2XV2A

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caahaam), chemically reduced, ph4.2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
124
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKGEQYMFFCAAHAAMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Metal-Binding Loop Length is a Determinant of the Pka of a Histidine Ligand at a Type 1 Copper Site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 28
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xv2A00
2A3TA 3DIVA 1HAUA 2XVBA 3X1NA 1ASPA 4YSTA 1ILSA 1NIDA 1PY0A 3CVBA 1ZPUA 1OE2A 1TEFA 1XB8A 3ZIYA 2FQFA 1N68A 1JXDA 1A4AA 3ERXA 4A68A 2BO0A 2J57A 3WIAA 1PLCA 1XMEB 2I7SA 2RACA 4BK5C 2WSDA 4P5RA 7PCYA 1M56B 2LLNA 2BWDA 1ZDSA 2PPFA 3BVDB 3FU7B 5F7AA 5I6NA 3NJIA 3NSDA 1L9QA 1XB6A 4EF3A 1CC3A 4N8UA 1BEXA 3FQYA 2IDFA 3QJQB 4JHVA 2QDWA 2ZONA 3AZUA 3UABA 1W6LA 3PPSA 1AS8A 2UX6A 2GHZA 1GYCA 2BP8A 1KDIA 4YSCA 2PPAA 4Q89A 3QJRB 2FQDA 2R7EB 1WS8A 1GY2A 3EH5B 4QLWA 2IDTA 2MRYA 2EILB 4E9YA 3N55A 4G7SB 2VSMB 3FQ2A 4G7RB 2ZWNA 3TA4D 4AKPA 1PF3A 1AIZA 1KDJA 2HX9A 5I6PA 3T71A 4GYBA 3S3BB 3CDZA 3MX0B 1JOIA 1NIBA 3EF4A 1OF0A 5D4HA 2YQBA 2GB2A 1PZCA 5B1JC 3S3CB 2XXGA 1A4BA 2E86A 1JZHA 1E67A 1YLBB 1KYAA 4G7QB 4YVUA 3N2JA 3QPKA 2JKWA 4PCYA 1ID2A 3PLYA 1W8EA 2J56A 3NJFA 1JZJA 1TEGA 2FT6A 2XX0A 3FYIB 1PNCA 2IWKA 2XYBA 5FC9A 1BAWA 4HIPA 2IAAC 2GI0A 3UGEA 5I6OA 1TU2A 2PPEA 3U25A 4CSPA 4YL4A 1A65A 3S8GB 4DP1X 6PCYA 2Q5BA 1BQRA 4UF7C 4A2HA 4MFHA 4HCFA 5B1BB 1T5KA 2VW7A 1SHWA 2AVFA 1MZZA 1SNRA 2GBAA 1AG6A 3G5WA 1E5YA 2YAMA 4M3HA 1EHKB 1SDDA 2I85A 3KW8A 5D4IA 1NDTA 1PLAA 1NZRA 2YARA 4E9TA 2X88A 4DP4X 4BXSV 3FQ1A 2EIMB 3NJKA 1IC0A 2YAFA 4M4RB 4E9WA 1OE3A 1BQKA 1OCOB 2CBPA 4F2FA 3PCYA 3UAEA 3HEIB 3CVDA 2CUAA 1XB3A 1AS7A 5B7EA 1IBZA 3FU8A 9PCYA 1JVLA 1SFHA 1ET7A 2PPDA 3ABLB 1CYXA 1OCCB 4BDVA 5I5MA 1WAEA 2CJ3A 1NPJA 3ABMB 5AZUA 4HCIA 2UXVA 1BXVA 2BP0B 5E9NA 2EIKB 2XV2A 2IDSA 2PP7A 4DP0X 4F2EA 7PAZA 2P80A 3ABKB 1PLBA 5B1KA 2HRGA 2UX7A 3AG1B 1ILUA 1E65A 3HB3B 3GYRA 4A66A 4HCGA 1GW0A 5B1AB 4KOCA 2H3XC 2W88A 5LDUA 2GC7C 2TSAA 3EH3B 3TASA 2FNWA 4YSUA 1ASOA 2QPEB 1GS8A 4WTQA 1AS6A 4KO7A 1L9PA 1KGYE 3BQVA 5I26A 1NIFA 3WNJA 4HHGA 3JT2A 3DKHA 4K9JA 1JZGA 2XV0A 2IH8A 4E9QA 4YSEA 2X87A 3JTBA 3X1BA 1AG0A 4HHWA 2QPDB 1PAZA 3S3DB 2YAPA 1AACA 1V55B 3FSVA 2PLTA 5B3SB 4WKXA 1M9WA 3X1GA 2YAEA 2Y69B 1A3ZA 1J9SA 4HZ1A 1KCWA 1SJMA 2FT7A 2HX8A 4DP9X 4Q8BA 2QDVA 3QQXA 3NJGA 2DWSA 1AOZA 1QLEB 1KBWA 5B7FA 3FPXA 2HLEB 1AR1B 1ZV2A 2FQEA 3IEAA 1MG2C 3IE9A 2W8CA 3OM3B 1ZDQA 4L0PB 4X4KA 1E30A 3EHBB 2FT8A 2AZAA 1KBVA 1SFDA 5D4JA 4DP5X 3ZX1A 2GSMB 2OCCB 3NJNA 2H5UA 2I7OA 3T6WA 2PCFA 3SBRA 4TXVB 3ASOB 2PPCA 2B08A 1BYPA 4DP7X 1JZIA 4PAZA 2GC4C 1PMYA 3FS9A 1BXAA 2XWZA 1ADWA 4UANA 5TK2A 1JZEA 1IKOP 1A8ZA 3FYEB 5I6KA 4BXVA 1AZNA 1QNIA 4E9XA 1ET5A 4G70B 1VLXA 2BP8B 3AG2B 2VSKB 1NINA 1MZYA 3OMAB 1UATA 3NP3A 5AKRA 4GP4B 3NJLA 3WI9A 4YSDA 3S8FB 4YSSA 1BXUA 2FWLB 3ABGA 3RYMA 3ASNB 1GR7A 2UXGA 1MG3C 3ZDWA 3H4HA 4GP8B 1JXFA 3NSYA 1GSKA 3AG4B 2FJSA 1L9SA 6PAZA 1V54B 3NP4A 1L9TA 5F7BA 2IH9A 2BW5A 3D12B 2P80D 1PZBA 1V10A 4YSAA 2AFNA 2H47C 3QJUB 1X9RA 2VM3A 1RZPA 2YAQA 3OMIB 1FFTB 4E9VA 5TK4A 3FU9A 1IUZA 3PAVA 2XV3A 4A67A 3C75A 3FSZA 2CAKA 5I6LA 2DYRB 1NICA 2XUWA 3IN2A 1WS7A 3NT0A 2IDQA 1AZRA 2PCYA 4UAHA 4NERA 1L9OA 5I6MA 3AY2A 4DP2X 4GXFA 2IWEA 1B3IA 5B1JA 1CYWA 3CZUB 4ZK8A 1GS6X 1SDDB 4KNTA 1IBYA 2BZCA 2GIMA 3PXLA 1A4CA 2QT6A 2Q9OA 4FAAB 5IY5B 3FT0A 4P5SA 1SHXA 2HX7A 1ASQA 1I53A 2OJ1A 1QHQA 3NJHA 3FU7A 4BWWA 2YXWA 4YSQA 1PNDA 2DY2A 2TSBA 1NPNA 3H56A 1HFUA 3TU6A 2MTAA 4AKOA 1OV8A 2YAHA 2IDUA 4BWTA 2AZUA 2EINB 3AW5A 1J9TA 4JHUA 4BDVB 3PAUA 3KW7A 2XXFA 2DV6A 1L9RA 2BWIA 3OD3A 4W9ZA 2AANA 3MBWB 3WNIA 4RH4A 2R7EA 3NSFA 2DYSB 4NB7A 1WA2X 2FQGA 3X1EA 1RKRA 2YAOA 3FSAA 1ETJA 3X2QB 5AFAA 3H4FA 2XLLA 4ENZA 4BWUA 2PP9A 1DYZA 3V9CA 3UADA 4E9SA 1OOWA 2VM4A 1M57B 2WO2B 3SQRA 1AANA 2PP8A 4KOBA 1SF5A 1F56A 4KNSA 4AKQA 2JFCA 5I28A 3ZBMA 3OQRA 1NIAA 4DP6X 3QJSB 1RZQA 4GY4A 4AZUA 2DWTA 4NAJA 1AAJA 8PAZA 3UAAA 1E5ZA 1ET8A 3V9EA 4HAKA 4F7KA 3X1FA 3IBOA 4YSRA 3T6VA 1BQ5A 4A2FA 1URIA 3SBPA 4DPBX 1AZCA 1OE1A 2CALA 3CVCA 3IN0A 2J5WA 1OCRB 3OMNB 4W1TA 2XU9A 3T6XA 1CURA 2Y1AA 4G71B 3T6ZA 1J5CA 4HALA 4KNUA 4A2DA 1J5DA 1MDAA 5ANHA 1FWXA 2OV0A 2B3IA 1GS7A 2EIJB 3GXUB 1RCYA 2UXTA 3CDZB 4FA7B 2VMJA 2N0MA 1CUOA 3NYKA 3AG3B 4DPCX 2VW6A 2ZXWB 3QJVB 5PAZA 3WKQA 3SBQA 4CSZA 2WO3B 1NWPA 1KV7A 1J9QA 4YSPA 4E9RA 2UXFA 1ZIAA 3T9WA 2VW4A 1TKWA 2HRHA 2BW4A 1KCBA 1NTDA 3NSCA 4G72B 3NJMA 1AZBA 1X9UA 4DP8X 3L45A 1WA0X 1WA1X 2BP0A 1AZUA 1PZAA 2YXVA 5B7MA 1HAWA 3QJTB 1OCZB 1DZ0A 3EH4B 4N4YB 4JKNA 1ZIBA 4YSOA 3WG7B 4KO5A 1JXGA 1J9RA 2HXAA 4A2GA 1NWOA 4A2EA 1R1CA 3PAZA 2JXMA 2VN3A 1SF3A 4QKTA 3FPYA 4KO6A 5PCYA 2FTAA 4DPAX 2BZ7A 1N70A 2CCWA 5EHFA 3GDCA 5I5JA 1JERA 1W6WA 3TBCA 2ZOOA 3WKPA 1AQ8A 2HZHA 1JZFA 1PCSA 3FSWA 4AX3A 1NIEA 3DTUB 4KO9A 1BYOA 2J55A 1FA4A 5A7EA 1GY1A 2XX1A 4YVNA 3NJJA 1JVOA 3TBBA 2BHFA 5I5IA 2NRDA 3UACA 4AI7A 2IWFA 3CG8A 4GP5B 1EZLA
