2XV2A

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caahaam), chemically reduced, ph4.2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
124
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKGEQYMFFCAAHAAMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Metal-Binding Loop Length is a Determinant of the Pka of a Histidine Ligand at a Type 1 Copper Site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 28
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xv2A00
1KBVA 2WO3B 1XB3A 4DP0X 3PAZA 4JHVA 4L0PB 1ILUA 2GBAA 1WA0X 2J57A 4RH4A 1QNIA 5AFAA 2YXVA 1NINA 2BO0A 1SDDA 1CC3A 1MG2C 5AZUA 1KBWA 3TA4D 2N0MA 4HHGA 1GR7A 2XX1A 1X9RA 3BVDB 1AG0A 3FQ2A 2NRDA 2PP9A 2I7SA 4KO7A 3HEIB 1ASQA 1AANA 2FTAA 3JT2A 2Q9OA 5AKRA 3TASA 3PLYA 1AZUA 4PAZA 2BP8B 3FU7B 3ABGA 1KDIA 3QPKA 3PCYA 2BWDA 1JZEA 2DWSA 3ASNB 4M3HA 4JKNA 2WO2B 1ID2A 2ZOOA 4G7QB 1OCOB 4DP6X 2BW4A 2VN3A 1HFUA 4DP1X 1KGYE 4BDVB 4E9QA 1ZDQA 1PLAA 2XV3A 1ETJA 2PCFA 2QDVA 1A8ZA 3HB3B 3WNIA 1SHXA 2I7OA 4G7RB 3IEAA 3MX0B 3ZX1A 1AR1B 9PCYA 1V54B 4KNSA 2IDUA 4A68A 3NSCA 2FJSA 2VSMB 2EILB 3EF4A 2IWKA 1AS7A 3QJTB 1BXUA 4UF7C 3V9CA 4DP8X 1BXVA 2PPDA 3QQXA 4GYBA 1UATA 5B7EA 1XB8A 2EIKB 1L9SA 2DY2A 3NJNA 1E67A 1OV8A 3X1NA 1YLBB 2AVFA 1J5CA 3JTBA 1J9QA 2CBPA 3T9WA 1CURA 1GS6X 4HCFA 1PAZA 4NB7A 4E9SA 2VM3A 3ZDWA 4TXVB 2R7EB 3OD3A 1ILSA 4A2FA 1BYPA 2FQDA 5I6KA 1HAUA 3FPXA 5B1BB 3CG8A 3FYEB 4G71B 1NPJA 3H56A 1OE3A 1N70A 2FQGA 1XB6A 3IN2A 1AQ8A 3GDCA 4F7KA 1OCZB 4BWUA 1SHWA 1W8EA 4BXSV 2PP8A 3D12B 2XV2A 2UXTA 6PCYA 1NIBA 1GW0A 1PY0A 1SDDB 2FQEA 3CDZA 2QT6A 3DTUB 2HXAA 1BAWA 3AY2A 3TBCA 3NP3A 4KO9A 3PXLA 3ASOB 1PCSA 1EZLA 3UACA 4MFHA 1AOZA 5EHFA 1KCBA 3FU9A 1L9RA 1FFTB 5B7FA 3FYIB 1IC0A 4DP9X 1OOWA 3FU8A 1AS6A 3N2JA 4NAJA 3TBBA 4UANA 4YSEA 4BK5C 2HX7A 2ZXWB 2YAHA 5D4IA 1TKWA 4KNUA 3SBQA 1PZCA 1BQ5A 1M56B 3QJVB 1JOIA 3TU6A 2H47C 1JZFA 2PP7A 2GIMA 3EH3B 4N4YB 2J5WA 4KO5A 3NSDA 2P80A 5TK4A 5A7EA 1CUOA 3U25A 1A3ZA 1V55B 4DP4X 3UADA 1DYZA 1JZIA 1BQRA 2JKWA 3OMAB 4YSRA 1SNRA 2Q5BA 4QKTA 3QJQB 3T6WA 1ADWA 1ET7A 1MDAA 2P80D 4KO6A 4YSPA 5TK2A 4HCGA 4HZ1A 1BQKA 1JZGA 4HIPA 2XX0A 2XXFA 5ANHA 2YAQA 1BYOA 4F2FA 3NJLA 2VW7A 3CVDA 1J5DA 2OJ1A 2Y1AA 2UXGA 2BHFA 3ABLB 2DV6A 4HALA 2CUAA 3C75A 4ENZA 1PF3A 2PLTA 3OMIB 4YSQA 3FQYA 1SFDA 1NWOA 5PCYA 3NJFA 2PPEA 3CVCA 2A3TA 1IKOP 1F56A 3S3BB 4HAKA 3X1FA 3CDZB 2JXMA 1L9QA 3UAAA 2AZUA 2CJ3A 5FC9A 3DKHA 4E9TA 2GB2A 4A67A 2OCCB 2FNWA 2DYSB 3NT0A 3S8GB 3PAUA 2IDQA 4GP8B 1OCRB 3SBRA 4GP4B 1ZDSA 1QHQA 1WA2X 3FQ1A 1GS7A 5PAZA 2YQBA 5I28A 2XWZA 1W6WA 4PCYA 3WG7B 4K9JA 4E9WA 2CCWA 1AIZA 2XU9A 2JFCA 3NJHA 3SQRA 1L9OA 1E30A 3RYMA 1PNDA 3WI9A 3CZUB 3WKQA 3X2QB 3ERXA 4P5SA 7PAZA 3T71A 4YSSA 4ZK8A 3AZUA 1AS8A 2VSKB 3T6ZA 4W1TA 4AI7A 4G72B 3FSVA 2UXVA 4KOCA 1TEGA 1L9TA 1AZRA 2HZHA 2IH9A 3T6XA 3H4HA 3S8FB 3KW8A 3QJRB 3GXUB 1N68A 4GP5B 4YVUA 1AACA 4N8UA 2MRYA 1SF5A 4KNTA 2XYBA 3NYKA 2YARA 1DZ0A 2MTAA 1BXAA 1RZQA 2FQFA 3EH4B 2AZAA 2EIJB 2TSBA 2GI0A 1JERA 2DWTA 2BP0A 1E65A 4G70B 4Q8BA 3KW7A 2UXFA 1VLXA 3IBOA 2XVBA 4DPBX 2IDFA 3ZIYA 4A66A 3T6VA 2GC4C 4GXFA 1AG6A 1FWXA 5LDUA 4DP7X 3NJGA 4AKPA 5B1KA 4AKOA 1R1CA 2WSDA 2IDSA 3NJKA 5IY5B 3OM3B 3QJSB 2HX8A 5I5MA 1W6LA 3AG1B 4DP2X 5B1JA 3CVBA 1QLEB 2EINB 1OF0A 1NIDA 5I6LA 3AG2B 2CAKA 2J56A 1WS7A 5B7MA 4A2DA 5B1JC 2PPAA 3DIVA 3ABKB 1AZNA 3NP4A 4P5RA 2DYRB 4YSTA 2I85A 1FA4A 3FS9A 1B3IA 4E9RA 4M4RB 2XXGA 4NERA 3ZBMA 1I53A 1KDJA 2HRHA 2E86A 2IDTA 1GY2A 2HX9A 4UAHA 2YAPA 4DPCX 4BXVA 4YSAA 1PZAA 1NIFA 1AAJA 2BW5A 2YAOA 2ZWNA 2PPCA 4YSCA 3NSFA 1ET8A 2GHZA 2OV0A 2RACA 1T5KA 1KYAA 1KCWA 3X1BA 4AX3A 3X1EA 1ET5A 4DPAX 1NZRA 2VW6A 4JHUA 5D4HA 2ZONA 2FT8A 2GSMB 1GY1A 3GYRA 4E9XA 4HCIA 2YAFA 2W8CA 1WS8A 2BP0B 8PAZA 1MG3C 2EIMB 2YAEA 3BQVA 5F7BA 3WIAA 1ASOA 3G5WA 4FA7B 5D4JA 2AFNA 4E9YA 3OMNB 2IWFA 4F2EA 3X1GA 1V10A 2J55A 3UGEA 3IN0A 4X4KA 3AG3B 3WNJA 1IBYA 1E5ZA 2B3IA 1J9SA 1KV7A 3ABMB 1CYXA 4FAAB 4YSOA 1M57B 1AZBA 3V9EA 2CALA 1PLCA 2W88A 2TSAA 2HRGA 1BEXA 3EH5B 3L45A 1IBZA 2IAAC 3AW5A 2BWIA 5I5JA 4AZUA 4CSPA 1NTDA 2VM4A 1GS8A 1ASPA 4YSDA 2XV0A 1PNCA 2XUWA 4HHWA 3FT0A 4WKXA 2YXWA 1L9PA 1JVOA 4BWTA 1J9TA 1PLBA 5I26A 2QPEB 1SFHA 1SJMA 1A4CA 3H4FA 2FT6A 4KOBA 2VW4A 3EHBB 3FPYA 3QJUB 5I6OA 1NDTA 4YVNA 2X88A 3NSYA 4QLWA 1JVLA 1ZIAA 2H5UA 1JZHA 4BWWA 1OE1A 3OQRA 1JXGA 1GYCA 3S3DB 1NICA 5I6PA 1WAEA 2PPFA 2UX7A 5B3SB 4E9VA 1HAWA 5E9NA 1X9UA 1PMYA 1WA1X 3UAEA 2QPDB 5I6MA 2HLEB 2BP8A 3FU7A 1MZZA 3FSZA 1JXDA 3SBPA 2B08A 1M9WA 3NJIA 1JZJA 7PCYA 3NJMA 4Q89A 3N55A 2YAMA 2UX6A 4CSZA 4GY4A 1SF3A 4BDVA 1EHKB 2PCYA 2BZCA 1JXFA 4YSUA 2LLNA 1E5YA 1IUZA 1GSKA 1ZPUA 1MZYA 1A65A 2X87A 2GC7C 3MBWB 6PAZA 5I5IA 4AKQA 1ZIBA 1NPNA 4A2EA 1J9RA 2FWLB 1NWPA 5B1AB 2IH8A 1ZV2A 1AZCA 2FT7A 5F7AA 1URIA 1TU2A 4YL4A 1NIEA 4EF3A 3FSWA 1CYWA 1NIAA 1A4BA 1OE2A 2VMJA 1TEFA 2BZ7A 3AG4B 1RCYA 5I6NA 1A4AA 4WTQA 2XLLA 4G7SB 4DP5X 1RZPA 4A2HA 1PZBA 2H3XC 3PAVA 2AANA 3IE9A 3UABA 2QDWA 1OCCB 2R7EA 3PPSA 4A2GA 3NJJA 3WKPA 2Y69B 3S3CB 3FSAA 2IWEA 1RKRA 4W9ZA 1XMEB
