJ9B 5AZEH 1QLEH 4NWTH 3CXDL 4FNSA 4BV1A 5CAYB 3K81A 3OG4B 1MCDA 1MHCB 4J3OH 1QZ1A 4ZUSA 4OV5A 4MFHA 3VXME 1AKJB 1BOGB 4JE4B 3LRKA 2DQEH 3IXAB 1SDAB 4TSAH 5AL8A 4GFTB 2NMSA 1B0GA 1NGQL 4KKZA 3LQAL 3PFQA 4RGND 3DROB 3L5HA 4LBEA 5GSVA 3UIYA 4TUOB 2EABA 2VR6A 1ZLVK 2XRAH 3SDCB 1MRDH 3P4NA 3ZTDC 3POHA 1XBDA 4YH6A 1FAIL 1HKLH 2BFVL 1MXGA 1H15B 3GKWL 3PAUA 4OM0L 4L8SC 1K3ZA 3WIHA 2CLZB 3JV0A 3HMXL 4X4XA 3FQWA 1CFTA 1MI5A 2BLFA 4E36A 2J7LA 1A3RH 1ZPUA 4Y4KA 3FRPG 3LS5H 5BCAA 1RERA 4NM4H 2NW3B 4M7KH 1U8KB 3B56A 3DXAB 4PJAF 4OLWH 4MLSA 4NC1E 3ZKXC 1H19A 2WP3O 2WXMA 5EZOL 5H4ZA 1UZ6F 2VL5A 1HTYA 2Y9RT 3FN3A 4P46D 1XH0A 4AEEA 4JANB 5KYUA 1PLGH 4PS4H 4EUPH 4IS6B 4L4JA 1VAHA 3P02A 2LFEA 1GY1A 1T3FA 3ARBD 3G6JF 5AAMC 2QSTA 1AMYA 4EDWL 3QQDA 1P84J 1B88A 3ALWA 1CGSH 3NTCH 2C4FT 2FJGB 4GKOA 5AG9A 1OLZA 2N0KA 4LXFA 2BP0B 4WIQA 4DPBX 1ED3B 4GRWE 4WO4C 1KV3A 5PAZA 4PLNC 1KJVB 2X87A 5F89B 4NAMA 2XETA 4ANWA 3MA9L 3OF6A 1WTGT 2HT2D 1CFQB 3RUGE 4G7QB 4DHLA 3IFLH 4WW1A 4F93B 2VSDA 3DETC 2HFEA 5BQ7B 3MLXL 2OSXA 5IMOB 1Q9OA 1R5WA 2JKXA 4U1IB 2RMNA 3OAUL 3QJTB 4FG6D 3WE6A 4Z8FL 4W4OA 2P52A 5CHNB 5FM5M 2P5WA 3EFFA 3ZYIA 4Q2ZB 4JZNA 5D55A 3KYKL 4N5EC 4RWYH 1AAJA 5CF3A 3PXHA 4K71C 1QNZL 1ORQB 3U46B 3MCYA 4RISH 5CJXC 6TAAA 4TSCL 1QA9A 2F8OA 4GQ9H 2DLHA 1NGWA 1TEFA 3Q6GH 3MNVA 5ABAA 4NN7B 2OJEA 3FQ2A 4LASH 5HHME 3QEUA 2YN3A 3MFFA 4H0HB 4QMEA 4UDTB 2ZWZA 1HQ4A 4NJAH 1MHEB 3LRSB 3QHFL 4HT1L 2EXYD 4KKBC 4ZW3A 5SWZE 3HUJE 3MRCA 4RRPM 2BW5A 3UABA 4PB0L 1NFIA 4XZ4A 5AWNL 2WY3B 4Y16A 4K07A 5GGVL 1QSFD 3BVDB 3VQ1C 5C08E 1JOIA 1MCKA 1T1YB 3K7UA 4AM0A 2O6FA 2ZKMX 5BQDA 2Q9OA 5CGYC 2A6IA 5HYJB 3O4LD 4QRTB 5D1QD 3NFNB 4UTAL 3TO2A 5BO0D 1CZ8H 4N8CL 1AE6L 5A7EA 4ZSOE 3ECUA 3MOBL 4FRWA 35C8H 3QORB 3A23A 1ZLDA 4OLUH 3VVVA 3BAJA 4KTEH 1YPZE 1AXSB 4X7DC 4RESB 