chains in the Genus database with same CATH superfamily
2FIKA 5DSCB 4AYBA 1HH6A 5DHMC 3ARDA 2NY0D 4JZNA 5IJKA 5KVEE 1IGCH 4OZFB 3MBXL 2X9ZA 4ZO9A 2ZX8A 4I2XB 4UTAH 1BOGA 3L1OL 5E94B 3K6IA 4BH7A 5KVEL 4KKBD 4M7JL 4L8CA 3UTSB 1DCLA 4K8RD 2CRYA 4FQ1L 4UZSA 1MH5B 1OGTA 5D96B 4YHYB 2D4FA 1QMUA 3HE7B 3I9PA 4GMSL 5CEXB 5I6NA 2QPFA 5DVPA 1BVNP 1BFVL 1L9QA 2A6IA 4QRBA 5HI3D 4N8UA 1YMMD 3FO1A 2R0ZH 1WIPA 2EDWA 3MROA 4JO4H 3MNDA 1A6VL 4JHVA 4DAGH 1YYLH 5F9WC 4K3GA 4XNYH 5J89A 1PG7L 5T5NF 3ESUF 1G9MC 4HDIB 3ARQA 4UIMB 1A3RL 4Y9CA 4LSPH 3RDTD 4GBXA 2VO5A 4LK4A 5AW8B 1GY2A 1NFDF 1VCBC 3PJSB 2GITB 5JOEA 2W9LA 4I0CC 4HD9A 3D39E 3N55A 1KLUA 4KZ0A 3HG1D 2ESVA 2C3WA 4G7RB 3S97C 3EDEA 1ZLVK 2Y72A 1ZHLA 1VKXB 3CUPA 1HHKB 1DQLL 2C3GA 5J1TC 2V8LA 5ILTH 3QZBA 1AHWC 1YJDH 3QIUD 1L7IL 2PCPB 1MJ8L 3GQFA 5EOCL 3TWCL 4L29A 5HJ3A 3E1ZA 4ZS6D 5C0FB 3GBEA 2JQAA 2BVUA 3A4FA 4Y1AA 3SO3C 2ETWA 2FHCA 3CNKA 5HVFB 4KQ4L 3A4EA 3FZUC 2FJHB 3Q2NA 5C7ZA 5IMKB 4KVCH 1Y1UA 4NP9A 3APFA 4HIPA 4W9DC 5HYJE 2Z8VC 4WW2C 5KG9A 3SB3A 1MFBL 4R2GC 3ULUC 1WFMA 4RZKA 5GRUH 1S2EA 3AQZA 1JFHA 1NCDL 3V4VH 5FYJH 5I18H 1E8YA 3T1WA 1ZLSH 4A2HA 1BPVA 1S7UA 1FFRA 1XTLA 3B2UC 2BIHA 4DGYL 4X6CB 2MSPA 3SKOB 3HFFA 1RUKL 4OAWA 4U3CA 4NM8H 2VLRE 2E9BA 3KPMA 3IDIA 4IQHA 2EO1A 5IIEA 3O45B 3G5WA 2DMGA 3B5TA 5F7NC 2ICEC 2WLJA 4R9HA 3IYLW 4BZYA 4HOZA 1VGEH 2P5EE 4KUCD 1V3JA 4B5ZA 4WK4B 4RMBA 2X88A 4L3EB 1JAEA 2CDEA 1K2DA 2A9CA 4N9OB 5EF3A 4PRPB 4M7KH 1IC0A 3TX4A 3O9WB 3VMOA 2EDTA 2CBPA 1OCOB 2QKIC 1AGDB 5I75C 2BLFA 4WI7A 1XGTB 5I5RA 4DCQB 4PQXA 1C8QA 2OULB 3IF1B 3ROLB 3TN0C 3HMXL 2D9CA 1FPTH 1TZGH 4AV5A 5JDSB 3PAYA 4BV1A 2Z8RA 3FTZA 3SEPA 5HI5C 5FDYA 1ORQA 2CO7B 1NBZA 4NQDD 4IKNA 2WYZA 4DESA 1E28B 4LOUD 4NKMB 4D0BB 2DTMH 3QDAA 2N7BA 4N2CA 4K3DL 1KB5L 4PY7A 4OFKA 1YEKL 2G5RA 4MA3A 3ZDZB 3GMQB 2EH7H 4ZAKD 4MVBC 2PW1A 5ICXA 3IVKA 1UWGL 4QJ3B 4F7EA 2OMZA 2F19H 3EO0A 2Q8AH 3OJ2C 4MD4B 3WFDL 3WIIH 3FUJA 1HI6A 3C60D 4L37B 3QNXA 5MENE 2FNBA 4EIGB 4AQEB 1VZGA 4MDIB 2A6KB 4MMZA 3O6ML 1NIFA 4RZCA 1BD2D 3OAUL 1K8DA 4K9JA 4MRCA 4P5MB 5J3HD 5I24A 1RAMA 1UA6H 3CBKB 2GCYA 3T0DA 2EVGA 4GAFB 5EFIB 1SHSA 2VAJA 1F4AA 4HH9A 4MJ6A 1FORH 4F20A 1M6OB 2BSSA 3G9AB 5FS5A 3D2UD 1CF8L 3MNWB 3MRGA 4MCMA 4LGSB 5I1GH 1RZIA 5BUPA 1U3YA 3K80A 4BSWA 3V4VB 5EUOA 4CMMB 2JLLA 4YLCA 5TH2A 3FTYA 1SJMA 4ZMPA 4R4FH 3H7LA 1I3GH 2Y7SA 1NSNH 4DP9X 2DQFB 3KEHA 4ZFGH 1KGUA 2K6YA 2P43B 3WIFB 1MLBB 3PXJA 3TVMB 4MD0A 1KBWA 4FABH 3ZOAA 2H8PB 4PGBB 4X4KA 5TE7H 5F7WC 1NGWB 4B41A 3P30H 4K71C 1LP9A 1NCJA 3FUNA 4ZD3L 2JF1A 3SPJA 3NA4A 3MTRA 2I7OA 3D3VD 1FSKC 4LHUG 3V0JA 1P7KB 2BNRE 3QCTH 5LG1A 4LU5H 2NX5B 4UI2A 3EBIA 3HBZA 2QQNH 3UG5A 1ZVHA 4DP7X 3BPNB 1SJEA 4K55A 4KK9C 2NY6B 4LDOB 4S0HA 5DYOA 1I9RH 4MBOA 1AQKL 1NKGA 2IALB 5I6KA 4M3JA 4PD4J 1KEGL 2XWRA 4PS4L 1SM3L 1VLXA 3QBTB 4XTRD 5I66A 3ZTEA 2I32A 2VLLA 1KF9B 4S0TD 4H8WH 4Y89A 1LWJA 1DQQA 1MJJB 4JPWL 3TO4A 3FFDA 4PHZA 5I1DA 3KLKA 1NCNA 3LN5B 4P04A 1A6UH 1B0WA 4FZEL 3BHBA 5AWNL 3ZO0A 4HJGA 1P5VB 2BIQA 2WWKT 5K9OA 5ACZA 4XP4H 2NY2C 2FJSA 3CFEB 1MJUL 4FQJH 4I18C 4OLWL 2YPVH 1MREL 4R3SB 3TESA 5A1AA 2ZOTA 3GJEB 3GWJA 4B9JA 1S7SB 4G8IA 3RNKA 4JG0L 2WLYA 1CD0A 4HSCX 2NW2B 4Y4KB 3ZT6A 5CWSA 3KXFA 2VM3A 2VR3A 3CSYA 3RAJL 1WCBB 2YA1A 3U30C 4LQFL 3BP4A 5C71A 4WFGD 5C8JA 5IB4B 4M6OL 4JHAH 2G9HA 1X6LA 4MMXB 3DJSA 1OO2A 4U1LA 1DQDL 4PW9A 5E70A 5TDPB 2BINA 3FU6A 3T4AA 4IOIA 1OSPH 2W91A 3RJOA 1ROCA 3HC4L 3WHXB 5FFGA 4CILA 2FATH 2H7WA 1JE6A 1N3NA 1NGXB 5IESL 1MFAH 4Y9EA 4G7YL 3BH9B 4I1NB 1I82A 3BAYA 4KMTL 4KNTA 1IBYA 1T0MA 2FJGB 1PD1A 4XP5H 1Y6MR 3DX6A 4M00A 3WNOA 4AM0B 3UTZB 1UQSA 2E6QA 2QADB 3FDWA 5INDA 2QTVA 4Z3EA 1MCNA 1MIML 5B39A 5IFJB 3OZKA 2Q0ZX 1JXKA 2VDKB 2DQTL 1TTUA 3FU7A 3M45A 4KHXL 3BC9A 3RWHA 3HRZB 1S78C 2CR3A 4OM0L 2OMVA 3M6DA 1E4XI 3CQFA 5EDSA 4OI9A 2IAMC 3ARRA 4K7FB 5BS0E 1Q9WB 4PJDE 1OGAE 4WEBL 1NFDB 3RI5K 4EIBA 1CG9A 5IEHA 1P4BL 4GW5A 2WVVB 5DQ9A 3PWPA 1RKRA 4ZZKA 3GSRB 1GVIA 4JQXA 4RBPH 2H1XA 4JB9L 4UYQA 1TNNA 4XX1E 4EN3C 4I4WA 3VM7A 3PHQB 4Q9RL 1MI5E 5TGBA 3EYQD 2ICCA 2WN2A 2ZCLH 4QHNA 4XI5D 1TJHH 4J3OF 3ZY7A 4KK8C 4HVBA 2G30A 4OCLC 3CH1B 1JUFB 3TV3L 1EEZB 1A1MB 1XCQB 4APXA 4F37K 5FA4A 3C5JB 3MBXH 3QAZB 2N7SA 1TXKA 4JDEB 3RX7A 2R2BA 4RMQA 1MCRA 3MLXL 3WJMA 5KVEH 3QJSB 5FW6A 1PPIA 1F6AB 3D85A 1Z0NA 4M7JH 1PZUB 5D1QE 3D69B 4XCCL 1G6VK 3Q2WA 5BOZG 4S1QL 3EJYD 4FQ1H 5ABZA 1OB1B 5EMYA 4N9GB 4GMSH 5J4MA 2NT0A 2J1XA 1NEUA 2A2QT 4X8JB 4IMKC 1BFVH 5JORA 2D2CC 5H37A 1C7TA 3BZEA 1F00I 3D33A 2GFBA 3BQUC 3QPXL 5C9JA 1A6VH 2W07A 4QHLB 5IROD 5MERB 1GMEA 4KNUA 2ITDA 4Q4EA 1F1GA 3O4LE 4PJ8C 4F24A 1A3RH 4YGVA 4CJ0A 2X2UA 3VXSD 5GRZA 2QVKA 3NCJL 3NFPA 4HEPA 4HHAA 1A22B 1NMAL 2ZNWA 2DBJA 1UT2A 5DK2B 5T5FL 5JHBA 1DUYB 1ECYA 4WHTB 3MRMB 1DQLH 3R4RA 5C7XL 1G6RL 3NYKA 4Q6IC 3JYBA 1TOXA 2G2RA 2WLIA 1LE9A 5FFLA 1L7IH 5EOCH 1MJ8H 4ZFOB 3TWCH 1SLVA 1Q1PA 2QMKA 4I1RA 3HBGA 4U1NB 5DC2A 1TKWA 4WENB 2BW4A 3KWWB 5DZOA 1DO6A 3MMEA 3NH7L 4PJ5A 1BREA 4KQ4H 1TLMA 5KBDA 4ZSOA 3MLTA 1KTRL 3PV7A 5JHLL 3MGTB 3QJTB 4HIEB 3FFCD 1I8UA 4XGZA 4V11A 5DVLA 3KHQA 