chains in the Genus database with same CATH superfamily
3OKNB 3KYNA 3LH2L 1J87A 3X3GL 4QY8B 3HZKB 3RKDC 4H40A 3KCPA 3X3FH 4GSQA 4PR5A 4D9LL 3BOVA 2OLDA 3MLYL 1N5YL 2XQYG 3F83A 5A6MA 3EBIA 1HNGA 5D7LD 4EI5B 2ZG2A 1H3UA 3NCCB 3JBG7 2GVYA 1EJOL 4JDEA 4PFEA 3BVDB 3GDBA 2HVKA 3O3BB 2A9CA 1JXKA 3V6OA 3GUFA 4Z5RA 4NQDA 2BNRA 2AEOA 4PRDA 3NIDB 4KZDH 4UAOB 3KGUA 3PLYA 1LO4H 5IV2B 1UXWA 1GGIH 3GMMB 2ZXQA 1Q0EA 3CFNA 3HHSB 4M29A 1IFHL 1H6FA 1XGYH 4FHJA 2HJLA 2WM0A 1G9NH 4HS6A 3FT1A 2E8YA 5FWQA 3UG4A 2FO1A 2C3VB 2C1OB 2HJFA 4G9FD 4L5FH 4LLVB 5HJ3B 3VO0A 3MX0B 9PCYA 3C8KB 1AXTL 4OY9A 5D72H 5JW5A 5AEAA 4AT6B 5J1SC 2OYMA 3QO0B 1USQA 5LXVA 2O5YH 4YE0A 1MIML 3O45B 3CK0H 4MD4B 3K81A 1TU2B 1UM4H 2AVFA 3F6IA 4YK4C 2ZG3A 3MLVL 1RZGA 4ZW5A 3T9WA 4LDOB 4XC3H 3V55A 2WJ5A 4OB5L 3DMMB 2EO9A 2Y36H 3JV4A 5DQDH 5FKAB 4P2OA 1TT6A 3QQDA 4N2HA 4XVSL 4M8QA 4MAYD 5DT1H 2OMUB 3VXPB 4EVNA 1INQB 4NQSB 43C9A 4HJSA 4L48A 3WUZA 3QYCA 4MVBD 4HIEB 1U3ZA 2CPCA 1XD0A 5I6KA 1HHJA 1KGJA 1RSYA 2EP6A 1B4RA 1S78C 3P77A 4BFEA 4GSDH 3PS6A 4X7FC 1C8QA 3TM6A 4H1LG 2EDKA 2CLZA 3EO1B 4QF1B 4MDIA 2XVGA 3DJRA 3EYFA 4TOYL 4A2LA 1DTUA 35C8H 2ZIDA 2WLIB 1MXGA 1E5BA 3KL0A 1T0NB 1QEWA 4LARL 4W9HC 4JY4B 4X6BB 3RIAF 3APNA 3W5NA 3MRFA 1EZLA 3GJFH 3V0VB 4QCIB 1FP5A 4HWBA 3LZOA 4M1DH 4N2DA 2EDBA 3AQXA 4YHYB 3OAUH 5JORB 5DJ6B 3WLBA 3B7UX 5FYJL 3KDMA 4HWBL 2EVFA 5GGRB 3KPSD 4PV9B 4XCEB 1A7RH 1AS6A 3FQUB 3J07A 2HLAB 2XTJE 2BSRB 2ZXWB 4I88A 4AE0A 1D6EB 3CSTA 3FCGA 3MNDA 4JPVL 3IDIB 3ZKNC 4FG6D 1XL6A 2GI7A 1XCQA 3OKYA 3U0WL 4MNHA 5E7BA 2RFXA 3VDAA 1IM9A 2EADA 3HMXL 4O9HL 3NFNB 2FD6H 1I3VA 2AW2A 4QHNA 4R0LA 1HZHH 2CH8A 1CR9L 3OMAB 4OCYH 1DSFH 4TKWA 3IDGB 4XO3A 3ZT6A 1AQHA 1IKFH 2WQAA 1BQLL 1OY3B 3DX7A 3PIQB 2CGRL 5F97E 4OCXH 4OM0L 3ZYIA 1FJ1B 5FHAL 3K0WA 3QCVL 1ZT7B 4Y5XA 3BAYA 4YX2L 4J3WA 2OP4H 3PP4H 5JHLA 2WBWB 2DWYA 5DJ0B 3SQOL 1BFOA 3MFGB 1BYOA 2O6EA 3BIKB 3HE6A 3QXAB 4WV1C 1QUNB 1RUPL 1UJTA 2R0LH 1H5BA 3PREA 1F4AA 5LQBH 1II4E 4X9HA 2H9GB 2EYSB 1OGAA 4JRXE 1HKLL 4HIIB 3RDTA 2MKLC 4JM2A 1XH1A 4YIQB 5IW1A 4XP4H 4CJ0A 1YN6B 2Y6SC 3QZOA 1NFIA 5IJCC 1E8YA 1EO7A 2NYYD 3KPMB 3JWDC 5CEYB 5IB2B 5I1CH 1UKSA 3K2KA 5DMKB 1JNLH 2UY6A 1MJ8H 1EMTH 5EBLB 5KVGL 4ABUA 1QVOB 4MLSA 3JZ7A 4HWEL 5DD6B 1RUAL 5HHOB 3D4ZA 3ZHDA 5FA3A 3STZA 1T7ZA 1I85C 5EEWA 5FGCE 1F00I 4UM9A 1FH2A 5CCJA 5F8RC 3LPGA 3QUYC 4HCRL 4IIQC 1IGFH 5SWSD 4JZNB 4I8DA 4Q9RL 3B7TA 4NO0B 3ZL1A 2GFBA 3MJ9A 3QDMB 3WG7B 2VE6B 1G7PA 1F4HA 1WD9A 3H2WA 1NC4D 5GRZA 5E1AA 3GSRA 4HK3J 4L3CA 5DWUL 5GIRB 4HAFA 4JGNA 4EPSA 3WI9A 3P9MA 4Y4FB 1A6PA 3Q13A 4CVZB 5I1LB 2V2TA 4L8SB 1FSKC 1NQBA 4GRMA 5IUCA 3UZEC 3AY4C 2GJJA 2VLLB 3SDCC 2X70B 3KM2A 2V9TA 2EDEA 2Y2TA 4A37A 1UWFA 3II1A 3ULSB 4OFIA 3GMQB 3KW8A 2CGZA 1RZIB 1SJXA 3RWEB 2XQYK 3VWJB 5EIIA 2KL6A 4N8UA 3ZK0A 2MRYA 4A6YL 1NM4A 4M7JL 5JO5B 4XMLH 3DV6A 4PJ5B 4QRAA 1QW8A 4Y9CA 5GGQH 2K9UA 3WN6A 2ICEB 4U3CA 2WZPA 3PJLA 2XTJB 4N5EC 5C08D 2YBGA 3Q8CA 3N40P 2BOCB 3CIAA 1RZFL 1VLXA 3IBOA 4GUPB 1MVYA 5C9KA 5J06A 5M95B 4M6OH 4FRWA 4PJXA 2HTKD 3A67H 3IMSA 2J88L 2Q8AL 4IU3B 1U8JA 2LU7A 3CFUA 4MXWH 1ZTXE 2EIBA 3GBLA 2DDQH 4ZFGL 1MCJA 1PU0A 3Q0HA 3OM3B 3ETBJ 4DTGL 4XX1E 5KUKA 1F8TL 5CGTA 1JMZA 2XWXA 4LSTH 3BH9A 5ETUA 3HG5A 1VAHA 3QUML 4I48B 1MIEL 3UAFA 1E6JH 1M05B 3CLFL 3HR5B 4PJDF 1L0YA 4QRQB 5AAMA 2WZ5A 3RJQB 1XTLA 2IV9A 1DR9A 25C8H 4JRYD 3ZT5A 3PP3H 4MNQA 4R7LA 4WNJA 4DKEL 2Z92A 2LTQC 4KVCL 1HU8A 4JRXB 5I6XB 4YHPA 1BFSA 3MREA 3DRTA 3QP3A 2WXKA 1QI5A 3TESA 1GY2A 5HYEA 1BHGA 1AYOA 1TQTA 4JDZB 3L5XH 4ZUVA 4OUUB 3SE6A 2H6PA 4N2LA 4KUCD 3WU1A 3LTVA 1FL5A 1OLLA 5I30H 2IEPA 4L05A 2B39A 1NIFA 3QRGL 4UBDC 3ULVE 1JGDA 3IJYA 3ZYZA 1IE4A 1QUPA 32C2A 2YKLH 2G5BB 2PYEE 4ATWA 4YNYB 1E9QA 5EPMA 2XZCL 1KN4L 1T83A 4GBXA 4HETA 4XTRC 1H8LA 2ZUWA 5D55A 4C4KT 1M7XA 1O7DC 2E7LC 4NBYB 2FBRA 3RWGA 2R39A 4GSRA 2DWXA 1N59A 3RVTD 4FC3E 4QYOB 3LKQB 3K71B 2B5IC 4KTEL 1LYQA 2PTUA 4Y4KA 4XBPA 1UENA 1QLRA 3GYRA 2VXQH 3MJ8A 2BZDA 1NAMB 2DMBA 2ORBL 4A2MA 4DVBA 1ITCA 4X9GA 2YAEA 3AQDA 4PJBF 5L88L 1KTDA 4NPYA 3RURA 4OLUL 4MLIA 2BCKB 5ESAB 1RZ8B 3BISA 3WO3B 3LZLA 2QLYA 5FW6A 4MNGA 1NMCB 3L81A 1CGWA 1YYMH 1U58A 1EXHA 4PP2A 3QSKB 5C0FB 3UFIA 4GIOA 1E43A 5C0GB 1TZ8A 5INDB 1TITA 1FHGA 2DBJA 4NSKA 4F8NA 1XF2A 3BXNB 3VNYA 2AI0H 2YUWA 1P6WA 1Q94B 5MENB 1JZ3A 2ARJA 2BWIA 3KXFE 3CE1A 3MRRB 3S48A 4BE5A 3LAFA 4WWOA 4OM1H 4ZX6A 2A6IA 3KPRD 5FECB 4HXBH 3GO1H 2JJTC 3WMQA 4CNIB 3RWDB 4NZUH 1IT9L 5GRYA 3LKRA 3T0ED 3HPJB 3LH2H 3BPOC 1AGEB 3PXJA 4UIKL 4K8RL 1MNUL 5IQ9A 4WTXA 3VQ2C 3X3GH 3BGFB 1A4CA 3QIBC 4R7VA 1IV8A 4WUUE 4L4VA 4PJ9A 1EGJA 3W39A 3EJYC 4PHXA 4D9LH 1KYOK 3MI6A 3QJUB 1XZ0B 3F65A 1CFNA 2IDCA 2JV6A 2X88A 3MLYH 1FFNA 4L0ZA 3RVVD 3VXQB 1TSRA 4M7KL 1ZS2A 4N8PA 5DJAB 2DW5A 4JO5A 4Y9GA 5C0CA 1EJOH 3PXHA 4XN9A 2BIMA 3PL6C 4WWKA 5HYQB 2CRIA 4JFDE 5IVZB 5JYMA 2C4FU 5HHME 3BPCB 4HJGA 1OT4A 3UTTB 1WAAA 4G8GE 1R24B 2GQHA 4GS7C 3MRMA 2E9BA 5DI8B 1SJHA 3DSFL 3FAXA 2COVD 3R0MA 3BT0A 4LLDB 4PTTB 2B08A 2EEBA 4TPRL 3JWNE 4XOCA 1IFHH 5T1LB 3IF1B 2BVQA 3FO9A 2OZNA 4G8IA 4BCYA 3V5KB 4BKLA 3RWIB 5G5DA 