4E9RA 2P44B 1WZ1H 1XTMA 1DSWA 1XAUA 3L81A 4NBZB 1CDCA 3C60D 3KPTA 3IJYB 1IZJA 3DX7B 1E9PB 4XCEB 3C2AL 5DLMH 2EIEA 1OWRM 4KQ4L 3S4SA 5C0AD 1KTDA 4G8FB 4XMKL 5DUJA 4NQSB 2OL3B 4ZXBB 1B9ZA 4HIHA 4BHUI 5ANMB 3VA2C 3QZOA 2EEXA 4CMHB 1BPLB 2BIMA 3O41B 3VUAA 1JDCA 2NY0B 4WFHD 3MRQA 2GJRA 4KNTA 1NL0L 3TCXA 4O5LL 3KW8A 4FFZL 4XMUA 2ZWKA 3QXAB 3D39B 4ICWA 4JFFA 4PRHD 5IB5B 3DVFA 4YHPB 1QTPA 1QZNA 1TLKA 1KELH 4DESA 4N2LA 3R7QA 4D8PB 2EKSA 4E9VA 1INQA 1FCCA 1P6WA 3BMWA 1ZSDA 4HSAC 1W72L 3N3EA 5DJDA 5E2TH 1R3HB 3UJJH 3X11B 1G7MB 3HG1A 3U7AA 3QO1B 3MZGB 4V11A 4E68A 3HFML 3IMSA 3IJSA 1JZGA 5LBSH 3T04D 2EVIA 2FYYA 3IPEA 2X09A 4J3OC 4I4WA 5FOBA 2NTSP 2CGRL 2DMBA 1B6UA 4R2GD 3ZUCA 2VCOA 2PCFA 4M48H 5AZUA 4V1DD 1ZV5A 3HBZA 1UKQA 2VN5A 1S3KH 3IE9A 3QIUD 4ODWB 1XR9B 3VTMA 3UTZB 5ALCH 3AB0B 1ZVYA 4HIJB 1Q38A 2J8UF 3QJHB 1XB3A 2AXGB 2ZX7A 3B9DA 3DIFB 3DHJA 1GKEA 1X7TA 3O81A 2GFBB 4YBHA 25C8L 2NY2B 1ERNA 4Y5VC 4FI7A 4MQ7B 5K9JL 1MW0A 1Q0XH 2JWYA 3GSNH 4IEFB 2PTTB 1X4YA 4S1RH 2BHFA 3GJFK 1CICD 4IBWA 4RMWA 5ADPL 3BCFA 1YZZA 4JDZA 1IQDB 1IV8A 1NGXA 1KIQB 1HQRA 4I7ZC 3VSQA 1X5GA 2P5EA 5I0DA 4Q0XH 1J05B 5EOQH 5DFVD 2DH2A 3P0GB 5KW9L 1QSEB 3RWEA 1C7TA 3NIDB 4HUWB 2X6UA 4K23L 3OKMB 4JM0A 2ICWJ 4LE8A 1FYTA 3TNNA 2Z9TA 4XC1L 1R47A 3KXFB 1GYAA 4C57C 1IIIA 4HJGB 1FORH 3KL5A 2IXQA 3CHPA 3TBBA 3L5JA 2EXSA 2AFNA 4JQVC 5BVPH 5I6KA 2UV3A 4LOUC 1GYUA 3T6XA 3B5HA 1O7DE 1OCOB 2C9QA 4MCZB 6CGTA 1UOLA 1FN4A 1AP2B 5LWYL 4R26L 4JPWL 1LD9B 1CE6A 2R0LH 4AGMA 4F58H 4GRWF 4LVOB 4YLBA 4OZFH 5T3ZE 2AJUH 3DO7A 2C9AA 2CJUL 4Z5RB 1XCQB 1NJ9A 3NFSL 5DD0L 4GW1B 3SGDH 4XOAA 1SXZA 2VLLB 4O58H 4DEUA 4W6YB 3QDGE 5D7JB 1UEYA 3BW9B 1IU1A 5IB4A 3RUGF 3VGAB 5H37G 5J6HB 1U92A 2AXJA 1UD5A 5DRZA 1N7MH 2VRQA 1B2WL 1W0VA 3QPQC 5D70L 4HF5H 1D9KB 4KQ3L 2QSCL 3FO9B 2X2YA 4P2OC 3CVBA 