1MFBH 2YEQA 3P2BA 3WFBL 1ZGLB 4LOVA 3K6SA 1FNHA 3CXHK 1GTNA 1NCDH 1EHXA 3RWGB 3MACL 4ZW5A 2XWXA 4Z95L 3AGWA 4TLSA 2F54E 2F53E 1JNHA 3ZU8A 3QUYC 4DGYH 4EE2A 5E9AA 2K7QA 1SMDA 2J1KA 1Y6KR 3B3IA 4K7PY 2BZ7A 4TNWK 1NCIA 1RUKH 2R59A 3M1OA 4ZMAT 5EHFA 3GDCA 5HVHB 4ZUVB 1XXDC 1Y18A 4HUVB 2VAAB 4S11A 5LGJB 1RPQA 4YLQT 5E0QA 2LAGB 4WU7A 4P3DA 3P3RA 3NEEA 1QP1A 4N85A 1YC8A 5IFHL 1H3GA 4PRID 5T8IA 2HN7B 4ZX5A 3I02A 4PCSA 3P9MB 2APWA 1PX4A 3CFMA 4M93C 1O6VA 1EXGA 3TBTB 3SJVD 3HMXH 3JWDC 4BFBD 1U8QA 2GG1A 5KYYB 2K3TA 1UT9A 2ZX7A 5HVWA 5GRYA 1C5DA 4RX4D 1WQVT 3N1PC 4GSRA 2LLLA 4I0PB 3LZFL 1NIDA 2R69A 1KPUB 2VDLB 3BPCA 3NRFA 4RLDA 1RIVH 3MRDB 3TIDA 2K0RA 3CPLB 1PY4A 4FFTA 5DJZB 4YZFE 4HP5A 1RHHB 3QQDB 4K3DH 1KB5H 1YEKH 4Q4IA 1U21A 5JNYA 1FRGL 4P5TA 1SEBB 2BWDA 4JRFA 2H32B 4P23C 4PJDF 3DTXA 1JJUA 1UWGH 2OXGA 2XWEA 4YS4A 3WFDH 1OT4A 3ILPB 3PHOB 3B3BA 2VZUA 2F5AL 5K1NA 5A16B 5KAQG 3LDBB 3ZL1A 3UABA 1W6LA 4EEEA 3O6MH 2D0FA 5J11C 4TQEL 3OAUH 3BGMA 3F7QA 3IKCA 1GOFA 2H3KA 1KTCA 4B6ZA 5DC4B 1V7NL 5HGAA 1T1ZB 3QWOB 2AMUA 5LAXA 1G7JA 4J3OH 4MSWB 1NL0L 2X1XR 1CF8H 4XN5A 1O0VA 1Y0LB 1QFWL 1G0DA 1KB9J 3EUUA 3FTGB 3E2HB 3SKMA 1XCXA 4IW4C 3KPRA 2V17L 1OF0A 3PREA 3DX9B 3IS1X 5B3NA 5D6DC 2B1OA 3E6FB 4U1HA 1TCMA 2I07A 3O41A 1QD0A 3N2JA 4PCYA 4H2CA 2NY1D 5LJYH 2JCWA 4R7DB 2EEAA 1DN0B 4RISH 2YD7A 3K0YA 3T0VA 35C8L 2DM2A 2E6JA 4L2LA 3MRRA 4ZD3H 4MJIE 3EOTL 4FD0A 3TZVD 4WVRA 3D0VA 4ZPTB 3VX1A 4MHHI 1BECA 4WEEA 4FTVD 1DEEB 3ZE2B 2Q5BA 1PG7W 1E5AA 3C09C 3QH3A 3HZKA 3RTQC 1TG8A 4B50A 3M1BB 2G60H 1QPXA 1GIGL 2DQGL 4W9LC 5B1BB 3BSHA 1I8MB 1X7SA 4JE0A 1AQKH 1M4KA 2XPGB 5CLWA 1KEGH 4V2CB 4PS4H 2VRAA 5IB5A 1XVSA 4DUVA 1UD2A 2XT1B 1RH8A 1OGSA 2Z0BA 1RK7A 3QQ3A 3FQNA 4JPWH 1JF1B 5DHVA 3ZYOA 5EU5B 2XKSA 3UROR 1ZV9A 4FZEH 1FO0L 4FQXC 5AWNH 4DP4X 5JPMA 4WI5A 1KYFA 2YAFA 4M4RB 3I85A 3F7VB 2IPKA 2M8XA 1OE3A 2DIJA 1D9KC 2ZICA 3DV6A 2RB8A 4KH2A 3UAEA 1MJUH 1P5UA 2Q3AA 3KDMB 4OLWH 1T1XB 4Q2ZA 5CZKA 1MREH 3EDJA 5KYXB 2ZOWA 4EUPB 4H88L 4LF3B 4LPVA 4JG0H 3KLAB 3F7KA 4DIXA 1RP9A 4JFPA 3VXQA 4FQCL 3RAJH 3O2VL 4OD3L 1LMKA 4LQFH 4DP0X 2UX7A 5SWZB 3RL1B 3EDKA 1X4YA 1DQDH 1N8ZB 4NO2B 1ZT4A 3HC4H 1HS6A 1N6VA 1IQDA 4WGWB 2FDBP 2L7EA 2G5BB 2NZ1A 2ZUQC 1TQSA 4UNIA 1U3HD 2I5YL 2XWJA 5IESH 3P2DA 1KTDA 3HTLX 3VD1A 3INUL 4KV5E 4G7YH 5TDNA 4KMTH 3U9UB 4GG8B 2XV0A 3B2DC 3VXRD 3GRBA 5IVOA 4CVZA 5D5MA 3QUKA 4FULA 4ONHB 3WAKA 2WXIA 1KGCE 3GBML 3UTTE 1I3UA 3R18A 4DZ8A 3C6SA 2DQTH 1DFBL 1ZY9A 2HVJB 2HVKB 4KHXH 4JN1L 5DFVD 4MXVE 5BQ7A 4X8GA 4OF6A 5HD8D 1CXFA 4OM0H 5CGYD 1BWWA 1OAXL 2XTJC 1HH6B 1QG3A 3L3HA 4YZFF 4G1MB 3AXLA 4JZNB 2BIPA 2OR9L 4XH2A 1GRWA 3NFSL 4YDJA 5C3TA 4WEBH 3PJNA 5C0RL 3GLZA 4BFOA 5BNXD 1AR1B 5CGBA 2KHAA 3IE9A 2W8CA 3HNVL 1P4BH 3QR1A 4BH7B 2FT8A 1KCKA 4PG9A 3X3GL 1JN6A 4L8CB 1EZUA 4XNZC 5TTRA 1OGTB 3GF8A 4I13B 4N8VA 4W4OA 3AQYA 5GQBA 3C87A 1NC2A 3A24A 2Y22A 4JB9H 3G5VA 2UZYA 5I73B 3LH2L 2Z91A 1QSEE 2A6IB 5BZXA 5AW9B 4F8TA 5D7EA 4UOQA 3SYQA 3FO1B 4PAZA 3UJJL 2AF2A 4A1RA 2GC4C 3VSUA 4B97A 3MROB 4H40A 3TV3H 3KH3A 1F3JA 2AK4A 3MR9A 4TVPE 3UYRL 2IFGA 3NDZE 5EO1A 2ROYA 1K4DB 3KD4A 3LMJH 3NCBB 4GBXB 1AC0A 3GXNA 3NJLA 4DGWC 3NESA 4TVPL 2NR6C 4TRPL 2P44B 1YEHL 2FCBA 4XCCH 2W92A 2ESVB 5DA4A 4F58L 4LPWA 2VRQA 4S1QH 3AITA 1A7PL 1ZHLB 1JTTA 3CUPB 3NIFF 4R5VA 2KERA 1BM3L 4AGNA 5DJCA 1OW0A 1DJXA 2OTUB 3DHJA 3K8KA 2CO6B 2VE6A 3VE0A 4NDMA 5I1EL 4F80A 5HJ3B 2XZCL 3QPXH 4V1DD 2YD4A 2EYSA 3WEOA 4Z77A 4NAMA 4Y1AB 1ITBB 5AVSB 1L7TL 2DEYX 4FL4B 2GQHA 3ECBA 1PGRB 5AOIA 3F12A 3BZ4B 3LZRA 4EO5A 2NW3A 2B4CC 2XN0A 4PRHD 3DLQR 1MHCA 3NCJH 2X6UA 4HIQA 3PY9A 1NMAH 4BHUI 2ICWB 5KG9B 5T5FH 2OJZL 3NK4A 4F7PA 2EE3A 1G6RH 2XN9D 1P2CB 4JFFD 2A74A 2X6BA 3ZJAA 4OGYL 1GYUA 3OWRA 1BMWA 4K73A 1S7UB 3I3BA 4NUJA 1V05A 4AYFB 3N91A 4JFYA 3M7FB 4OAWB 3QUZC 5DGRA 3KPMB 3IDIB 5IIEB 2EXWD 4OJDH 1GS6X 3VFMA 4AXWA 1R5VA 1A4CA 4LVNC 5D7LD 1FYTD 3V0IA 1OSZA 3MNMA 1QKZL 3LVEA 4MXQD 2CDEB 4MA1C 5D93C 1LJMA 5EULV 1K2DB 3VMPA 5BS0B 4G7VL 4PJDB 1I53A 2WSPA 3NABL 1G0XA 3M17B 1T4KA 3WFBH 1WIUA 4UOW0 1KFGA 4RETB 3H9SD 3MACH 5HGBA 4Z95H 4HJ0D 4ABVA 4EXKA 3QHZL 2HCZX 1OV8A 3MOQA 1E40A 1F18A 1NBZB 3VWJD 1AQHA 1DUZB 1L9RA 3LHAA 1A9EA 3OD3A 4QGYA 5I82A 4F2MA 3K4DA 5CCKL 1OAJA 3O81A 1PIFA 4ORGA 3TJHD 3NSFA 2J25A 2FUTA 1TNMA 2AJYL 5F44A 2YGQA 3C6LC 4PY7B 3ZTJG 4I89A 1Z0MA 3LS4L 4MA3B 2PCXA 3DGDA 1FVEB 5IKCB 5ICXB 4H0GA 4OCNC 3QXUA 3IVKB 3K2KA 1J0HA 5DFTA 4KV5F 4F7EB 2OMZB 4YBLC 3EO0B 2RALA 3QG6B 2VSCA 1OOWA 2XC8A 4MMZB 3LZFH 4FGMA 1EPFA 2GKIA 4LRIC 2NTFA 4RZCB 1ED3B 1K8DB 1LE5B 3TM6A 5E5MA 2UZXA 1IZKA 1HH9A 1DANT 4PB0L 1KJ3L 4GIOA 4HH9B 4PV1C 2C1PA 1U30A 2DL9A 2ZJSL 4PBWD 2Y07H 2BSSB 2IAND 4FHKA 1FRGH 3I84A 3MRGB 1RZIB 5A3IC 4XNXL 2J5WA 3CVCA 1G6RB 4BSWB 4XWOC 5J56B 5EUOB 2IPUG 3N5AA 2Y2YA 3T6XA 2VISA 2F5AH 2VZSA 2ITEA 2ZKHH 4ZNEE 2OL3A 2Y6SC 5E6IC 5SWSA 1OY3B 2NNCA 1KPRB 2R1YB 4MD0B 1TSHA 4QR7A 2X2JA 4L8BA 5F7FA 4TQEH 3MV11 5ES4B 3IXTA 2KMWA 3GIZL 2ZX5A 4NUPA 5I0YA 2B3IA 1W91A 3RIKA 3GHEL 3OXSA 1V7NH 4QIRA 4FFVD 5F71A 1JPSL 1JTPA 1NL0H 3CFIC 4OFYD 3SDAB 