2XV6B

Crystal structure of the hiv-1 capsid protein c-terminal domain (146- 220) in complex with a camelid vhh.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
AQVQLVESGGGLVQAGGSLRLSCAASGSFFMSNVMAWYRQAPGKARELIAAIRGGDMSTVYDDSVKGRFTITRDDDKNILYLQMNDLKPEDTAMYYCKASGSSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords CAPSID PROTEIN P24
publication title Targeting HIV-1 Virion Formation with Nanobodies -Implications for the Design of Assembly Inhibitors
rcsb
source organism Human immunodeficiency virus 1
total genus 27
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xv6B00
3O45B 3P9LA 3T0ED 4CVXB 1ADQL 4UDTB 5GS3A 1FGVH 5EU3B 1TTGA 5TF1L 2H3NB 4UB0H 1CGVA 3HS0B 4WNQA 5MP6H 5H37G 2NYYC 3ECBB 4NQEA 3WNPA 4OLVH 4H1LG 4OLEA 2B0SL 1LP9A 4YNYA 2CH8A 2FATH 2R1WA 4KDVA 3QHZL 4DVRH 5L7XL 1CIUA 3W0WB 3HZKA 2R1XA 4WNQB 5L2JA 2V2TA 2QQKH 3MFFA 4I3GA 4WU7A 4NQEB 5EZJA 1I1FA 2HFFB 1LP9B 3QDMD 2R1WB 1H0DA 2YEZB 4YNYB 1DLHA 3W9EA 1F42A 1CICA 4CGTA 1CXFA 3HZKB 1JPFA 2HAZA 2R1XB 3MUZ1 4P5MA 5IMMA 5JA8B 3OGOE 4IOIA 2EO1A 4O00A 5L2JB 4JVUA 1EX0A 4L3CA 5D4QA 5DVKA 3KYNA 3MFFB 3W5NA 2V2TB 2KBGA 2BC4A 4WU7B 2Y4SA 5EZJB 2UY7A 1QFWM 1I1FB 4ZOAA 1H0DB 1DLHB 3W9EB 1DLFH 4CVWA 4IJ3C 2W0LA 1CICB 1NMCC 4M9PA 3O0RH 5IMMB 4P5MB 1EH9A 2YBRB 1NCDL 3ARRA 3E1F1 5BO1L 4IOIB 4EBQH 4L3CB 1DUYA 1AE6H 2P49B 2XI9A 2BC4B 5E2VH 1BREA 5FECA 2KH2B 4XWOD 5ERWA 4HJ0C 1R6VA 3HG1D 2HWZL 4WI4A 2DLFH 3QRGL 3UPAA 4WI6A 2G60H 4WCYL 15C8H 1DUYB 4HMDA 5FECB 1CVSC 1H5BC 5ERWB 3UJJL 1P4BH 3T0EE 2NTSP 1AGBA 3S36X 1DZBA 1WQVT 4F8QA 2CLVA 4ODTH 3VXTA 2EXYC 2X10A 2W9EH 5F1IA 2JJUA 2N7AA 3S36L 3FRPA 5T3XL 3RBSA 3ARGD 4U6VL 5E99L 5AYUH 3G5ZB 1AGBB 4WEBL 4TYUA 3F7QA 4JKKA 2CLVB 3ZL4L 3VXTB 2DM2A 2MHAA 2XZCH 5F1IB 4X4YA 4PD4J 2EH7H 1YEIH 4OCXL 3ARUA 4ZODA 5DMGD 2VZVA 3SOBH 1P7HL 2FBJH 4YBQD 5E4EB 5I74B 4KK6C 4EXKA 4ODVL 1IT9L 1PX4A 2D7OA 4IIQA 4XH2A 1XCTA 5DD5L 2MHAB 3KPPB 4J12A 3ZZ1A 4X4YB 4MA3A 1F8TH 3V7AG 1CQKA 5CIPA 2QR0A 4AQOA 2APWA 5GISL 3HI5H 2NY2B 4M6OL 4OI8A 1GOGA 4Z0XA 5AWNH 2QSTA 5C0RH 4QO1A 4IIQB 4XH2B 1XCTB 1BQUA 4WW2C 3RVUC 1MOEA 4NM8L 1CL7H 1MRFH 2NY5C 5CIPB 3QIWB 2QR0B 3HG1E 5EUOB 1OPGL 3QULB 3FB8A 5KSBA 4P2QA 3O3DA 4UTBH 5K9JH 1EJOL 2BMKB 4AMKH 1FYTD 1X4ZA 2Z8WC 4PJ5A 4OD1L 4KV5F 4PJIF 5GS2H 1JBJA 2JCCA 4PB9L 3TO4D 4YK4B 2FEDC 3MLWH 4U3HA 3FB8B 3AM8C 4LFHD 4P2QB 5C7XL 5KSBB 