4K3DL 3QYNA 4UT6A 3QWOA 4NZRL 4KITB 1K8IA 1YEJL 1IBBA 1OF2B 3EJZD 2G9HB 2FATH 3LHAA 4WCYL 4L1TA 3UYPA 4IOSA 2VMEA 5DSCA 4KY1L 4G8GA 2VITB 3ZXAC 3QWRA 4ONHA 3ZL1A 1GGCH 1ECYA 1CR9H 4POUB 1AHMA 5D1XB 5LCVL 3FCSA 1I31A 2E9IA 1C12B 3VU2A 1UM5H 5EO0A 3VFUA 4G7VL 1F3JB 2DLEA 2VDKL 4L8BA 4XNXL 2F58L 1W2KT 2H0JA 3T65B 3ULUL 3X14B 4E41B 4MJ5A 3QC6X 3HUJF 5DURD 2X9WA 2I5YL 2EDHA 4XP1L 2R4RH 2XUWA 2IDQA 4LLQA 3CFJA 1Z3GL 3H54A 4WW2C 5EUKB 5KG9B 3BVNA 4FEIA 3DTXA 3FS9A 3G04B 5TE6H 2C26A 4Z7IA 1ZEAL 1OTTC 2IH1A 3EJRA 3EGXA 4KI5C 1BAWA 1KY7A 3MV01 2QGCA 3QZLA 4Z7WE 1BLNA 4DCQA 3T3PE 3MREA 4WSJA 3O6KH 2V5TA 5KVEH 3P3TA 1YPZF 1V55B 3CK0H 3PL6C 5CP3H 4D9RD 1U3HC 5C0BB 3LKSA 5INCA 2ZKXA 2VT0A 1KEGL 4ZTPH 5GS0L 1MQ8A 1ZJBA 4KJQC 4DAGH 1TJMA 2CZNA 3O6MH 3RDTC 1NFDB 3A4EA 2B59B 2NZIA 1I1RA 1OIOA 2JQAA 3GMOB 3I85A 4NZUL 5AALA 5L0QB 4XP4L 1DJSA 3IJHA 3ARDB 3EO1A 3U0WH 1I9RH 2FX7H 1JHKL 2CHZA 1DVTA 4XXWC 5ICZB 2XWTA 1FNLA 2AF2A 5KTEH 5T33L 1XL4A 1OE1A 2DQFA 3MBED 3Q8EA 4DP8X 3VFNB 4P46A 3VFRA 4LSTL 2DLGA 2AVGA 2CALA 1U8QB 4XE0A 2DBLH 3OR6B 2AK4A 3PQYD 2V9QA 3QI9B 2CM6A 4L37B 3SGJC 1GMEA 4GXVL 2DIAA 1FNAA 2BY1A 3RWHA 1UJ3C 3IJ8A 2HT4C 1GJIA 1CU4L 4RAHA 4M5YL 1T7VA 3EH4B 4XN9A 4ZAKD 2P4AB 2DQCH 2IMNA 2D7PA 4IRZA 1AS8A 3GLEA 3QCVL 4G43A 3LNEA 1MFDH 3WAKA 4HX1B 3CBRA 5DI8B 3IXTB 1SVCP 5SX5K 4F37K 1AZVA 3ZBMA 3U1SL 3RKPA 4ABQA 5C0JB 4N8PA 1K85A 2DL2A 1KGUA 4JN1H 4R97C 5I18H 2EVHA 3UZEC 5H37H 3SE8L 1UM6L 3LS4H 4GH7B 5JDSB 3H8NA 3G9VA 1L9MA 4HS3B 1PZ5A 1RD6A 1NUFA 2VR4A 3CZLA 2UXTA 1KLFB 3OJDA 4GUPB 4N1EA 2AK1L 2OYPA 1RHFA 4UWQB 4G70B 5CNHA 2CDEA 4P5RA 4JREB 4OUOA 3FPXA 1LL1A 2GITA 4M5TA 1A9VA 1B4JL 1NIAA 1VERA 4DVBB 5JOFB 2GAZB 4XNUL 2LU5A 1Q94A 5I23A 3VM7A 3NRFA 3H6AA 3OKOA 1KB9J 4AQEA 4XMTA 2F53D 1H0DA 2ATPA 2WSDA 4LQFH 4CMMA 5G5DA 2P80A 2ADYA 