3HN3A 3MRCB 1AXTH 1HXMB 2KHAA 2VSCA 3MBWB 4M48L 5ICZA 2GUOB 3PNWB 2FDBP 3FQWA 2FWLB 1IFGA 3BW9A 4HKBB 4PTUA 4BCZA 5I73B 3ABZA 2EUWA 3EYQC 3GXNA 4HLZG 3IJEB 4UDUA 2DTSA 5CSZB 3NJXA 4X9FA 5CEXB 3MLVH 3VTAA 4I0PA 1P0SE 2IGFH 4HMCA 4PRHE 1NIAA 4S0SD 1SEBA 4OB5H 2DQUL 4X0KA 1D7DA 2PYEB 4XVSH 1OALA 1UZGA 3MUGA 4OLVL 4A2HA 1NKOA 2CRMA 4AQ8C 3PAVA 5D7KE 3ASWA 4Z7WB 5LGJB 3CMGA 4JLRB 4LOEA 4MWFB 3WKPA 2Y69B 1G7LB 1RKRA 2JCCA 3WYRA 2ENPA 4G59C 3TNMB 1HL4A 4WO0A 2WLKA 3IDXL 1LO5B 2BRRL 2JK5B 3WS6C 4JFPB 4GUQA 4KJWD 4UV4L 2VUKA 5HD8C 4RH4A 2YXVA 1JK8A 4JKWA 3ULUE 1BVKB 5FUOL 5EBWA 5HHOA 1XH3A 2HN7B 3AACA 3D48R 4LARH 4KTGA 3VXMB 5DZVA 4YE4L 5KYXA 2E5EA 3GWJA 2D3LA 5A7BA 2WKOF 3GHEH 1X9RA 2PCPB 1G7MA 4D0BA 4AYMC 2ITCB 4XP5H 4K7FB 5FYJH 3HEIB 4OJDH 5F7FA 2G3XA 3GRWA 1AO7A 3T08A 1A1NB 4JVWA 3KYMA 4HT1L 2HRLA 3H9SA 3FU7B 1OP4A 2MNUA 5FO7A 4G1MB 1VFBA 1W72L 4ELKA 2X5PA 4FNSA 4NO2A 4JPVH 4HIQA 4MDJB 3GPEA 2AVGA 4UZGA 2BW4A 4UQAA 3QFJE 4X83A 3HMXH 4O9HH 1X4XA 3FT3B 3QA3A 2QDVA 2GJ6D 2BVPB 1MAJA 1CR9H 3L2LA 1V54B 4N2FA 5DZOA 4WUUB 3PABB 1BQLH 2CGRH 3EF4A 2Y1ZA 5FHAH 2WY3B 3MA7B 3Q2VA 3QCVH 2FWOB 2IBGA 2ICCA 5CJOH 4B9JA 5IHUL 4LLWA 3L4ZA 1XF3A 4GYBA 1INDL 3KPQB 4KC3B 4RMWA 3ZZSA 5DZJA 3SQOH 4UZUA 4ZQTA 4J3OD 1BF8A 1BVNP 1K4CA 1I8IA 1RUPH 4MAYC 1CVRA 4PS4H 3HS9A 4JFDB 1R6VA 4MSWA 3MBXL 4MVBC 1HXYB 3HVDA 3Q9PA 4G8GB 1HKLH 4B9KC 1O0VA 4PG9B 5CNHA 1OLZA 4WUKL 4MJHA 1KB5B 2R2EB 3GKWL 3CQPA 3R4DA 4Z9KB 1NPJA 2GSIB 3U0PB 2WLJA 4ONFL 2CWRA 1ESOA 5FPIA 1U8IA 4F80A 4PLOB 3CN1A 5KVGH 4HWEH 3CV5A 1FGNH 3PFUA 2ZCHL 3X12B 2XA8L 4DOHE 5ABZA 5J6HA 3K6NA 2CDFA 2DBLL 3FB5A 1TPXC 5D6DC 2ZF8A 3IJSB 3WSQL 3MRIB 2VUYA 3W9EA 4YQXH 3TBYB 4GB9A 2BY1A 4P3DA 4HCRH 3N43F 2OXHA 2ZUUA 1E8WA 4YC2B 1NCGA 2MJWA 3PWNB 4B9GA 4Q9RH 1TQCB 5E4AA 4IRJD 4J3OG 4ACPA 2EH7L 4URKA 1B9ZA 4P57B 1Y18A 3KPLA 1VPOH 4TQEL 4M7LL 4HZLB 4HZAA 5DWUH 3HI5L 3BWAA 2OZ4L 2P80A 3FSOA 3NSDA 3V9FA 5I66A 1VEOA 3KGRA 4OBRA 4BELD 4C56D 1JYXA 3WFEL 1D5XB 4AGNA 5AVZB 3PQYE 1E9OB 2PR4H 5C0NC 2XWBA 3TF7C 1T0MA 3MGOA 4KKPA 1ADWA 2CO3A 4RA3A 4YSPA 3TCTA 1S5IL 3VFVA 1FORH 3HZMA 3BJ91 4FQQB 1YG9A 4WV1A 4Z7UB 3L7EB 4FD0A 2QJDA 2D7OA 4BH7B 1G7QB 2ZXDA 2FIKB 3DSNB 4F7PB 2EKJA 5F88A 3U46A 4A6YH 4M7JH 3WL9B 4F7MA 2L0DA 3VCLA 3SCMD 3O8XA 4L0YA 3IXTA 3C5JA 1DN0B 3F7RA 3ALWA 2ADYA 1PW3A 2F8XC 3REWA 2WLZA 4OKVB 1HE7A 1RZFH 2JKRM 3TEWA 3FQYA 3JT0A 1MY5A 2EZ0D 2FWUA 4HEMA 5F0JB 3JWDL 3WHE1 4LFHG 4JFHE 3CMOL 2P1YA 3OHXB 1G7IB 1XR8B 2J88H 4FQHA 1NKGA 3L3OB 2WIMA 3FO1A 3RTQB 3B3IB 5JHBA 2CHNA 4L2LA 1F56A 1MI5A 1S9XB 2D2OA 1I85A 3TP4A 2G60H 5BUPA 2JXMA 2DF3A 3FU5A 4DTGH 4M03A 1F8TH 1NLDL 4KQ3L 3RNKB 4E41D 2Y72A 3QUYA 4JL2A 4A1RA 4IIQA 1XO8A 3ELAT 5GZOD 1TQBB 3CQQA 5C3TA 3CLFH 1BZ7A 1U8NB 5ERWB 1BCIA 2UZXB 3IFPB 2N3JA 2VR6A 3WHXA 4K23L 1GS7A 3GSVA 3SKOA 4HF5L 3C2AL 1JNJA 4KVCH 1NANH 1P1ZB 1ZEAL 5BQ7B 4OFYD 4Q0XH 5ID1A 1TNNA 1A7PL 1Z5LB 1MXDA 2CNYA 3OGOE 4P5KA 4BSVB 1VKXA 2J4WL 4NJ9L 4M43L 3AY4A 3UZEA 4XVJL 2X3AA 3DPDA 1J05B 2R0WL 4OGAC 1MCRA 1SLWA 1W0YT 4WU5B 4AMKL 3AZUA 4NLAA 1M71A 1X5AA 5I74C 4G72B 4YXLH 3H85A 4KOCA 3U1PA 5CSGA 3U82B 1RVFL 2IH1B 3N6YA 4OZ4B 4RAVB 3FONA 4DOHB 5ESQB 5LGKA 2XZCH 1KN4H 4WSKA 4ZUUA 1EXGA 3FCTB 3PHSA 2XYBA 4D7BA 5T3XD 3DX8A 3WN5A 4WFHD 1ZS8B 3KH3A 4KTEH 2UZIL 1FBIL 2GI0A 2F54E 2NY7L 2W80C 3QQNA 2E8ZA 2ORBH 4N22A 3X17A 1HILA 5HHNA 5L88H 2CRYA 5D9SB 2WTRB 2APFA 2ARJQ 4BZ2A 2Y06L 5IG7B 4OLUH 2VSDA 4N6RA 2GTZA 4GKZA 4ALAL 1MFAL 2NW3B 5LNGA 2H2PD 3VUAA 4P23D 4QT5B 2IDFA 5K9JL 1HTYA 4RBPH 2A6DB 4U7SA 4F7CA 1CFSB 4YGVA 1KYFA 1N5AB 3HC2A 2E47A 3EGXA 1YCSA 2BNQB 2ATPB 4HJJL 4Y2DB 2WSDA 4OZFH 1K3ZA 3PQYB 5F72S 1DL7L 1KJMA 4QTHA 2WZ0A 3VXSD 4AQ1C 3VW3L 2GCYB 4E0RB 4F7EB 4FTDA 1QSZA 4JFFA 2PCFB 2NY2B 3RWJA 1S5HA 2MPVA 1FO0L 4X6DE 1Z7JA 5TDOB 3BSZL 2VDKL 3U0TB 2OR7A 1H3WM 4EAEA 3HVNA 3GGWA 4C4BA 4KMTL 2QBWA 3AAZA 3ABKB 4IYKA 3NP4A 1PZUB 3DVGB 1MCLA 1F1DA 1IT9H 4YPGA 3K6FA 3HNVL 4I3SL 3GSNA 1WZ1L 2Y2WA 1QWNA 2K8MA 3LRSB 2MQCA 3MLSL 3OXRA 4K8RH 4UIKH 4C58B 1OHQA 1QI3A 3MV9A 1IVTA 2EICA 3B9AA 2J1ZA 3B2DC 2YAPA 1I7ZB 1U36A 5JW4M 4YSAA 1WBYA 2NXYD 2XTLA 4QNPF 3FKUS 4FQXD 3OLGA 3IETA 3EKCA 4XRCB 4Y9EA 2FBOJ 5EC2A 4PRBA 5A40E 3FDWA 4JHBA 3QORB 4P4RB 1EANA 3EYSL 3T3MF 4N8VB 5JXAL 3BDYL 2E7LA 3RX7A 1PG7X 1L0QA 4MJ5B 1W8OA 2FX7H 1OGTA 2A99A 3FCSB 1KCWA 3MZTA 2CKBA 4RDBA 3RVTC 4M7ZB 3KS0J 1DBJL 3DSFH 4WI8A 3QI9D 5FYKL 5C09D 1FIEA 1P53A 4TPRH 5DA4A 1QMUA 1JRHI 3HC4L 1ULVA 2XPYA 3DUUB 3PWUB 1WS8A 3BHBB 1XSKA 4A39A 4ZFOB 3GK8L 5D4JA 2OW7A 4JEGB 5EU4B 4E9YA 2CCLA 1MFBL 4M48H 2FH6A 4FQIL 1K4DA 1L6XA 4X6CE 3BVUA 1AD9A 1DZBA 5EBMB 1V10A 3Q8BA 3IN0A 2O6CA 3BX7C 4ZG1A 1FUNA 2MQ0A 1IBYA 1N19A 3MRKB 2XHNA 2IOOA 4BFIA 1NDGB 3EG9A 4YSOA 5HYJA 1H3PL 3UYPB 3ROLB 1FQ9C 1AKJB 5E6IC 4ANKA 2IV8A 1BEXA 5D1XB 1KCSL 3D3VA 3RUGE 1PG7W 2NNCA 3F12B 1XMWA 3F7PC 4K3JH 3L5WA 2VM4A 5I1AB 2JJTA 4NP4L 1LNUB 4R96B 1DQJB 4LNVA 2A9DA 5EBGA 2CRZA 4DGVL 4PJ8B 3BFWA 4LCUB 1L9PA 5BRZD 1NAKL 5D2LA 1G9MH 2B4CC 3V4UL 3QIBA 5AG8A 1ZV5A 3T3PE 3V6FB 3IDXH 3TIEB 2BRRH 3VAEA 