2XV2A

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caahaam), chemically reduced, ph4.2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
124
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKGEQYMFFCAAHAAMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-Binding Loop Length is a Determinant of the Pka of a Histidine Ligand at a Type 1 Copper Site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords AZURIN
total genus 28
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xv2A00
1R1CA 2OJ1A 2BHFA 2H3XC 1NINA 4HHGA 2W88A 3ABMB 2AFNA 2FQDA 2J5WA 3SQRA 2X87A 5I26A 1OF0A 4DPCX 3WI9A 2PP8A 2AZAA 1BXUA 2QDVA 1AAJA 2Y69B 2YXWA 3CG8A 3ABKB 1E65A 1GSKA 2N0MA 1W6WA 1XB6A 3UACA 3ZX1A 3TASA 3CZUB 3QJUB 2GC7C 2CBPA 2IWKA 5B7FA 3H4HA 1BQ5A 2AVFA 3GDCA 1XB8A 2H47C 2I7OA 2IDTA 2FNWA 2VW4A 2VW6A 5IY5B 1PLCA 2GHZA 4E9TA 1I53A 1QHQA 4YSSA 2DY2A 1V10A 2BP0B 3RYMA 2JKWA 3JTBA 3NJNA 3DIVA 2MTAA 2R7EA 1VLXA 3OMIB 4HIPA 1XMEB 1J9SA 4DP8X 2GBAA 1KDIA 2P80A 3D12B 4WTQA 3T6XA 1OV8A 3V9CA 2XV2A 4MFHA 3T9WA 4M4RB 4E9RA 1NIEA 3S3CB 2ZXWB 2OCCB 1WA2X 3QJSB 3L45A 2W8CA 1BQRA 3FQYA 3IN0A 2PCYA 1N68A 2YAHA 4BWTA 2B3IA 3CVCA 3HEIB 1JZHA 1GR7A 4A67A 3NP3A 4G70B 1HAUA 4BDVA 1AG0A 2HLEB 1JXGA 5FC9A 4KNTA 2EIMB 1AR1B 1NIAA 1N70A 4N8UA 4DP1X 1RZPA 3NSFA 3H4FA 2PP9A 2BO0A 2PPDA 1J9QA 3AY2A 3CDZA 4G7RB 2FTAA 4AI7A 4M3HA 5PAZA 1EZLA 3QPKA 3IBOA 1AS6A 2FJSA 1KCBA 2XUWA 4N4YB 4NB7A 2VN3A 4W9ZA 1L9TA 5I6OA 3WNJA 1SF3A 3JT2A 1AZNA 2IDUA 3HB3B 3BVDB 1OE3A 2YAEA 1NTDA 1OE1A 2XU9A 1YLBB 3EH3B 3S3BB 2PPFA 1WS8A 2YQBA 1L9SA 1ASQA 4KNUA 4A68A 5I5MA 4GP5B 1TEGA 3NJHA 3NJLA 5I6KA 1QLEB 3NJGA 3UABA 1PNDA 3PLYA 4PAZA 3NJJA 6PCYA 1WS7A 3EH4B 3OMAB 4DPAX 1PY0A 1JZFA 3PPSA 3CVDA 7PCYA 2I85A 1RCYA 3ERXA 2FT8A 5I5JA 2YXVA 1RZQA 2BP8A 2QPEB 2PPCA 4HCGA 4FA7B 3NJFA 1QNIA 2XX0A 3DTUB 4X4KA 1PZCA 3AZUA 3IN2A 4JHUA 3IE9A 1PLBA 4GYBA 3QJVB 1F56A 2CAKA 2EILB 2QPDB 1GS8A 2DV6A 2GSMB 2IH8A 1AZUA 1GS7A 1ET8A 3SBPA 1JXDA 1PZAA 2X88A 1PLAA 4DP0X 4YSRA 5D4HA 1JXFA 1HAWA 1L9RA 1ID2A 1JZEA 2J57A 4BWWA 3NSDA 5B1JC 3S3DB 1ZDSA 3KW8A 2A3TA 1PF3A 1BQKA 1ET7A 3S8GB 3BQVA 4HAKA 3NYKA 2UXGA 1OE2A 4BWUA 1CURA 3AG1B 2LLNA 2CCWA 4A2EA 4DP9X 3QJQB 2HX7A 3AG2B 3V9EA 3X1EA 3SBRA 4DP5X 3EH5B 1AACA 4E9WA 4KOCA 1IKOP 3DKHA 1NDTA 2EINB 4L0PB 2IAAC 1ZV2A 5ANHA 2FQFA 1BXAA 4F2FA 3T6WA 4HCFA 2BWDA 2EIJB 1BXVA 1SFDA 4BDVB 1SJMA 4KO6A 3X1NA 1GW0A 3X1GA 1EHKB 4RH4A 1URIA 1NPNA 3NJKA 1BYPA 1WA1X 1JVOA 3T6ZA 2QT6A 3AG4B 4A2DA 4QLWA 3FSVA 1M57B 3N2JA 4P5SA 4ENZA 5I5IA 1W8EA 2DWSA 5I6NA 3AW5A 1ETJA 2IDFA 2ZOOA 4TXVB 4A66A 4F7KA 1AANA 1RKRA 3UAAA 1PNCA 2B08A 1GS6X 1SF5A 1B3IA 4WKXA 1V55B 1NIBA 1SHWA 4UAHA 1ZIBA 4AKPA 1V54B 1JVLA 1MZZA 2YAPA 4AKOA 2FT6A 3QJRB 3FU7B 3NSYA 2VSKB 5E9NA 5I6MA 2YAMA 4NAJA 2DWTA 1E30A 3FU8A 2AANA 1ZPUA 3NT0A 1GYCA 4Q8BA 1CYXA 3ZBMA 2TSBA 3NJMA 4A2FA 1KBWA 2UXVA 3MBWB 4YVNA 3TBCA 4E9VA 5I28A 2XLLA 1NICA 2XVBA 2IDSA 4AZUA 1E5ZA 1W6LA 2AZUA 4UF7C 4K9JA 4YSUA 4KNSA 3EHBB 4HZ1A 2IWEA 3WNIA 2Q9OA 1TU2A 2YAFA 1SDDB 2BP0A 1PCSA 1AQ8A 3FT0A 2BW5A 2VSMB 4BK5C 2EIKB 5B1KA 4DP6X 1ILUA 1OCCB 3OQRA 3FU7A 2WO3B 1BEXA 8PAZA 1JERA 4G7SB 3S8FB 3WKQA 3IEAA 1WAEA 1SFHA 3X1FA 3CVBA 4E9XA 3WG7B 3CDZB 3NP4A 5EHFA 5D4JA 1FWXA 2PP7A 1MDAA 2TSAA 1AOZA 3UADA 1ILSA 2WSDA 1SHXA 4ZK8A 4KO7A 1FA4A 4GY4A 1OCRB 1CYWA 3C75A 1M9WA 3PAZA 2QDWA 3FPYA 4A2HA 3PAUA 3FYEB 4GP4B 3ASNB 1ZIAA 1X9UA 1L9QA 4YVUA 3FSWA 4YSEA 1KDJA 2FWLB 2VM3A 2HRHA 3G5WA 2XWZA 1FFTB 4Q89A 1TKWA 1MZYA 2Y1AA 3FQ2A 2IWFA 1IBYA 5AKRA 1A3ZA 2E86A 1SDDA 1ET5A 3SBQA 1J9TA 2H5UA 3X1BA 4F2EA 1NIDA 1IUZA 4E9SA 1AZBA 3KW7A 2YAOA 1WA0X 1ZDQA 3WIAA 5B7EA 2VW7A 1KCWA 2XXGA 2RACA 2FQGA 4A2GA 1AS8A 2UXTA 1T5KA 5D4IA 3ZIYA 4E9YA 4YSTA 1OCOB 1NZRA 4YSOA 5AFAA 2HZHA 3FS9A 3ABGA 2UXFA 2XYBA 3OMNB 5B1JA 2CUAA 3QQXA 5I6LA 1DZ0A 1NPJA 1CC3A 4AX3A 4KO5A 2DYSB 2PPEA 1ASPA 1KV7A 1IC0A 1OCZB 3QJTB 2GC4C 1E5YA 4NERA 2IDQA 4YSPA 4DP4X 1A8ZA 3EF4A 2BZCA 4CSZA 2XV0A 3T6VA 2UX6A 4QKTA 1JZIA 2VMJA 1KGYE 1MG2C 1X9RA 4YL4A 1A4AA 1L9PA 3N55A 5B1BB 3X2QB 1J5CA 1GY1A 3ABLB 1AZCA 2J55A 3TBBA 3OM3B 3FPXA 4UANA 3AG3B 1ADWA 3H56A 4AKQA 3FU9A 4YSAA 1PMYA 1XB3A 2XX1A 5B7MA 2UX7A 3OD3A 4PCYA 2Q5BA 2BP8B 1HFUA 2GI0A 2WO2B 1UATA 1M56B 3FSAA 1BYOA 1KBVA 1KYAA 2PPAA 3FSZA 1NWOA 2XXFA 1J5DA 2JFCA 3MX0B 2YARA 2HRGA 1SNRA 1PAZA 5TK4A 5LDUA 1JZGA 2PLTA 3TA4D 2NRDA 2VM4A 3ASOB 4W1TA 1A4BA 1NIFA 2CALA 1AS7A 2ZWNA 3GYRA 4DP7X 6PAZA 3PXLA 2I7SA 7PAZA 1TEFA 2GB2A 3UGEA 1CUOA 4KOBA 3WKPA 2IH9A 3NJIA 2ZONA 5PCYA 1IBZA 2HX8A 2BZ7A 4DP2X 2P80D 2J56A 4HCIA 4E9QA 1NWPA 4FAAB 3NSCA 1AG6A 1AIZA 2PCFA 1OOWA 4HALA 1A4CA 2FQEA 1MG3C 4JHVA 4CSPA 2YAQA 3PCYA 1PZBA 4G72B 4G71B 5AZUA 3FQ1A 4BXVA 1ASOA 5F7BA 2FT7A 3ZDWA 5A7EA 1AZRA 3T71A 4YSDA 4EF3A 2BW4A 2CJ3A 4GP8B 1GY2A 4DPBX 5F7AA 5TK2A 1L9OA 2XV3A 2OV0A 5B3SB 3UAEA 2MRYA 5B1AB 2DYRB 3TU6A 1A65A 2JXMA 4BXSV 1JZJA 3FYIB 4JKNA 2GIMA 2HXAA 1BAWA 1E67A 1J9RA 4HHWA 4G7QB 4P5RA 3GXUB 3U25A 9PCYA 2R7EB 2HX9A 4KO9A 4YSCA 1DYZA 3PAVA 4GXFA 4YSQA 1JOIA 2BWIA 5I6PA