3F7YB 3GSOA 1AZCA 3LZFL 3MRDB 4HFWB 1KGIA 2GSGB 1OPOA 4KO5A 5IBTH 2Y5QA 4R8WH 1QX1A 5D6DC 1B3JA 1UYWH 5FB8B 1ZS8B 4NKMA 4LLWA 1WHPA 3O4LA 1X5XA 2W38A 4GRLA 1QSFE 4MHHI 4QXUL 4F1SA 1TJHL 3EOAB 5KYYA 5ICYA 3K6SA 3E80A 4GKLA 4LVHB 4Z3FA 3VXSB 3FQ1A 1WWBX 1P7QD 4X5PA 5FCUH 3ZTCC 3IGUA 5JO5B 4Q9BA 2OMNA 1CGXA 1TQBC 3GJFH 5D1QE 1QRNE 9CGTA 1D6VL 1IEHA 4JG1H 1QBLL 2JJSC 1EQWA 4EVNA 4W9ZA 2VLKB 5HHVH 1VPOH 1H3VA 4G8EB 4XX1G 3L3HB 3KG5A 4FDWA 2WOYA 4YE0A 3SKOA 4AMKH 4NS0A 3UTSA 4MRCA 3S0PA 3EGDA 4N6RA 4ZX4A 4X9IA 1SNRA 5F9WC 4WKXA 3NH7H 2SODB 3TJHD 1C08A 1CB4A 4AENB 1E5BA 1SXCA 3FT0A 4HKJA 1J12A 3CLFH 4KPHL 4NXKA 1TYEB 4WV1C 4WUUE 3E1F1 1UXSB 1XGQA 2MQ0A 5BV7L 5FO8A 1U3JA 2Q0ZX 5JQ6L 4KOCA 4PRHA 1E9QB 1T7XA 2NXZD 3P73A 3BESR 4LP8A 4PP1D 2ZUUA 4URKA 1KYAA 4ISVA 4H5SB 1WZLA 1BZ8A 4NXSA 4KRLB 1L7IL 3D0VA 3V4VA 2XG5A 4QRAA 2KZKA 3L5XL 3NZ8A 1XX9C 2Y4SA 4GKSB 4QJ4B 1WLHA 3QUKB 1CMOA 4A38A 1CL7L 3HOGA 2OPCA 4Y4HD 5DJZB 2WBJC 5BS0D 2WLZA 4H0IA 4ZUTA 2XN9B 1WFUA 2C3GA 4M03A 1A65A 1SF3A 1VFAA 2MRYA 5ID1B 1QW8A 1SYVB 2OR8A 4LSSH 1GTFA 3T0DA 1SJHA 4RNRA 5MEPB 1SJXA 4FFVD 1W9XA 4OCRH 5AVSB 1BFOB 2H1PL 4HPYL 2YEVB 4W9IC 3EZJB 4Z7WF 2BXYA 1OGAA 1A4CA 4HFUH 1WBZB 4S1DC 2BRRH 1R3IH 3TBWB 5EORH 4N2EA 1TFPA 3VI3E 4ZFQA 1SMAA 1SVBA 1Z9PA 1BVOA 2H47C 4ODBD 5DTFB 5C6TL 2HKFH 4XPHH 1DUYB 3GUFA 3WJMB 5B8CC 4TL4A 1Q90A 2YAQA 4KKLC 3PAYA 3O3DB 3C8HA 4UI2A 4P2QD 3T0EA 3J2PA 3B2DC 4DVRL 5J6GA 3CXFA 1MCNA 5DMJB 2CMRL 2Z0BA 4D8OA 1NSNL 1TO5A 2V8LA 4F9LA 2GK2A 3MRKB 1MFMA 1LO2L 1LXMA 3VRLE 1UZ8B 3MYZA 5DMKB 1OWWA 4YHKL 5FF6B 3RGVB 4XNQB 3FO2A 5C0GA 4JRFA 4APQC 3LPWA 1N2RA 2NY5H 5KJRH 4HCRH 5BVJB 2EE6A 4KKAC 4QHUA 3I9IA 4PBDA 1XZ0A 2RIKA 1D7CA 4JRYD 4UQ2A 4Z3EA 1JGEA 4N2IA 5J6SA 3QRFM 3FFCA 1LO0L 3KWWA 4IRSD 3CPLB 4JFXB 4PV8B 2I85A 1IAMA 1AMXA 3MRHB 