2Z91B 4UV4H 5IMLB 1GYWA 3R06B 1IBDA 3JVGC 4UYQA 3BLBA 3RJDA 4WO4D 2V7NB 3H9YA 5FUOH 4WFED 1HQRA 2R9HD 1MJJB 3NCFB 1HCYA 3SB3A 1C12A 4WJ5B 5EU6D 2XWEA 5IOKA 4LVNB 5KN5B 3ME0A 3B7YA 1E4XI 3RPIB 3IPFA 1XGTA 5CKGA 5HDQL 5E9NA 5KBDA 3KLAA 4HT1H 1JNNL 1BSIA 2G0KA 3DX1A 3QPXL 3E38A 4Q4EA 2PKDA 2XQYA 3DOIA 4ZJ9A 5IP4A 3MA9L 2ED7A 3FU6A 4IKKA 4X6DB 2VLRB 4P2QD 3GJFB 3FTXA 4BDVA 4LVHB 3UBXI 1KTJA 4XOBA 1Z66A 1PJ9A 3ARBB 3DRQA 1KJ3H 3D52A 2YK1L 3OR6A 2R4SL 4Y2NA 1IUZA 3HBZA 5EOTA 3OB8A 4OFDA 2VM9A 4K07A 2O5XL 2F53A 2UYLB 2B77A 4N0FA 3D08A 4J27A 1MFNA 3VI3A 2GBVA 3IM1A 4XB7A 4NQXA 1BEYH 1INDH 4Y8AA 3LD8C 1EBPA 4TNVK 2OR9L 2DLEA 4TTDC 5F7AA 5MEOA 3BH4A 4KTYA 1CFQA 4AVJA 1THCA 4C83A 4AQ8A 2K6WA 3GJEB 2EC8A 2ENYA 4H0GA 2FLMA 3LKPB 3NCXA 3O3EA 3MBXH 2HFEB 3DURA 5F0PB 3GLEA 2VWEE 3AS3A 4WUKH 1PZDA 2Z4QB 1JFHA 4OF6A 2ZNWA 3IVKB 3CZFA 4RIRB 5DRWB 1Q9KB 3HS8A 5ITFA 3GKWH 1XBRA 5I8OL 3WS6A 2CO1A 4LASL 3SYCA 5IB1A 1D3CA 4KJWC 4ONFH 4GAJL 5DVLA 5D7LA 1ZLWH 1NSNL 3TWCL 1HXKA 2HT2D 2J57A 1I7RA 1U6AL 2VYRE 3MCYA 2ZCHH 3GMPA 2XA8H 5AAPA 4RAUA 2DBLH 4X6CB 2ITDB 3WSQH 2WZAA 5BZDA 5FO8A 3EOBB 4ZBJA 1ODAA 1WIPA 1H8NA 3VD7A 3TO2A 3GZQA 1LEKA 1NCNA 1GOHA 5ESVA 3LZFH 2KQMA 4H1LA 3CZSA 3IJ8A 3HFFA 2K6ZA 4JQXC 4OCWL 1J10A 2X9ZA 3RUGB 4LNRA 1AZUA 2EH7H 2ZOLB 4XZUA 5I18L 1JTTA 3AWEA 4ONHA 3V0DA 4FCHA 1DLHA 2EE9A 4XH2B 4G9FA 4TQEH 1HIML 4M7LH 2DAVA 2HG5B 4MA3B 3HI5H 1ADQA 2XIBA 2XG5B 2Q2EB 3UBXG 1CPUA 1I82A 2EDYA 2OZ4H 2AV1A 2HJKB 4JFQA 4XBEL 1LE5B 1ETJA 2JLPA 1SXCA 3H2PA 2AQPA 2W0PA 3WNIA 1T1XA 3WFEH 5J13C 4G7RB 1J5HA 2AJVH 5DC0A 4M6ML 1F1AA 2ADJB 1NGQL 3EYVB 4DP8X 1S5IH 4HKZB 4Q56A 4J3OC 4YHIA 5DD0L 2PPDA 3GSXB 4OQTL 4MAYA 1XB8A 3NJNA 4MQ7B 2ATKA 3NFPA 1HX0A 2O30A 5HDLA 4P4KD 3RLSA 3L17A 2K6YA 5B3NA 1NBYA 4WKZA 3M88A 3TCLB 2X9WA 5E1QA 1E3FA 3V52L 2VQ1B 4R3SB 4A7GA 2X4SB 5DMIL 2ZUQB 4PJEA 3HC3L 3HUJE 5F7DA 1DQLL 1RP8A 3RP1A 1TF4A 3KBEA 1ZGLB 2YJLA 3FUNA 4NAQA 5A2LH 2A77L 1LP9A 1T1WB 3CG8A 1YVLA 3CMOH 3OKMA 3MBEB 3MNZB 5HYSG 2ZNXA 2VMFA 3EOTH 4XN7A 4WWNA 3VXUE 1HL9A 1Z2KA 3LKNA 3RB5A 1FG2A 5IROD 3MUZ1 4K3HA 3CDZA 1QASA 1KXTB 3WHE0 1NLDH 3P4MB 4KQ3H 1BAWA 3U9UA 3KPSA 1IC1A 3NCBB 2E6PA 4ZPVB 4AQAB 4GO9A 1JP5A 2QADB 3CH8A 3FOMB 2LOEA 1PIFA 4FNLH 4IS6A 2X05A 3ZYOA 1JPEA 1H9VA 3D06A 1KACB 5EU7E 4IRJC 1FFTB 5AW1B 4LCYB 4POZD 4XMPL 4CDHA 4EUPH 4MJID 3D30A 4F1ZA 1UT2A 2H3KA 1PD0A 3C2AH 4YSEA 3E6FA 3FTGB 2CIIB 4NXSA 1ZEAH 5F21B 2Q3XA 3OZLA 3V6OE 3VFTA 5F96H 4NQDE 2QQKL 2ZWZA 3G6AB 1EVUA 1JOIA 5C9JA 2FO4A 4PGCA 3RFZC 3LVEA 2J4WH 4NJ9H 1U8PB 2C7UA 2QKIC 4M43H 4IBWA 4XVJH 4G6FB 2R0WH 2XN0A 4EXPX 4AMKH 1U0QA 1KF9B 5E5LA 4R26L 1BX2A 1N9PA 3PV6A 2XBZA 3FJTA 2CR0A 3O3AA 1RVFH 5D5MF 1CBVL 3EBHA 2WBJC 3ZT7A 3CTTA 4UUJB 4LGPB 3KNBA 1U8OB 2ERJB 3NJLA 1C16B 5BZWB 4P5TC 2UZIH 3C8DA 3BGMA 3I3EA 5JZ7D 2NY7H 5DS1A 1P69B 1WK0A 1VEPA 4JAMA 4MHHI 4OGZA 3SY0A 2P44B 3QYNA 3GMRA 3KWXA 2Y06H 1IM3B 1BIHA 4ALAH 4E5XA 1MFAH 1AC0A 1U8CB 3FUHA 5K9JH 1JV2A 2FJGB 3F84A 2J8UF 3SSGA 4HS3A 1WIUA 5HPMB 2ZOUA 3JUZA 3HR6A 4ZUTB 4J6IA 3MCLL 1IE5A 4HJJH 5IW6B 3LRLA 4XE5B 3VW3H 5SWSA 5GZOC 2AZUA 2HUHA 2WWKO 4NQQA 5HHQB 1T5XB 3WJLC 2DIAA 2GIXA 2FH8A 4OF0A 2AAVA 5KVMC 3NZHL 4L4TD 1KXHA 1FO0H 1ZSDB 6CGTA 5E4EC 2IDQA 1QFPA 3BSZH 2VDKH 1NC4A 4M61B 4O5LL 4KMTH 3HPLB 2V2WA 1QHQA 4I87A 1CXHA 1JFQL 1MAKA 1Y07A 2A4CA 3FUKA 1U8LA 4U1HB 5DZPA 1ZE3H 3HNVH 3NGBC 3OBAA 3KG5A 4I3SH 5FYJE 1PYWB 4GG6F 1WZ1H 1F0LA 2XFXA 3C60D 3MLSH 4IRZL 3TH3T 2DD8L 1ZHKB 1CIDA 2JFCA 2HT3D 1P2CB 3SQRA 5K9QG 2A1WL 4XPFL 2Z93B 2EE0A 3GSWA 1QSFD 1XEUA 3WKQA 3CJJA 1UB6B 1WC7B 3K8MA 3HG1E 1PGRB 3RWHB 4Q9QL 1NGWB 2CR3A 3Q6GL 5B39G 4HK0B 3HMWL 2X6AA 4M6NH 3VXUB 2V7HB 1XF5B 2IADB 2BERA 5JW4N 2F7QA 5FS5A 4F27A 1UXSA 5JXAH 3BDYH 4JJHA 4XXWC 1J8KA 1TQVA 2F5AH 1VCAA 3VQ1C 3C87A 3KYNB 2Y7SA 5DJXB 3MRGB 3QJRB 2D7TL 1DBJH 5FYKH 2VR4A 5D7JD 3KEHA 3WBDA 3KCPB 4EQ2A 4Z0XB 3U48A 2MTAA 3BKYH 2EEFA 4HV8A 3N42F 2KI6A 4WW1B 3MGAA 2C9XA 1OIOA 3ZR6A 2VLJB 2QZQA 2ZCKL 5E6YA 4BCXA 4ICXA 4MHHG 4CKVX 2BP0A 2H2PC 1ZVSA 3GD1C 4P23C 2NNFA 3OPZL 3S2CA 3GK8H 3EJZD 1U8KB 4NQDB 1MFBH 3GSOA 1L6PA 1F3JA 1OGAE 3L6FB 4FQIH 1X5ZA 4PRDB 2P8LA 3AREB 4RGMC 2IF7A 4X0NA 3UH8A 4I1RA 4BK4A 4F3FA 4ZMOA 3NIFF 4GXFA 3CHSA 2AV7B 5JA8B 3CLWA 3DXAD 4RNRA 2VLMD 1B6UA 4M02A 3HNSL 3VTMA 2K1MA 4LSRH 1H3PH 3X13B 4FQ1L 4ODTL 4P2CG 3BI9X 4K2UL 3ARDB 1YUHB 4JRYA 1A02N 5HI5C 5IMOA 1MCOL 5DC2A 2DEYX 3AG2B 3DTDA 5C0BD 1UASA 4I13B 4N9GB 3F05A 3KHQA 3UTOA 4DGVH 5IF0B 5DC9B 1NAKH 1DVXA 2BS8A 2G2NA 1YECH 5GS0D 1XCXA 4LLQB 3IXAA 2IDTA 2YPKA 4I2XA 2NXYC 5AKSA 4FQXC 4XNQA 5IVXF 3D39E 5E9DD 4DN4L 4GAFB 4EOWL 3VH8B 1JWMA 1OB1A 3LY6A 4QGYA 3I74A 3EIFA 5I2IB 1P4LB 3LS4L 3VB8A 4GH7B 3LRMA 5IEHA 5HDQH 3QI9C 1ZXKA 3HRZC 1SN2A 1CDYA 1JNNH 4BSWB 2VN5A 3V95A 4EI6A 3QPXH 2YOCA 3TBSB 5B38B 4IJ3C 4X7TA 5EN2B 2ZP0T 3ECVA 3MA9H 4MXQD 4U1NB 4XVTL 3SDDD 2AJXH 4ZW6A 2WLHA 2W81C 3BE1H 5D1ZD 4YFLI 5KSBA 2YQGA 2YK1H 5DSCA 2WQUA 3L16A 1SVBA 1F2QA 2YD3A 5KWYC 3KPNA 4P8QA 2O5XH 4ZMNA 4FHKA 1J1PL 3T2OA 5I75C 1CGSL 1TYRA 2J55A 3Q8FA 4GW1B 