chains in the Genus database with same CATH superfamily
1P6FA 2ESVB 3D39A 1U2HA 4U0QB 1ICTA 4PRPE 2OMYA 4A39A 2JKNA 2WQWA 5F7EH 3L2NA 3QH3B 3E38A 3U2SA 2DJSA 3NCJH 2MCG1 3VFRA 2GSGB 4GXUN 4NN6B 3QG6A 3PDOA 5KYYA 4LSRH 3GSXB 3CG8A 5C3IA 4HUKB 5JORA 2RBLA 5I1CH 8FABA 2OXGA 2LE9A 5DJ2B 3S4SA 4TQEL 5I16A 5E5MA 3UAFA 3TESA 4M7LH 4I3GA 2A6IB 3SPCA 5F7YC 5I1KL 2Q8AH 1IC1A 3VFSA 4MCZB 2VW4A 4NZUL 4FFVD 1AO7B 5T1MB 1XAKA 3CPLB 3MFFB 1CDJA 4HEPA 3S37X 3ZZQA 1IZKA 3VXME 2A9MH 4RBPK 2ZUYA 3PL6C 3GIZL 1V10A 2DYPA 4UZSA 4O2CA 3B7RL 1QSVA 4YC2B 2DLGA 4IYKA 3PHOB 2GBAA 4GMTL 1CLZH 4R7LA 4MFHA 5HI4C 4MQ7B 4K23H 3T9WA 1NUGA 1XAUA 1K8IA 2ZXEB 4RRPG 4KRMB 4NJ9H 4AXWB 1O6SA 4UU9B 1ZV9A 3JWNH 4EDWH 4ZD3H 1BQRA 1CS6A 2Y7QA 1UKTA 5KG9A 3H9YA 1CL7H 4D0BA 5BRZB 2JKXA 3LKRB 1LDSA 3KPNB 4G70B 1ZWIB 3V6OA 4BFFA 5INDB 2MKWA 1FFPA 1E8ZA 1V3JA 5DJAB 3INUH 4I48B 4AJ0A 3BVNA 4NPKA 3TBSA 4MCYA 4XBPA 4NWUL 2YD1A 3P2DA 4I5BA 2A74C 1N9PA 1RZPA 4PHXA 4L4VA 3GTNA 5DC9B 2PP9A 4FZ8H 5DUBB 1KC5L 3QEQB 4ANVA 1CDGA 4GKLA 4OZHA 3FB5A 4MA7H 1BVZA 1DVSA 4DN4L 5HY9B 1HYSC 4ZW8A 4EDXB 2P46B 4UT7L 1GGUA 1S8DB 1W0YT 4IBLT 4ODXA 5D7IA 5I73B 2EYSB 5IHZA 5CCJA 2NR6C 3BGMA 2VDLB 4XVJH 2DQTL 3JT2A 2BVOB 3BVDB 1E4WL 3DMMA 5JPMA 4Z0BH 2OFQA 2P7TA 2KLSA 1E90A 3S5YA 3TH4T 1K85A 1YN6A 4Z5RB 2FJFB 3BRGC 5IK3A 1DSFH 4KX9A 2BSBA 3C6EA 2F5BL 4XNMB 5GGRB 2ZWLT 1W0WB 3DROB 5DRWA 2IBBA 4GSQA 2AQTA 2AHIA 3FQRA 4Y4HC 1P7QB 3ZW3A 2KZWA 1FVCA 4PRNB 4B95C 2YR3A 4HFUL 2CZNA 3WEMA 5AD0A 2BNRE 2ZG2A 2P5EB 2AK4B 2YXVA 4HK0B 4WDIA 1OAYH 2BP8A 4ADGA 2M83A 1TFHA 1XH0A 2FYYA 4QKXB 1S78C 4NQQA 1AGEB 3RUGA 1Z9PA 3CLWA 3FF8A 3L5WB 4GYBA 4PVNA 3TYFB 5CJ5A 3REVB 1HHIB 1JZ5A 1JGUH 3T0VA 2PABA 4FABH 4YHNB 4HJ1A 4YXHH 3MRBB 1QWNA 3AXLB 2HFGH 4AL8L 5EORH 2H6PB 2ZWKA 3KWUA 3HRZB 9CGTA 1LO4L 5D6CB 5ABAA 4NYLB 3WY3A 5JXEA 1FLRL 2HG5B 1T22B 2VDPH 3MOBL 1FFOB 1IT9H 3OR7A 5HY9A 3VWKC 1A6VL 4M00A 5B1JC 1INDH 4FNTA 5E2TH 2K4WA 1AMXA 4F24A 3DK0A 4ZNCD 3FULA 2YUXA 5CGYC 3VDAA 3O2VL 2W92A 3D0VB 1Q9OA 3WIFB 1LWHA 1UM6H 4ZFZB 3DX2A 2X9XA 1V5JA 3L3IA 2LLNA 5FUZH 5KVEH 3MLYH 1NUFA 1OCWH 1ZT4A 3M17A 5C6TH 2HKHH 1F4XL 2YGQA 4YEFA 3RPKA 4PV9B 4WI3A 4CMHB 1EFXB 2WO4A 5DLLA 2D4FA 1U95B 1A7NH 3DI3B 3DKHA 3W38A 4JFUA 4N2KA 3KYNB 4QF1A 1I1CA 2O30A 4TSCH 3PWLB 4AVKA 3VI4B 1JI1A 1IAOB 4XZ4A 3B43A 1MIML 4ZXBB 4GG6E 4H8UA 4XPBH 3W2DL 4KO6A 4ZFOB 2ID5A 1RH8A 1BQSA 4JRFA 4EN2A 2P52A 3I9IA 1B88A 2JELL 3FTGA 1CFMA 3BRDA 1K3ZA 1UURA 1XR9A 3CZSA 3DMMD 1KB9J 2A9CA 5E99L 1GXEA 4P5SA 1WAAE 1PQZA 4UTAH 4AENA 2F08A 5I6NA 4ELKA 3V52L 2XY1A 2ZCLH 4H2CA 1TQWA 1CXFA 1FZMB 3WJLC 3WL9A 4ZNEA 1MFCL 4NJAH 2W0KA 4KROC 2IBGA 5EOCJ 1NLDH 3FMGL 5GGVH 4TVPL 3QXVA 3VYPA 2FWOB 5D1ZD 1AC0A 2YWYA 3ZYIA 1R3IH 1DJHA 4K3JL 1V54B 4PLNC 3NZSA 2G9HB 1SYVA 1BFTA 2B4CL 1TYJA 1CGSH 2D03H 1UENA 1Q9OB 3CMGA 3IDJA 4KTYA 1IM9D 1U8PA 5JDSA 4F20A 1M2VB 1UVQB 1YC7A 1G6RA 4KQ4H 2OLDA 1OPGL 1H0DB 3CFKA 4D8OA 3KS0H 3ZDXB 4KHTL 1Y7VA 4LF3A 1OLLA 2K1MA 4OJDH 3B9KB 3VYNA 1HHKB 2ZAHA 5HVHB 4GKOA 2XV6B 3ETTA 3QUXC 1DVQA 4MNQA 3EXJA 2IDSA 4WAFA 2CRZA 2YS4A 3O81A 4LAJH 4NIYE 2VAAB 5E8OA 3LIZA 1G1KA 3UPAA 2NYZA 3SE3C 2IWEA 5AZ2L 5K9JL 3DTXB 4LZKA 4S1SL 2CGRH 5D1XB 3HE7B 4HULB 4P49A 4BZ2L 2BP0A 3UBFA 5FFGA 3X11A 3X14B 4BH7A 5T5NG 4A7QA 1U58A 4NP9A 3Q5OA 3QFDB 2DKMA 4N2NA 2VQ1A 1WICA 3ULUF 5SWZD 4XMXA 1YVLA 3CDGA 3B56A 5LBGA 5D93B 4R7NB 4YL9A 4AV5A 5EOTA 3C09C 1JMXA 1S4IA 5A43C 4PJAF 5HDQH 2E0PA 1MFAL 5BO1L 1TZ8A 3CHSA 2ZP9A 3WKQA 3S8FB 4QLRA 4UT7H 5C0AD 1PKQA 3X1FA 5L2JA 3AS1A 3CVHB 3HC3H 1AYRA 3AADB 1EVTC 3P69A 4KKRA 3PF2A 4HCRH 5JR1L 2PP7A 2W81C 2VZTA 3JYBA 1ILSA 1YJDL 1OTTD 4KO7A 1QUPA 1ZGLM 4UNTA 4J2XA 4L1SA 2QR0A 3H9SE 2NDFA 4LDCA 3BESR 1PFOA 3B5TA 4FFZH 1G7JB 2A0LC 2VR3A 5ITFB 5TPWL 1J8HE 5BXFB 4FQQB 4XXWC 4H25A 1W0VA 4Z7VE 3PUUA 43C9A 4M4RA 1WV7T 5J13C 1TQBB 4JDEA 4Q14A 1NGPL 1A6WL 5AW1B 1WSST 1A3ZA 2XTJD 2DH2A 1S8DA 2JQAA 1NGQL 1SDDA 3EJZD 3HAEB 5TE6H 4LLUA 4AE0A 1NKGA 3QZNA 4FXKC 4OCSL 4XO4A 1KBGL 1BIHA 5EU5B 4M3JA 2O26U 4WY7H 1RZFL 4TRPH 1LILA 3KPMA 1K9TA 3FHEA 4YLQT 1MCBA 3KPNA 3UBXG 4L8BA 3WUZA 3BSGA 5MI0B 1MSPA 1TF4A 1U2CA 3R06A 4MDJA 3RUGE 4M8RA 3QR2A 3WE6A 4D0DB 4DGUA 1PSKH 1KCUH 5B1JA 1WG3A 3FRUB 5I6LA 3MYZA 1CICA 5AOJA 5CCGE 1OGTA 1N64H 1C5BH 1JK9B 2E9WA 3MLYL 4YDIL 3VXPB 3DNKA 3M88A 4ZO7A 2GC4C 3C5ZD 2G30A 1U95A 4KK8C 1E3XA 3ML9A 1HSAA 1FC1A 4OGAC 5E4OA 3NIGF 4IBYA 4BA0A 1UGNA 4QKTA 4X4XB 1AR1C 3L4YA 1E5BA 3EYOB 4N90D 3NVQA 5SWZA 3A22A 3NIDB 4BQ9A 1F0LA 4L9LC 1KTRL 1EO8H 1IAIM 1NDGB 4W4NA 5D2NC 2ZX9A 3WFBH 5J12B 1FYTD 3T1FA 1CFNB 1P0SE 2A6IA 3U0WL 1FCCA 5LBSA 3P73B 3TC9A 4L3EE 1I9JH 3KGSA 2Q2EB 3FCBA 2B9AA 1XR8B 4N0UA 4YHMH 3EDJA 3VG0H 3DUSB 3F6IA 1S9YB 3DX8A 5C97A 4UNIA 5B7MA 3V5HB 5EBMA 1ZK9A 1Z9MA 3OD3A 3U46B 5BUGA 3PFQA 2WO2B 3R4DA 5BMFL 4QHUA 1DFBH 5CBEB 5JOEA 4ANWA 2F8VA 3H9HA 3C6LD 3DO4A 4PJAB 4Y4FD 5MI0C 3EYVA 4AGPA 4MNHA 3TYFA 2ESVA 3B83A 3ILQC 4QI3A 1S7SA 4P2OA 4BSVA 5T1LB 1T7XA 4NZTH 3ZZSA 5ID1A 4ZT1A 3B2PA 1MPAH 4OFYD 4FG6C 5LO7A 2ICEB 4FQ2H 2Z92B 1DL7L 4P2RA 5IROD 3BUTA 