3MLZH 5ETUA 5KSVA 4ZSOB 5LJYH 4YDJA 3EJZC 3Q5TA 4MA8H 4R26H 4PJ5B 4XPFL 4A2MA 1SJVA 3FQUA 4G6JH 4NKDA 4LF3A 2LVCA 2JCCB 5SWQA 1IC7H 4M7KL 1BFVL 4O2EA 2EH8H 5EC1A 4WV1A 4PR5A 5ETUB 3QIBC 3QUXA 5KSVB 4FFYL 3RHWF 1WZLA 2ED8A 2R2HA 4YDJB 1D5MA 5EBWA 1FQ9C 1WUNT 3FQUB 4NKDB 4WJ5A 3H42H 4LF3B 4PUBL 1TJIL 5SWQB 3EJJX 1S9KC 1HHIA 4WI2A 4O2EB 2F15A 5EC1B 1RU9L 4P2RA 4WV1B 5JW4R 2WUCH 4PR5B 1FG2A 4IM8A 3QUXB 3RHWK 3HTLX 2R2HB 1MIEL 4M1GH 1MNUL 3SKJL 1D5MB 3JXAA 3WD5H 3CXDH 4WJ5B 1KCUH 5FA4A 3WO3B 4HUNB 2PXYA 4JO2H 2AQ3A 1HHIB 2XPGB 4P2RB 1T89A 2AJXH 1FG2B 2OM5A 1OB1A 3QEQB 4LP5A 2P42B 3BD3A 2MKLC 2R4SL 1A7RL 3IDXH 5D96C 1CGTA 4HKZA 3VFTA 1JHKL 5FA4B 1XGPA 3V0AC 2VZTA 4K94H 3B2UD 3CFKA 3BD4A 1CXEA 5E9DA 3S3SA 1GGYA 1OB1B 1YY9D 3GMMA 3CFJA 3O6KL 4PJXA 4G43A 3KLHC 2FIRT 5AAWA 2XTJB 4HKZB 3VFTB 3ZDYE 2OL3H 1XGPB 2NW3A 4YC2C 3PDOA 3QWQB 3CFKB 5FM8A 3O41A 1MEXH 3MRNA 4GS7C 5H8DA 5F1OB 4HK3N 3CFJB 2BY0A 4PJXB 4G43B 3RZCC 4I0PA 1YNKL 1UH4A 2APBA 3VXRD 3DX8A 5I1LB 4PJFE 5CP3H 4BFGA 2NW3B 3WFZA 1F3JA 1VEOA 3GIZL 1P4IH 1T04A 2ZKHH 4YFDB 1OWWA 3MNVA 3MRNB 1ETZA 2BDNH 3C08L 2PTTA 1QKZH 1FDLH 4I0PB 3RDTC 1GAFH 2HP4A 4K07A 3DX8B 25C8L 4IMLA 1EVTC 4RX4A 3GMRA 1DFBH 1F3JB 1FO0L 3C60C 2RBLA 3MNVB 2YUVA 1ETZB 3D87B 4JFFB 4RMVA 3EAKA 4MXVF 2NY4B 1VEMA 3B8YA 2DMBA 2D0HA 2AKRB 1BAFH 4P2OC 4IMLB 3GMRB 5FOJA 3RVWC 5J3HC 3KJ6H 5H94A 1Q1JH 3LS5H 3SGJA 5DHXB 2GEEA 3QUYD 5D7LA 1XF1A 4NZJA 4YQXL 2M8XA 2AJUH 5EC2A 3MBEA 2PETA 4TVPD 3CDGA 4OGYL 5T3ZL 2V9QA 3E3QC 4WFEE 1A14L 4YGAB 1M7IA 1GGIH 5CZVH 1UYWL 5H94B 3KJ4C 3O81A 4OQTA 5D7LB 4YHOL 4U0RB 4FABH 5KVGH 5EC2B 3MBEB 5FCUL 4XVUD 4E5XA 1JL8A 1DBML 3GSWB 5KAQG 3CDGB 4EDWH 4GT7A 2FJFA 2XXCB 1NGQL 4MQ7B 1CXKA 1INDL 2JIXA 1M7IB 4PJ9C 1A1OA 3DYOA 2MFNA 2A1WH 1MCLA 4NWTH 3P0YL 3VXRE 1G9NH 1GHFL 4E5XB 4JO3H 3BDXA 2FJFB 4P3DA 1E4WH 5GJSH 1SBSL 1U92A 2JIXB 3BKCL 4HDIA 1K4DA 4FQJL 1A1OB 4HC1L 1J8KA 2E8ZA 2P47B 4KTDL 1EO8L 3SDCC 1J0IA 2NMSA 4FMFA 2NXZD 1EEZA 4P46A 1BHGA 2FL5A 4P3DB 1GIGL 3BH8A 1U92B 2DLGA 4HDIB 1CK0L 1K4DB 3B9KA 3LDBB 4LSTL 4O2CA 5L8LB 2HT2D 2EE3A 2VR4A 1XMWA 3FL7A 4YH6A 4LARL 3KDMA 3VGDA 3VGBA 2BVPA 4QWWD 1QLFA 1OAKH 2E7BA 2F54D 4HJJH 1EEZB 4P46B 4R8WH 2FL5B 3QXWA 2NY7L 1UH3A 3LIZL 4MJ2A 4MD4A 3OGCA 3B9KB 4O2CB 4U6XA 4JFXA 4PGDA 3BP6A 5J7CC 1RJCA 3KDMB 3EJYC 1TJGH 4TVPE 5E2TL 2BVPB 4KJYA 4YFEA 1QLFB 3ARFA 5EUKA 3H0TA 4OJFL 4N8VA 