1NC2D 4B5EA 3GSUA 1VEMA 8FABB 1BMWA 3ZDYF 4JO3L 4PYGA 4PJDB 3HG1B 2NCEA 4FAAB 4PJXE 3KPRA 4D2NA 5C3IA 1QLFB 2R1YB 2P5WB 5E6SB 3DVNA 5H35A 1JZ2A 2GW5A 2X9YA 4JFXA 5HGGS 2OL3A 1ASPA 3C5ZD 4CW1A 1YUKB 4PGEB 3SPJA 5DEGB 4PRAB 4UNUA 5I8OH 4CVXB 3IE4A 1W0WB 4LASH 5D93C 3BQUB 1XDTT 2KUTA 4GAJH 1JUFB 1QRND 2APWA 2CD0A 2VC2H 4QXGL 3JVGA 3TJPA 3TWCH 1SFHA 1UXLA 1W15A 4D8PA 4QHPA 4P48A 1MRCL 2ZAGA 4WO4C 4AIZB 1U6AH 3E0GA 4F2ME 1MCHA 4IMLA 3IFLL 4E42B 2UWEF 4X5WA 2AJSL 2IPTL 1UWXK 2NUTB 3W57A 3ARWA 4P3WA 4LLYB 1MH5A 3ATDA 1JXGA 3C6LB 3T8VA 3GHPA 1UT1A 1VIWA 4JMXA 2DYPD 1ETZB 5D2NE 4OCWH 4JDVA 5BVJA 4FTVB 5IB4B 3KYOB 4PJGF 3ROOA 2UY6B 4PJBB 5F9WC 5I18H 1UKQA 2C34A 2HLEB 1RLBA 3PFQA 4QHLA 3RAJL 2GBUA 1HIMH 3NJMA 4HC1H 1AYRA 1AZZC 2VL5A 1DDHA 1LM8V 1NGXB 2NZ9D 2ZD0A 4QRPD 3ZL4L 2K78A 2BZCA 1NCOA 3AADB 2R2BB 3MNWB 5GZND 4GQPH 2FEJA 1RLWA 1A65A 2VQTA 3PNRB 1IC5L 1ZIBA 1MLBB 3BD4A 2VUOA 2XSKA 3CBKB 4OFKA 1FCGA 1SJEB 3D39B 5DD0H 1NPUA 4BH8B 3OKKA 1ZV2A 4OQTH 1YEKL 4AWJC 4NN5C 4CMHB 1BQHA 1QSEE 3VG9C 3OLEA 3QCTL 2V2XB 1J1XL 4MNGE 2ZOKA 3LJ3A 3L9EA 3IDMA 4DP5X 5FEBA 5A2KH 1HEJC 3ZGIA 3UDWC 5KG9B 4XNDA 3IE9A 2NTSP 4MXVF 4ODSH 5CEZL 3GZPA 3VM7A 5J9PB 4FMKA 4U1JA 5DMIH 2IWEA 1EZVY 2IFFH 3HC3H 4QHKI 1DQLH 4WF7A 3S8FB 3TN0D 4UQ9A 3FF7A 2A77H 5F1NA 1YO4A 5G4NA 1KIUA 1ONQB 5K59F 1U3JA 2G3ZA 4A6YB 4AYGA 2D9QB 5IHBA 3G3LA 4Z6AT 4JPIB 4UQDA 1IL1B 3K74B 2DPKA 5J89A 4HLJA 3TA3D 3ZY7A 4NYLA 5DD5L 3ILQC 3IDYB 1IGYA 1O6SB 4L4VE 3N1FC 2J21A 3FQ2A 2O1AA 4B41A 3NRPA 3PF2A 3QQ3B 4XBMA 4K71C 1ZRUA 1NBZA 1DANT 1YEFL 2FNBA 3WNKA 1A6TA 1U92B 4EZLA 2H32H 5C0CE 3TASA 1KJ2L 1RHHA 1X6LA 3FQTB 4PRPD 3TH2T 1S6NA 1MHHA 1M7DB 1J9CT 2GJ6A 5FWRA 1UH4A 2DQDL 1IKNC 2QQKH 4OGXL 1CD9B 2ZSWA 4MD5B 5BS0B 4DQAA 2Z0BA 1SXZA 3QUMB 3ZJAA 2J1YA 3TBWA 1OGSA 3PWVA 1E27A 3J8F7 5C07D 1DVFB 4FXGB 4WWID 3CSFA 4ZQKA 5JIIA 2M1KA 1ZY9A 1FNGB 4R26H 4R7DB 3BVWA 2AHIA 4X4XA 4GW5A 3W3BA 5CJ5A 2EILB 4FLOA 2G2RA 4F2MB 2FYVA 1OSZB 1S7QB 4Z7NF 1CBVH 1JZ5A 4W70A 2FZ3B 2WWMD 2NY4D 4IEFB 4MA8L 4YHPB 3LEXB 1CG9A 2VZUA 3D07A 5D96B 4P4KC 1Z0MA 3X1NA 4ZO7A 3RL1A 4X7SL 1J9QA 3DOSA 1JK9B 4N2MA 1HSAB 4PN6A 2ADGB 1X4YA 3L4VA 4NM8L 5D2NB 1MW1A 2YPLD 2OTUB 5JPNA 1OTSC 2EDJA 2AXGA 4NAMA 3EGDA 4RMQA 4D0DA 3NN8A 4ETQA 3Q06A 1E9QB 3QIUC 3V6ZA 1KENH 2WCGA 2VGLM 4YHZL 3BP5A 5C0EA 4FQCL 1I9JL 3MCLH 1I8KA 1UKTA 1S7WB 3KL3A 2C3XA 5SWZE 2OMXA 4XAKD 1QPXA 1A0QH 1NFAA 1TMCB 4JFSA 4K5MA 3VFPA 2CM6A 4BINA 2WWNA 1QLRB 4KV5F 1IEAA 3MJ8B 5AW8B 2L3BA 1C5BL 5E8OA 4KO9A 3D9AL 4K9EL 4IRJA 3NZHH 1UVQB 3BEVA 4NPYB 1AOZA 2EYRA 5IJKC 4LBAA 1X7TA 3ATEA 3II3A 3MYZA 5I5RA 1L9RA 1QSEB 4PBDA 4O5LH 3T65A 3FYIB 1JFQH 4AMXA 1GCYA 4OZFB 4UANA 5C6PB 1HN1A 4ZUSA 3IGFA 1CDBA 5IBUG 5JDSB 1AXSA 2L7QA 5E8EB 3GNML 4QRRD 3SBQA 4IRZH 3QIWC 3KWWA 5FK9A 4C56A 1S46A 2XQ0A 5A2FA 1XF2B 3G5XB 5I0XA 1HOCB 2A1WH 2I69A 4NWUL 1AO7E 1T1ZA 4WLCA 4KY2A 5HVFB 1EHLL 3UC0L 2FATL 3H9SE 1NOFA 1PLGL 3H3PL 4TF4A 1A3ZA 4Q9QH 1PTZA 3EZJB 3AWFA 2FEDD 3Q6GH 1LMIA 3HMWH 3N1QC 1FGVL 2QR0A 1P5VA 3QJQB 3KPPB 2WBJA 3DJZA 4JZOA 2DM3A 1FV1B 5JPMB 3LN4A 4ONOA 3SCMA 5JIKA 4IOIB 4JANB 1I3RA 2D7TH 2YAQA 1QHPA 4APQB 3IMUA 2X4RA 3EFFB 4MQXC 2VLKD 3IKCB 4OSUL 2K4AA 5DQJA 2EKSB 3S88L 2ZCKH 1OVZA 3EBGA 1HS6A 4OJAA 1RJLA 2BHFA 3WEAA 4KUZL 1GYAA 3OPZH 5ANMA 3OMIB 1YNTF 1AIFA 2VDML 5H8DA 4E41A 3NJFA 4ODWB 5ID0B 3K1KC 5GZOA 1ZA6B 4G43A 4GKSB 3UBHA 2IQ9L 3HNSH 4HAKA 2EH8H 3N43B 3WJLA 2BSBA 3ZPDA 3QYMA 3T77A 3US0A 4K2UH 4E9TA 1QR1A 4ZS6D 4X99B 3RU8L 4XI5D 2BVUA 2DYSB 3PAUA 2A74B 1KNOA 4OFYA 1TVDA 4Z0BL 3BUYB 4NNXB 3HLAB 4TVUA 3C60C 1LEIA 5LBVA 1I3GL 3JYCA 5D6CA 1H15A 2HT3C 1TKWB 4K9JA 1GJIA 1QFWH 4UQCA 5DR5L 3VE0A 4LGRB 2V0AA 3D18A 5CP3H 4G3YL 1DVZA 1UD3A 1WFMA 3ERXA 4DN4H 4FGMA 4OLYL 4EOWH 2GIYA 5LAXA 4XXWA 2L7JA 4PI2A 1SOXA 1KTLB 5SWZB 3UEQA 4ZTOL 4G42B 5L0QB 3LS4H 1IO4C 2F8OA 3KGTA 2YN3A 3ZKSD 2NT1A 4NI6A 4R4ND 1XGZA 5D7JC 3ET9F 4YZWA 1E90A 3KLLA 4NUJA 3LYRA 1TETH 1GZPB 3L4CA 4XVTH 1D5ZB 1JG9A 2BSDA 4PJIF 4P23A 4QNPE 3K5RA 5DVMA 3D69A 1TTUA 2FX8H 4U31A 4Y16C 3EJZC 2VERN 2DWTA 3DX9B 1GL4B 4G70B 2JJSA 2APSA 1FNSL 2XVBA 4NKDB 4PCKA 4EDWL 2FSEB 1PL3A 1EDQA 4LEEA 4NN7C 2XWTB 3VXSA 1LGVA 1J1PH 3CVHL 4H5SB 1HHIA 2DWEB 1W72B 3OG4B 3CU1A 1CGSH 5AL8A 3V7AE 3UTTE 3EOYG 1QBML 2OMTB 1HEHC 1VFBB 4JO3H 4P5MA 2WYHA 4Z95L 4JQVA 3AWGA 1AP2A 2V8MA 1UM6L 4HEME 1BBJA 2BC4B 4ELMA 2CO2A 4GUCA 2OX5A 4QOKB 4X5RA 2PW1B 2WYZA 1JWSB 3B9EA 3EFOA 4CKQA 2X4TB 2FUQA 4TUJA 2EC9T 4MS8D 4DPRA 5F3BA 4FG4A 4UQ2B 5EF3A 3ZKQD 1WS7A 5LXGL 3S34H 4OBSA 3I6LE 2IANB 4TUKL 3GXFA 1Z6JT 4HLZH 4FKKA 4JM0A 4HS8L 3WFZA 5GS0C 2WVVA 1L6ZA 4FQXA 4S1QL 4YAQB 4QXGH 5AVQB 5AB1A 1PZ3A 2W92A 5F7UA 5KZCB 1PZ5B 1MRCH 1Y0LB 4O00A 2HX9A 2MNJB 3B7SA 1Q1PA 3VQLA 3ARGC 3IFLH 5FF6B 5IM7B 1A4JA 4IU2A 4MGXA 3FTSA 1HCVA 1S7VB 3CFKA 2AJSH 2IPTH 4OU3A 5D7HA 5IB5A 1YEGL 1BFVH 1TTCA 5E4OA 1K6QL 3KR3L 2YAOA 5C09A 3TWYA 3QI9A 4RFNC 2VOTA 3HRZA 3O6LH 3EHBD 5AVUB 1NJ9A 4WSGA 3LQZB 2GHZA 3BMVA 1HINL 4Z3HA 1M6UA 4Q14A 4MXQC 3AU1A 4IK7A 1T20B 3SDDC 1IEHA 3WNMA 4HUUA 4EBQH 3RAJH 