3TBVA 5IW6A 2X2HA 1JIBA 4Y9CA 3WKPA 1S2EA 4KKLD 4CDGC 4Z95H 1SVBA 4ZNEE 2W9LA 2WQVA 2ZJSL 1IBZA 3ZTNL 4HUVB 1MCQA 2WXLA 3RWDA 2BZ7A 4W9JC 4HCIA 4NQVB 1DBBL 2O93L 1T5WA 3VU1A 4S10A 5CEYA 5T1KA 4OLZL 2WZAA 3JVGA 4KRLB 2MCPH 4QNPE 2A83A 4Z3EA 5AZUA 1JF1B 1ZA6B 3OKDA 2K7PA 5IEHA 4L8DB 4PB0L 1KCSL 1TFPA 4Z6AT 3HG2A 4HWEL 3U4BH 4MJIA 1BLNB 3W2DH 4UTBA 4PHZA 1BD2A 4ALAL 4M9PA 2IANE 2OAAA 1OZTG 2Z9TA 4LGSB 2X4PB 5K33A 4JQIL 2J20A 3UL4A 5L7XH 3HI6L 3T65A 1BAWA 5AOLA 3G6AA 3KLDA 3QI9B 1DE4B 4NQCD 3KXFE 5INDA 2J7LA 5DQ9B 1F4AA 3A0OA 4LPUA 1VGKB 1KLUA 4F91B 4XAKD 4MD4A 4HZAA 3B9VA 3I9AA 3C09B 2NY7H 2FGWL 3MRFB 2XT1B 5T5FA 3L3GA 4NLAA 4NUQA 3UDWA 2ZX8A 2Y2WA 4FQCL 1WZKA 4LP4A 4AIZA 2OL3A 2OP4H 3QC6X 2DQIL 5T33L 2AZAA 3DDGA 4TNWK 3GMMB 3QFJB 7FABL 2ENSA 1GSKA 1LD9B 4MSWB 1ESOA 3EYSH 1GYAA 3MV11 4NT6A 3RKPA 5DJZA 5C0CA 4HMEA 3G6AB 2IV9A 2K3HA 4LCUA 2CKBB 3BPOC 3ECVA 4IHOA 4LARL 5T8IA 2FHBA 4UUJB 2C4XA 3ZHKA 3VQLA 3VX0A 3MDJA 2WVTA 2C9UA 3O6FC 3H55A 1I7RA 2OSLA 1SM3L 5IESH 1MHCA 4BV1A 4BRJA 5LQBL 3QRFM 3EO9L 2XVLA 2ICEC 5JHDE 1SQMA 1JTTA 2WV3A 1KB5L 3G5YA 5SWQA 3IFNH 1HOCA 1TSRA 1X9LA 1RZFH 2VLKE 1UWEH 2WVUA 1CJYA 2DQJH 4WUUD 1MN4A 5D2LF 4R0LC 2WGNB 1NIEA 1OK8A 3TYGL 4OFQA 1ZA3B 2J88L 1XGPB 2ZCHH 1PCXA 2BS8A 3DVGB 4KX7A 1BD2E 3L45A 4H25B 5ETUB 5MEQA 2XYCA 4Y2NA 1A6UH 3KLQA 3L3KB 1JZHA 4PI0A 1KIPB 1QYGH 1AI1L 1OTUC 3G9AB 1T1ZB 2X40A 4GI6A 1BOGA 2BHUA 4OQTA 1JXGA 5EOTB 2OL3H 2VUKA 5EEXA 4U1JA 4KNTA 5DMIL 4IGBA 5E6SB 5GSRA 3P0YH 3C6SA 4ODWB 3LZFL 3TJHD 5EN2B 5GGSB 1KXQE 3R7RA 1SXAA 3EJRA 4MLSA 1GJUA 3GUFA 3BAEL 5FKAA 4AI7A 4J5VA 3Q1EA 3WS6A 1GCYA 4XWOD 4OZGA 4BFIB 1G9MH 4QHPA 2GTQA 2JF1A 1NANH 3KLKA 1UXMA 2V5MA 3HB3B 3L54A 3MRHB 3GBEA 3GWJA 4PJIB 1YLBB 1NCWL 5AW7B 4YBLB 1WS8A 4R90L 4LIQH 4N2IA 2NCMA 4ZSOE 4ZW7A 1Q90A 1ZLUH 5ANMA 1IZJA 1ZSHA 1KCKA 3ISWA 1E8WA 5LAXB 4MMZC 1NFKA 2Z35A 3D34A 4A7GA 1TTCA 2OPCA 4PJAA 3PDDA 3EH4B 4AUYA 3O3BB 4MJID 1JZFA 1H3XA 1QR4A 2CWRA 2WXOA 2VTFA 1RCYA 3BAIA 3HZVA 3PDGA 4MQTB 2HVBA 3IF1B 3DIDA 4LLYB 1AXIB 3RFZB 1VFAB 3GO1L 4G3YH 4ONFH 2BK8A 3ULUL 1PEWA 5I71B 4YH6A 3Q2NA 1YPZA 5HXMA 1PKOA 4N0UE 1PZCA 1GZQA 2WMPB 5CR1A 2YKLH 4GBXA 5E5LA 4Y2LA 4Y8AA 5JIQA 1PQZB 4Y5XA 1THCA 1GS7A 5A16A 4Z95L 4D0CA 1G7MA 4N2AA 3T0XA 4U6YA 1LDPL 2W07A 1ZHNA 3QDAA 4L0YA 1T6WA 3FN3A 2BSTA 3ARDA 5CHNB 2YPLE 2HJKA 2FJHA 2VERA 5I17A 4JRYD 4H20H 1DANT 4BE5A 1USQA 4PJDA 1MI5B 1W72L 2PO6A 5JPNC 3F7VB 3FQTB 3FUMA 4XCYB 4HC1H 1HNYA 2DQFA 4P2QE 1JGVL 3GC3A 4RMBA 4KC3B 1Z9SA 5KWYC 4FMVA 3RHWK 1S3KH 4GUQA 3PGDA 4UYPA 5HVWA 2NSMA 4JM2B 2A4CA 4GH7B 1LL1A 4I9WE 4K5MA 3GS7A 1FP5A 1EJ6A 2B1AL 4UTAA 4GXUM 5FWRA 1JV5A 2JMRA 5CP7A 4OTXH 4Z7QE 3JTSB 1CF8L 4H8WL 4C56D 3MV7E 4L8SA 1SFDA 1YEKH 3LH8A 1II4E 3ZE1F 4QHNB 1BZDA 5D1QD 4ECNA 2GITA 5A2LH 1NPNA 4Y16B 3R8QA 3VXUB 3MCG1 3MV9A 4IBQA 4FQCH 1HCVA 1WA1X 2YMXL 3KPRB 5F7HA 3H54A 5E2WL 5KAQG 2BINA 1JF1A 1HCFX 5SX4I 1TOXA 3B2VH 4ENZA 1R5WA 3D48R 2VZVA 3F62A 1KPRB 5C7ZA 1ZCRA 3RX7A 1ETJA 1MWAA 1B0GB 3RWHA 1A66A 1F00I 4TL5A 3OL2A 4KTEH 1NIBA 4ACTA 2WYHA 5HHVL 2VUYA 1ZIBA 2NY3C 5G4MA 5EU3B 3LIZH 5M94B 4HS8H 2F0CA 4KPHL 2BCKB 3Q6GL 3FTUA 1D5XB 4TVPD 4YHNA 4N1HB 3FFCA 1AZVA 4ODBD 4MCMA 5IQLA 3MROB 4OJYA 2K4AA 3NCMA 4KK6C 4UZGA 5DMKB 3O4OB 3PV6B 3U82B 3HPLB 1KBWA 4KI5C 1YN6B 1IEBA 4Z5RA 32C2A 5C0CE 1ED3A 4L3CA 2LU5A 2Q86B 5FO9A 5GS1B 2X05A 5J6GA 1JZ7A 1XDTT 1W6LA 5D7LE 1RXLA 3SYCA 4KNSA 2BVYA 2YEVB 1ANUA 4IOSD 4L4TB 1KYFA 2ZXDA 2Z93A 1E43A 2CDFA 4HLJA 2DEXX 3K2UL 4OVVA 1HE8A 1A7RH 1N4XL 5ALBH 3NDYE 2NQCA 4AWJC 2O61B 4DP6X 4ELMA 2P49B 5DUMH 2DB8A 1N5AA 3BCFA 5KJ7E 4ZX5A 2HMID 4MD5B 4XP6L 3KYAA 2IQ9L 3ZE2F 4CUCA 4KKBD 5FYKE 2VC2B 4LF3B 5DD3L 4HSQA 3FUDA 5FEBA 2BY1A 2DQHL 4WCYH 5CZKA 3OKKB 1HSAB 1AXTH 2K45A 5D93C 3V4VB 3VM5A 4V33A 3AJ7A 4G2AA 4JFYB 4B5ZA 2JJWA 4LHUD 3T08A 2DH3A 4LVNC 3UADA 3BQUA 4N0FB 2A4EA 4L1BA 2VDOH 5BPPA 5JXEC 1NAMB 4PS3A 5EZIH 4DKFL 5JPMC 5DJAA 4X7CC 2PR4H 1M9WA 1UWXK 1YNKH 4EIZC 2XN9D 4K9EH 5E95B 4U1IA 3T0EA 2J5LB 1VJSA 3BPNB 5D7SL 1FVEB 1MW2A 2FWOA 3I6LE 1RHFA 3UJTH 4B3VA 5C0BD 1JXJA 2GQHA 1HI6A 2WBJB 3QUKA 4TOYL 3PP4L 5D7HA 3HUJF 4F2MA 1S9XA 1VFBA 4KKBC 1FG2A 4MDRA 3G5WA 2X9YA 1MI5A 5LJYH 2NY1B 1LLAA 1T6BX 2V9RA 4JFDD 4LBEA 1IBYA 4MNGB 2EDMA 4AYDC 4QEGA 2E9BA 3D85A 3DX6B 4DO5A 3FB8B 1N0XH 1J9TA 2YKLL 1YA5A 3SBWA 4EXKA 3AC0A 5IW1A 2A9DA 3GSWB 4XR8C 3OPZL 3GEWB 3HVNA 1TJMA 5ERWB 4C56E 3I2CL 1YEWA 2VW7A 1SXNA 4I77L 3HRPA 2VITB 3WNMA 1S7TA 2PMZA 2AXFB 3OGCA 3BMVA 2H9GA 4K8RD 1LEGA 2NPLX 5DQJA 4CADB 4FQQA 4P2YA 4YSOA 5IM7B 4X8XA 4AQAA 5CWSA 3VW3H 1LQBC 3ARDC 4YHKL 1EMTH 3VXOB 3AREC 3DO7A 3Q9QA 4GEIA 2WYIA 4PVBA 2VSDA 3U2SB 1A3QA 1A1OB 1E4XI 2MPAH 4KK6D 3IJSA 3CFBB 1JGEB 1G84A 2J8UF 2BSSA 3B3IB 1QX1A 1DLFL 1EDQA 1TVBB 4PH8A 4YFLI 5IJVB 5I5RA 1X7TA 3VFNB 3NCWA 2NNFA 2VQ4A 3VB8A 3NGBC 2CDEB 2NY3D 1NKRA 1B9KA 1I8IA 1MG2C 1UUSA 4HAGA 4Q9QL 4MS8C 1E9QA 4ZUSB 2Q87A 1G7QA 4GT7A 1OSZB 3CLFH 1D6EB 1GY1A 4NO0B 1K4CB 1U8HA 3T2OA 4IIZA 3MLSL 1SN0A 1FBIL 1NEZG 3UYPA 3TCTA 4QTIH 2X4QA 2Q5BA 2OXHA 4DO6A 3TPUA 5HBBA 2OSXA 