1KJVA 4W4OA 2HFGL 4JO1L 2DM4A 4MD4B 3OGCB 4OF5A 4U6XB 5J0BA 4H8WH 1MRDL 4PGDB 4U7SA 2WZPD 1E4KC 1AO7D 2CDEA 3GJEA 4FQLH 1I7ZA 4F2MA 4P4KD 3TN0D 4ZUSA 4KJYB 5L88L 1JI1A 4L3EA 2YA2A 4X6DA 4PBWD 3ARFB 5DMIH 1AI1H 1MFNA 5EUKB 7CGTA 3H0TB 5A3ID 4N8VB 3ABZA 2F8XC 2EXWD 5AUMA 4ZMAT 4PJBA 3HI6L 4NGHH 1NCAH 4Q9QH 4LOUD 4Z7UF 4NN5C 4EUPA 3NZHL 2CDEB 3GJEB 4XMKL 1QTYT 1I7ZB 4ZUSB 4F2MB 4L3EB 3P4OA 3RL1A 4X6DB 5DD3H 1WZMA 5FYJU 1ADQA 3WXWH 2EDJA 1NDMB 4XPHL 3MYJA 5AUMB 4PJBB 1AHWA 3HAEA 1S9VA 4OF6A 2IGFL 3DMMA 1G6RA 1NGZA 4EUPB 3LCYA 4LGSB 3WUZA 3P4OB 3RL1B 5B8CC 4H0GA 4LVHB 2OTUA 1BQLH 2X42A 3MYJB 5GGRY 1YMMA 3WIHL 2LVEA 1AHWB 1QBBA 4XPAH 4EIGB 4JG0L 3HAEB 1S9VB 1J1OL 4FZEH 3DMMB 1G6RB 4Y7MA 4HULB 1NGZB 3BESR 3GJFA 1W8NA 4HH8A 4M1DH 5HYFA 1RUKL 2OTUB 1CS6A 4IMKA 3V0VA 2CQVA 2W0PA 1IEHA 1DQJA 1I9IH 1MFAH 3VFGH 1I3VA 3GSQA 4KZDH 4MLSA 1MF2L 4XMPL 3HE7A 2Q76A 1P5VA 2X89A 1WISA 3GJFB 3IF1A 4TVPH 3RWIA 4RGOH 1MHCA 3TF7C 3TT3H 4EOWH 2J6EL 3HN3A 3FMGH 2NR6C 5T1MA 5IG7A 3V0VB 2VOTA 3BPCA 1DQJB 2J88H 4NCC1 1YNLH 4Z7OE 2RFXA 3GSQB 4KZEL 4DKFH 1NFDE 3I84A 4XVJH 1KJ3L 1WT5A 3HE7B 2Q76B 1RMFL 3EDDA 3IF1B 3RWIB 4WW2F 1A0QH 1MHCB 4OBSA 4K3GA 1S3KL 5F96L 5IG7B 5T1MB 4ZFFA 2VXQH 3BPCB 5F7LB 3U79A 4NRZB 5IKCB 5F3HB 4C56D 4DN4L 1AH1A 3EOTL 3CX2A 1FG9C 1NBVH 2EC9U 4LDLB 3GZKA 4PLJD 1CDYA 5D7JC 4N0CC 5GS0C 1JHLL 2EEBA 2FGWH 4ZFFB 3GSNL 2ADFL 4BSJA 1K6QL 3SE3A 2YK1L 1KCSL 1XR8A 4XNYH 1LO3H 1LEIA 2BVTA 3VW3L 5IVOA 2IBGA 3T08A 4YPGA 2J8UA 4MAYC 4EDXA 1RIVH 3PGDA 2QQQA 3D2UD 5CD5C 5ACMA 3W2DH 2BVOA 4WHYH 3HC0A 5KW9H 4Q2ZA 1XR8B 5KOMC 3BJ91 2MQ3A 1BVKA 2NY1D 3WXVH 5TQ2H 4K9EL 4YPGB 2J8UB 3D0LB 1BPVA 3JWDC 3QDJA 2AEQH 3T0BA 4EDXB 3QB7C 3PGDB 1DL7L 4Q6YA 4HGMA 2WANA 2E3VA 2BVOB 2WLZA 3HC0B 4NKOA 4M5YH 5CEZD 4Q2ZB 5IGXH 4LFHG 2ZJSL 3VJ6B 5BV7L 2FB4H 3T2PA 5K59F 3HZYA 1BVKB 1OP3H 1JPTH 4IRZH 1FCGA 5F6IB 3ARBC 3C2AH 3QDJB 5ECJE 4LASL 3DHJA 4GRWE 4LLVA 4NKOB 3PP3H 3VFVA 1EVUA 1MWAH 1KIUA 5I30L 4RISH 4Z7VF 5LVEA 2R8SL 3HZYB 3DRTA 1C5DA 4DTGL 3HPLA 1P7QA 5F3BA 4C56E 2PYEE 1ZEAL 3LB6C 1EFQA 4JQXA 4I5BA 4GKNA 4OZFH 1J0ZA 5E7BA 4LLVB 5BVJA 3MRIA 3QR2A 4JKMA 5FXCH 1D5BA 3VFVB 4PRHB 1OAZH 3TM6A 4JM2C 3DRTB 1VPOL 2V9TA 4RRPG 4W4NA 5ADOH 1P7QB 4A6YH 5IJKA 5F3BB 1E28A 3ME0A 5LGHL 3PP4L 4U1SA 4IRJA 2EDOA 3K8MA 4GKNB 4I5BB 5BVJB 1QSEE 1OAQL 4KQ3H 1D5BB 5DEFA 3KGRA 4YDKL 4KTEH 4LIQH 3U7WH 4YR6A 