4XP9L 5D71L 1QFUL 3LN9A 1RZKH 3LRLA 4PJFB 3C87A 2Z4TA 3TTYA 1X5HA 5IW1B 1TQCB 1NCCH 2XDHA 1LTXA 3N40P 3TEUA 4JLRA 2DPKA 3FH8A 2N59A 3BUBA 4PJHB 5GJSL 1DQJB 3VX0A 1KACB 2HT3C 2WLLA 5MEOB 2IAND 3FOLB 3OKDA 4JKMA 5DHDA 1OT1A 4OZHA 1EDHA 3W9EB 1F86A 4KV5E 4WFGD 3TH3T 3GI9L 1X7QA 2EZ0C 4LL1A 1AQKH 1NMAH 2UZYA 3P30H 3H2PA 3RI5K 4MCNA 5E51A 3L5IA 4L4VE 2CPUA 2UX7A 1XDTT 1DBKL 3QA3B 5FYLL 2AKRA 4WEEA 1DDTA 1QWUA 4H20H 4F57H 4KVCL 3GUTA 5H2BA 1JN6B 2NX5D 3MQIA 1A5FH 2RQ8A 2DJSA 5SX5H 4RRPG 3FPYA 3PPSA 4M6ML 1NC4D 4FX5A 4QCIB 4XN2A 1UQSA 2PO6D 3LVTA 1IGJA 1ROCA 1P4BH 3D3VD 4KJPC 3IGAB 4P5TB 4JO4H 1GW6A 1YEIL 4HALA 3U82B 3MJ9H 1QI4A 3PJSB 3ZLQC 4UMSA 3E6HA 3TA4D 3L9EA 2HLFC 3X3GL 3UGXA 1KLUA 4NO3A 3UP6A 5FUZL 2CJSA 1S7XA 2HFGL 3AACA 3KLHC 2ODHA 1RVFH 5I16B 3F83A 2OMYB 2MJWA 4JM4H 1XFPA 5EIIG 2V7HB 3FF8A 1YY8A 1IIKA 3SDXE 2B5IB 1SHMA 3GHBH 4FQXD 3FUMA 3N41B 3ZKQD 2WPGA 3AWFA 4EIGB 3QUXB 1NCBL 1Z2KA 5B22A 3VXOA 3U83A 2MQGA 3W1ZA 1HOCA 1TUPA 1BEXA 1U8NB 3ABLB 4L3EA 2DLFL 4NCC1 3ZY7A 1NDGB 3ZHLA 2J5LC 4D9RE 3NIFE 1NAMA 5CXPA 3MXVL 4WGVB 2WUCL 5I6XC 3TBTA 5HHOB 5INDA 5IFJA 4JB9L 3GRBA 2ATKB 2FD6L 1MH5A 4L1LA 3FUEA 1U8IA 3QR2A 3S5LB 3UO1L 3M07A 3WL9B 2ZWNA 3KE0A 4BFGA 5E2VH 1V10A 2WYZA 3FB6B 2GC7C 1FNSH 1KXHA 4NQVA 1KTJA 3DV4A 3OWEA 4BFRA 4MZ2A 5D7HA 2AQ2A 5DK0B 1DBBL 2J1YA 2A73A 3B9KD 2H3XC 4OD1H 5E4EC 3AXLA 3ZHNA 2JKIS 5A16A 1EO5A 5CJOH 1PX3A 3QO0B 1S9WA 4GAJL 4J3VA 5G2NA 5GZND 4J3XA 2QV4A 1J1OH 2OJZL 3MLZH 4PY7A 2WWMD 1SEBA 2ZOTA 3KWUA 2D8KA 5AQ0A 4FXKB 2FIRT 4MAYA 2BSCA 4CADA 3AMLA 2Z7UA 5ESVB 3SJVD 5LG1A 1QYGL 5C9JA 15C8L 1XTLA 2EIDA 2EO7A 4FABL 4AEIL 4LSDA 1BZEA 4N3TA 4NJ9H 2AGJH 1WAPA 4FS0A 2Q87A 3SE6A 2BP3A 3EBAA 2VIRB 5H94A 3MFGB 2W91A 3DMMA 3KDMA 2ZPKH 5HI3C 2R2HA 3ARQA 1OP3K 4B9GA 2XPGA 4G9DA 5I76B 1Q4NX 3GHEH 4IGBD 