2MWCA 3EIFA 1W8NA 3DA0A 3STLB 3V10A 3W3BA 3DHMA 5D96C 5KSBA 1QFWH 4YHYC 5CD5D 4X6DA 1KACB 3HE7C 1U4EA 2B5IB 3NCEB 2C9VA 2WTOA 4U1SB 1SJEB 4UQBA 4L8DA 5DRXA 5DYOB 2PYEE 2V17H 2I60L 2WO3B 4P2QD 5C07E 3GD1C 2QVMA 4NPYB 1BZOA 2FO1A 4WDIB 3PIQA 1VFOA 5I66B 3EKCA 3VFWA 4N2DA 4H20L 1DQQB 1ZV5A 5F1IA 4E41A 3TO4B 3FFDB 5I1DB 3OVUB 2WOYA 35C8H 5IHZA 5HYSG 4HJGB 2E7MA 3EOTH 3ZMRA 3ZGIA 5K9OB 3SDCD 4JM2D 5ACZB 3ZE0B 1AGBB 4FHJA 1E9PA 2ZUTA 3PAZA 1MHEA 1R3LA 4YDLB 3ARBD 3ECQA 3WTXA 1GIGH 2DQGH 5T1KA 1XMWA 1TTAA 3BDYL 1LQSR 3I9IA 4WTZG 2ZOKA 4X6EA 2LFGA 3RNKB 3HI5L 2V9UA 4NPKA 1A0QL 4XB8A 4HIIA 1OD7A 3TBCA 3ZL4L 3KZ8A 3KXFB 1IB5A 4FOMA 4P2RD 1W2KT 3BP4B 5D1ZD 5BRZE 4KITB 1KCUL 1WRFA 3O4OB 5I16A 1FO0H 2A4ZA 1XWVA 1Z66A 2V4LA 2AP2A 3RG1C 5I76B 2LU4A 3I6SA 4G2AA 5AW0B 5H37H 1MCEA 4Z7UE 1UWEL 5F0MB 5F7YC 3T4AB 2NRDA 3F62A 5HHOE 4IOIB 1MFDL 3K8LA 4P2OA 3DMMA 1PKOA 5DVMA 4P3CL 1E4JA 2AGJL 4H88H 1N3NB 3APCA 3PQYD 1K8IA 2VMDA 1T0MB 1RZ8B 4C55A 2J71A 3H55A 4FQCH 3R7RA 3VWKA 1A6PA 2CJUL 3O2VH 3ZXAC 5JW4N 4OD3H 3DX6B 4Q56A 4A68A 5C0ND 1C12A 2WXKA 4QF1A 1J9CT 1UQSB 2R0KL 4KZCA 5KOVC 5B39B 4MJ5A 5F7AA 3BVDB 3FU7B 4KJPC 1UZ8B 2IH3A 3O9WC 3V79C 2CUHA 5HI4C 3OKDA 2F2HA 2OMVB 5DFWH 3DBXA 1J0YA 3RX5A 5IJCC 2WO4A 1JCKA 1R34A 2I5YH 4Y2LA 2N01B 1TCRA 3MV9A 1JIBA 4A2LA 3INUH 1CG9B 4AENA 5IEHB 5JXAL 4EDWL 1B4TA 4O2CA 3ARSA 2H41A 4GW5B 2FQDA 4X4ME 4X7CC 4N68A 3TH2T 3ZRFC 3TJPA 3NIFB 5B38G 5DQ9B 3PWPB 3UDWC 4PTUA 4GIPD 1IU1A 3WFZA 2CK2A 1C8PA 3EFOA 1AYRA 3GBMH 4RAUA 3QSKB 1R5WA 2F7IA 1N64L 4I4WB 4UQ9A 1DFBH 2WLLB 5TGBB 4JN1H 1SN0A 3DO7A 1Y7VA 4QHNB 2AAAA 1ZK9A 5BMFL 1YZZA 1NIBA 4MJIB 2A6JA 2ZE0A 3EYVB 1OAXH 2E59A 2JWYA 3BXNB 2AV7A 2OR9H 1YJDC 5IM7A 4HJEA 3NFSH 1YMMA 4APXB 4BH8A 5C0RH 1KIRB 2ORBL 3VQ1C 1U42A 3HNVH 1XH1A 3G6AA 3WJMB 2KPWA 3ZKXC 1OZTG 3O2DA 5D7JC 3X3GH 2V5MA 3U2JA 2OX5A 4DWHA 5I6OA 5FO7A 1TU2A 1ND0A 2F08A 4CSPA 4AMXA 3S8GB 3TH3T 3DNKA 3LH2H 5JORB 3FB8B 2WZ6A 5HXMA 5AW1B 2V5YA 5IQ9A 3BZEB 3MBED 3UJJH 1PJ9A 2A0LC 2GFBB 4LBAA 2TRHA 5C9JB 3W39A 5AOKA 1AE6L 2BS8A 2GT9A 2W07B 3ATFA 4N2MA 4CU6A 5DGQA 1PL3A 2ITDB 1MZZA 2WQAA 2VDOL 3P4LA 3UYRH 1DHKA 4FCHA 3CZJA 2O5YL 4YGVB 3KW8A 1SXAA 3TVMC 2OM5A 1O6SB 4HHAB 4FN0A 4TVPH 4TRPH 1YEHH 4F58H 4N0CC 4H4NA 2JKXA 1HK6A 1J8HE 1BM3H 2H2SD 5HHXH 2G2RB 2WLIB 1I1CA 4XMPL 1MCWW 3FN9A 1I7UB 4NN7B 5I1EH 1JP5A 2OL3L 4WFED 2XZCH 4PR5A 4EXPX 5C86A 1TKWB 1TVHB 2NY6C 5J1AA 1YECL 1S3RA 5AOJA 1L7TH 2BSCA 3BKML 3MMEB 3MRJA 4PJ5B 5JW4M 1W72A 2Y6TE 3ABMB 3O2WL 1N18A 5E8EB 3MLTB 3P02A 5E9NA 2XV2A 3EJSA 4G9FE 4FKHA 4WGKA 3FT2A 7PAZA 4XGZB 4W9EC 3O3DA 2OJZH 2HRGA 3K6SB 1KBGL 2NYYC 3LRSA 4KX9A 3H3PL 3LKQA 1PYWA 2R0WL 1ETZA 4HCGA 4N90E 4UOJA 4OGYH 3W2DH 1KY6A 3SO5A 1ZA6A 2BNQD 3D30A 1JNHB 3GEWB 4OT1H 1Q90A 4UNTA 2QPUA 2NY5C 5J12C 4Q7DA 3S5LA 4MQSB 2CWRA 1YDPB 5KANG 1A02N 4AJYV 3CN3A 1SJXA 4BEIA 3QC6X 3SE3C 4BCYA 4Z7UF 5AYTA 4EKXA 2IH8A 1H0DA 4Y4KC 1QKZH 3QEUA 3UC2A 4JN2A 5IUCA 3IDJA 3NABH 5IWLA 1YA5A 4KI5C 3WKYA 3TXAA 1KTKE 1MFNA 4Y16A 4MJHA 5DZJA 3SY0A 3X1GA 2VLKE 4BFJA 4MMXC 5EBLB 1U8QB 4ZAKA 2J20A 3L5JA 3QHZH 5ISZD 3GLEA 5E4EB 2D0HA 1GYWA 3ZQXA 2QDVA 5IW3A 5SWQB 4L9DA 3NRQA 4JS7A 3QDJD 4U2YA 4X5LA 3G6JA 5IW6A 4NZFA 2VR4A 3TIDB 5E1GA 1VFAA 4J3TA 3QXDB 1SFDA 4Y4HD 3UZEA 2AJYH 4IU3A 1BD2A 3LS4H 2BFVH 2OCCB 1WCQA 4NWTL 2H5UA 5JNYB 4P5TB 3NCCB 2YS4A 4UDTA 2QADC 4TXVB 1K9TA 3T0EC 2OXGB 5A2BA 3DVNA 4IRSD 2QZ5A 3UH8A 4UDUA 3NCFB 5LNGA 3D2UA 4OF5A 2DEXX 3EDDA 3GS0A 5DT1L 1PMYA 5J57B 1IEAA 1DLHA 1JDCA 4YHZL 3HRZC 2OMUB 3FUHA 1HHIA 4CJ1A 3BW9A 5F8RC 2JQZA 4MAYC 4IIZA 3Q44A 4U49A 3LKOA 3BGMB 3PNWB 4FE9A 5DWUL 1LEIA 1CFQA 4KKLD 4L4TA 4U6YA 2BVOA 4PB0H 1IO4C 5E6SB 1KJ3H 3RIFF 3ASNB 4EDXA 3U0WL 3O6FD 2ZJSH 4MNGE 1G7JB 5LAXB 3SPCA 2CG9X 4H8WC 1QLRA 1EAQA 3D50A 5LGKA 4JJ5A 4QRRD 3MYJA 4XNXH 4OR1A 4P05A 3D3VA 3KPRB 3GBNL 3AABA 3D08A 2Q8BH 4HS8L 4U1HB 2I07B 3F7YB 3IFPA 2ROXA 3O41B 1DVUA 1YN6B 2IH1A 3G5ZA 1RZPA 3BWUF 4FLRA 3GIZH 3QAZC 1ZS8B 1OARL 4FLQA 3GHEH 3II2A 3MRRB 1PZ5A 2EJ1A 2WVTA 5ADOL 3PWNA 1JPSH 2MKLC 3D0VB 4K8RL 3U7AA 2NUTB 3P69A 4O4YH 3QH3B 2GUYA 2Z4TA 3HZKB 4WUUE 2I60H 1X3DA 4TS6A 3QUXA 4Y88A 3QUMA 4GSDL 4N8CL 3CFBA 4GXFA 5HHVH 5L4FA 2EVJA 2O5NA 3RE0A 3OX8A 5IB5B 3KLLA 4LHJB 1BPLB 2OQJB 43C9A 3O2DL 3QQ3B 4H20H 2C9PA 3FQNB 3HG1E 4XPGL 4UNVA 4HS6A 4KMLB 5JPMB 2W38A 9CGTA 4DTGL 3ARTA 3D1MC 4MA7L 1LD9A 2IPKB 1QHQA 4LVEA 4PJ7E 4IK7A 4GI9A 4B60A 1P5UB 5EBGA 1GXEA 1F2XK 4I0KA 4Q2ZB 3X13A 3NUKA 1J87A 4NXKA 4EZJA 2NXYD 3BDYH 5C0CD 1CL7L 5AQ0A 3O0RL 1MAML 5CHNA 3HI5H 5FYLE 1A0QH 2OTWA 5EZIH 4OZGA 1WISA 4TULL 3ZL4H 5CAYB 5BV7L 2BIMA 4JFPB 3VXQB 4RH4A 5KYWA 2EDRA 4LPUA 5DZAA 2YUWA 1Z5LA 1MRDH 5FYLL 4QTFA 1KCUH 4GKLA 3EGDB 4ELKA 2FQGA 3RPIA 2P8PA 3PDGA 2EEBA 1Z1WA 3ARED 3B83A 3H4FA 5HHNB 1UWEH 2Z1PA 4AEIL 2XYCA 4J4PC 1ZT4B 3SQOL 1MFDH 4A6YA 2P8LA 1B0GA 4X9HA 4E9SA 2W95A 3NZSA 4P3CH 1P4UA 2MHAB 4XCFL 2AGJH 4MZIA 1XF3A 2CZNA 2W0KA 2VDMB 2XWJB 4DK6A 4MX7A 3WY4A 4KTEL 3I2CL 4YPJA 2JTYA 5TDNB 5HVHC 2YSTA 3JWOL 2B1AL 2CJUH 4APQC 3H9ZA 5FM4A 5D5MB 2XY1A 3G3LA 