1MHPH 5C6TL 1OWRM 2VQUA 3CVHL 3V52H 4OLWL 4HKBA 1E28B 3RKPA 1CE1L 4V2BA 2I07A 3SDYH 4U1SB 2ARWA 3AREA 3OKOA 4JCLA 1T03L 2WNGA 1S7RA 5DEFB 4YR6B 5I1KL 5GGTH 1N0XH 4WRLA 3B83A 5FGBA 4HKBB 2VB5A 4X5LA 1T7WA 2I07B 2CKBH 1ZLUH 5CEZE 3AREB 4RDQF 1RZJC 2QV2A 3OKOB 1YJDH 4PJGE 3NCBB 1S7RB 2HRPH 4ELME 5DK0A 3RU8H 4P9ML 4Z7WA 1CN4A 3MZTA 2ICWA 1BM3L 3CXHJ 2DM7A 5IV2A 5DVOA 2CK0H 3OV6A 3ALXA 4KQ4L 4M4RA 2CMRH 1F2XK 1MJ8L 4GRWH 5AZEH 4NQUA 5CJ8A 2CSPA 3G04B 5DK0B 4NFCA 1N59A 1EFXD 4PTUB 1R3IH 1BD2D 1PYWA 4Z7WB 5GGSY 4PGZA 2ICWB 4XVSH 5IV2B 1LO0L 2K3TA 4JPWH 5HYSG 2Z35A 3GO1L 3IFNH 3N1FC 1IGMH 5L0QB 5C0NC 4JQIH 4ZNEE 1Q0XL 2JELL 4XXCC 1N59B 5D72L 1PYWB 1S8DA 5F7EL 2D3VA 3UBXA 3ZDZF 3SGDI 4U6HA 4K2UL 2NY3B 5HYEA 2Z35B 1SM3H 3K0WA 3HMWL 4LVOC 2D7QA 4O58H 1KN2H 4NKMA 3UTQA 3N85L 5D1XC 4XGZA 5KVFH 3LSOA 1GVIA 1S8DB 5E5MA 2EE2A 1ZLSL 3UBXB 3SCMC 1OGAD 1XEDA 1ZANL 2IG2H 2AP2A 5E03A 4MHHI 4U6HB 3TO2A 3BI9X 4ZTOH 2PR4L 1H8SA 1FVEA 4NKMB 3UTQB 1BX2A 1FO0A 4XGZB 3LSOB 1J86A 2YS4A 5E5MB 3PL6D 5CJOH 4C4KO 5GGRA 2L7JA 1OTTD 2C3WA 1HK6A 3CVIL 1UACL 4OLZH 1ORQA 5CEZH 5KJRH 2EC9T 4M5ZL 3L3DA 5TPWH 3OKDB 1SMOA 4HPOL 1FVEB 4GXVH 1BX2B 1FO0B 2F5AH 2VJXA 4BQCA 1K5NA 3IFPA 4FP8H 5DO2C 3MRRA 4L4JA 4GH7B 5F7YC 2VISA 2R23A 5GGRB 3X3GL 3NIDE 1EA9C 5BCAA 3MTRA 1MCHA 3I02A 1UM4H 3L3DB 2VLRA 3IVKA 5IB4A 2C3XA 3FT3A 1SJXA 4R6UA 4OFYA 1O7VA 4Z95L 1QRND 1K5NB 1UEMA 3IFPB 3MRKA 1S9WA 5HSFA 3MRRB 3O2WL 3LPWA 4OZHA 2VISB 2P46B 4O02L 3BP4A 2A2QT 3QUZC 1G7HA 2YR3A 3D39D 1TJHH 4ZTPH 3I02B 5D2NC 4XCNA 4UIKH 2VLRB 1YEEL 5IB4B 3FT3B 3EHBD 1NSNL 3MRKB 1S9WB 3F5WA 1GGBH 4OZHB 4LNVA 1UWEL 3BP4B 2OQJA 2DQTL 5KVEH 1G7HB 3OTTA 4KUZL 5GPRA 3B9EA 4PJ7F 5GZND 4K3HA 5IK3A 4XCNB 4ALAH 3ARVA 1ZXQA 2N7BA 4X7SL 5D6DC 4N9GA 3DXAD 2DTML 4IRSA 5JUEH 1OGAE 4HC1A 3C6LC 2WSKA 3F5WB 5DRZA 1AJ7H 2P43B 4E42A 3D85D 2OQJB 2LV4A 2IWGA 3A67H 3NH7L 1KXVC 1T66D 5IK3B 3DBXB 5JHDD 1I1CA 4AH2A 5GRUL 3JTSA 1ZWIA 2FLBT 3WCYA 3QUKA 2KDGA 3L3KA 1U2CA 5DSCA 1W72H 5IVXE 1C5BL 5DRZB 2OR7A 4E42B 3MLTA 3ULUC 1X5FA 3KPSD 1NQBA 3L5JA 4HEPG 4FS0A 3QNZB 1JF1B 5DGQA 4ZPVA 2WWMC 5GGUA 2ADGA 2HH0L 3U4BL 2WIIA 3JTSB 3WKML 4AH2B 1ZWIB 5E24E 1A6TA 4HIJB 3VH8G 3QUKB 2V9RA 4UV7H 3L3KB 5DSCB 1EZVY 4KMTL 4ODBD 4OZFG 3MLTB 3G5VA 1Q94B 5HY9A 1BZQK 2JJWA 2B1AL 4V2CB 5FUOL 1TTUA 1H3TA 2IEPA 2Q8AL 1NCCL 4C57C 4X7EC 4ZPVB 3U7AA 2ADGB 3MNZB 3PXJA 2WIIB 