5HHVL 1EEYB 5JQHC 5I82A 4C55A 3S35X 5ACZA 4P2RD 5HDOA 3ZL4H 5D70H 2BMKA 3QCUL 5EU5A 4TL4A 3P3YA 4KROD 4PJFF 4MCZB 4AGPA 2YWYA 3QNFA 2LW3A 3CZEA 4K7PL 1IC5H 2CO6A 2XNAA 4L8DA 5TFSL 2WJ7A 5CLXA 4N2BA 4H8UA 2NLJB 2QV2A 2F5BH 3M07A 5FGRA 1AI1H 1JRHL 4KX8A 1YEKH 1UACL 1UWEL 2BP3A 4OIAA 4AM0A 1AZBA 5L2KE 1YAZA 5FW8A 1D5MB 3W0WD 3K5SA 4AEEA 2O61A 1WJ3A 5DHYA 5BRZA 2NUPA 3QISA 4XO5A 3RRQA 4JW3A 1GS8A 3E8UL 5CEZH 3DJ9A 5EOCL 2XKNA 2XWBB 4NQTA 1E50A 4JREB 3QT2A 1S2EA 3VGEA 5JW3L 3HZMB 3QFDA 3ZHNA 4JFFE 4WO4A 3QNXA 2MHAA 1MCPL 3TJHC 4H8VA 5EU6A 3HBPA 4FQJH 4KOBA 3BDBA 2R2HB 3BUQA 3T3MB 2Z7YA 3GIVB 2FJHA 1RUMH 3VCLB 4IKIA 3CFIC 1EFXD 1JHTA 1FE8L 2H0EA 3IXTB 4H2AA 4K5OA 5DD5H 4ISVA 3MV9E 3T4YB 1HCFX 4WGVB 2CA4A 3QC5X 4ZAKB 1D5IL 1UYWL 5JUEL 3ES6B 4JVUA 3SDAD 1YEFH 4P2QA 3BESR 5EORL 1UH2A 2QHLA 4BFGA 3IFNL 4G8EA 2DRUA 3CZJA 3ZU8A 2NZ9C 2DQDH 2YC1B 1BD2D 1O7DE 3BRDA 3H0TB 4RLDA 2A9BA 5DJCB 5FYKE 2EDDA 5GZNC 2E75C 1RMFL 4KKCD 3V0IA 2EQDA 4AW4A 1J8HA 2Q0ZX 4G9DA 1E4XL 2YD1A 4EUPB 4YHML 3DO7A 5T5FA 5I9QC 3T2LA 6PAZA 2V9QA 4ELMF 3SKJL 3WHXB 2C4XA 2IH3A 3RFRA 4PV8A 2HSIA 1M7UA 2PETA 1U8HA 2IH8A 3ENEA 4FADA 4MA8H 3VXOA 2DQTL 5FYJU 2O72A 5J6GB 5K39B 3UDWA 1OE2A 2VMJA 4UZSA 4CU6A 5CP7A 1UOWA 1TMQA 4NM8H 4X5PA 3SDCB 1PZBA 2AANA 5HYJE 2FGZA 3TN0C 2L7UA 1D2OA 1WBXA 3P9LB 1LE9B 5FR3A 4FEMA 1EVTC 1LQSR 4PRNA 4ADGA 2QTEA 3O4OB 5ADPL 1LDPL 2AXFA 4YDJA 4NHCL 1HNFA 3Q8EA 4YHZH 4FQCH 1I9JH 5E8NB 1QPKA 4GINA 2PO6B 3TA3C 3MTXA 1T2XA 3FB7B 4NQEB 3HJEA 3HJ0A 1USZA 1KY6A 4KXDA 2OYLA 4NOBA 1C5BH 2Q76B 3JV6A 3D9AH 4K9EH 2WVTA 3WMSA 4WGWB 1B9KA 3IU3B 1UD5A 1AG0A 4N6RB 1KPVB 1G7JA 2XIIA 2BY3A 2CDGA 5INCB 4GRWF 5J4MA 5L2KB 4XVUD 2CIKA 5L7XL 1S7SA 2FTAA 3QHFL 3MVSA 2A73A 2I60H 3AUWB 4OZHF 4TSCL 5AYTA 4BHUA 2Z3FA 1GVIA 1IKNA 1SEQL 1AGDA 1E4WL 5L2JA 5F1SA 3ZE2F 1BZ9A 2D31B 3B9KD 3GNMH 1FZJB 1MCCA 1N0LB 2N01B 1P7QD 3DDGA 1S8DA 1OCOB 3O0RL 1MQKL 5T1MA 4PJ6A 2CLRB 1HFUA 4NWUH 5L6YL 1OSYA 1EHLH 3UC0H 2FATH 2JIXA 5DFTA 5KVFE 2XV3A 3WCYA 1MJ7H 1FO0B 3ARQA 2Y7QB 3GEWB 1PLGH 2NXZD 3H3PH 2VDKB 3TGXA 4N87A 4D9RD 3HC0B 1J5IA 1ZVNA 5HDBF 1FGVH 1MW3A 1XGPA 5IFJA 2WWMC 5CD3B 2NY4C 3D0LA 2F7IA 4P4KA 4YPGB 1KELL 5JTWA 2OMWA 5DZAA 2NQCA 1VGKB 4DZBA 5FLVA 1XHHA 2XV6B 2F53E 2Z4TA 1DE4A 3CHOA 1DVSA 1FFPA 4U2YA 5I8EB 3VI3E 5I1DB 4HCFA 3SPVB 4OSUH 4MJJA 3S88H 3MR9B 4OCNC 1UWGH 3ETSA 1UADC 2VO8A 2GBTA 4HXAL 3HG2A 4DH2A 2G30A 2P48B 3CZKA 3QIUA 2VDMH 5IROA 1MCNA 3FYEB 4PD4K 4PJHA 1BIIB 4LLMB 2B5IB 2ZWLT 3D4GA 4BXSV 3QJFA 3BSGA 1M2VA 3MO1A 4Y2OA 1BBDL 1L5GA 4JE0A 4HULB 2QTVA 4IJTA 1D5BB 5IJKA 5D7LE 3RU8H 1KG0A 3TV3L 5MP6L 1HHGB 2X4UB 2ED6A 2CHXA 4KH9A 5DXWA 3WO4C 1JJUA 4ZYKB 2NY3D 5EHFA 3QWQB 3U4KA 4Z0BH 4J39A 4LAQL 2YPVA 1IU1A 5C70A 1I3GH 4XMWA 5DJDA 3E1ZA 3CWGA 2YAHA 2JKXA 1PZCA 3A6OA 3N50A 1DJZA 5DR5H 1GHFL 5HYJB 3RX5A 2GK0B 2WOYA 4G3YH 3RZCD 3ECBA 4DVRL 2FEDC 4V11A 2NCMA 2ZJSL 3QQ9D 4AG4H 4ZFZB 1BQRA 5F89B 4JFOA 5J57B 4ZZKA 4N1EA 4ZTOH 2DEWX 4BV1A 2B9BA 4ODHL 1ET7A 3BPOB 3K2IA 3M7OA 1TLMA 4KO6A 5EU3B 3W56A 3EYUL 3SE9L 5GSVB 2M2DA 3P54A 5DFWH 3GTTA 4F9LC 4AEIL 2P43B 4H20L 3WKNA 1F86A 2R69A 1KLUB 5B39A 1CXLA 5AG9A 1WWCA 4HEPA 4WFGD 1I8LC 3PL6B 3VXRD 4MA1C 2OTWB 2CUAA 4TQHA 3C75A 3UG5A 3MLZL 4HOZA 5LGHL 1XGRA 4GS7B 1F3RB 2A38A 4OF5A 3G5ZB 4MJ6B 4HWZA 1PAMA 5PCYA 1GCFA 3CVHH 2SEBB 1U21A 4L3ED 1KLFB 3AQYA 1H9DA 1DVQA 1X5IA 3M45A 4DJMA 4PJEE 2IAMB 5IMKA 3M86A 4Z95H 3AB0C 4L4TA 2YEZB 1QRKA 2V37A 1UM6H 3SQBA 4ZS6C 4NENA 3V5DA 2X6CA 3D4YA 5GS1B 1J11A 43CAB 1R5VA 1FNFA 2BOBA 1WFJA 3BP6B 4UTCA 2I27N 2D0FA 1BOGB 2WN3A 3CFCL 3C60A 5D1QB 3MRBB 5LXGH 4GQQA 5BPPA 1A1OA 4G6AC 1XH2A 3F5WA 1FF5A 3KPSE 3NIFE 3VMNA 1OOAA 5C6WH 2YD4A 4LCWE 4TUKH 5DURB 3BZEB 1FNLA 1QSFA 4HS8H 4NQXB 2GAZA 2QMJA 2DMGA 2NZIA 2CCWA 4LKCA 1R3IL 2NDFA 3VFGL 4C83B 3S36X 4KITB 1XIWB 3HZYA 4JJ5A 5TF0A 4KJQC 3MRQB 2EDHA 5D5MB 1I9IL 5I17A 5TPWL 3H3BC 4H8HA 3ZTCC 1WF5A 1F13A 1XGQA 2B9AA 4V1DB 1YEGH 1HL8A 1K6QH 3KR3H 4LXFA 1ZLUH 4W1TA 3R19A 2ESVB 2UXVA 2B59A 1C08B 3PJSB 4XN4A 2A4ZA 4R4NC 5D7JA 2GTQA 4OZIF 5ITFB 1Q8MA 1HINH 4AC4A 4JUSA 3QUKB 2LFEA 1KTKE 2RTTA 4RWYH 5ADOL 1JZDC 4K3EH 2X2IA 3M46A 4PWEA 1I1AD 2X41A 1JDCA 1UJ3B 1TFPA 2FBJL 4R5TA 4F1SA 5AW6B 4AM0Q 2UVEA 4RAUB 1RIHL 2J8UB 4QHMB 5BZDB 5CS7A 1RK1A 4GRWH 4S1RL 3BC9A 3QCUH 5E5RB 5CZRA 1DBAL 4U6XB 2DQIL 2H26A 5F3HB 3ETTA 1LEKB 3VJ6A 4AITA 5E08L 2F74A 3DXAA 4GFXA 3VFOA 4H1LB 4HFUL 1LO2H 1A21A 4K7PH 1FNAA 1CFTB 4UT7L 4A66A 4Q6IC 5TFSH 1LL1A 1GRWA 3SO5A 5CBEA 1YEHL 4MA7L 4WEBL 4PH8A 4MCYA 1JRHH 1BAGA 5FB8A 1UACH 1UWEH 3B3BA 3HI6H 4X7DC 2YXFA 3B2UD 1U8QA 2D73A 2IGLA 1AY1L 2J20A 4EMZA 3V4VH 5C0BA 2CGYA 2CUIA 1E2WA 4IGBD 4MS8C 4PJAA 3AG1B 5DHVH 3BUTA 1WT5C 3JTSA 5HY9A 1MEXL 7CGTA 4KZ0A 4XZ4A 4GG6B 1TCRA 3RA7L 4I9XA 3E8UH 2RMNA 4X6EB 5F6HI 5A3ID 2ZX6A 3F7YA 4LHUG 5SWSE 3FB8A 4R4FL 4A2DA 4G2AA 1N18A 3WUWG 3MRHA 5JW3H 2VDQL 4HHAA 3BRFA 5M94B 5CCHE 1IJNA 2I85A 2OCJA 4YSTA 1TJIL 5E9DA 5AVWB 1B2WL 4P9HC 3D51A 4M4RB 3EAKA 4HD9A 3SGEI 1JE6A 1Q9WA 4NO3B 2ENQA 2HRHA 3BT2L 1IRAY 3O4LE 1YY8A 5IEKA 3D33A 