1EEZA 3IU3A 4GS7B 4LOVA 2APBA 4WI8A 4X7SL 2DQDL 3MV7A 5SWSE 2A6JB 5HHVH 1A0QL 1BAGA 2DJ4A 2PYEE 5L4JA 3PPEA 1Y07A 2HRGA 1E4JA 2EECA 4ZYKA 4V1DE 3TA4D 1I3RA 3TA3C 1FRGH 2B20A 5FYJH 5HDWA 4OB5L 5DUBA 3E7JA 1JGEA 3TO2B 4WUUB 3PXLA 3SE4C 3ZJAA 4K94H 2VOTA 4Y4FB 2LFGA 4AVHA 3CIQA 2H32B 5T3ZH 3VH8G 1IGJA 1MQKL 2D3NA 3D5OF 3ZDYF 5KZCB 4JREB 4Q2ZA 4EI6A 4JEGB 3I74A 5IHZB 4G6FD 1JYVA 4PJCB 4UBDD 3GINA 3TT3H 4RRPA 4L1TA 4WK2B 2D31B 2J56A 1IFHH 1OARL 3UZVA 3SDAD 5FB8A 4XX1E 1IM3B 3C9NB 3GIVB 4WJ5A 1M3IA 3JV6B 1EBAA 3VD5A 4XCYA 1RQ5A 1OXYA 4HALA 4X80H 2FQEA 3FFOA 4K7FB 4LRIC 4WK4B 3TIEA 4GRMB 3TEXA 5F3HB 5DZ9A 3A47A 4EBQH 1CIUA 3CTTA 4ONHB 2H1LM 3JV4A 2WBJA 2XQBL 3V4LA 1MW0A 1WUNT 2X4TB 2X6CA 4PG2A 5FYJD 3BXNA 2P5PA 2K3TA 2LTQC 4YWGL 2ADJA 4XX1G 5A2KH 2Z4QA 3V0VA 1FFNA 1FL5A 2XV3A 1Y0LA 2I26N 4LBEB 1AO7A 5T1MA 5EO9B 1RURH 2VXQL 1HNFA 1QPXA 4KKQA 3L1FA 4WHTB 5I1AA 3GUTB 4Y89A 3NABH 3G6DH 5D7LA 2F8IA 1QSEB 3OJDA 4BUHA 3MLWH 1SEBB 4HHWA 5JYLA 4MMXB 3M8OL 3MNDA 4I2XE 4YSQA 3QYMA 3DVIA 2HTKC 3BKYH 4ZOEA 3M17B 3UMNA 2EH8H 2CR0A 1W91A 2VDOL 1NBCA 3F3HA 4LLYA 2AFNA 3KNBB 1RI8A 2EICA 3DGDA 3O0RH 3D7PA 4H26A 4KPHH 5JA8B 1DEEB 1FC2D 1KZQA 4X6BA 3RZCC 3OTTA 3ULUE 1CO1A 5HPMA 1BLNA 4TQPA 1I1FB 1K4DA 1W6WA 2QZQA 2HG5A 3VAEA 1FH5L 5I8OH 5ECGA 1OKEA 4Q6IB 5FW8A 4B9JA 3SJVA 2I60H 2V5TA 3EOTH 3IJHA 3RQ3A 2R2EB 5A40E 3U7WH 5KOMC 4CC4C 2IDTA 2HJFA 4FFWD 2CHZA 1AQKL 3RL1B 2ATAA 1XCQB 2E7LA 2CUMA 2I07A 3D39E 1M53A 3ILPA 1NGZA 3WJJC 1MIEL 4LSRL 1NBYA 2F9BT 4GKSA 1DBJH 4NHCH 4P9HH 5CMAA 3RZCB 3B9DA 2ADYA 2XKNB 1J18A 1KDIA 1KNOB 3ATEA 3CVHH 1OV8A 4ACPA 3KPRD 2AC0A 1CFSA 4F2ME 5JW5B 1CLCA 4AEEA 4DSYA 4RRPM 2ZICA 3CZFA 4HIIA 2LV4A 1BF2A 2F5BH 3DHPA 5CILH 5EU3A 4UM8A 5HDBE 4LLWB 4P4KC 1CK0L 1KJ2L 1CWVA 3L3KA 4X9FA 2WZPD 5GRJH 4PTUB 5DS1A 4XPTL 5I0ZA 5BRZE 3EBAA 3KWWB 1HAUA 2B0SL 3BN3B 4I3SL 5A3IC 1HOEA 1NGYB 1UJ3A 2W0FB 5FHBH 4N85A 5AUMA 4HH9A 3P4OB 3LQZA 1PL3A 4KMQA 1GKOA 3RVVC 1X5HA 3H7LA 4IKKA 4EKXA 2R83A 5IWLA 2A99A 3BP7B 4RGOH 2EYSA 4R26H 5I23A 4TSAH 2HN7A 1D5IL 4G7RB 4G7VL 2LW3A 4IRJC 2ZZUT 3S37L 3TTYA 2UUDH 1DO6A 1X5GA 1KCBA 5HDOA 4BFRA 1LK3L 1NAML 5IB4B 4TLUA 1AQDB 1DCEA 2Z3FA 1X5XA 2R69L 4WO0A 2V5RA 4KZCA 1LO4H 2C7UA 2XWJA 3LV3B 1DN0A 1HHJA 1ORQB 3HE6A 4PRIA 2JWYA 4V1DD 4KKPA 1KJ3L 3ULVC 3OKMB 2ADIA 4PRHD 4LO9A 4PREA 4HUNB 3ESPA 4J3OH 1IQDB 6CGTA 1DQLL 4IBWA 1JHKL 2GK2A 4JS7A 2IOMA 1A21A 4N1EA 4G43A 1UM6L 6PCYA 4FKHA 4DPAX 5EORL 3S96A 2CJUH 4UUJA 5IB5A 2I85A 2BVUA 4GQZA 5K5YA 5I5JA 1ZVSA 2VJ8A 3V8OA 1BVLB 3BH8A 3QCUL 3V9FA 3HS0B 5MEPB 3C6LA 2G60L 4HJTA 4YDMA 2P5WE 3NJFA 2GJ6E 5IVZA 3OAZH 5I15H 3BP4A 4F58L 2YPVH 2GAZA 4Y2OA 3O2VH 3D4GA 2AXWA 4PRIB 4WENB 3QIBA 1UD6A 2FJGA 4YXKL 2AK1L 2DV6A 3S4SG 2N1KA 4P4KB 1I9RH 2ZKHH 4LPCA 1L6XA 2OL3B 1WC7A 3D52A 4XXDB 4I1PA 4TUOB 4GO8A 2B2XH 1XGTB 2VLJA 3L3GB 4N90E 3LEYL 3WNKA 4N5EC 1H8OA 4KUCD 4K3HA 2N4IA 5CHNA 2VGLM 2H2SC 4PJHE 4TV3A 3P4LA 1N8OE 4HUWA 4V2CB 3ZHNA 4OZIE 3FDWA 4UQ2A 5BW7C 3ULVH 3HB3D 3R1GL 2A3TA 4P4RA 4ATTA 1QATA 2ETWA 1R33A 1CU4H 1W72A 4J2QA 4NRXB 4POUB 3RBSA 3RTLA 2OYMA 3N6YA 1TLKA 1NOLA 1R3IL 1IB5A 5AB1A 1CICD 1U91B 4JO8A 1WYJA 4LAQH 4YDLC 1YY8B 2LLGA 1FBIH 1ZJBA 3P77B 3ZK0A 2C9PA 4UTAL 5K93A 4ALAC 3CMOH 1XFPA 4J8QA 2OXHB 3MTXA 3CFJA 4Q6KA 2WC7A 4KXZI 5AVVB 5FF6A 1GVIA 1S7SB 2BVPB 2XTJE 3H3BC 3QDMB 5C6TL 3BPCB 1MCPH 2F6AA 1T80A 5IFHL 3WDHA 1F6LL 3CXDH 1XGQA 2QT6A 4A2DA 4QLWA 1M57B 5H37A 3FAXA 3ZE1B 1NCNA 1CL7I 1OPGH 2O5XH 2OR9H 4MXVE 1RK0B 4XE0A 5FO8A 3P77A 5HYSB 3GRWH 4M1GL 5F88B 5C0BE 2WLZA 2WQAA 1CXKA 1J8HD 5DJYA 1ZVYA 4X98A 5IKCB 1YEJH 4A63A 4G82A 3BZDA 3ZQ9A 4Z23A 4G6AD 2HH0L 2YK1L 2L4OA 1CIDA 3NSYA 3EHBC 5J0BA 1WIPA 3MA7A 4HKJB 2V3DA 1JGIA 5AZ2H 3SN6N 4ZMWA 3N41F 4BEIA 1O5DT 4ZFGH 4KKNA 4OLYL 4X4XA 4YHIA 1E30A 3UP6A 4PWGA 4Q9BA 1XH3B 2Y7SA 1V7ML 1P84K 3BKCH 5BVPH 4PYHA 4RGMB 5FM8A 5JXED 4M6NL 3FFDA 3SB3A 4HU8A 3EUDA 4LU5L 2G2RA 4ORGA 3TCLB 2WB1A 2OI9C 5I28A 2W0LA 2XLLA 4AEFA 2BNQD 1GHFL 3SE3A 4AZUA 2LAAA 2C4FU 4K9JA 3VTMA 1PDKB 2D03L 4XP1H 1CK0H 1KJ2H 2X0UA 3EHBB 4G1MA 4D9LH 1TU2A 1Q9KB 1P7BA 4HV8B 5I8CA 4FTVD 1MHPL 4JRXB 4CBZA 3SCMA 4TM9A 1CB4A 1TQCB 1FFQA 2NYKA 3GSNH 3AQZA 4I2XB 3QUYB 1H3PL 1MHHB 1QSEA 4K2UH 4QOKD 1U42A 3UP1A 3ZE2E 4UAOC 5ADOL 1OGTB 2GBUA 4HHAB 2O1AA 1YQ2A 1BVNT 4PD4J 4RWHA 2GK0A 1IM3A 1WISA 3C9NA 4OH2A 4BM7A 5C3TA 1E6OL 3QWNA 1PG7L 3WMPA 4E9XA 3Q05A 1R5VB 4WO4B 1AD9A 5A2AA 3OLIA 2OTWA 3H3KA 2EYRA 1U93B 5F3HA 3RKDC 2Z31C 1E28A 1BEYL 5IGXL 2A0LD 4YDJA 1FA4A 5GRVK 3VMNA 1MW3A 4JHZA 4LDOB 4LXFA 4P23C 1WO2A 2ZCZA 3KJ6L 4TULL 3KPQB 2VR8A 2Y36H 4HBCL 4KDVA 2QDWA 5HDQL 3PWUB 1N67A 3SEPA 5DJDB 4JFFB 2F5AL 5F1NA 1WWCA 4GP4B 2ICWJ 3MO1B 4WHYG 1S5IH 4JN1L 1EHAA 3FO1B 4UT9H 3GMRB 3GSOA 2FWLB 2IALB 4LHUA 4R4FH 1UXSA 5KVMC 1RJYA 3CBRA 5IB2A 5DVPA 4CNIA 2VLKA 3KPSD 2VZ1A 3UBGA 4Z18A 2NY6D 2QQKH 4QTHB 1CZ8H 1PX3A 3IFOB 3VFPA 4TPRH 3OKNB 4ZUWA 3ZDXF 3E6HA 3AREB 3QUHA 5IG7B 3RNKB 2JI1A 4E2OA 4L5FE 4MJIB 4G59C 3WO4B 4HOZA 5HYQB 1A9EB 1WAAF 2NXZD 3CZFB 5C0NC 5IW6B 2EIDA 2Q86A 2EDWA 2A38A 5B7EA 