3DV6A 1A6TB 5F7FA 4XPGH 1OAYH 5GHWH 1G1CA 4IBLT 2E9JA 3PGFL 4LPYA 3D39E 5DVNA 3FQTA 3G5VB 5HY9B 1VHPA 5F9JA 1ZHKA 1YEJH 2HVKA 4POZD 2ESVA 5SX4I 3DV6B 3L7FA 3QISA 4JHBA 3OG6B 2CIKA 1RIHH 2YZ8A 1CLZH 4NDMA 4QRUA 5F9AC 1BWMA 3FQTB 5ISZA 3SDDD 4DFIA 5HHNA 5F9JB 2XY2A 2Z8RA 3LKNA 3Q6GL 1ZHKB 5IFJA 5C0CD 2ESVB 2VLKA 4YDLB 3L7FB 1E4XI 2CIKB 4X7DC 1A9EA 4WO4C 4NDMB 4QRUB 1QYGH 4RWYH 4XP6H 4TNWK 4U3CA 4AL8H 4GG8A 3L9RA 5JHDE 5HHNB 1AQKH 2A6IA 4FQIL 4X4ZA 3LKNB 1ZE3C 4PJHF 3S34H 4B7IA 5IFJB 1QO3A 2G9HA 1QBAA 1PY4A 2VLKB 1NANH 5K9QI 3CDFA 1UJ3B 3WIHA 4S10A 1U3ZA 3MPCA 1A9EB 3FFCA 4ZS6D 4GG8B 3KPSE 3L9RB 1YYML 4XNMA 1KEGL 2BXYA 3VI3F 5DQDH 2A6IB 4K23L 3T8XA 1T7ZA 2NY5L 3W0WD 1QO3B 2NX5A 2G9HB 4K7PX 1YZZA 4U7KA 4M4PA 2EECA 5IIEA 1S5HB 4I4WB 1FFPA 4M1CC 3BKJL 3FFCB 3KYAA 4N9OB 4NQED 2XQBL 4FMKA 4K7PL 5F8QC 5HI3C 4YBLC 3T8XB 2AV7A 3GI8L 2J6EA 1HQ4A 5JQ6H 1TZHA 5F1SA 2NX5B 4I0KA 1CU4L 4NN7C 6CGTA 4D94A 5IIEB 1U42A 4NO0B 4HWNA 2AQ1A 1FFPB 3NCYP 3ZSSA 1LO2L 3KXFD 3R0MA 2RHEA 4YZFF 1AC6A 4LQFH 3W0WA 1IKNA 2AV7B 1HQ4B 1CICD 4KDWA 4XNQB 5GGSA 1Q38A 2DDQH 1PVHA 5JO5B 4XP1L 2BXZA 3SGDH 1FIEA 3QHFH 1EGJH 1GGCL 1MCBA 4QXGH 3P4NA 4MNGA 5C0CE 4LU5L 1I8MA 1JWMA 2FHCA 3MLXH 3GKZA 5GGQL 3TYFA 5J13B 4KI5E 5GGSB 3VDCA 3GSNA 1OTUD 1MCOL 4XCFL 3PABA 4LBEA 5JIKA 3VWJD 1Y18A 1G7IA 5FYLE 1HI6A 3P4NB 3NACL 4MNGB 4Q0XL 3BP5A 1I8MB 1JWMB 2VYRE 3TYFB 1A7PL 2IF7A 1WF5A 3PABB 4OAWB 4LBEB 5M7QA 1IC4H 1EXUA 1Y18B 4NZUL 2N1KA 1G7IB 1ONQA 1HI6B 4PTTA 1FSKB 3W0WE 3U4AA 4LLUA 3BP5B 3RL2A 1FE8H 2HT3D 3O11A 1B4JH 4GBXC 1FC1A 4PJIA 2PO6A 1CFQA 1PJ9A 4NQEE 5GGVL 3GMPA 3A6BL 1EXUB 1BEYL 1LP9E 2LFGA 4WWKC 4S1SH 1ONQB 3BUYA 4U1GC 2AEIT 2R1YA 4MB5A 4LLUB 5FKAA 4I0CC 3RL2B 1W8OA 3O11B 1SMAA 5DMJB 3VGFA 4RAUA 4TVSa 4PJIB 1MUJA 2W65A 4HT1H 2PO6B 1HYRC 5C3LD 6FABH 1CFQB 4MA1C 1L0XA 3KYKH 4CMHB 2G2RA 4FOMA 1MAMH 1TZGL 1IZJA 1MI5A 2AK1H 2DQJL 3BUYB 5BV7B 2NY2D 4XPBH 3DETD 3O6MH 3D5OF 5FKAB 1RSFA 3OJ2C 2DJUA 3FO1A 35C8L 4WY7H 4KHXL 2IPUG 4RAUB 3BE1H 1ZGLP 1MUJB 2W65B 4UU9A 3S7GA 2LTQB 2HKHL 2H2PD 2Q3ZA 4X7TA 3UO1H 2G2RB 1UA6H 4BFIA 1IAIL 5T1DL 2VDOH 1MI5B 2B2XL 3WN5A 4FFZH 3WS3A 4O51A 4LQ1A 4KUCD 1FZJA 5SV4A 3FO1B 2VL4A 4RFNC 5DQ9A 3FQNA 5JOFA 2QHRL 1G0XA 4UU9B 4X7TB 4BFIB 3VFRA 3UJIL 4PP1D 1JGVH 3U7YH 4P2QD 3WN5B 2AJZB 3VRJA 3WS3B 5I1GH 1B2WL 4O51B 5JIPA 3CVHA 1FZJB 5MEOA 1A64A 3MLSH 2Z31A 5DQ9B 5LGJA 