2WV3A 2APVA 2XKNA 2XG4A 3WNKA 4GUCA 1YECH 4NN6B 3VI3F 4NHUB 3U4BH 3AMKA 3CFDA 3F2LA 4XB7A 4DP9X 1UURA 1PZ2A 3FTSA 1FSKB 4YDIH 4ZO7A 3E8VA 5EU4B 3IFOB 5D2NC 2VDPH 2F53A 4A1RA 3TESA 2JKRM 3QUYC 2FBJL 4JFHD 2YMTA 4E9LA 3TYFA 4FYTA 1HHKA 4G5AA 2NY5C 1ZLUK 4M1CD 2YD9A 5J7CC 2FTAA 4XH2A 1WIUA 2IFFH 3BSZL 1NCNA 1DUZB 1A25A 1KJ3L 3R7RA 4Z7VF 3CDFA 2E4TA 1R75A 4GRMA 4KROB 4UUJB 4WGKA 3S2CA 4ORZC 3VNZA 4JRWA 4PRIA 2W60B 6PCYA 2I24N 2Q7YA 1ZXKA 1OTSD 4ANUA 1AXTH 5I15H 1RZKC 1P7QA 5CBEA 1EA9C 4BYHA 1M7UA 3MUJA 5J9PA 2WTPA 3HNVH 4GI9A 5HHXH 5IEHB 5JTWA 1KIRB 4DFHA 4M7ZB 5I1HH 1SLWA 3SDYL 4EN3C 5E2WH 3IMVA 2VYRE 1NQBA 4FA6A 3S48A 2HP4A 2OMUA 2XICA 3L7FA 2MPVA 3CAFA 3ZDZE 3AG2B 1SM3L 4PIBA 4KZDL 2A74B 1ADQA 3FUKA 5AVYB 1RJZB 3U4KA 4NQTA 1V05A 3BD5A 3AGVA 5AOMA 2YRPA 3EDJA 4TLTA 4Z7NB 4YDMA 4M6OL 3REVB 1JTOA 1U6AL 1IGCL 1T66C 2W81C 3QDJA 1IM9B 1Y18B 1B3IA 1CBVH 32C2B 3S35L 1Z66A 3ARRA 3DSNA 3G7TA 2MCG1 2WXNA 5F7DA 4HUCA 2OXGA 3JVGC 3CN2A 4I18C 3RNQA 2CO6B 3JWNG 2R15A 2DWEB 1P4LB 5A2CA 4UILL 1BYPA 3UTQB 4JG9A 3VRJA 5IB1B 1D7DA 1MHHB 1FVDB 2IDUA 4U6HB 2G5BB 5DVPA 4MJ2A 3T3ME 5CGMA 2WXFA 1TKWB 3C75A 2F54D 5CEYB 3DX6A 4LIQH 5BS0A 3GJEA 1DJWA 5IWLA 1S9KC 3VFPB 3MYJB 3ULVH 4MX7B 4JZOB 3PS6A 4MDJB 1BXXA 3JBG7 2W95A 4WI3A 4WO4D 3FTXA 1CQKA 2F19L 3RIAK 2G3NA 2VDLB 2F7OA 1CD9B 2WIMA 2Z7ZA 4JQXC 2OMZA 2WNGA 2XN0A 1OVZA 1NCIA 4OB5H 4P2RD 5EU5A 4NNPH 4XPBL 4NRZB 3RNKB 4XXCC 2IDCA 4JO5A 3WIHL 3ARTA 4MJIA 5KBMA 4LCWA 2FX8H 2XTSA 2BINA 4Y9FA 4EBQH 2NTFA 2Q76A 3K6NA 2E7MA 4E9TA 3NG5A 3R18A 5EZJA 4N5ED 3VDCA 2IWKA 2RTTA 5FK9B 4X6CA 3UJTL 1IGTB 4HC1H 1HKFA 2EAEA 2VR7A 3Q48A 4P2QA 4AGOA 3TN0A 4FFYH 3SYCA 1AI1L 3T77B 1KXTB 3TCLB 2Y25A 3NIFF 2L04A 3HS0B 1CDIA 3BAEH 4DZ8A 1CURA 4PJDE 2KMWA 5CUSH 3PDOB 1MAMH 5FHBH 3FYIB 4TRPL 4I1PA 3QCUH 2R29L 1LO4H 