5GS1A 5D1QC 4FDWA 3P3RA 4JDTH 2NY0D 4LFHD 4A2GA 4OD1H 4NQXA 4OZHE 4JR9L 4QXGL 5D4IA 4EVNA 2X42A 2AQRA 4Z7VA 5GXBB 3BPCA 5LGHL 4PGBA 3HR6A 3O4LB 3SOTA 2AV7B 3P3TA 5E94B 5I1EL 1MVUB 4PTTA 1E3FA 1N12A 2R29A 2UXFA 1XCQA 1AMYA 3CUPA 1MVFA 3ZUCA 4MA3B 1A1OA 3BZEA 2VM9A 1B0RA 3DBSA 1TR7A 2V5YA 4QHUB 1U8NB 4QRUB 2OR8A 5GJTL 4JRYE 2YQ3A 4M1DH 3BKJH 5AYUH 2AKRA 5CLWA 1IM3D 4EIUA 3MBXL 5K39A 2APFA 2YPLA 2FEEI 1T2QH 5CM1A 5L2KB 5I75C 3T8XB 4ELDA 1DL7H 4HXAL 5JDJA 3BKML 1MRCH 1Z0NA 3MXVH 1T1XB 1LJMA 1UM4H 2EDJA 1N0LB 4MJJA 4XMTA 3P11L 4JKMA 2J55A 1DJSA 2FEJA 2L7QA 2ZSVB 2FLRT 4P57B 1MCPL 4AKQA 1T0NA 5GZOD 1YPZE 3QORD 3ZKMC 5C09D 3BW9A 2YEQA 5E2UL 2VMEA 2GI0A 5DXWA 5ID0B 1JPGB 3ME0A 4BFNA 3ESVF 3DX7A 4JN2A 4OCYL 3E6FB 3FUHA 4MJ6A 5EZLB 1YEJL 3PNRB 3FTGB 2PW1A 2GAZB 5I19H 4F5CE 5HYJB 1OK0A 4LLVA 5ESAA 4PWIA 4FP8H 3ULVE 1M05B 1OM9A 2OW6A 2N7SA 3IK2A 3JTTA 2Q20A 3PIQA 5KJRH 1RD6A 1RZKH 5EEVA 5IJBC 4ZAKC 1VF5C 3NBNA 5LDSA 2C9XA 1DFBL 4KOBA 3CDCA 3PHOA 4JKWA 4RISH 4Y8DC 5GS1C 3AY4C 4CVWA 3OKLB 1Z5LB 2WXQA 1UKQA 1FVEA 3G5ZA 1NBZA 4FQXD 5F6HI 4XCEA 3U9WA 4PRPB 1G7HB 1U2YA 1XH1A 5I82A 1QFPA 2C3XA 4F7PB 2F2HA 2UY6B 5DTFB 1COBA 1HZHL 3L7FB 1AGBB 1INQA 2AJZA 3N42F 2E6QA 4Q0XH 4U4IA 1J87A 1JF6A 2D7OA 3HC4H 7FABH 2WD0A 2HRPH 1MFEL 1JPFA 1XF4B 5I0WA 4MS8D 2HFEB 3CC5B 4WFHD 4D9QE 2WVVA 1LWJA 2BW4A 2COQA 4P57A 1H3PH 3EYQC 3L6FA 4DPBX 1SLWA 3O3AA 4PRAA 1TZIA 3O2DH 2ROYA 1PY4A 4HAFA 1QG3A 4KK9D 4UINH 4XN2A 5EPMA 3U36A 1P84J 2VN5A 3UTPE 5J56B 5IFHH 5FO9B 5J6GB 5HYIA 3O3BA 3F83A 3PQYA 1HHIA 4Y9GA 1PG7H 2BOLA 3A5VA 3QYNA 2I27N 3QZLA 4YXLL 5MEND 5JHDD 4KO9A 2WCSA 1CDBA 3S9DB 1GH7A 2DIEA 3ELAT 2YA1A 3ARED 4HJGA 5T1DH 3QA3A 3FOLB 5GZOA 1ZV5A 3DRTA 1F4WL 4P48A 4U1MB 1KTCA 1IC7L 2VIRB 4AV0A 2X87A 3BVWA 4ZUTA 2V33A 1CDUA 2QDVA 2J1YA 1IARB 1MVUA 4PTTB 1LE9A 5DLML 2ZG3A 1V7NH 1NFDB 3LCYA 2PXYD 1MRFL 4TS6A 2Q10A 5F9OL 1QFOA 4X6CF 4PM1A 2FO1A 5F7UA 4Y5YC 3KZ8A 3COOA 3KPLA 4GMSL 2FNBA 3MLPA 3HN5A 5FGSA 1SZNA 1P9MA 1ODUA 3CWGA 2J6EH 1I8IB 5IFAH 3DRTB 4Z8FL 1KYDA 5D71H 1N18A 4FLRA 1WBXB 3IGFA 4YX2L 4ORZC 4EI5D 5JW3L 3C60C 4ZFQA 5DURD 5KBLA 4R5XA 3RAJL 3DV4A 2VL5B 2XZAL 4MAYD 2GY7B 4PS7A 5JHLL 2FJFA 4KZDH 1UB5B 4DTGH 3SGJC 4WTQA 4JDTL 3BAXA 5E00B 3H7BA 4H26B 3TV3L 3D9AH 4E9RA 1WA2X 1KCRH 1OZUA 1MCCA 3UBXI 5J1AA 5CINH 4R2GB 3IN0A 4BWTA 3EXLA 5DZOA 2WLLB 2Z65C 5M7QA 4OBRA 4BDVA 2ZQKA 3EHBD 3ZL1A 2DMHA 3IJEA 1EV2E 3IFNL 1P7HL 4MX7B 3MYJA 4AYID 1D5MB 5ALCL 3ULUH 1CGTA 1OWWA 2G9HA 2NY6B 2V7HB 3ELQA 4FFVC 5ERWA 4DN3H 2PPDA 5KVFL 1JV2B 4WO4A 1NC4B 3ZYOA 1HESA 3OB0H 4M3HA 5KG9B 3NJXA 2WLMA 2NR6A 4MZ3A 2BC4B 1JGDA 4QNPF 3US1A 1YO4A 3CPLA 4MS6A 1SJVA 1UM4L 1ZD6A 3NZHH 3PHQA 3UH8A 4CN1A 1OE3A 4K7FA 1CVRA 2L3BA 3B5GA 5C2BH 1P4IH 5DC4B 5E9DA 1GAFH 4XWGL 4ZMXA 4E41D 3KHQA 1HKLL 3LZFH 2AI0H 3HE6C 5DFVC 1BBDH 3HS9A 4Z0XB 3TJEH 4E0RA 3NQIA 5C7XL 2QLYA 3VWKA 5KSBB 1WPCA 1RV6X 4R96A 3QCTL 4CL7A 3WUWG 1Q9LB 4HC1L 1MCFA 1M42A 5DHEA 4PCKA 3ERXA 5DWUH 1I1AC 4HEPG 2IH3A 1P6WA 2J2ZA 2W9EL 3I50L 4ORGB 1VADB 4HWNA 2QPEB 4POZD 1U4FA 2BPBA 2EAEA 5EH1A 5HDLA 3C6LC 3F05A 4WW2F 1NCIA 3VRJA 2MKLC 1NQBA 5EIVA 3U7YH 5C6PB 4JHUA 5DJXA 3RWJB 5IEHB 1F56A 3IKCB 4HPYH 1GS8A 4LOFA 3FT1A 3WIIH 2OYPA 3SD5A 2ZCLL 1SDYA 1JXKA 2NY5H 3JSSA 3DOHA 4AOFA 4MJ2A 3U30C 1FH2A 1QACA 4RESB 2C3VB 1UD8A 2D3LA 3QNFA 4ANUA 2P47B 3P0GB 4DZBB 4FLQA 3ESOA 5E94A 5T5NF 4G3YL 4EN3C 2EADA 1Z9LA 2RFXB 5H37H 5F89A 1G43A 1M6UA 2D0FA 4PJCF 3TBVB 4FQXC 4N25A 4QRUA 3FQWA 4YHLH 5A2BA 2JJSC 1QSFB 1CBVH 2V17H 2VLLA 3B1UA 3IDYB 3BX7C 3S36H 4F8NA 1E2ZA 3MA9H 3AG1B 4LHJB 5F6IC 1Q4NX 3REVA 1R0AL 1OO2A 1U8QB 1E42A 4KRPD 2YD9A 4QYOB 4FQJH 4NM8H 3I6KB 2IMNA 4QY8A 1N3NA 3GMLA 5KTEH 4H8QA 1T20B 3VH8B 2Z8VC 4W9CC 3MOQA 4OFYA 4AEIL 3T6WA 4HVBA 1D5XA 3MAWA 4A7SA 4OIBA 3UTZB 4BCXA 2CGRL 5F7KC 2LTQB 4OCYH 1GTFA 1LVEA 3ULVD 1JGLL 3OWRA 4KUZL 4YBLC 4DOHE 3O6MH 1GW0A 2IH1A 1OP5H 5GGQH 4HF5L 1HCYA 2IWGA 3ZHLA 3P73A 1S3KL 2HTLC 1EJOH 3P54A 4U1NA 5JQ6H 3BWAB 1JVOA 1M9SA 4RFNC 1YC8A 2V9TA 1QLEH 4HKBB 1S7WA 2DWSA 5IQOA 5BS0B 2IDFA 2ZUSA 4LHQB 2XTJC 4ZBJA 2MOQA 1RKRA 2AQSA 1AD9B 5F9OH 4W6XB 4X99B 3QW9A 1YMMD 2BS71 1N4XH 4AYGA 1U3HD 3FU3A 2NQ3A 5DGRA 3QFJA 4F80A 1Z9NA 2X38A 2E4TA 3QNYA 1IKNC 4JO4H 1XSOA 4Z76A 3PWVA 5A6IA 4WSKA 2PWDA 4U31A 3PGCA 4I0PC 4KXBA 5TE7H 4Q8BA 4IEFB 4F7EB 2NW2B 1J8KA 3N3EA 3E1ZA 1NMBL 5J1SC 2X1PA 1G7IA 2NNCA 3RGVA 4U1HB 5FW6A 3W11D 3IDNB 2Z7ZA 4DAGL 2ZTBA 4X6FA 1WQVT 4G43B 3TCLA 2V0AA 4ZMTA 4HZ1A 4PJXF 4OF8A 4W93A 2Y6SC 5HHNB 3W0WB 1QEWA 3QNXA 1SDDB 3QPXL 1BFOA 4JM2F 4OCSH 4EZKA 3S35X 2MQGA 5E4IA 1XIWC 4MA1B 4L8DA 1BZEA 4G1MB 2VSMB 4DCQB 5BS0A 1G1YA 1RIHL 4GSUA 2ZT9C 4LSSL 3VXRB 1BG9A 3GRBA 4AYFB 2QELA 1R47A 1OCCB 4U1LB 3ZQWA 2O61A 3DURB 1I9EA 1RAMA 2PXYA 3CN2A 3P4NB 3ZXAC 4XO9A 3RZCD 1UA6H 2NYYC 1IAIH 4L37B 4RCAA 3JUYA 1BF5A 1FF5A 3QDJB 1ZGLP 3D33A 5EHFA 4ABWA 1FSKC 1G1OA 1PG7X 1UADC 1WAAA 2G0KA 1OTUD 1YUKB 2HVKB 2H7WA 1DDTA 2E3VA 3F64A 3P3SA 3ZYJA 3T4AC 5FYKH 5FM5M 1NCBH 5JMOC 3IS0X 4NUGH 3PWPA 1L0YA 4DN4H 4TLKA 5I2IA 2Y1VA 4UAOB 4A2HA 4LPYA 43CAB 