5JOFB 1OT2A 4BK5A 2XXMB 2Q8BH 3LRSA 2AJVH 3VFRB 1T3FA 1JYXA 2RCSH 4JPVH 3O4OC 3VRJB 2GHWB 2XWTA 3CVHB 2VDKL 4J3TA 2GFBA 5MEOB 5ESQA 2Z31B 5LGJB 3O6LH 3AXLA 1L7TH 4TSBL 1NLDL 4FNLH 4K7PY 1INEH 5EORH 3DX6A 3LRSB 1NMBL 4M03A 1NLBH 3E6HB 5FB8A 2EDQA 2IH3A 2ZPKH 1T3FB 3ARXA 1J1PL 3VWKB 3QUXD 3MREA 2XWTB 1FGNH 2DAVA 1XFPA 3I9GL 2GFBB 5ESQB 3ZO0A 5DRNA 4JREC 3AXLB 4L4VA 3V0WL 1C12A 4OGXH 2FX7L 4F57L 3HNSH 1UWGL 3DX6B 5I71B 5FB8B 4JG1L 3X17A 2FEEI 4P2RD 3LHPH 5SX4H 3MREB 1GZQA 5DRNB 2B5IB 4LRIA 4XHJC 4L4VB 3WUWG 1C12B 4QNPF 2PXYD 3BPLC 1K3IA 4HFUL 1ZGLA 1MCWM 4MDIA 1FZMA 5HDLA 3RVXC 1E4XH 1GZQB 3GHEL 1V7MH 4Z0BH 4LCWA 4ERSH 3ZE2F 2K1MA 2XTJD 2HLAA 4RBPH 2FO4A 4UV4L 2IMNA 5KSBE 4P2QE 5SWSA 3ZTJH 1ZGLB 4YXHH 1HIMH 4CBPA 4GLRH 1FZMB 4MDIB 4R4FL 1EHLH 5E9DD 3UEZA 2PW1A 2R56L 2JCCE 3TJHD 4LCWB 4XNXL 2F5BH 3VDBA 4PJ8A 2HLAB 2W9DL 2FO4B 1WAAF 4JRYA 5SWSB 3R8QA 1EEYA 3MRHA 4NC1E 2Y25A 3S35X 2YPVH 2IFFL 3LMJH 1X5IA 2PW1B 2EDXA 4I0PD 1SEBA 4LCUA 4L4TA 3S35L 4PJ8B 4C55A 3GUTA 4JRYB 1RPQA 4X80L 4UDUA 1KFAH 4ZFGH 3MRHB 3S4SG 5D8JL 4HG4J 3ULUF 4Q9RL 4K71B 1B6UA 4OSUH 2QTEA 2RAMA 1AKJA 3WV0A 4TQEL 1MFBL 1SEBB 2NY4D 4LCUB 2C4FT 2VLLA 4L4TB 1A6VH 4K3DH 3GUTB 1DBJH 1HXMA 1QBLH 4P2RE 4PBXA 2ZUSA 1U8LB 4J23A 4UDUB 5JXAH 1DQQB 3GNML 5KSAC 1KELH 5KVDH 1AKJB 4MHHG 5BVPH 3WE6A 2FWOA 1CZ8H 2VLLB 1CGUA 1JNJA 1HXMB 1LNUB 1HSAA 5TJWK 1OAXH 5IBUG 3LS4L 5FYKD 1QA9B 4I3RH 1WJ3A 5D7LD 3P11L 5IMKA 2XTJE 5MENB 1TNNA 1TVBA 3WE6B 4IOFD 4GXUN 2FX8L 2ICES 4MB3A 4KK5D 2F19H 4RMQA 1HSAB 4AEIH 2CO6B 5E2UL 3O6FD 5E9DE 2WQ8A 1QFPA 3DUSA 3IFLH 1YN7A 4PJXE 5F8RC 1QSZA 2D03H 4N8CH 2EDBA 4F15C 5IMKB 7FABH 1TVBB 4KJPD 3QUMH 3K74B 4NHCH 5IQ7L 2SEBB 4YHMH 4JZJC 3WNKA 2RB8A 4NNPL 3NGBC 4HZLA 2OLDA 3DUSB 3V4VH 1YN7B 4JB9H 4EI5B 2BCKA 4KK9C 3KNBA 3NCCB 4YFLI 2R0LH 2V2XA 3NIFE 4TUJA 4HZLB 2VXSL 2OZ4L 4BA8A 4KMLB 3K1DA 4POZC 3WHXB 1NMCB 2BCKB 1DVFA 3KNBB 3O2VL 2A6KA 3O8XC 4OV5A 3T0DA 1UT9A 1I1AC 4KMQA 2V2XB 3SJVA 4P46D 5DS8A 4TUJB 2J2ZA 5LXGH 1QNZL 3GMNA 3MRJA 1DQMH 3U1SH 3B9KD 3C09C 5IESL 1AR1D 2OX5A 5GS0L 1DVFB 4KI5C 4S0TD 1IGFL 4MD0B 2A6KB 2DBLH 3PQYD 4J6RL 4JN2A 4OV5B 1RZFH 1XF4A 4ZAKB 4N0FA 3SJVB 4PLNC 4L8DA 1EBPA 4PJEF 5FYKE 3L5WA 3MJ9L 3GMNB 3V6OC 4ETYA 3QIUA 3MRJB 3LN9A 5D7LE 3RKDD 2OBGA 3H7LA 2F53A 2A74B 5C2BH 1BECA 3L3JA 4JN2B 4WTZA 3VI4F 3I3BA 3IDIA 1XF4B 2AAVA 3ARFD 4N0FB 2VAAA 4L8DB 4GSDH 