3QUKB 4Z9KB 1KGXA 4CVZB 2VUOA 1RZ7L 4WAFA 3L3OA 3MJ9L 4F1SA 2R0KH 4XMTA 3IBOA 1SYVA 4D9LL 4DZ8B 4PVLA 5I74B 4ZOEA 3EAKA 3Q1EA 4AYDC 4BZ1A 1KG0A 4DSYA 2G2PA 5JLZA 2VQ1B 1CURA 4NQDE 3UTPD 2Z8WC 1J5CA 3KHOA 3AXLB 2ZXDA 2IC2A 4NRXA 4U0RB 4XH2B 3M46A 3OGCA 4YDJB 4NQCA 4MDJB 4ZOBA 3KYKL 4I0PC 5JXAH 1ADQA 4EDWH 1JXJA 4HG4J 2PYEB 5C07B 4LHUB 4PG9B 5F3BA 5L2KA 3K4ZA 1JN6B 5IREA 1NBYA 3HB3D 3HS8A 4G8GD 3LPPA 1OAZL 4PEEA 4XHQA 2UZYB 1N64H 2XQYG 3D34A 4PV8A 2Z91B 3S35H 5FEBA 3QYMA 5IB3A 5IV2A 2X4SA 5BMFH 4CDGC 5KAQF 5CU9A 4POZD 4E9RA 4OY9A 4H25A 1E6OL 1ZIAA 3ILEA 1FZJA 2AK4B 3MR9B 4DJMA 2GHWB 2YQ3A 3MREB 3P4NA 5EO1B 3DIDA 1MCDA 3LDBC 5FDWA 3IGAB 1X9UA 2ORBH 4LCWD 5IROA 4AJWA 3EYOA 2J21A 3ATEA 3DDGA 4HOWA 3F5WA 2YXVA 5EC1A 2B7DT 5FHAL 1OCZB 2C9UA 1MCJA 5LXVA 3VD7A 3VXSA 1XF5A 5I8EA 3AT0A 3D06A 4GJTB 4YSOA 5DJCB 3FO9B 1U8CB 2RGSA 2HXAA 3EOYG 5IQMA 3VE0B 3QEGL 4NDMB 3EW3B 5F7LB 2EYTA 2GJ6A 2VLJE 2EKSA 2VN3A 4TUKL 3KLHD 1Y1DA 3K4AA 3E2HC 1AE6H 3O6LL 3BUTA 2EYSB 4Z7UB 4Z77B 3TEYA 2QL1A 4PJIE 1JERA 2EC9U 4TQIA 3UPAA 2O5YH 3F12B 4KKQA 3QPQC 1ID5I 3DWTA 2L8AA 5L4IA 5C2UB 3IJSA 3TT1L 4UT6A 1HJCA 4R96A 2PYFA 4F7PB 3QIWD 1Q4NX 1U8KA 3GHBL 3TBBA 2K78A 3MRKB 2A74B 2OR8A 4XMPH 2IWFA 4AMWA 4NUJB 1PQZA 1MVUA 2OL3H 3VX0A 2VWEC 4EMZA 1LK2B 2FR4B 1XL4A 1G7PA 4WF7A 5J7CC 1YECH 1JPST 3BKMH 2JH2A 1TEFA 2G4EA 3ILDA 1CB4A 3SDXA 1R5VB 3VFMB 3W9DA 1A8JH 2VXVL 2WLZA 3O2WH 5J6HB 2ED7A 1N68A 4GI6A 4KKRA 1IAOA 3IWUA 2VXUL 4I9XA 3Q2VA 2E8ZA 2X3AA 3WIAA 3FL7A 2RACA 1JK8A 1T4KB 5AENA 2YLHA 3JTTA 1KBGH 3H3PH 2X2IA 4OGAD 5DD1L 2R0WH 3IU4L 5HGBB 2CPCA 3QEQD 2JB6A 2PTUA 3BOVA 3PGCB 4X7EC 5I1KL 2PO6D 4KRPD 1J11A 2VABB 3VH8G 2HT4C 5LBSA 5DHYB 2UX6A 5HY9A 1A9EB 1GYCA 3DTDA 4H8QA 3EUDA 4U7KA 4F2MB 2KLRA 4KUZH 3KL5A 3VXOA 1T20A 2IDTA 5I8CA 3A6OA 3VI3A 1QFWI 4GRWB 3ETSA 1BCIA 1PF3A 4FXLA 2ZUUA 4ZRGA 3PWJA 2JJSC 5F2FA 1RUML 4W9HC 4KUCF 4OBSA 2WWNA 1O7VA 1HOCA 2WUBL 3FH5A 2F61A 4J3OC 1PSKL 4C4KO 1EFXD 3OAYH 1VHPA 1E6JL 2DH3A 3PL6D 3DJ9A 4L3FA 2BXZA 5IOPA 3E6HA 4P48A 5L8JB 2WXGA 5CUSL 1OF2B 4NI3A 4X4XA 4S1DC 2NTFB 3ZO9A 5FOJA 4OTXL 3GPEA 4UM9D 4KZEL 3VXMD 3NJFA 5E2UL 2W0LA 1JZJA 2KDYA 1TEGA 2FT6A 2UZXB 3FYIB 2OW7A 5E5MB 4J6IA 5FC9A 1U8NA 2CHNA 4NWTH 3U25A 2XN1A 1G87A 4P99A 4OKDA 3MRBA 2H0EA 2VL4A 4NO0B 4XAKD 2WXOA 3QQ9C 2VISB 5DT1H 4WTWA 3TGXA 4YHZH 3CSPA 4HBQA 4KXDA 2OL3B 4FQLL 4PVMA 5SWSB 1CDBA 2AVFA 4N2IA 2G3XA 1SUJA 4H7VA 3TCTA 4OZIE 3JV0A 4L8BB 5IJKC 2DQDL 1T7VA 2DJUA 3SE9L 5DWUH 4R5TA 3IXTB 2WNWA 2JCCE 1A4KA 1AR1C 4JK0D 3OXSB 4L18A 1Q9KA 3ZHLA 3U0WH 1A3LH 1CE6A 2EIMB 3NJKA 3OQ3B 4OSUL 1QUPA 1MCOL 2O6EA 2Y7QA 1NM4A 1EJ6A 4JFSA 5KSBB 1U9KA 4X6DB 2QMJA 2V5RA 4G9FB 3H1ZA 4U3HA 5DLML 3TNMB 5I73C 4JDVB 4L8DB 5DRXB 3KPLA 3GBNH 4OJYA 1WSST 3VYNA 3O3AB 4Z3JA 4HEME 1FNSH 2Z7YA 1KIQA 4NKIL 3CFDA 2J72A 4FG4A 1BG1A 3PIQB 3GMMA 3VFWB 3FT3A 4KI1A 3WDHA 2RIKA 2KZBA 5F1IB 5IVXE 4CN6A 3SGEI 1BXVA 1OHQA 1AGEA 2ZYIA 1HQ4A 2M2DA 3F04A 3LIZA 1OARH 2Q6WB 3T4YA 5IHZB 4ZFZB 4GBXC 4OF8A 2OLDA 4HQQL 5ADOH 3VD3A 4GEJA 2YFNA 4AYSA 4EN2A 4K8RH 4YHML 1D5XA 4ZXBC 2F74B 5B4MC 2BERA 4PJIF 5CLZA 1E9PB 3GBDA 2W88A 1X7QA 1MHEB 4YLBA 1R3LB 3SYCA 4Z3IA 3TASA 3FQRB 4XN7A 1QBML 4YC2C 5GZNC 5T1KB 5KVGE 4ZX4A 2ZOKB 4GSDH 4N8CH 2IV8A 1AS6A 2YD0A 3L5IA 4HIIB 4U6VL 3B5HA 2DZEA 3EZJB 4Z18A 5K59E 1KGYE 4HUWA 3L9BA 4GQZA 5IG7A 3O2DH 3NGBC 5KVGL 4NENA 2EZ0C 4P4RB 4FL4C 4XPGH 3HVNA 3IETA 5I16B 1U8OA 4DTGH 2YPKB 4MA7H 4YPGA 1WWAX 1G94A 4C47A 1M9WA 3DUHA 1EHNA 4K3JL 2WTRA 4P2OB 3HAEG 4OFQA 3MZGB 3DMMB 1CLZH 5CCHE 4X2UA 4AH2A 1CL7H 3O0RH 1MAMH 4YHLL 1K8IB 1FIGL 4PFEA 2JJVA 1AOZA 1RK1A 1UB5A 2HLEB 4TULH 2WOBA 5BV7H 3FFCE 5JO5A 1E4HA 4OQTA 1UWFA 4FNLL 5FYLH 2ZNXA 4I8DA 2VDNB 3L2NA 1C12B 4QF1B 4R5XA 1IL1A 2PCFA 3I9AA 4AEHL 5EEYA 2WZ5A 4LMQE 5IHWA 4AEIH 1OTSD 3SQOH 1LVEA 2P5WD 3OKDB 3MUY1 2Q2LA 2Z35B 5DURD 5BRPA 4UTCA 4FC3E 3DBXB 2XWZA 4IBYA 1YEDA 4MNGB 4XCFH 4Y4FD 1IKOP 1EUUA 5DD6A 1TCRB 1QNIA 1E2VA 1ET5A 2A77L 3I2CH 4Q9QL 4L4VA 2NY0B 2UY6A 4O2CB 1XDTT 1ML0A 2D8KA 2OSXA 3FK3A 3LNIA 2BH0A 3JWOH 3Q5TA 4Q6KA 5DZVA 2B1AH 3GXFA 3DOSA 4PRIE 2VERN 5E51A 3BUBA 2LU3A 3P9WB 4PTUB 4XVUC 1RZ7H 4TF4A 4W9JC 4JMXA 3MJ9H 4QEGA 3K5SA 2SEBA 3EFOB 3SJVE 4D9LH 1R5WB 3V2AR 1DQVA 1AP2A 3QP3A 2NQDA 1UC6A 4UINL 4WKZB 1EHLL 4EJ1C 4X7TA 1L6PA 3SGDH 4DVBB 2VIRA 1L9TA 2A6JB 3WGUB 2BW5A 4ZBJA 5H94A 4TQPA 3F58L 3L3JA 5D1QC 2AV7B 5EN2B 3SOBL 1IGFL 1YMMB 3QDGD 3KYKH 3VFPA 4NN6B 3FU0A 3KLQA 4MMZC 1EDHA 2PWFA 3G6AB 4I5BA 3RVTC 5FGBA 2YAQA 3OMIB 1BBJA 1R3JA 3FU9A 2PABA 3MUZ1 5IK3A 1TU2B 3GUTA 3FSZA 3UG4A 1OAZH 5I1JL 1VPOL 4Z3GA 4MLSA 1KTLA 3B2VL 3L5WB 3HG1B 4B95C 4OZIF 4ORZC 1YYML 2GABA 3TV8A 5IQ9B 4U3SA 2ZXBA 5C08D 3BAEL 2JCCF 1GW6A 4R0LC 4EZLA 1KENH 1T3FA 3QIUB 1E6OH 5E9DE 4IOSA 5ANMA 2CGRL 3TA3D 1G9HA 1WV7T 4V1DA 3E38A 5EWIL 3MCYA 1MFCL 3NN8B 4IOFC 3D51A 4PGEB 3T2LA 5FHAH 2ZXQA 3QORD 4Z1PA 5CIPH 4MB1A 1WTLA 2AQSA 4X5QA 3G5YB 4OIAA 3WAJA 1B0IA 5DHDA 1YNTF 1CBJA 3QEGH 1SXCA 3OL2A 3SDAC 2Z65C 5IVXF 4H1LG 3DV4A 2XN9A 4TUKH 1S9KC 4JFFA 4PR5B 3O6LH 1S7RB 5J1AB 1FFQA 