3MJ8A 4AEHH 4DVRL 4ZMPA 4TNGA 2OMWA 1PKQB 4FF9A 1TEYA 4G11A 5LCVA 4Z7QF 3ATAA 3QFJD 2BIOA 4BCZA 3KE0A 2MPAL 2H3KA 1TMQA 1AXTL 2HLAA 2WUBH 2Y7NA 3DX0A 5JQHC 1UA7A 4ABVA 1CFSB 3BYTA 1HH9B 1IBFA 2X7LB 5D1ZC 1Q0YH 5IB3B 2HVKA 2ZNWA 4TUKH 3WFCH 4F9PA 2YRZA 3ZMNA 1T4KB 5JW4R 4P9ML 1RK1A 4NQCB 3OKNA 3LNFA 3DMMC 1AR2A 4YGAB 2E75C 4QXTB 1WIUA 4XPHH 5I66A 3W39A 1C16B 2WJ5A 3K6SA 1T5KA 3U46A 3IFPB 4NZTL 1ES0B 2FDBP 4UDUA 3I9PA 4JFED 2Q3XA 4LSUH 4L05A 3FB6A 4OLWH 2NZIA 4ZXBC 5ABZA 1KJMA 5HHOB 2GVYA 2R29L 1DZ0A 2CR3A 2EDEA 3IRPX 5E08H 3NK4A 2B1HL 2BNQE 2DYSB 4WNSA 1I8KB 3NZHL 4FI7A 4LCUB 1IC0A 3HR5A 4AYSA 4FQJL 1A6ZB 4ZSOA 3W5MA 2A7BA 2BZCA 3Q8AA 1T7YA 3JZYA 2K6WA 4OB5H 4HIJA 5AVSB 1JZIA 3GQFA 3V6BR 2R2HA 4B41A 1OQXA 4TSBH 5FGCB 4PJHF 1L9PA 1RZJH 1WUZA 4PB0H 2BIIA 1H3TA 5ENWA 1E2WA 1KWKA 2W59A 2HKHL 5EO0B 3E8VA 4QHMA 3UZVB 3QG7L 2DM3A 1S7RB 3NIFB 5LKNA 4AMKL 1A7NL 1DLFH 1V05A 1TVHA 4JRXA 2P5WA 5LB1A 4B9KC 4EI0A 3LNEA 1G7LA 4Z7IA 1A6ZA 1TTRA 3GMMA 5T3XH 2VDRH 1QNZH 1DANU 1F4YL 2UYLA 4XPBL 4OZFH 1A1MA 3G6JE 3L9RB 4KKLC 2PPAA 1NEZB 5FHAL 4IDLA 1CD9B 4RA3A 3K2MC 3MX0B 1T1WB 5H4YA 5D5MF 4JO4L 3I6GA 3HR5B 3UTZA 3MZGB 2XN0A 3V52H 2BDNL 3QC5X 4FXGA 3UTTA 3FTYA 3AUWB 3UZEA 1E9PB 1F42A 2NY3B 5DFVD 5DGQA 5HGGS 5TE7L 2GJZB 1ETA1 4B60A 3PHSA 2CGZA 1MCRA 3V4PB 4MHHI 3SKOA 1JDDA 3STBA 4LE8A 1FL6A 5D7EA 3QQ4B 1CGSL 5HYSA 2DQEH 4LRIA 2BMKA 2VLLB 2JQMA 2UZIH 3MR9A 2OK0H 2VJXA 5GS0D 1KN2L 2QPUA 3ZDWA 3TN0C 1U6AL 4N1CA 4D2NA 4B9FA 3H8NA 3W1ZA 3AMLA 4J3OF 4N8VG 1BQLH 3FONA 1UGKA 2Z8SA 3U2IA 3TNMB 5EFIA 2IBZX 3HBGA 5GGSA 2C3VA 4WFFD 3TYGH 3QIBD 2VXSL 4POYA 1QTYT 4OF3A 4PV8A 3ARFB 3NFNA 3QZWG 4LL4A 3LHPL 2ZYIA 2Y3NA 5L6YH 4JG0H 2XZQH 1E67A 1G9NL 1A6UL 1K5NA 4C83A 3UCRA 4AQ8C 1H15A 3FF7A 4GQ9L 4KJWC 2DW5A 4HJGB 1KYUA 2CXGA 3GHEH 3KYOB 3LSOB 2J6WA 3DUHA 2OMZA 4GRWF 3QJXA 5C09B 1BF8A 2P5WD 4H1LG 4OCWH 4UOW1 5GGRY 4YWGH 4FFZA 5CIPA 2ZIDA 1NINA 3MV01 1UH3A 2OZ4A 1WZLA 4E5XG 1OF0A 1VHPA 3DGGA 1MWAH 3APCA 3SY6A 1F11B 4DVBB 5LNGA 3US0A 4EO5A 1FZKB 1NBVH 5EU4B 3L6FB 1RU9H 2ALAA 2JV6A 1ZLVH 4L1DA 4QXWA 2J43A 4HIEB 3LQAL 1QSZA 1VCAA 1YJDH 4HXBL 4M8VA 2CBPA 3NZ8A 4MXVF 3VXPA 1LP9B 3WN5C 1JMZA 2IADA 4U2ZA 5J7CC 2I7OA 1IM9A 5FDWA 2VCOA 4BJLA 1TETL 1Q9LA 4J12A 3FAWA 4U1HA 3B7UX 1CR9L 1JRHH 1OANA 5D1XC 1AYOA 2J72A 1QHQA 2E9GA 2ZPKH 1XTLA 4Y2OB 4J39A 2E7CA 2B59A 3G5ZB 4J1UB 1J9CT 3J2PA 5IBTH 4PB9L 4IRJA 2LU3A 2P80A 3DSNB 1CI5A 5DK2A 3MRQB 4PUBH 4UTCA 1WJ3A 3UPRB 2Y4SA 3HRZC 4PY8I 3VSUA 1JAEA 3EIFA 4Y7OC 4HPHA 4ZO6A 2FZ3A 3MODL 3FTXA 1AQKH 2YJQA 5H8DA 2PCYA 2BNUB 2ZOKA 4UQBA 1KLUB 1QBAA 4PREB 4KZEH 3D07A 4P04A 1GIGL 3V6ZA 3EG9B 1EAOA 4BK8A 4DPRA 4KH9A 2X9ZA 4DEPB 2G60H 1NLBH 1NCBL 2H1PH 3BWAA 3H4FA 3AM8A 5E1IA 4HIEA 4QOKA 3BFWA 1DQLH 4NZFA 3UJJL 5ISZB 3U48A 5AOIA 1MCJA 4YXKH 4U6XA 5CILL 4WO4C 1FGVH 2OMVA 2F7OA 2KH2B 3F85A 5BV7H 2XUWA 5DRXB 4AITA 3K6NA 4YAQB 2A9NH 2EXWC 5LG6A 2MTPA 2HT2D 5CNHA 4YDIH 2YGNA 2DLFL 3VXNA 5J9PA 3GHBL 1OY3B 4W9KC 4FG2A 4Z9KB 4B7LA 3DTDA 3ZKXB 4Y4KB 4OI8A 5DHMC 3GLEA 5CEYB 1Q0YL 5T1KB 2ORBL 3I6KA 4GP5B 4QY8B 1AGEA 2YPLB 1ZT1B 2F54D 4TYUA 4ZAKD 5EEWA 2CK0L 5CJ8A 3TP4A 1WS7A 5F70A 3SQBB 4Q52A 2B2XL 1BBJA 3PPSA 2O6DA 1KWGA 4RX4A 1YNTB 3MLXL 3PGFL 4HWUA 3ULSB 1ACCA 4MAUH 1U3HA 1JK8A 3VGHA 1DVXA 2O6EA 3SO3B 1U33A 1S6NA 3BUQA 3IN2A 3ROLB 1A5FL 1YEIH 1CU4L 5C70A 4GKZA 4UIKL 5ILTL 5AD0B 3CHPA 2NY2D 2LVCA 2Z0UA 1YPZF 3K6IA 4OJCA 4XMKH 5HHOE 3RU8L 2CJUL 5E08L 2YD5A 5FUCC 3MV8E 1J1PL 2EABA 3RVWC 2OMVB 4NC2B 1XCTA 1U58B 2JE8A 3V5HA 2ZKXA 1L9RA 5GRUL 4WI2A 2ESVE 3SPGA 3E6HB 3QQ3B 4B9GA 4X4YB 5FWQA 2A2QT 4KRPB 2RGSA 3S3DB 1B0GA 3LN4B 5T5FL 4L5FH 1MWAB 2DOCA 1K2DB 5CP3A 1BQKA 5F1OB 1IEHA 2JJTA 3BQVA 1OB1B 2WY3B 2J1XA 3S6CA 1IE4A 2GJ6A 4RFEA 5AW5B 1OE2A 1TQBC 3VXOA 1FFPB 2O5YH 3KBEA 3RZWA 5M95B 3HLKA 2I9TB 2FHFA 3FN0H 1CGVA 2CO1A 4K7PX 4JFFA 3X1EA 4JY5H 5DUPL 4DZ8B 5CUSL 2H6UA 1UXWA 3TA3D 2QADD 4ZW5A 1BZ7A 3RA7H 4YNYA 1QZNA 2UV3A 4LPXA 5JHDB 4F2FA 4N8VA 1PVHA 2VDNB 4PJDB 5DDHA 5E2VL 5D2LE 4A6YH 5I17B 3EBHA 2HFTA 1G7LB 4IRJB 1R5VA 3QWRA 2Y25A 3T3MB 2DM7A 1WEJH 5ALBL 4V1DA 1HJBC 2HT2C 2JJVA 2VZOA 3QDMD 3MRDB 5E6IC 2BSCA 4JGJA 3VXUD 4NAMA 3BUIA 5G2NA 5KYXA 4R97C 3IDUA 1R17A 3QJZA 4NCC2 2AJUH 5IQ7H 1GGIL 3ARXA 1NBVL 4QRTB 3QNZA 5L0QC 2B15A 3D3VE 3SGEI 3RTQB 1SF5A 3DGCR 4QO1A 4QXUL 1K3IA 4XVUD 2JCWA 2QVIA 1CFVH 2DIBA 5T3ZE 3L3HA 1A2YB 4MJ5A 5JIDA 5I9QC 2FT6A 3CFTA 4Y5YA 1TETH 3MRLA 4Y2DB 3EJCA 3B9EA 1JF5A 1GYWA 3OV6A 1QABA 2Y1ZA 4PJEB 3QEQE 4WW1B 1I7TA 2UWEB 4JFYA 4OSUH 5HPOA 3FB6B 4PJ5D 2CLVA 3FU8A 4GW1A 3NCFB 1HQRA 4NPYB 1YYLL 1FFOA 1DBKL 2TSBA 3OR7B 4J6RH 2Z93B 1REIA 2BFVL 4M7JH 3SE8L 5DD0L 3ARDD 3NN8A 3P0VH 4JRYB 1M71A 2W60A 4JB9L 1WBYB 4PUBL 1AO7E 2MOGA 3SKUD 2ITCB 3HE6D 3L5HA 4BQBA 1OAZL 2YOAA 4RSVA 2JNZA 4HYTB 1R3KA 5F7MC 1A3LH 2WAQA 4M1CD 4X8JA 4ATWA 4CVXB 1H3UA 1E6OH 3DX3A 5EFIB 4FA6A 2G0LA 5D1XD 2IAMA 3FU6A 3O4LA 2P28B 5EEZA 1VKXB 4Y19D 1T04A 3GXIA 1EAQA 1Q8MA 1TKWB 1U8NA 4TUJA 3QARA 3RIAK 3SKJH 1H6TA 1B0IA 2MHAA 1B0RB 2XJKA 4FZ8L 3SDDC 5L8LB 4YLBA 4L3FA 1I4FA 3BSZA 