5HPMA 1TCMA 3QZPA 3S37L 4F7KA 5CD3A 3GZOA 4LAQH 3OAZH 2HVJA 3IDXL 4ACPA 3GYRA 2HPTA 4HXAL 5JA9A 3LEXA 5C0DB 3HNSL 3BO8B 2I32A 3QNFA 4Q4EA 3SDAC 4JRYA 5CGYD 4FAAB 5I66A 2AMUA 1WYJA 3SGDI 3TVMD 3VXRE 3AWEA 1QUNB 3W2DH 4ZUWB 5F7FA 2UZIH 1NKOA 3ARGB 1OSPH 12E8L 4K7PL 4DQAA 2XIDA 4X5XB 4S0TD 2J57A 5EWIL 5E1AB 5EG6C 1UH3A 4MA7L 4OF0A 1RZ7H 3AU0A 1GY2A 5DUPH 3FQUB 3QULB 4TOYH 1E6OH 5KBNC 2V3DA 2K78A 3V4PB 5ESQB 5A2JH 1DP0A 2R1XA 3K3QA 4G6FD 4L8CB 5FYJH 2KS0A 1LILA 2OP4H 3JWDH 1CDYA 4WU5A 3K1KC 1BHGA 2ENQA 3FT9A 3QJRB 2V7NA 5DJAB 2VLRE 4JFZL 3FFDA 4YO0A 4XPFH 1YEDA 2B1HH 1VRSA 5EOTA 3ZDXE 2VM9A 4OCWH 4XHJC 3REWA 5ILTH 1MF2L 1S9YA 4L29A 4CBZA 2XWZA 3C08L 3AZUA 4ZUSB 4OV5B 2IV9A 3HB3C 2NX5A 1ZCRA 3B34A 4CKVX 5JPNA 2LTQC 4WTQA 4ZNEE 1S5IH 2JCCE 4F24A 3D05A 1B0GB 3TX4A 4TLKA 4N8VB 4I3SH 1QSZA 3GRWL 5DHMC 4J3OD 4G2AA 2Y22A 3I50H 2YMXL 4LBEB 4Y0GA 5GSVB 3VYPA 4LCCC 4N2FA 4M5SA 3P4NB 1XAKA 1OP3H 4GG6A 4TSBL 4YXHL 1MCOL 1SLUA 2AEWA 1ZTXL 2A1WL 4BM7A 4X4XB 3FQWB 1CFTB 1MI5B 2BVTA 3K74B 1A6PA 4NGHL 3CN3A 3FF7A 4Y4KB 4HLEA 1WTLA 3FU3A 2Z31C 3SQOH 4ZG1A 2ZP0T 1FNHA 3FT1A 2EYTA 2VL5B 2VAJA 2PUQT 1IGFH 3D87B 3PUCA 4FQLH 4F7MA 3D4CA 3QUMA 5KYUB 3L4CA 1N0LA 2E27L 4OLXL 1X9RA 4PYGA 3ZDZF 3BEVA 1ZLUH 1KB5A 1T3FB 2DL9A 4YVUA 2JJUA 3QQDB 3RAJH 4UQBA 2J2ZA 1XXDC 3MA7A 1A4AA 3JSSA 1FAIH 3HBPA 4LGSB 1FO0A 3CHXA 3GXDA 3HC4H 5AD0B 3GDBA 3R06A 1QPPA 1NGYA 2ZXGA 2XX1A 3GSVA 5DD3L 4RX4D 3SKMA 3FO0H 4H8UA 3LKPA 3ATFA 1WJ3A 2OL3H 4TVPH 4WW1B 3ULVC 4KHXL 2W0LA 2HFEB 1EDQA 1FG9C 3B9KA 4ODHH 1Q9OB 4YX2L 1FBIH 2R0KL 3NT0A 5DEJA 3WE6B 2R69H 2CXKA 5DFAA 3U7WL 1KCUL 3W57A 4H88L 5I0WA 4JFQA 2P5WB 4ZOEA 3EFFB 3EOYG 1IBGL 4KVNH 1BJ8A 3FU5A 4JZNB 3LRMA 5GZNA 1SUHA 3H9SE 2CR3A 1DQLH 2IJ0C 4P07A 2AJVH 4PJ9C 2VGLM 2CAKA 4F33A 3DBSA 1T89C 1QA9B 3VXUE 3SJVA 1NGWB