3L5WB 4L8SC 3GSXA 3QIUB 1Z0MA 3MRLA 1D5ZA 2F53B 3T3PF 4C4KT 5DZNA 3JWDL 3L3JB 3IDIB 2Y72A 1A3RH 3O3UN 1E4JA 4KPHH 1F97A 2VAAB 3DUUA 4LL9A 5JDJA 4RNRA 1FFNA 4KKCC 4Y5VC 3TNNA 4JY6A 3PG2A 3WSQL 2KQNA 2UWEF 5HVHC 3MRLB 1D5ZB 2KPNA 2QHLA 3I6GA 4EKXA 2V5RA 4WW2A 1IVLA 1YNTA 5D7SH 2WAHA 1NGYA 4JKPH 3C8KA 5DWUL 3VMNA 5A40E 1SY6L 3DUUB 1UENA 4RNRB 3IDJA 2FECL 1YEFL 3C8DA 4CRPA 5DHYA 3ETBF 2DJSA 3I6GB 4P99A 4GG6F 1QOKA 3DMMD 2UZIH 4Y2DA 4WW2B 3U46A 4LVNC 1NGYB 4HWBL 3C8KB 1CYGA 3ZKQD 2HG5A 3IDJB 5CBAA 1YMMD 2VDML 3F58L 4HWUA 5DHYB 4FQ1L 3WFCL 4HF5L 4Y2DB 3WFEH 3ESVF 4H20L 3QDGA 1FFQA 4G6MH 1FHGA 5K9QG 1J18A 4OFDA 5FYKH 5D70L 5DEGA 2Q20A 2HG5B 3QIBA 4R90L 5CBAB 2XWJA 2ZNXA 3B9DA 5FO9A 4JDTL 3HE7D 3SN6N 4NZTH 3N06B 2D4FA 3QDGB 1F4AA 1BMGA 1S7QA 4JCMA 3Q5YA 3MV11 4HMCA 4XP9L 2XZQL 5E7FA 5JIHA 1GCFA 4P9HH 2BOBB 5DEGB 3EYSH 1KJ2L 3QIBB 5IEKA 2XWJB 2K9UA 1MCPH 3M8OL 5FO9B 3FRPG 4OCSL 1JRHL 1JMXA 4L3EE 4LAQL 4X6DE 3OF6A 3VXQA 1A7OH 1MFDH 3DX9A 2R2EA 1S7QB 1S7XA 5E2WL 5J12C 3ZHDA 5E4EC 2OXHA 3CDYA 4PJBE 5I74C 2HFEA 4MXQC 3EO0A 5GZOD 5IEKB 5IFHL 3NCJL 4G5ZH 1D6VH 2I9LA 1A7BA 3H3PH 4WTXA 4Z7VA 3OB0K 3DX9B 2R2EB 3NPSB 1DCLA 1S7XB 1AGDB 2L0DA 3EO0B 5DJAA 4F8TA 1JWSA 3HMXH 1UH2A 3OR7A 5T3XD 3T0XA 2ERJC 4X9BA 2H2PC 1T1WA 3G6JF 2F8VA 2I9LB 4Y4HC 3QIWC 4Z7VB 5JMRA 1PZ5B 3GMOA 3BH9A 5E6YA 4LRNL 3RWCA 2H8PA 1YMME 3BDYL 1KACB 3V6BR 5DK3A 5DJAB 3LPFA 4XX1E 1JWSB 1D7FA 4U1LA 4NKQB 3AAZA 3OR7B 4O4YL 3QFDA 5EZIL 1KEML 2H1PH 3RZCA 1ZTXH 4DCQA 4JFQA 2DS4A 5DFTA 2XRAL 2Z9TA 2GJ6A 4K94C 3UAJC 3GMOB 3BH9B 3RWCB 2EE9A 2H8PB 4IOSD 2DQEH 5D1ZC 4YC2B 5BS0A 2CR6A 1H3WM 3ZE0E 3MLUH 2VDRH 3F8UB 3UPRA 3EDKA 4U1LB 3AAZB 3DSFL 1QPPA 3QFDB 1JNNH 4QXTA 3RZCB 2IBBA 1JHTB 4DCQB 2O93L 4HUWB 3X14A 4JFQB 3RDTA 1YQVH 3INUH 2R9HD 4GKSA 1L7IH 2GJ6B 2ICWI 4R97B 1OAUL 5BS0B 4J3SA 2XZAL 4LSVL 4NCC2 3UPRB 3C60A 1TFHA 1KBGH 4KH2A 4N0YL 2IBZX 5JHLH 3EUUA 4LCCB 4QXTB 5L6YL 3X14B 4GKSB 4QHNB 5DMKA 5F7KC 4RMSA 1R5VA 1JTOA 1WK0A 3HNVH 4K3EL 3MRGA 3RTQC 1F4YH 5F9WC 4ZQKA 3ILQC 5AG8A 2GIYA 2W92A 1ADQH 1IGIL 5E6IC 5DMKB 5TF1H 1X5XA 4P23C 1R5VB 2QADB 2P8LA 3IDGB 5T3XE 3MRGB 4MXWH 5DFVD 4I3SH 4IRJD 3QHZH 3PGCA 4ZQKB 4Z8FH 5L7XH 4CJ0A 1NGXA 1RZ8A 4P49A 4BYHA 1MCWW 1YA5A 2J8UE 4AT6B 4M7JL 2D7MA 1FL3A 4KJWD 4RMTA 3FHAA 4PJ9A 4U1NA 4FQQA 3ARED 2Q86A 4P5KA 1ZK9A 1NGXB 1RZ8B 3SEPA 3QFJA 5ICZA 4F37F 4RGNC 3VXMA 1FL3B 