5JXED 3E2HC 2GT9A 5CZKA 3QG6A 3L9YA 4ZPTB 3RY6C 1JGEA 2MPAL 1XZWA 3S96B 1P6FA 1RK0A 1FE8H 3BKCH 3EHBC 1HC1A 2ZWNA 3MKGA 4ZD3L 4ZZFA 1CVSC 4AJ0A 4AY0A 1D5IH 4Z3JA 2MFNA 1UYWH 3SDDA 5JUEH 2ZE0A 2MNWA 2CDEB 5KAQG 4B53A 3OKMB 4EZJA 1KYAA 5EORH 4WW2F 5D1ZA 4AX3A 3EZ8A 4NEHB 3IFNH 4H2CA 4PIRF 1DUYB 3FFCD 1HSBA 1TPXB 4PGDB 4XO8A 1H6TA 2LLGA 3DROA 2P8MB 3BPNB 4HC1A 1W2KT 5DJYB 1J0IA 3SJVD 4LAJH 3WY1A 1IFRA 2X1WL 3DO4A 4KROC 4YWGL 2AF2A 3NIFB 3P0YL 4LRIC 3MCKA 3OKEA 4LCWB 1RMFH 2FB4L 3IDUA 2EIMB 5H37H 4PJCF 4MMZA 5F7BA 3MROA 1E4XH 2D0GA 3G5WA 1YSOA 1Z5HA 4GRLC 4YHMH 2FL5B 4IHOA 2H32B 3RGHA 4AVIA 3VTTA 1SMOA 3SKJH 1IGTB 3LB6D 4U0RC 4XHJC 1A6ZA 3K1DA 2IFGA 3ZDZF 3IJ7A 4Y5YC 5GGTA 4WK2B 4QEGA 4HWUA 1H19A 5C9JB 1RP9A 2DQTH 4BFOA 4OJYA 4YOKA 3C5ZA 3HE7B 1TZHA 5AW5B 5F7HA 4AYFB 2EO1A 4WI9A 4QMEA 3DYPA 3ILDA 2MOGA 1QRNA 3PV6B 4OI9A 3VFUA 3O3AB 5IVXB 1RSFA 2YXWA 4JRYE 4Y9FA 4HX1A 3Q9QA 3HG4A 1FVCA 5JHDD 4XGZB 5M7QA 1WISA 4BWTA 5IGXH 3R8BB 5ADPH 1LDPH 1KEML 4LL4A 3WEOA 1HVXA 4NHCH 4N9OB 1YY9D 2CCVA 3CDGA 4U4IA 3QUXD 2D7PA 4LMQE 5DEFB 2DICA 3FQNB 2DYPA 1WCBB 2L7EA 2O26U 4MXVE 3L3DA 1R5IA 2SODB 4JPWL 2QZ5A 4U3SB 4IBUA 4QO1B 4C4UA 4NZFA 2R2CA 5DHEA 5GRVL 2LHAA 1AQDB 3SDAC 1NGYA 4YBLC 1K2DB 4ZNEE 2OK0L 2UX7A 3OXSB 4E9VA 1GTNA 4NCC2 3QHFH 3CUPA 3PWJB 4EI5D 5K59E 1WA1X 3L3HA 2XWJA 4QRPA 1MF2L 2QPDB 1SEQH 1E4WH 3L3GB 3E3QC 1EHNA 4Z7QE 2EEAA 1JPTL 1OQOA 3L1EA 3VQMA 4AGMA 3SBPA 2ZTBA 3SBWC 5GZNA 1Q0YH 2YMXL 1OQXA 3O0RH 1MQKH 3N55A 3MNMA 5BXFB 4AJVA 1EHKB 1B0GA 4ZOEA 2X09A 3ZDYB 5IR1B 4D0CA 1L0XA 5E8PA 1GSKA 4AKQA 3QO1A 1NPNA 3O4LB 3VXNA 1OT2A 3UO8B 1S7TA 4YHOL 1KEGL 5IB3B 4PY7A 1Z9SB 4Y19E 3VU1A 3SDYH 1KELH 3DV4A 3WV0A 4AIEA 4OJEH 1JV5B 4KGJA 1HJBC 2VDNL 3UTQB 4A04A 1PX3A 4TV3A 2PWFA 2CE6A 4KFMA 4UT9H 4NOFA 4G7SB 3JTTA 3TN0A 2H3XC 3TNNA 3VI4F 4M5TA 4M3JA 2KDYA 4OF8A 3VB9A 2IC2A 2XFGB 2HVJA 4HXAH 1UA6L 2PWDA 3MODL 4PGBB 1Q0XL 3KPRE 5CLZA 1T4KA 4JY6B 2V5SA 1Q9OA 3RGVC 3DMMD 4Z7NE 2FX9L 2UWEB 1DJGA 3CDCA 1TOXA 3N1MC 3TA3A 2JQZA 3ZRSA 2ZYIA 4X8JA 2BHUA 4L3FA 2VDOL 5EO0A 4NQVA 4YO0A 3DLQR 5DZNA 1BBDH 2JB6A 4K3GA 4I77L 1SDDA 4XXDA 1CC3A 4PJGB 4FLHA 3TV3H 2FJFA 1NEPA 4G8FB 1ZHBB 4XVUC 3T1FB 4TNFA 2H0FA 4NIYE 1F3JB 1ASQA 4F3FB 5FYLD 1AD0B 5MI0B 4EIGB 2YKKA 3M1OA 3B9KC 4LAQH 5KSUA 3SOBL 5CU5A 4B3VA 4AQ1B 2BS71 3QPKA 4KQ4H 5C07A 4WQOA 2PN5A 3Q3GA 5AUMB 4YEFA 2LLLA 1CICB 4GKOA 3A23A 5HGDB 3WLWD 4KV5E 4DP1X 4E9QA 2NXZC 3MGTB 4OZGA 3V4PL 1PJWA 3WIHA 1KTBA 4DVRH 1EV2E 3QNYB 1OARH 1WRFA 5IMOB 2ZJSH 2Y5TB 4N6QA 4YFLF 4TUOA 3V0HA 3K2MC 4FJZA 1MFUA 5KS9A 1XF1A 3LX9A 4MMYB 3L9RB 4ODHH 1FIGH 3EYUH 4KKQA 4NT6A 3SE9H 1I8MA 4LSVL 3T09A 1KCVL 3ML9A 2FCBA 2YPLA 4AEIH 1YLBB 4H20H 5FUCE 1BVLB 4HUWA 1FLRH 1AHWB 1O7SA 2BCMA 3ZL2A 2LVEA 4FFYL 4IBTA 3F85A 4NWTL 2BSED 3GMLB 4TXVB 1CD1B 5IOPA 4JNXA 5HVGB 4ZMWA 3MLZH 5LGHH 4LF3A 4ZMAT 4JFYA 1HAUA 3FH5A 5TH2B 4ADIA 1BVNT 3BAIA 7FABL 4BUGA 3IN2A 1XF4B 1AQKL 1KLGB 5DRNA 1K8IA 1B0RA 5E23A 4RGOL 5ICYA 1SJVA 5F6IB 2XIDA 1VADA 4LOFA 1A7QL 2WSKA 1PY0A 3T0AA 3KD4A 4NNYA 4GAYB 4YDNA 4J8RA 5AKTA 1EAPB 4Q2ZA 2NY3C 4Y19B 5CJBA 4RFEB 3QXTA 2WAHA 4YDLC 4RZKA 4JZJC 4QRRA 5A2CA 1GOFA 2WANA 5FA4A 1KPUB 4DP9X 2HYMA 3N2JA 1T3FB 2WXFA 3J7HA 3NAAL 3TBBA 2X53A 5E6IB 5I8CB 1NGZA 1R3IH 3HZ3A 1CDUA 1F42A 1GPOL 1D6VL 3VFGH 1M56B 3TZVC 1E28A 3BH8A 3UTSE 3QQ9C 4KO5A 1UH3A 4Z7NB 2Q8BH 5TPWH 3QDMD 3OTTA 5IESL 3U9PH 3DVNB 3ARSA 2GJ6E 3REVA 3HZVB 4UNTA 5AZ2H 2A83A 4DT2A 5E94B 4B9IA 4OT1L 4Y4FD 3P3UA 4X4YB 2VLKA 4GAGL 1XCWA 3GHBL 1K72A 4NPJA 1PQZA 4KY1L 4PS3A 1YPZA 4IBYA 1W0VB 3VFSA 5ADOH 2H3NB 5DFVD 3O2WL 4D8PB 4O02L 3AITA 1I8LA 4YL9A 5EEZA 4ONGH 1RULL 2EVHA 3DI3B 5EIIG 4BQ6A 1TTRA 2X4PB 4HGWB 4DEUA 2NX5B 1JWUA 1RIHH 4N0UA 1X9QA 4J5VA 2G75A 4S1RH 3W5MA 2DV6A 3QEQB 1DBAH 1MH5B 1AVAA 2DQIH 1AQMA 2RIKA 3CHQA 1T22B 3QUZB 4HALA 4FA8A 5E08H 3LHPL 3P2TA 1R9FA 1OHZA 3D25B 3FFDA 4HFUH 4UT7H 4PJ5D 4F8PA 5IKCA 1KPRA 2WQRA 1CF1A 3HHMA 4BK8A 2MWCA 4M56A 1TLKA 2XTJD 3NEEA 1YEHH 4MA7H 4WEBH 2N7AA 2NY5C 5IHLB 5ISZB 2HAZA 2XPGA 4QHLB 4KTDL 3K80A 2DQFB 4PJIE 1AY1H 1KTRL 4XMKL 5IJVB 3KYKL 1DDHB 1GGBL 3QNZA 1E4HA 1E7UA 1IEBA 4FMFA 4S2SA 1A9BA 3DYMA 1UQSA 3V0WL 1MEXH 5FYKU 4O2FA 4L29B 1TJHH 5ALBL 3RA7H 1RIVL 5BO1L 1EJ8A 4R4FH 3BZ4B 4XNZC 4AK2A 4DEPC 3LD8B 2VDQH 4QRUA 5BZXA 3L3IA 3ZKXB 3ZHKA 4TNWF 1TJIH 3UZVB 4YDKL 2GY5A 1A2YB 1ND0B 4JO2L 3WGUB 2WGNB 5CFAA 3IMWA 4GT0A 5CEZE 1KIPB 1H0DB 5DU7A 4BFKA 5BO0D 3B7RL 2OXGA 4B50A 3RG1C 5IT2L 3IDMB 4U1KB 2Y25A 2MPAH 4JRXD 5LLIC 2XICA 3N5AA 4Q9CA 1OT1A 1H6UA 1S9VB 3WNPA 3CN2A 5LHDA 3P4OA 3WE6A 1UT9A 3L95B 4U1JB 3FSVA 1KYDA 2VR7A 4ZD3H 1QQDA 3U2IA 3FHAA 2CO7B 2PYFB 1L9TA 5B8CC 3MV8B 1GC1H 1SPDA 1XWVA 4NLHA 1TNMA 2W38A 3ZO0A 4H8WL 4FFZA 2BHZA 3ULUL 5MEPA 1R3LA 1RJZB 5E2UL 3L48A 4HKJA 1YNTB 2ZX5A 3IYLW 4WHTA 5DTFA 2FQFA 1C5DA 2CA3A 3P0YH 3QR0A 2MTPA 2FB4H 1JERA 2YSSB 5CKAA 5EO9A 4UDTB 1WWAX 5J3HD 3HI1A 4TVPL 3MCG1 1DCLA 1KJ2B 3WJMA 3UTSB 1A6TB 1G0DA 1RI8A 3GSQA 4R83A 5FO9A 1F3DH 3H3KA 2MQGA 4NUGL 4XWOD 3B2UC 4EKJA 4OGYL 5A2JH 5LDUA 2AABL 5ANME 3NJGA 4KKLD 