3FU7A 3SZKC 3CFIC 4BKSC 1EH9A 3SDCC 3UXFA 5I1IL 32C2B 1EEQA 1W8OA 3NCEB 3MV9E 2K0RA 4E5XB 2D0GA 1ZXQA 3FUEA 5AVXB 4BH7B 4NN6C 1S5HA 1NFDA 2YUWA 4PEEA 5H37G 5IF0B 4HFUH 2DLFH 1KULA 1UWFA 2VO8A 5DR5L 3GNML 1E4KC 5AB9A 1BQHB 4I9XA 4L4VE 3C75A 1TNMA 3MJ9H 3FO1A 1KIPA 2CK0H 4YIQA 3FYEB 4EZLA 5HP5A 4JDZB 3VCLB 4LEBA 1BDYA 1IGIH 3IDMA 4MASA 2VYRE 3QEQA 4LP8A 3SYPA 5C9JA 4Z7AA 1ZEAL 3K3QA 3CBJB 3Q13A 5ESQB 4G80A 3GK8H 3DMMB 2RTTA 2NY0B 4R9HA 3NEOA 5I18L 4Z7QB 4IKIA 3VG9C 1H6UA 5K9QG 4X6CE 3TN0D 5DA4A 3SDDD 3VGEA 2EO1A 2ITDB 5BRZA 4D0BB 3X1BA 1QTSA 4EN3B 5K59F 3VGBA 3UFIA 2BLFA 2PYEA 2QV2A 1ZDQA 4HWBL 4URTB 4MQXD 4X7SH 3ARFD 3WFDH 1Q0EA 4JRWA 3BKJL 3WFZA 2CDGB 4PRID 1FG2B 1X5MA 4NWTH 4N6RB 4FJZA 5J4MA 3ZIYA 2FJHB 4DESA 1INDL 4UM9A 3B7TA 1Y1UA 5F1SA 1RP8A 3V79C 2VLRA 5IROC 2DTMH 2CUHA 2VQTA 5FOJA 3IMSA 2CUAA 3GKZA 3E6FA 4MJ6B 5EU6E 3VD3A 4Z7NE 5L4MA 5D7LD 2O72A 3HG1B 4NQED 4UIMB 1JCKA 3NACH 3FBKA 1B2YA 5HHOA 5I19L 2J71A 5GS0L 5DZJA 5J6HB 1GZQB 3DIFA 3SQOL 3ARYA 3HC0B 2VERN 1WAPA 4APQA 1TU2B 3LRSB 4YLCA 2XRAH 1MCNA 2X2IA 2IPTH 4L48A 3RY5A 4U6YB 5DHVH 5K1VA 3S5LG 3L4WA 2VXVL 2HKAA 5I0YA 4UQCA 3WIFA 3P40A 3PNWA 4HQQH 1E9OA 1MCWW 1UACL 3FMGH 1FIGH 2LR4A 4P23B 1LP9A 1T6VN 1LTXA 2WINA 4PJCE 3OAUH 4JZJC 4P2QA 4BFOA 4KJQD 5AYUL 5EC1B 1T7WA 2R56H 1UFUA 4LKCA 1D5BB 1KTDA 2Q7AA 1NCOA 4HJIA 1QLRA 4P3CH 1A5FH 3MRBA 3OG6B 4IOIB 4RISL 4Y1AD 1KBVA 2IDCA 3EOYG 4Q9RL 2KT6A 1KYAA 3OG4B 4ES8A 2X4NA 3BIAX 3MXVL 1R3HA 1EXHA 1W8NA 3QO0A 3O45B 3OLDA 1MVYA 2NY1D 5GGUA 4PGBB 2CRMA 4MZ2A 5F88A 3SE4A 3TTSA 3MROA 4D8PA 4XP4L 2HRPL 5FOBA 3O2WL 5MEOA 1N6UA 2QSQA 2R8SL 1EJFA 2PWEA 2CPUA 3C2SA 3H6JA 1U8OA 3IDXH 2O4EA 3MRNB 4KXAA 4AJWA 3NRPA 5DEFB 1QUNB 2KQNA 4I9WD 4M8QA 4MBRA 5AB2A 2CD0A 2OMWB 4XX5A 5KBPA 2HAZA 3QZWB 2JKIS 5I2IB 3OPUA 3QORC 3ZKMD 1VB9A 4NRYA 5GZOC 2AP2A 2LOEA 1TUPA 2L04A 4HZLB 3C6SB 4ODWA 2PCFA 4H88L 4QHLA 4ISVA 5FX3A 1NEUA 1PZBA 2BVOA 3O3DB 3GSUA 4IRZL 4MKTA 2D4DA 3IJHB 3ZDXE 1PX4A 2BMKB 1G1CA 2DDQL 2NTSP 4UQ3B 1D5BA 4FNLH 1FE8H 3WIHL 2NY2C 4JPQA 4HUWB 3G08B 5EC1A 3FHAA 1RVFH 1OAKL 2J6EA 3HZKB 3SE6A 4AM0B 4GJTB 1OSEA 1ZA3A 1NCAL 4ERSL 1I31A 4KKAC 3KNBA 3WY2A 4B96A 2VNCA 4PI2A 3AWGA 1RJYB 1G7IB 3NSJA 5GRJL 5I74B 5IQ7L 4DO4A 2AEQL 1IBHA 1X4YA 3DHUA 2HX9A 3AMKA 4F92B 5IOPB 1L9MA 3CD4A 3K2UH 3OHXC 1JFHA 1NFAA 3ZE0B 3CN4A 1KGCD 2LT9A 5TF0A 5F0PB 1GL4B 1NAKL 1K8IB 4NP4L 3LVEA 2CBOA 4WHTA 4FG0A 1DQJA 4MQ7A 2OCJA 2Y5TB 1PFCA 3GLDA 2DQCL 4TL4A 5DD3H 2HSIA 2AQ2A 3WEXB 5I1HH 3QRGL 1B6DA 2K70A 4K3DH 2E9JA 4IEFA 3PG2A 4MKMA 4QRBA 4FFWC 1NFDE 3BVVA 3MPCA 4I4WA 3VFGH 4L1HA 4KY1H 2O6FA 3L3DA 2WXRA 2XG4B 1NGPH 1SMDA 5KVFH 3MLUH 2OTPA 3VWJD 3HPJA 3JWNE 4PU2A 1IMHC 5DS8A 4ESKA 2R2HB 4S1RL 4CW1A 2SEBB 2A73B 5AWNL 4Z78B 1LP9F 3MBWA 3LVTA 3QDJD 2WNKA 1IQDA 5B21A 3RYMA 4B5EA 4C4BA 5C0AB 4ZMNA 4ZPVB 2ZUTA 2R7EA 1RULL 5I1GH 1XMEB 3E8UL 3ESNA 3OKMA 3QUXD 4YHIB 5FO7A 3QI9A 5KVDL 3VNYA 2V2TA 3ZTEA 4TRPL 3V9CA 4F3FB 2NZ1A 4M4RB 2E6JA 3V0WH 1DTUA 3S3CB 3L4TA 1YECH 2W0FA 5DWPA 3QPQD 4NBZB 3UTSE 3IDGB 5I30L 2AI0L 3T0EC 5I15L 3BQUD 2XNAB 3STLA 2NUTA 3TEZA 2ATKB 2R2BA 4JFVA 3CXFA 5FYJE 1T4KA 5IQNA 3HEIB 1UD2A 2VXUH 5EBGA 5FA3B 4LT7A 1YQVH 1I8UA 5C0EA 4HPOL 4CJ1A 1KGWA 1TJHL 4R97B 5K9KA 3ZL2A 5J06A 2OSYA 3L4UA 3UTSD 1PGRB 4X2UA 4MMYA 2FX8H 1G7PB 3QR0A 4KFZC 4DP1X 2VLKD 4WUUE 1N26A 1IVTA 4NENB 3BDXA 5DVKA 4KROD 5C7XH 3KR3H 3IJYA 8CGTA 4NHUB 4XGZB 4ZX3A 3A3YB 3LZNA 3SOBL 3VWJA 2MQ0A 3WIIL 3AB0B 4MA8L 1M1XA 2ZWYA 3MRNA 4W9ZA 4MB4A 3EBIA 1HH9A 2ZX6A 5D2NA 1OE1A 2YD2A 4LPTA 1F3DJ 4UBDC 2PPFA 1KTDB 1L9SA 4PJHB 5CP3H 4U7SA 4X5QA 5IMKB 2QQLH 1ZSDB 5IVXB 3KPPA 2NT0A 3H2WA 2IFFH 4L37A 2H2PD 4LESA 1MXDA 3HMXH 1T3FA 3O8XB 2FBRA 1BAFL 1PW3A 2IH3B 2J2ZB 3LXAA 4N2MA 2H3NB 4ODTH 1LEIB 1FAIH 5KOVC 4P5KA 3J7HA 1BGXL 2ZF9A 4MNQB 2XN2A 3A6CH 1MF2H 1VSCA 1RZQA 2WXMA 3NFPA 1VFMA 3M45A 4KRPC 5I1KH 2XWXA 4I87A 5D1ZI 1P4IL 1SOKA 5CF3A 3L95B 5J8OA 1KOAA 3KYKH 1O7DE 1BFOB 3DUSA 3Q6FB 4UT6L 5FYLL 1CTMA 3PU7A 3HNSL 3N06B 5J13B 4ONOA 2AMGA 2QMKA 1A4JB 2VXQA 2DQUH 1M2VA 1C1EH 1UVQA 2X4RA 2XN9A 3TNNA 3IBEA 3BWUF 3E0GA 4JZNB 4OJFL 1MY5A 4X6DB 2UYLB 1IAMA 5TF1H 4AYFA 3VXRA 4Y5YB 4EN3D 3PJSA 1SEQH 1DQVA 1PLAA 2BNQA 3LS4L 3NA9H 5CJOL 4N2OA 4WFFE 3WFHA 1OAQL 2VLRB 3T77A 2HH0H 4PWJA 1JZEA 3POHA 4F7EA 4OLZH 1LO0L 1JV2A 5D55A 3DIFB 2A77L 1ZDSA 4GW5A 4X5LA 3ECWA 4IU2B 4M6OH 1PF3A 3AUVA 3P30L 4JY6A 4P07A 1ET7A 3HIZA 3ZE1E 5JW4Q 2XRAL 4HPYL 3LH2L 5EU6B 4Z7NB 1WFJA 4HIXL 5EU5A 5IZ7A 2D0HA 1CURA 4N0CC 2EEDA 1V7MH 2FJGB 1VDGA 3TWCH 4POZC 3V0VB 4DP9X 4GIOA 5DC0A 4FZEH 4DZ8A 1EJOL 1ZT4B 3QHZH 5EZOH 1AACA 1SDAB 4XMLL 4H40A 4MA7L 2IEPA 4ERSH 4L0PB 2Z6FA 4N6RA 3HS0A 5MEPA 3EF7A 4J3BA 3VD7A 3FCTA 1HXYA 4KHXL 1DUZB 5CXPA 5IB5B 2BVTA 1CLOH 3P4MB 5C07B 1BZ7B 1WFUA 2DM2A 1T2XA 2CIKB 4NNPH 5ACZB 4LLUB 4Q9RH 3P2TA 5FB8B 4PP2A 2KI6A 3VD4A 2WTRB 2FL5A 3CK0H 5KSBF 4NKMA 4NXKA 1NAKH 2E8YA 4NP4H 2VXQH 4JFDE 3TL5A 2AQ1A 1ID5I 3AGWA 2H2SD 4XN7A 2GJ6B 2NT1A 3K81A 4Y1AE 4F1SA 3RVXD 1E6JL 5DJ6A 5DD1H 1TQVA 3T0BA 3TO2A 4UDTA 4EI5B 3AW5A 5C07D 3FHQA 