4QCIB 1QSFE 4OV6F 4NUQA 4FQQA 4RGND 1W72B 4DN3L 5GS0D 4AMKL 3GMOA 4J6RL 3NRPA 2FLRT 3FT2B 1KT2B 3TT1H 5F0JB 2B77A 4FTVE 1CVRA 1T5WA 2YAOA 3JV6A 3O3DB 5KZCD 1FYTA 1NC4D 5FO2A 3MLYL 3GHBH 4L5FE 3JUZA 3LRSB 3RX8A 3GI8L 4Q58C 3LKQB 4DO6A 3N9GL 3V8OA 1ZA6B 4PLJD 2AJ3A 3AFLA 1QFUL 1A14L 1JZ2A 4MQXC 4L5FL 1ZTXE 2W0PA 4HLZG 3HVDA 1VESA 5HDRA 3FCSA 4YDLC 4X4YA 2DTSA 1D3CA 2G4GA 1GSMA 1F56A 4JFZL 5BW7A 2VXVH 3BVUA 2HVBA 3AS1A 4KKNA 4NQDB 3VWJA 1X9LA 2ZQKA 1HT6A 4WI3A 1FQ9C 1JHTA 2RJMA 3P0VL 3RKDD 2VXUH 4AZUA 2WAQA 2AJSL 3TF7C 1HCVA 5D6CA 4JN2B 2F8OA 3IDJB 3W0WD 5MEQA 3X1FA 3O4OC 3VTTA 4ZDHA 1MNNA 3OF6A 1EZVY 5DD1H 4L1TA 4XN2A 3SY0B 1HZKA 5KSAC 3T2PA 3KPNA 1NJ9A 4ZAKB 2WXHA 4KJQD 4ZO6A 2KPNA 4BFGA 3DUSB 4IRZA 2CE6A 2YPLD 2ZKYA 4TSCL 4DT2A 5I1KH 2WQWA 2XQ0A 5ALBL 1DJZA 1MDAA 3C60B 2MTPA 3G6JB 5IW6B 1VFAB 2E5EA 1CTMA 4F92B 1DE4B 3EYFA 4FNTA 3ZDYE 2XQYA 1GS7A 1KLGB 4IU3B 3RB5A 2CBQA 1BD2B 3GM0A 1JZ8A 2V9QA 3T6QC 4JRXD 4UDTB 1HNFA 1RUMH 1DBML 3DVNB 5J13B 3U0PA 4TQHA 3HG3A 3H42L 1IM3D 2IANA 3D2UB 4PM1A 4PLKD 4P59L 1PSKH 2GJJA 3KYOA 1IEAB 1DLHB 1E6JH 3BJ91 5D1XE 3ZTJH 1HHIB 3E1F1 4YHNA 3BW9B 5CUSH 4HC1A 1QEXA 5EU6D 3NSCA 5F9AC 3VXRE 3ME0A 2CDGA 1AZBA 4OTXH 1D5MA 3LKOB 4KFMA 5E1AB 4KZEH 5E2UH 1LEIB 3DUUA 4L4TB 1KJVB 2BVOB 4U6YB 1PZAA 5CGMA 2RAMA 1YY9C 3LRKA 4EDXB 3V4PA 1IGTA 1RJCA 1I1YA 1DVYA 2DIBA 4PJIB 5CLXA 5D7IE 4B3EA 3AB0B 3EH4B 3MYZA 3VI3F 4IBWA 2FD6L 3D25A 4JJ5B 3KJ6L 3MYJB 2P1YA 4A2GA 3E7JA 1EWHA 4JQXC 3D3VB 1P4IL 1GTFA 1HXMA 4M5YL 4NIYE 4G11A 3GKZA 2NY7L 4FQLH 3IFPB 1FGVL 2Z0UA 5JA8B 2C5DC 1DVSA 4JY6B 1B88A 2IH1B 2DQDH 2VCOA 1PKQA 3G5ZB 4J7RA 4PS3A 3SE9H 4CADA 2TRYA 5L2JA 5T3XE 1LM8V 1SVZA 1BZ8A 3IJ9A 4LLVA 1EK3A 3PWNB 2D3VA 4OSUH 5ESVA 3BWAB 4L4JA 1MCOH 4OUUA 5T3XL 1I3RA 5FGSA 5F7DA 5FM5O 4BKTC 4XNDA 2N0KA 2DWXA 5A43C 4JFXA 3FF8A 1HXYA 4AIZA 4TTGA 5DLMH 3O8XD 3DVGA 4PRBA 4I18A 3TT3L 1DQJB 3IDXL 3QUXB 4LSUL 3QUMB 3CFBB 4HJUA 4NKIH 1ADQH 3BGFB 3OX8B 3ARBA 4GXVL 2IQ9L 5DJDA 43C9B 4YAQA 3ZIYA 1BGXL 3Q5OA 1D5ZB 4HS6B 2IG2L 2IVFC 3JV4A 3ZUCA 2OPCA 4HQQH 2WGXA 1XMEB 1RSFA 1LD9B 2Z4QA 4U1JB 4YHMH 5AAWC 1MKFA 3D4GA 3VH8A 5DUBA 4V1DE 3X13B 1B4LA 2F7RA 4OCYL 1QBMH 2R15A 2G0LA 4D9QD 1PY9A 3GLAA 3WUWG 1ZT7A 1B9ZA 4QRSA 2BM3A 5CHNB 5DQJB 2OTWB 5JUEL 4U6VH 2GHZA 4OZGB 4PRHE 5EZLA 3KE0A 5KVGH 3IPEA 5KYWB 5F72S 4A37A 1WEJL 4EOWL 2OTPA 4W68A 1Z5LB 4JDTH 5ESQA 1CXLA 4ELKB 2V3DA 3RPIB 4XC1L 1WUZA 5FKAB 4QWWD 4GW1A 3MFGB 4J12A 1TJGL 4MCYA 5EBMA 3CZSA 4A6YB 2O72A 1B0GB 3CDZA 4K3JH 5CJOL 2X89A 4FX5A 4PJAE 3T2NL 5D4HA 5HYSA 1XF3B 4YHLH 4Z6AT 1FIGH 4JRYD 3NFNA 2BY2A 4G7QB 1T7ZA 5D7LE 1YEWA 3PLYA 4UT6H 2QTEA 3H54A 1U33A 4PGJA 5L8KB 5IMOA 3VD0A 4L1HA 4FNLH 3HPLA 3IJYB 3LQAL 5KSVA 2GI0A 1R24A 3L3OB 2AQNA 1NEZG 1F0LA 1SYVB 3H9SE 4G1EA 1L4IA 2GSGA 4AEHH 5CSBA 3S9DB 4HX1A 2GSIA 2JCCB 5F1NA 3VCLA 4ESKA 6PCYA 4GKZA 1NCAL 1L6ZA 1KG0B 2P5PA 3LH8A 4HCFA 5JLZB 3DROA 3ZDYF 1T5KA 4CVXA 2BVYA 5H35A 3BSZL 1YNKL 2GBAA 2H6OA 4NQCB 5E4EC 3REVA 4Z76A 4X80L 4Q9QH 2YWZA 4F1ZA 1EHKB 3QZPA 2EH8L 3U83A 2FSDA 4HETA 3VI4A 1SGKA 3ELQA 3L81A 1U6AL 4N3UA 1Q9OA 4MDRA 2HRLA 4HWBL 4GRLD 1A9VA 1NBYB 2FIRT 3K46A 4DKEL 5LCVA 2P8MB 3T77A 4OCRL 5FCUL 4PV8B 4F15B 5E6RB 1MCQA 5KBNC 1GZHA 5IV2B 2X4SB 1EHLH 3L7FB 4IMKA 1X5MA 1A7NL 2DWEB 3D39D 2ATPB 4OFPA 2K7PA 3SCMD 4H25B 3F58H 4N28A 4LLQA 3BQUA 1S7WB 3SOBH 3MBEA 1EBAA 3FW6A 1TETH 3P4NB 1BSIA 5FDWB 5TQ0L 3K2IA 1YRKA 3EYOB 4HUUA 3L13A 2UXVA 4JG1L 3F5WB 1O9ZA 3IRPX 5DEGB 2D03L 5EC1B 1AQDA 5HI5D 3MGOA 5GGRY 1F3DJ 3H0TA 5M95B 3IMRA 4JO1L 3UBXI 3VXSB 1EA9C 1HHHA 4JGJA 5E7BA 1TVBB 3AM8C 5I8EB 4IBVA 5I1JH 1VPOH 1MW0A 3B2VH 1Q0YL 3CZNA 3TFBA 1YYMH 4Q6IA 1FF5A 2EYTB 2GJ6B 3COOA 3POCA 1A1OA 2EKSB 3BAEH 3EH3B 3AS0A 3CSBA 5HYJD 4ONFL 2XWTA 1BIIA 1IE4A 1MY7A 2ZTBA 4CRPA 4ZMLA 1JGIA 2YA2A 3Q6FB 2CGRH 4EI6B 1N8OE 3AROA 1FV1A 2OA9A 5FUCE 1YC7A 3RY6A 5EWIH 1MFCH 4E9QA 1E5CA 3IJSB 5MEPB 1D5BA 3SDYL 5E6ZA 4AJ0A 4PGZA 2X6VA 1T2QL 4R96B 4UB0H 1THCA 2PYFB 3HAEA 2KDGA 2VLRD 1U8KB 1QR4A 2V0AA 3ET9F 2YEZA 4X6FA 3FFCB 4MWFA 5IUSA 3FSVA 1P7HL 4P2QE 4XO4A 2P5ED 4Y9FA 4ILDA 4PJHE 2Y69B 1PQZB 1MVUB 1E27A 3GT6A 1MHHA 1LDSA 3VDBA 1H3XA 2ZKWA 3NJGA 2EACA 3L4XA 1HEHC 3W9DB 2J5LB 4DN3H 3C8HA 5F8QC 4AMKH 4J6RH 1IAOB 4AYGA 5DVOA 5BCAA 2Z92A 2WVUA 4D2NA 1JK8B 3F83A 3JTTB 3T6WA 4MHHG 3QG7L 2CJTA 1B0RA 3MLYH 1SQ2N 3QZOA 2MCG1 5JPMC 1E3ZA 3GI8H 3T0AA 4F9PA 3N9GH 2WZPD 1K5WA 1A2YA 3OC5A 4IK6A 4DPRA 2JB6B 3V6OE 3KGUA 4IHBA 1QFUH 1A14H 1P5UC 4L5FH 4O02L 1D2OA 2Y7LA 3QDMD 4TMPA 1N2RB 4P2RE 3SZKC 5B38B 3CMGA 3NZ8B 5HY9B 4XHJC 3OKOA 2AVGA 4JFZH 1N19A 4IJTA 1ZPLA 3VXOB 1T20B 2FE0A 1UVQB 3P0VH 3QDJA 4AIOA 2EC8A 3VI3B 3E9UA 2F6AA 5I8CB 2AJSH 1ZT1A 4H8HA 4QRPE 2J6EL 5A6MA 5MEND 4RWYL 3PWJB 2NZ9D 4Y4HA 4N5EC 4GP8B 2FRGP 5F6IC 5JIQA 2E4FA 3V0HA 4DH2A 4XB7A 4P23A 1HOCB 1RJYA 3FHQA 3GB7A 3PQYE 5FB8A 4FFWD 3GTVA 3ILQD 5IOPB 4TSCH 3E6HB 2K45A 1I9JH 1P9MC 3AS2A 3OJMB 4LL4A 2XKNA 4YSAA 5ALBH 4IRJD 1X9RA 3GI9L 1OP4A 5GGTA 5C0JB 1GGIL 4KKAC 3V6ZA 4UBDC 4XBPB 3L48A 3R4DA 3T08A 1U8NB 2AHIA 2XCMC 4HUXA 1OPOA 