2VT0A 1P5UB 5CN1A 5B1KA 2VQ4A 3FTZA 1JGLL 2X1PA 3DX6A 5AVSB 2J72A 1PS3A 5D7IA 1WT5A 4WNQB 4KH2A 2EYTB 1U41A 1MCWM 4E41E 4DGYH 5J13B 1MJUH 5A3IC 1KCKA 1Y6KR 3KEDA 3JYBA 4OI7A 3P0VL 2CPUA 1OPOA 3EH2A 3D5OF 3I6KA 1BPLB 4BA0A 3HB3C 1HZKA 1CGXA 1UHVA 1T6BX 2OR8A 2WWOA 4ODUA 1MRFH 1G7HA 5MEND 5FKPB 3F7QA 1KEMH 3FS9A 1LD9B 3ZBMA 1BJ1J 2WNKA 1SVZA 1FNHA 4J1UB 4TS6A 3QDGB 5IW3A 4JPWH 1AAJA 1GKOA 3C9NB 1OL0A 4KK5C 1G5GA 2DM7A 2EXSA 3EGDB 5EF0A 5I19L 2OK0H 3MYJB 4PJIB 1HEZA 1YMMB 4P2RA 3VRLE 2OMZB 1A4KA 3UERA 1JPTH 1RERA 4WU7B 5I8KL 3A0OA 4LRIA 2YMXH 5EOQL 1M53A 1MVUB 1XH0A 5T3XE 2FT8A 1N8ZA 4HG4K 1VZGA 4L9LB 3X11A 3CU7A 1IGJA 2VR3A 4E9XA 1NFDA 8PAZA 1LVEA 1XXDC 5ALCL 2NNXA 5IBLD 4R7XA 2B16A 1UM5L 3CZLA 3LB6C 5EZJB 5ITBL 3RZWA 3WMPA 2ETWA 1MLCB 3L7FB 4N0RA 3D09A 3NH7L 3O3DA 5T1LD 1LK2B 3AS0A 3UMTA 3P2BA 1KEGH 4XHQA 1IMHC 1V27A 3W0WA 4ZUSB 1TSHA 1UB5B 1OSPL 2JKJA 4XCYA 2C9VA 3RFZB 2R29L 3KWWB 4XNMB 1ERNA 2QKIB 3L08A 3AUVA 2VDNH 3VXSE 4F33A 1T1ZB 4YR6B 3BP7A 3BUIA 4JGJA 4NKMB 1MPAL 1X7QA 2Y5EA 3L45A 5HGAB 2YA0A 3Q48A 4G6KL 4CSPA 1TDQA 2X40A 4OV5A 1NCJA 4EI0A 3ULVD 1JF5A 1GMEA 1CLZH 1NCBL 4LEXH 4ELME 1UA6H 4NC1C 3QXDA 2WBJB 5A2AA 2E74C 2FX9H 5IUSA 2PYED 1OAYL 3LS5H 3QUXC 3LN4B 4AQEA 1PLBA 1FZKB 2W94A 4ODXB 5JIDA 2ZKWA 2P8PA 4P5TB 1EFXA 2XDHA 5IHZB 3U30C 3IU4H 5HVHC 2EEXA 2VDOH 2VW4A 3QJHA 5I16A 5EDSA 5EZIL 5DQJB 3G5VA 3ULUF 5J11B 3VRIB 3SYPA 3DGDA 3SDAA 1JZHA 3C08L 2G9HA 4XPGL 1DBBL 5CJQL 4KX7A 3S3DB 3P11H 1T04A 2VDMB 4PHZA 1HT6A 2F08A 2HVBA 4L9DA 5AW4B 4CADA 2VABB 1R33A 4EI5C 2FJUB 4EO5A 1ZTXH 1BD2A 1R3HB 2V3EA 2NNAA 4RA0C 1HAWA 2OQJB 1MCQA 4RZCA 3QZMA 5DCCA 4QTIL 3SOBH 3ARVA 3VXMD 3SBWA 1UUSA 4PJFB 2HFGL 3DC0A 5C09E 1P9MC 1S7RA 1MZZA 4KVNL 4PEEA 2QVIA 1T6WA 2F19L 5KVEE 3DGGB 2DKMA 3A21A 4NCDA 5E4EB 3T8XA 3D50A 3S98A 4ZO8A 2V5YA 2C26A 1F90L 5H94A 3WFHA 3EDKA 4GRWE 2AKRB 3WIIL 5I5IA 4OZHE 4HDIA 5MEQA 1LEIB 2QSQA 4LSVH 5K69A 2A6KA 3ZE2E 4PJ7A 3MLTA 4HH8A 1KCVH 1N3NB 4Y4HB 3RWCB 1UA3A 3GZOA 5EFIB 4WUUD 3FH8A 2DN7A 3DPBA 1VHPA 4HIHA 1IBBA 2YMOA 1A4BA 4CVWA 1FNEA 1RCYA 2OSWA 4W9CC 4FFYH 4NWTH 1RZPA 1XCTA 2F58L 2R7EA 5HDBE 4J6RL 1AC6A 3RGVA 4UTBL 3DMMC 3STLB 3UTZB 4GG8A 2X4OB 5AAWA 3WFDL 2FLBT 2W91A 4WI5A 4JFDD 2LU4A 3GI8L 4G8GD 1AQKH 4CMMB 5C0JB 3T1WA 4Y5XC 1U2CA 4L0PB 5K9KA 3EFDL 2P7TB 1ILUA 1OPGL 1QO3A 2DS4A 3BP4A 4R8WL 4RGOH 2M83A 4XP9L 1KIQA 1A7QH 2X4NA 3JZYA 3LHAA 4N3UA 1FAIL 1U95B 1JGVL 2Q20A 1O6VA 4WFEE 2VRAA 1MHCB 2VXVL 3AMKA 4HHGA 1GR7A 4W6YB 5GRXG 5EDXA 2JI1A 1XGUB 3CVHB 1OXYA 2G5RA 3B9KA 3QE5A 1HYSD 3CSPA 1Q1JL 4JM2C 2EUXA 4KHXL 1P7QA 1A6VL 2RB8A 2Z35A 3CZNA 2HLFC 3NAAH 4LCIL 4YHYC 2BP8B 3AM8A 3WLWC 1KDIA 3GXIA 1WAPA 2YMTA 5L4IA 1GPOH 1BBJB 1IZJA 1D6VH 1ZT1B 5DJ2A 3K0YA 3QBTB 1PKQA 4KU1A 4ELMB 4P2QE 1M7IB 2VN3A 2P9RA 1LJMA 3EDFA 4PSRA 3NPZB 1EZUA 2DIJA 5DZ9A 2JH2A 5IESH 3HS0B 2K7PA 5FW7A 5DRXA 3UL4A 2W60A 5D7KD 2E7HA 4DKFL 1SZNA 2ZAIA 5TDNA 3SGJC 2G3NA 4LEOB 4JS7A 5C1MB 4N25A 3O41B 2M26A 4OT1H 4R97B 4U1MB 4GAGH 2OPCA 3FO2A 3GHBH 1J8HE 3QZWA 4KY1H 2QQQA 2YXMA 1U93B 3B1TA 1FC1A 2Y22A 4P49A 1BDYA 3OGCA 4L3AA 1CJYA 4KXBA 3O2WH 4RRPA 2EDXA 4OGQC 3OKOB 4O02H 1A3RL 1R3JA 3NG5A 1RULH 4CBPA 2VISB 3P73A 2EDRA 3FULA 1HZLA 3PY9A 3KGSA 2GITA 3LN5A 4JG0L 2HUEA 3CFBB 1O6TA 2YRPA 4M1CD 5ENWB 2PWGA 1A6UL 1NJ9B 1LWRA 2FECI 4IW4C 3MJWA 4IJ3B 1KB5H 3JWNH 1V3LA 3PWLB 4G7VL 3QDJB 5TQ2L 2WUCL 3PDGA 1OCZB 3VSVA 4XCFL 2R8SL 4KTDH 1JGUL 2E76C 4GRWB 6PCYA 4NGHL 2X1QA 2CUMA 3G6DL 3X14A 1GGBH 4OZHB 4MX7A 2ID5A 1IC7L 4JZJA 3HCVB 3V0WH 3ISRA 3RTQD 5I23A 3ZE2B 5ALBH 1RIVH 5BO1H 3K7UA 3BEWA 4OF3A 4U6YB 4PSPA 2NDGA 3MV11 4LP5A 1A14H 1S9WB 4RAHA 1IC0A 5IIEB 5CLTA 3ESOA 1OW0A 5GS3A 4APXB 3RZCA 4WI0A 1DEEB 4OVUA 4AZ8A 2AJUL 4PRIB 4XVOA 4YDKH 4YXKH 2IBBA 4JO2H 5HDBB 1ORSB 1UD2A 3QEUB 2BVOB 4HIJA 1T1YB 5FX3A 5IQOA 1B4TA 5DHVB 3B2XA 1JD7A 5AQ0A 5LG6A 2J5WA 3BWUC 4YFEA 2P46B 2GKIA 5IT2H 5DJZB 1VZIA 1JSYA 2PTTA 5DVNA 4X5XB 4UV7L 3LRKA 5CSBA 4DP4X 2JKWA 3NCEB 4Y4FC 2XKNB 3F7VA 5EZLA 3UJTL 3UG3A 4I3RL 5KOVC 4A63A 5L4FA 3H42H 4L8SC 1MDAA 5LCVL 1NBCA 2R1WB 5TK2A 5GJSH 3KWUA 5CIPA 2ZICA 2IPUG 4H8WH 5AWNL 1F6AA 3ULUH 3VXRA 2XX0A 5FOBA 1N64L 5E2UH 5DRZA 3TYFA 3S37L 2YEQA 3KBPA 2ZPKL 1DJYA 2PXYB 3LXBA 2DEXX 3B5GA 1QP1A 4LSSL 4ZMYA 3TO4B 3IDNA 5BV7L 3VWJC 4AQZA 1PD1A 2H1LM 2DM4A 1RPQA 4U6HB 2Y1AA 3S4SA 3G04B 4GW4B 4ZOBA 1IQDA 2EIZA 2WOBA 4L37B 2ICEC 4TVPH 1SOQA 4UU9B 3BMWA 4ZMTA 2WMPB 2X10A 1MCFA 3MRPA 5JMOC 3S7GA 1H3GA 5DK0A 3BRGC 2X4QA 2NY5L 3QXVA 5KYNA 2AABH 2ROYA 2A3TA 1JGLH 3X1FA 3EJCA 1MWOA 3LKOB 2B8OT 4KVPA 3UAAA 1KGIA 1G1CA 4PJHE 4M5YL 3TVMB 1RZKL 4QWWD 4A67A 3EOAA 1J8HB 2OCCB 1M6OB 3LQAC 2BNQD 4Y2DD 5SX5H 3P0VH 1XR9A 3PQYD 5DF0A 4W9JC 3VXTB 1OCRB 3MV7E 3WEBA 2D03L 2ICWA 1MCSA 4GXUM 4U0QB 5DK2B 4J4PD 4ZMQA 4UIMB 2NY2D 4NN5B 3A6BL 4PCYA 1TFHA 3BD5A 4ZDHA 1OZUA 2WXOA 2CUHA 3UBXB 4WCYL 4K55A 4KJYB 4HH9B 3CFEA 4LLAA 3BZFB 5I6XC 3CH1B 3KLDA 1MHEB 2JSFA 5GS2H 2ICWJ 5B8CA 1W8NA 4A55A 5AB0A 1U91B 2GUYA 1KBKA 5HI3D 4HK3N 3CPLA 4MB3A 2X2YA 4NXKA 4AL8C 5JIMA 4NRZB 1I1AA 1AZRA 1HQ4B