3RJQB 1DDHA 5ADPH 1TJIL 3EJTA 2B08A 3I6LD 4D7BA 4ZDHA 2FR4B 2XN9E 4XOCA 2Y1YA 4PWFA 1AR1D 4UQIM 4L3ED 1GC1L 4P5MA 4PSPA 4Z3TA 3RILA 1U8OB 2G9KA 1YMHA 3ZOAA 3WN5A 1CXHA 2DWDB 2MIZA 1A7BA 3BE1L 4KI1A 3C5ZC 1R75A 2N7BA 4QHKJ 1KPVB 3V6FB 4Y5XC 4FABL 4IKNA 2O6PA 3QR1A 2J44A 1FH5H 4X5XA 2XWTB 2VMFA 3MOAH 4AC2A 5IVXF 4M5SA 2FVNA 4RQQA 5I9QB 5I1DB 4XNXH 5T1JA 4F37F 5FYKL 4FQLL 4NQXB 4EVNB 3MNZB 2GUOB 2Y7MA 3BGFC 4Y5VB 3UC0H 3S48A 3TWYA 3F58H 3MCLH 4HX1B 2AZUA 1EXGA 2HYMA 1DQDH 4YSUA 1UA6L 4U05A 4FYQA 1TXKA 1RZ7H 3SDCD 1VKXA 2D2CC 1CFQB 1MREL 2VSCA 3RL1A 2YGOA 1T0MA 3AT0A 3KEDA 4ZMZA 2PXYC 2YZ8A 3F7LA 1SYVB 4I48A 1B90A 2HPTA 1ECYA 3BSZL 3BUPA 1A64A 3B2UD 1HDMA 4JKPH 5MP6L 1L6PA 1J05A 4HS6A 5EIQA 4ODSL 1KENL 1FWXA 2HFFA 1SVZA 4NN7B 4XH2A 3TZVC 2WSDA 4XMPL 4AENB 4TVPE 3N1GC 2V3FA 3W9EA 5KYXB 1FO0A 3NPZB 5KAQF 5HJBA 5ICUA 1G94A 2GTZA 2P43B 3QPQC 3WHXB 3PAZA 3O4OC 3NUKA 3R06B 3DWTA 3S37H 1J7VR 4XCCL 4JLRB 5IW1B 2B59B 1Z6JT 3EDKA 4L8BB 1DVFB 3OF6D 4K7PL 4NI3A 4JVWA 4Y9BA 3O11A 2WXFA 3H42L 4M6AA 4FS0A 2Y1AA 2HLFD 3FQNB 4XVUC 3JV6A 5ICYA 5K59E 1AZZC 1KTLA 1ZT7B 5IMOB 5D1QE 4BQ6A 5AVRB 2ZSVA 1NIDA 4GQRA 2GTZB 3WHXA 2FUTA 4PY7B 4NBXB 4GRMA 4MCZA 4ZFZA 1AQMA 3P2BA 1UB6A 4KU1A 2QVKA 5SWZE 1AS8A 2WJ7A 4N5UA 3MGTB 1F86A 2BNRB 1KY6A 1LO0H 3BPOB 4QRQA 5C0RH 4ZYKB 4Y19E 5H4ZA 3CV5A 2H0EA 2NZ9C 4PV9A 3KYOA 1YPZB 4QWWC 3EUUA 1RFDH 3LN5B 4RFOH 4R8WL 2B5IC 2WUCL 4XMWA 3VFOA 2DI9A 4U6VH 4K71B 4NYLA 4M62H 3ABGA 1VFAA 4H8WH 4IRSA 3DX4A 3QS3A 2AMUA 3TM6A 1RMFH 4AX3A 4CVZB 1EGJL 1MH5A 1UJ3C 25C8L 3TXAA 3ZMEA 4XPHL 3QJTB 3V0JA 1GMEA 3GJEB 2IDQA 2YXMA 4KKAD 3UYPB 2OSWA 2YMXH 3FO2A 3T6VA 1S5HB 1XMWA 4JFXA 4OM0H 4PJHA 4GRWH 1MJJB 2KDYA 3KH4A 4RAUB 2YD4A 3NA4A 4HMCA 5D2NB 1Z2KA 3MRKB 4L9LB 4U7KA 5FGCE 1JNLH 2LU4A 1YMHB 5G4OA 4HCRL 3QT2A 2ED6A 1AZCA 2ICWA 2WQRA 3GSRA 3C2AH 4J23A 3FSOA 4J3OC 3X11B 1KZYA 1HHGB 3MRGB 5KANG 3X14A 2JCCE 1I1YA 1PMYA 2CXKA 3D6GA 4Z77A 1K4CA 1U8HB 2FWUA 3QZBA 2AJSH 4HA1A 3RDTB 2XKUA 2R1WA 1F3RB 2WBKA 1A6AB 3PWNA 5LWYH 3WJMB 3GXTA 3G6JB 3VXUE 5CN3A 2EVIA 1BM3L 2XXFA 3OSKA 5AG9A 5SX5K 1J5HA 2XFGB 3MX0A 3TLRA 5MEQB 1SNRA 5LDUA 4XNQB 1MCLA 4OZHB 2NRDA 3AAZA 2CALA 1E9PA 4DP7X 4U1GB 2A77H 2YUZA 2NMSA 2WBJD 3NSXA 5C2UB 1MFAH 5BO1H 4L4TE 1KB9K 1OQOA 4Y1AA 4CVZA 4GQ9H 4I3RH 2E6PA 3KS0J 2EVFA 1CPUA 3N0AA 3F5WA 2KBGA 5JO5A 1BQLL 2JB5L 3MNWB 3G5YB 3HC2A 4ZFOL 4U6XB 5IM7A 1BP3B 5I6XB 1T0PB 1X4ZA 2WVVB 4Z78A 2M26A 5D1ZB 4ZOAA 4LK4A 3B3BA 2QTVA 5HGDB 2WSPA 4JPVH 1A4CA 4JAMA 3L2LA 1IGCL 3N40P 4FQHA 3FQ1A 1KIUB 4ZPTB 5DRZB 4N2FA 1FV1A 2E46A 2F19L 4WSJA 3SGDI 4CGUB 3IMUA 3RAJH 2FEEL 1C5BL 5AAPA 3MUGB 4JQVA 2UVEA 4JLRA 4AK1A 3N1FC 3CU1A 5ICYB 1RL1A 4EAEA 4WWID 4G6JH 4QUOA 3QQ9C 3F8UB 4R4NC 3SHSA 1NGQH 1WP6A 3UJTL 4A7TA 3QIUD 5IBTL 5F6HJ 3NZUA 1KN2H 3L1OL 1TZAA 3V55A 5MERB 1QFHA 4CMMB 5JLZB 3S35L 2JKLA 2WLLA 4F33A 3U0WH 4OGXL 4P06A 5I6PA 3MLZH 1R1CA 5J1AB 4WZ9A 3R18A 1U92A 3ABMB 2KERA 3EFFA 1ZLUK 3EDDA 4HGWA 2VE6A 3K91A 1DUYA 2ERJC 5A16B 4MNQD 5GGTL 1BA9A 1A4JA 4TN9A 1AAJA 2A74B 2APWA 1CL7L 4JVPA 4OAWB 3ABKB 3LN4A 2VH5L 4LSTL 4MQXC 3WHE0 2BOBB 1U8IA 1XCWA 1EHLH 3O6FB 1B2WL 1JJUA 4XPAL 4HG4K 4WGVB 4N2HA 5EF0A 2IWKA 4E41E 2XIDA 3GDCA 3IF1A 4X5WB 3RFZA 1HYSD 1X5ZA 2H47C 4XBMA 4PW3A 2WZPA 3KPTA 1N8ZB 2Y36L 1FFRA 3F58L 3MKKA 3QH3A 5FW7A 3ZQXA 1CQKA 3KYMB 3T4YA 3C87A 3ROLA 1O75A 1AD0A 3KPOA 1MUJA 3SGKA 2JKWA 3I9GH 3NG5A 3IXAB 1NGWA 5GHWH 2J21A 4AQZA 3VJ6B 2PCPB 1D5ZA 5DWUL 4Z0BL 3F84A 4PJIA 1NLBL 2AEWA 2OZNA 4L0ZA 3U4AA 1QBLL 4ABQA 1EJ8A 4ZTOL 2QQKL 1I85A 1KNOA 1HL5A 1XGYH 3W9DB 3MRMB 4KJWD 3HMXA 4EIGB 4LQFH 5C08A 3TNMA 1PIFA 4BSVB 1N68A 1PZ2A 1DLHB 4KDTC 3DUUA 4MD0A 1CD0A 4HMDA 4RMSA 4FHBD 4A67A 4GKNA 3U4KA 3STLB 1EO5A 3KYMA 2V7NB 3PL6B 5J89A 4JJ5A 3GHBH 1E4XL 3QFGA 3APDA 4PB9H 3JQOB 4X83A 4ALAH 3SKNB 4BA8A 3I3EA 4U1JB 3GMPA 1N70A 4N8UA 2GABA 3NSFA 2JB6B 3MUJA 3V5KA 2BO0A 3BOVA 3HKFA 2OJEB 3DX8B 1KCVH 2BOBA 4G6KL 4W4OC 1AH1A 1I7RB 3PWUA 3CH1A 5BUPA 3ZL4H 3BZFB 3LXBA 4EUPA 1ZK5A 4LSVH 4NB7A 5B3JE 4WEEA 2FIKA 4L8SB 2ZYRA 4GSRA 4PJFE 5C0FA 2IDUA 3RWIB 7TAAA 5I74C 2G3ZA 4IS6A 1NTDA 5HD8C 5IB2B 4CMHC 2X70A 2YD3A 3CX2A 3D25B 3FCSB 4G9FB 2JSFA 2OYLA 4H8HA 1ASQA 1OGAE 3WAKA 1Z5LA 4LB8A 3UABA 4PP2B 3T1WA 1MFMA 4KKCC 1V3LA 1MRCL 1FGVL 2UY7A 1ULVA 4BZYA 3FXIC 3GUTA 1NDMA 3RPIB 2FT8A 3CLEH 1A0QH 4AQ1C 3L4ZA 2K6YA 1F4XH 4JFEB 1QKZH 4N2GA 4HCGA 1MDTA 2KPNA 4Z3HA 1YYML 2CIIA 4KTDL 5FO2A 3DTUB 1Z7JA 3EJQA 3IE9A 4CSSA 3CZJA 4ZODA 1G9EA 2QPDB 1FYTE 3IPBA 1ECZA 2FO8A 5C0GB 3JWDH 3PJLA 4K5PA 1FNFA 3HMWH 2GIYA 5IB4A 4DP0X 2K78A 3BT2H 1BSIA 2E7HA 1HAWA 1U4EA 2H0PA 2NY7L 4PJAE 4X6DF 2J57A 4OZFG 1JD9A 4JPVL 1JBJA 1SRDA 4B9IA 3WFEL 1WCBA 2DQIH 3NABL 2X70B 4WGWB 5T33H 3AU1B 2BJML 4HAKA 1OP3K 1WD8A 2GJPA 4KDWA 1MCWM 4NQSB 4XRCB 5DEGB 1YEDA 4OGAD 1I3RB 3EYSL 4L8CA 2HX7A 3ALXA 4LEXL 3RY6C 5CCKL 3VD2A 3CFEA 2WBJC 2PF6A 4DP5X 1SY6H 4YIQB 2R1XA 5GJSL 1XF2B 3QDGB 1EHXA 4YQXL 1KBBA 1BXAA 3EGDA 3RWCB 2AF2A 2WKOF 4JO2H 3FQWB 3NJVA 1A14H 1QRNE 4HD5A 1RIUH 1LO3L 7CGTA 3L1OH 5KVGE 4QXUH 4PMEA 5LWYL 2VN4A