4LEBA 3CVIL 1SLUA 2CAKA 4GAGH 4IEFA 4NXSA 1DBMH 2OSLB 3MRBB 3O6FA 1WS7A 1J1OL 4JY4B 3WNNA 3HRPA 3EDFA 3H42H 3HHSA 2QSTA 4P59H 5I74C 3V4UL 4C56D 1L9OA 4DGIL 3QE5A 4WQOA 3U48A 4QRRA 4M9PA 3J8F7 1X5LA 2IBGA 2XVGA 5D6DA 1B3IA 1U3NA 1OHZA 2BNRD 5AVWB 4ZK8A 1QFWM 3FT9A 1H5BB 4U0RC 3ESMA 3PXLA 1PG7X 4JFQB 1AQMA 5BPPA 5EG6C 3DX7B 2NY1B 1Q9KB 2X7LA 2YOAA 4XODA 3REWA 1CE6B 3IM1A 3ALXA 2OMNA 1LEGA 2Y7QB 4L1LA 4MLIA 1MCWM 2FD6H 1CL7I 3KJ6H 4IJ3B 3PGDA 5DJAA 2PETA 4YSQA 4QXGL 1G1CA 2D73A 1P4IH 5DRNA 3KPLB 5IMLB 4M5YH 3RTQA 5K39B 1JBJA 3F85A 3LN4B 1KIQB 1J9TA 3B7TA 1CICD 2NY7H 3CFDB 2NZIA 3N43F 5DRZB 2HG0A 3SY6A 2GUOA 3GMMB 3KW7A 4XN1A 3FT3B 3BESR 4Z7NE 1IX2A 1AGEB 1HQ4B 2A1WL 3EG9A 4OIIL 2VMFA 2K70A 5GGSA 3T4YB 1PLGL 1ZJBA 1WA2X 3CAFA 4ETQA 1K72A 4FQXA 3HE6D 2XKUA 5T3XH 2XLLA 1D5XB 4YXKL 2APXA 2VDRB 4PJ9D 1D9KA 3OAYK 1X7QB 1OW0C 1DYZA 1D2PA 4KKCC 3V9CA 3TT3H 3U4EA 2CR0A 3IDXH 4LSUH 1KNOB 3I75A 1XHHA 4GXVH 4ENED 2IQ9H 5EORL 3LXAA 4ISVA 4OD1L 4HUWB 4IGBD 5IG7B 4NENB 2GJZA 2F8IA 3E80A 3CFNA 1BGXH 1YSOA 5LAPA 3ZBMA 1T5XA 1X5AA 4PJHF 2IG2H 3IETB 3S3PA 1U8OB 2ISDA 2X0VA 4OM1H 4EVNA 1KZYA 2J8UA 4QHUA 2NNAA 3PGFL 4YSRA 4WFEE 3TURA 2WTRB 4PW4A 3L4CA 4RWHA 3T8VA 3MV7D 2A74C 2IBZY 4OCYH 3SD5A 4AH2B 3HKZA 3DURA 4NZUH 4JM2F 1RZFH 5C0BD 1UB5B 5JUEH 4AUUA 1WFIA 2DIAA 4F8LA 1U3HB 1FNEA 5ANHA 1AKJD 5JO5B 1WEJH 4EOWH 3A21A 1NCWL 2OV0A 4OIBA 5FLUA 1AC6A 3L4UA 1M6UA 1UZ6F 1IL1B 5D70L 2UXTA 1G5AA 4XC1H 3FRUA 4PJ8D 1OGAD 5FYJU 2BNQE 3V5DB 1TJGH 4PMFA 2Y2TA 5IHLB 3VFVA 1TUPA 1CTNA 5CJOH 1F4WL 3EOBB 3T2NH 3L4TA 4ABQA 1KV7A 1F5WA 1YEDB 4DHLA 1XX9C 4EKJA 4TLKA 43CAA 3FN0L 3GSOA 1C1EL 4PJGA 5DD6B 3HJEA 5I1LA 1KCBA 4CSTA 4G72B 1MI5D 2BVEA 1I1AD 5FWRA 1LWRA 4UOW1 3DOSB 4AL8L 4HLJA 4NNYB 4PJFE 1UUNA 3LQAH 1I85A 4RFOH 2MCAA 5GIRA 3N1QC 1EGJA 2BPBA 4OZHA 4XWGL 1ZIBA 4WUKL 5ADPL 1AP2B 5ITBL 2OZ4L 5ISZE 1NUDA 1NCAH 4H8UA 4X7TB 1QRNA 2VIRB 2JXMA 4DQAA 5HYIA 2X53A 1A6ZA 3L4WA 1MFMA 2EIZA 3L3JB 4MB3A 2CCWA 1V5JA 1YNKH 2NT1A 3BSZH 3D18A 5F9WB 3ZZSA 3ZPDA 3VFPB 4X80H 2R23B 1OANA 5FXCH 4G5AA 4JE4B 4XN8A 4I5BB 1GZQA 2EH8H 2OMYB 3QUYD 3ZHNA 3BWUC 3QRFM 2TAAA 3N85L 1U6AH 4HWBH 1R3JB 5AUMB 5IK3B 4DKEH 3GUTB 5JHMA 2NR6A 1MCSA 2FB4L 2NMSA 5CLTA 4NCC1 4QRQA 4OCRH 4O00A 2MQ0A 1KXTA 5FCUH 2BHFA 1SBSL 3FBKA 3RGVD 1RQ5A 5IBUG 1U2HA 1A7NH 4JVPA 5J8OA 3UO1L 1GCFA 1N5AA 2XWDA 3FONA 1YEJL 3ZTDC 4LP5A 5ANMB 1BAGA 3THML 1QX1A 1SMOA 4D0DA 4V1DB 5TQ0H 3B7UX 3ZKND 3LV3B 3L5HA 3VG9B 1OK0A 2D03H 1A4JB 1BW8A 2F7PA 1IJ9A 1HNGA 4JO1H 4RMWA 3K72A 1HU8A 4R2GB 4CSSA 3WUWA 3MRQB 3CZKA 5CP7A 3SKJL 1GGUA 3G5XA 1Q0YH 3B2XA 4U2ZA 3QIWA 1ESOA 4Z7NF 3DV4B 2XN9B 2AEQL 4U1MB 4JFFB 3VRLE 4ONFH 3WS3A 4HC1H 1O7DE 4L05A 3CHXA 2N4IA 4TUOA 4ZG1A 4FQQB 4GLRI 3WMPA 3QUZA 5C09D 1HYRC 2G75A 12E8L 3QJRB 5CKGA 1UOVA 3GMOB 2SODB 1IGML 1E3XA 4PGDA 2HJFA 3SDYH 4A7GA 4C8XA 1G9EA 4JQVA 1T5WB 1VRSA 3JV6B 1T2QH 4MNQD 4Q0XL 3CHPA 1P7QA 1FYTB 2H6PB 3ATAA 2OXHA 2DI9A 5A2AA 2OMWA 4B0MM 3S3BB 1AVAA 4URKA 2DQJL 3Q8AA 1HYSC 4OVVA 5K5YA 3L3KA 5GZOD 1XIWD 3GSNA 4IKKA 3FCSB 5K1JA 5GS1A 3J2PA 3QEQA 4LHQB 1KYAA 4X4YB 5EIIA 1QASA 3KVQA 1OOAA 5G2NA 3WD5L 5TE4H 2WANA 2PO6A 1NEZA 2J56A 3VXPA 2VRKA 5E1HB 1IGYA 2DLGA 3VWJB 1JHTB 2HLFD 2CKBA 1JMZA 5D6CB 4I88A 3UX9B 1ERNA 5MEQB 2LU5A 5B8CC 5MHSE 3GGWA 3QG7H 2V2WA 4ZDHB 5C6PB 3AXIA 3SBWC 5C0CE 3VGAB 3KPNB 1QVOA 1NJ9B 1FH5L 4HF5H 3GMRA 4ZUWA 5DK3A 2VDPB 4P07A 4J39A 4JFEA 4O02H 4QYOB 5JHDD 1ACCA 1WO2A 4QAMB 4ZUUA 3BUDA 4P2OC 3DMMC 2DLHA 4DF9A 4XPBL 1EFXA 4W9FC 2BRQA 1CI3M 3PL6A 3OXRA 3X17A 1I8IA 4LRIA 4ONGL 1Z5YD 3SE8L 2X6MA 2ZOUA 1OQOA 3RWEA 1PEZA 3CVHA 3LAFA 4UM9A 1WWCA 3VXMA 1BZQK 1QFHA 4RWYH 4WFFE 4AQZA 4DN4L 5ALCL 5GRVL 1ZVNA 2CUIA 3RB7A 4JO3L 2JIXD 1UA7A 2HYMA 5BZWA 3Q0HA 2IANB 3F6LA 4GG6A 3KYOB 1NCGA 5EU7E 1MCPL 3FU8A 4Y19A 9PCYA 4PJFF 5ABDE 1LXMA 3DJRA 3ZK0A 4BDVA 1KCRL 3ME0B 2CDGB 5E6IA 1HESA 1D5MB 1T7XA 2ZWYA 3GI9H 1NPJA 3DUUB 1K3ZA 4ZMXA 4LCCA 3BX7C 1OP3K 2V3FA 2NY0C 1HHJA 1IGTB 4HMEA 4RMVA 1PD0A 4K71B 5BO1L 4I2XA 3VAEA 3CVIH 1H6FA 3BFQG 5HGHA 3H6AA 1XH3A 4C4KT 1DBBL 3MLRL 3UTSA 2L3BA 3GJFA 4KKBC 1HL4A 1CFSB 1J1OH 1CJYA 4MA8L 4GMTL 1HXMB 3P3TA 4K8RC 2V33A 2MFNA 3HE7A 2BOCA 4Z7VE 3V4UH 4X98A 4DGIH 4EIUA 3QB7C 4HWUA 2V9TA 2D3JA 4M8RA 2IGFL 2ZKXA 1GS8A 4WTQA 4F8OA 4P2QB 4RQQA 5HI3C 1PKQB 4CADB 1CQKA 1JF5A 1F58L 1JZGA 4KXAA 4G8GE 3TNNB 3W11C 5L2JB 2YZ1A 4NN6C 2CIKB 3JTBA 5DHXB 4LLVB 1E4XL 3FUKA 4UIMA 5ESVB 3Q9QA 1I3RB 5F7DB 3CDGA 2YUZA 3RDTC 1SN2A 4HGWA 1IGJA 4JFXB 5AEAA 4AIZB 3SDCB 4MXWL 4QXGH 3B7SA 1NPUA 3CSFA 3DVGB 4I18B 3AXHA 3T09A 2J2ZA 1XSJA 5DMIL 1PS3A 4L9LA 1UXLA 4LCWE 3FHAA 3ARBB 1DVFD 3QIUC 4YAQB 1XH0A 1YUKB 4HU8A 3PF2A 5IBLD 5CNHA 3QJHA 5IQLA 4L23A 2DM7A 2A1WH 1OAUL 2AZAA 4OIIH 1KBVA 4ZS6C 3FB7B 1PLGH 3JV4B 3M1CA 4ZUSA 4TOYL 1ORSB 3U30B 3ZX1A 3VRLF 3QYNA 5BV7C 2Z4QB 5D1ZB 1QACA 2ZWZA 4S1SL 4YXKH 3ZUNC 2XBZA 3T2OA 3UAFA 2A7BA 2Q7YA 2IDCA 4LMQI 5DUBB 3VH8B 2Y7MA 3VSVA 1QYGL 3O11A 2VXQA 2NPLX 1ZT7B 3FS9A 5IHUL 4QRSB 4LSQL 5C0AD 4JQIL 4X5XB 2X10A 1RIHL 1R3HA 2PXYD 4K5MA 5EORH 2A6DB 1KBKA 5EZLB 3KCWA 4OD1H 2ZX6A 4X6CA 3MVSA 3PQYB 5GSVA 2R1XA 4UT9A 3SKOA 3WDIA 1QABA 3B9EA 4YHKL 2W5PA 4MMYB 4PGCA 2WIIB 2HT2D 1KUMA 5T1JA 1GR7A 2F7OA 3KBEA 4GW1B 4X5WA 1ACYL 3CWGA 3JWOC 5EBMB 4UTAA 1LL1A 3VGBA 2YRZA 5SX4I 1AHKA 3HHMA 6PAZA 2BWQA 2VXTL 2ZP8A 7CGTA 1XGPA 2X4OA 1NBCA 5HYSB 1XGTA 3VRIA 3IF1A 3ROLA 5GSRB 1NOAA 1IIIA 3U9PL 1Z3GL 4Y4FA 3UCQA 5JDSA 4XO3A 3L3IB 2IPUK 4LO9A 4JLRA 1E4WL 4HK3J 5IMOB 1NCWH 3IJEA 3JVFC 2EABA 5KSVB 3QI9D 4P46A 1R24B 1FNLA 5D70H 4EI5D 3C75A 4G1EB 1FVCA 1E28A 1ETB1 4GPVA 3ZTNL 4D0BA 3Q1SL 4HX1B 1U8HB 4LOUC 1NICA 4WI0A 2DYPA 4NRYB 5IWLC 4GKZB 2Z34A 1QW9A 4GKSA 1AZRA 4RGMB 1QAWA 5EOQL 3Q7JA 1F4WH 2O5ZH 2FWOA 4UMSA 4CVXB 4ZAKC 1OT2A 4ICXA 3B9DA 5I6MA 3FN0H 4D8PA 1C1EH 2C34A 2C3VA 4HWNA 3REVB 2AEIT 4NT6B 4ABUA 1T83A 1JGLL 2CKNA 3C60C 1Q9OB 4AL8H 4L3CB 4P0DA 3FT0A 3Q13A 1SHXA 1MOEA 5D7JA 4P5MA 3UZEC 4JDZA 1OWRM 5J3HC 3P77A 4XWGH 4WUKH 4Z7NB 5ADPH 3MV8D 5ITBH 5E1QA 2OZ4H 1BVOA 5KN5A 2Y3AA 1R3IL 1PNDA 3F6IA 3FT4A 1QI4A 1T2XA 2VLMD 4ODXA 5E00A 1FFPB 3NK3A 5J13C 3BP5A 4NYLA 5KVDL 1E8ZA 4Z0BL 3RU8L 4LLQB 4ODSL 4ZFFA 3BQUB 3WEBA 1P7BA 2YHGA 2Z8SA 3MBEB 3V4VA 4HUUB 1NDGA 1QFOA 4FQ2L 4I87A 3N85H 1AQDB 3WIFA 1YO4A 4FFZL 3TVMA 3ML9A 4FJZA 4Z7IA 1D7BA 4Z7VF 2H8PA 1HHHB 2HFEB 2UWEA 4M03A 5D4QA 1AXSA 1KMGA 1JD7A 1SBSH 3AB0C 4Q6IB 4OZHF 2BZDA 1A1OB 3IDNA 3HZ3A 3MX0A 4ODWB 2XWTB 1BIIB 3UO1H 1YEJH 2KS0A 1AO7D 1M57B 5AB2A 3THMH 3K7UA 3OG4B 5FOBA 5LKNA 4DP6X 2IALA 5A7BA 2BRRL 4R4BB 1RZQA 1TTCA 3HZVB 3ENEA 1NGYA 5I8OL 3WTVA 3JWNE 4B9KC 3HAEB 5H2BB 1ZTMA 4XTRC 4BFEA 1MJJA 2YEZB 4X6FB 4MWFB 3SKJH 4NBZB 1S7XA 1TYEB 4BFRA 3OZ9L 1IC5L 2AEQH 4XE0A 3DARA 1IC4L 1EAPB 4H0LC 1HZHL 4M9OA 4GNKB 1S5IL 2AJXL 3D2TA 2WY3B 3LZOA 5C07A 3RUGE 5LWYL 4KRLB 4R3SA 5F1OB 2A4CA 3BGFC 12E8H 1QUNA 3IMUA 2HFGL 4FFYL 3SE3A 1IGMH 5HHME 2F15A 2CR6A 4C54A 4P57B 4H1LH 3WLWD 1USQA 2EIJB 2Z92B 3L4ZA 1WFJA 3OKYA 2F5BL 4Q0XH 3CJJA 1B0RB 1WCBA 4HKJA 5HJGA 5GGVY 3AG3B 3EBAA 4DPCX 1S7TA 3W0WA 5GGUA 4K7PL 5G4MA 1NAKL 2DQJH 2QVIA 3EOAA 4GRMA 4HBCL 4MMXA 1N67A 2Z7UA 4CSZA 3V6BR 2UXFA 4HJTA 3P3SA 3AVEA 2VW4A 1U3ZA 5AVXB 1CXKA 5ISZB 4IHOA 4F57L 3WD5H 1DDHA 4HOMA 5CFAA 2LLGA 3QDJB 1NMBL 1FGNL 1I1FA 1NA8A 1ZT1B 3W56A 3EJQA 2FJGA 2AAVA 2ED8A 4Y4HB 4ATTA 2BX5A 2E47A 5ID1B 1QA9A 1NCBL 1L0PA 3BIAX 4P23B 4Z3TA 1FH5H 4Y0GA 1N5YL 3GB7B 3T0EA 5FB8B 4PBXA 4HFUL 2BCMA 1AXTL 4DPAX 2XKNB 3HRZA 2XIBA 2ZXCA 4GQPH 1CLVA 3D4ZA 3OR6B 4MAYA 4NPJA 4ONGH 1XF4B 4PP1D 2VJ8A 1J1PH 3SE8H 4KPHL 2IGTA 3FOLB 1NFDA 4HH8A 1D7DA 3HNTL 2P5WE 4CNIB 3VTMA 1RZGA 1IARB 4JO3H 4IEFB 5I5IA 3O6FB 5BJTA 1HJBC 4AI7A 3OGOE 4OJEH 4K5NA 3MJWA 1PU0A 4XX5A 2OW6A 4GP5B 1TTRA 3HHSB 5CZVL 3CIQA 3DIVA 4QRRB 1MCPH 2WUCH 2R0LL 1GHFL 2E9GA 3P3YA 3K0WA 2YWYA 1SEQL 1JCVA 1PY0A 1OE2A 1KCRH 3EYQC 1G4RA 3IFNL 3BN9D 4XI5C 3BAJA 1JUFA 2YPVA 3CH1A 2DMKA 1EVTC 4NNXB 3KNBA 4WNSA 5I1HL 3H9YA 3S34L 1JXDA 2X7LB 4JGNA 1OCWH 3REWB 1UJTA 2XG5B 2J57A 3GK8H 3V0FA 5BO1H 3APMA 4H1LB 3PRZA 3LZNA 4TLUA 1LEGB 1U8JB 2ODIA 1CLOL 2HH0L 2H0JA 4J27A 1DBBH 3MLRH 3PGDB 5DJAB 4MA8H 4GMTH 4NP4H 1OB1A 3RTQB 2LU7A 4F15C 1TR7A 3EJYC 3QDGE 2IDFA 3A4AA 4L3ED 3ZT5A 2ZONA 4GG6F 2WQ8A 3KH4A 4IBZA 2IGFH 3O8XA 3RVVD 2GUOB 5HI4D 4WSKA 4BFNA 2PWDA 1IT9L 1F58H 1QO3B 2AMGA 3EG9B 3VDCA 3CK0L 4ANKA 2PKDA 4WO4D 5IROC 3VSQA 4B7LA 5TD4A 3AWEA 1UM5L 5ERWA 4ETQB 1E4XH 4LXFA 4AE0A 4FQXB 4QOKE 4A55A 3DC0A 1CLYL 3T1FA 4WWNA 5C08E 4NZDA 2KLSA 4N2AA 2I69A 5I6PA 4GIAA 4GYBA 2ED9A 4MXWH 5EOTA 5L0QB 1Q38A 1DL7L 3HR6A 4IYKA 3UTQA 1H15A 5TDOA 5DMIH 1PZCA 3L1GA 3S3CB 1JZHA 1XGRA 4QNPE 5C0CB 2IV9A 5FFOA 5HHOD 4KK5D 1FL3B 1ZEAL 2GJZB 4CU7A 3QCVL 4U1NA 1T5XB 1AJ7L 1OAUH 3QHTC 3E8VA 2IWKA 4P4KD 2XYBA 3MJ6A 2DIEA 5AVYB 4TOYH 2YBRA 4NQTA 4EVNB 2XETA 3FO0L 3FQWB 4QHUB 1BVLA 4S1SH 3RZCD 4FG0A 2BP5M 1R75A 4FMFA 1VSCA 4HIEA 2RQEA 4QRAA 1QR1B 3AREB 2V7NA 4PBDA 1SXNA 4RIRA 4J4PA 3QJXA 1AKPA 1QYGH 1R17A 1RU9H 3DURB 3EO9L 4RGNE 5IHUH 4JQIH 3H2PA 1CFNA 1J12A 3KPPA 3CHQA 1RIHH 2AI0L 3O0LA 2WB7A 1MRFL 3KPSE 1FNEB 5G5DB 4N6QA 5GS0L 4YHKH 2J5LC 3NBNA 2NQ3A 5LNEA 2Q20A 3SOTA 4ZUVA 1QTYT 4APQA 2W65A 3FRUB 1INQB 4XN4A 1ACYH 3SN6N 1QWHA 3PCYA 3VFVB 1UOKA 2D3LA 2VXTH 3PP3K 4NKDA 1RI8A 1DP0A 3TL5A 2EIEA 1T66D 5CZXD 3P9MA 4XXWC 3GSOB 4PJGB 5I1LB 3RVWD 3S3SA 2ZXAA 4XCYA 4YDVA 3U9PH 1Z3GH 3ZSTA 4ZJ9A 2W60A 2KI6A 4S2SB 5AZUA 4Q9CA 2NX5D 1E4WH 4I0PA 5DUML 4POYA 3KWTA 1KWGA 2HTLD 4K4KA 4F2EA 4NQXB 5GIRB 2P80A 4TUUA 1KXQE 2X41A 3MRDA 3CZFB 1X5GA 4OZHB 3ZTNH 2H1PL 2CXKA 3CPLA 5DJZA 3Q1SH 3V52L 1E65A 3HB3B 1J5IA 1UA3A 2YPLE 5EOQH 1FP5A 1QRNB 3FB5B 3RFRA 2TSAA 2JXMB 1BG9A 2EIZB 2LABA 4LVHB 3H8NA 3HPJA 1HWGB 4JKKA 4F7TA 3ULVD 3D39A 3SCMA 5LLIC 3BFWA 4A2FA 5A16A 1JGLH 3DKHA 3DJTA 4XNMA 3RQ3A 1YY8A 1SQMA 4UQ2A 4Y2DD 4LCWB 1AD0A 2FECI 4JRXE 1JPGA 1G7HA 3BKCH 4XO8A 4QO1A 1IGIL 2KL6A 4QKXB 1KXTB 4U3XA 3WSQL 1WICA 2XDHA 3MUUA 2JJTC 2FJFA 4BIKA 1B4JL 2HB0A 1R3IH 1T1ZA 4FG6C 2Y06L 3UZVA 5B3JE 5EU6E 1JWMB 1N5AB 3HC0B 5KVDH 3FONB 4Z0BH 3RU8H 1OTTD 1IAII 4M6NL 4ODSH 5E2VL 1O5DT 4D0DB 5HYJA 3FPXA 1KYOJ 3JTSA 2DQIL 4UMGA 2K6ZA 4FQ2H