3MV8A 2YXFA 4PJ9B 4U1NB 2XYCA 1CLOL 4QCIA 4FQQB 1P4LA 5DJ2A 2Q86B 1LVEA 4AIOA 4P5KB 3MODL 2AJSH 3QFJB 4LSQH 4JN1H 4F37K 5FK9A 5ICZB 1EV2E 3VXMB 3KPMA 3MV8B 5ITBL 1CXIA 4UI2A 4UT7L 4QCIB 5DJ2B 1P4LB 1YECL 1G9NC 5M94B 4W68A 1OARL 3MSPA 1WV7T 5TFSH 1RI8A 5ENWA 3ULUL 1S78D 2JF1A 5FK9B 3GFUA 4POUB 4BQ6A 3KPMB 1A3LL 1UXSA 3S5LA 2NW2A 3BZDA 4OIAA 4D3CH 5EBLA 3OAZH 1GYAA 3BGMA 5HYJA 3UJJH 2NY3D 1E0OB 3I2CL 4LGPB 3P40A 1IKFL 3RWJB 5EZLA 2ZCLL 3BPOB 5ENWB 5ICXA 3V5HA 4WFHD 1LDPL 2GW5A 5IMLA 4KWUA 1UXSB 1PQZB 2NW2B 5EBLB 3R4DA 1MPAH 3S36H 5T3XH 1NAMH 5E99H 3W81A 3BGMB 5HYJB 1FIGH 1NBZA 1QFUL 2GKIA 5DA0B 5D6CA 1N64H 5EZLB 1E4KA 4NJ9L 5B21A 5ICXB 3V5HB 2VDLL 3RY4A 3N9GL 1KPVA 4D9RD 5IMLB 1ZLWH 4OCXH 3B2VL 4MMZC 5CJQH 2CR3A 1L4IA 1VERA 5JW3H 1FORL 2X4QA 3AB0B 3MBEC 1NBZB 4J4PC 5D6CB 8CGTA 4KROC 2VIRB 3MLYL 5DD5H 4QTIL 1KPVB 5TE7L 3V7MA 4XB7A 4H8WC 3BSZL 4PJ7B 3RFZC 4NO3A 4LLMA 4JM4L 3I6LE 2X4QB 1KB5H 4FQCL 2Z91A 3BIAX 4Z7WE 4HPYL 5MEQA 4Y88A 1IGTB 1UZ8A 3WMSA 3VG0L 5B8CA 1BVZA 5DR5H 1LDSA 4L5FL 3V4PL 1OPGH 4NO3B 1P69B 3RY5A 4LLMB 3UTTA 1JNLL 1EJOH 1IQWL 2VRAA 5T3ZD 1JZ7A 2VLRD 2FX9L 1H3PH 2Z91B 4X4MA 4A2LA 2OS7A 2JB5L 1J5OH 5MEQB 1DBKL 2IBZY 4MJ6A 1UZ8B 1SVZA 3G08A 5CZXD 4OD1H 2XT1B 5B8CB 1TTFA 5D2LF 3LDBC 4PB9H 3SE9L 4KRPC 3VXNA 5JOEA 4KC3B 3UTTB 1JI2A 1KT2B 2VR9A 3B5TA 4KRMB 4WFHE 3ILPA 3K2MC 1WFOA 3RJQB 1C1EL 4EI6A 4MJ6B 3G08B 3WHE0 2DJ4A 2HKFL 3B9KC 4WUKL 4G9FA 1BFVH 2XIDA 3DVFA 3VXNB 2QSQA 4CADB 2OZ4A 3VGEA 3ILPB 4NP4H 4D9RE 1JGUL 4IRSD 4EI6B 3CZJA 4NPYA 3DYPA 2IPTH 4G9FB 4NQVA 2D31A 3VD7A 1V3MA 1I1YA 4N8VG 2DM3A 3MX0A 4Y1AB 4ZPTA 4AG4L 1DBBH 5D7JA 1WVZA 5C0AA 4W4OC 1T7VA 4NPYB 1CXLA 1PG7W 5SX5H 3O4LA 4F9PC 4NQVB 2ORBL 3ULVH 2GTWA 2D31B 3LY6A 4PJHA 1I1YB 3T65A 5EA0L 3MJ9A 1U36A 4ZPTB 3UZQA 4XVTL 4X6BA 1PSKH 5D7JB 1A7RH 5C0AB 4NCDA 4EUPG 1JHKH 4MAYA 1PD6A 3O4LB 3EOBA 5T3ZE 5F7DA 2GTWB 2VLRE 4HD9A 4PJHB 1TNMA 1K9TA 1A22B 3T1FA 3PE9A 4LVHC 3SO5A 4OZHE 4X6BB 1TXKA 3FZUD 3HAEG 3OPZH 1C08A 5CS7A 2ICCA 1AHWC 1YQ2A 4MAYB 1R3JA 3EOBB 2DQUL 5F7DB 1T80A 4M7LH 3TT1L 1KCRL 3T1FB 3ZE1F 2CXKA 2AVGA 1NUFA 3DSNA 5DT1L 1YNKH 3UROR 4XX1G 1C08B 4HS3B 3ARBA 1C5CL 4MSWA 5ISZD 2BY3A 1XF2A 1R3JB 3IDYC 2HT4D 1SY6A 1CR9L 2QSCL 2VLKD 3TZVD 2EDEA 1X6NA 2P7TA 2DBJA 3HR5A 5HHVL 3ARBB 3L3IA 4MSWB 25C8H 1XF2B 3LOWA 3GBML 4HWBA 4HCRA 4KVNL 4MNQA 5CMAA 1G9MH 2Y5TA 5FF6B 1A4KA 3EYVA 3MC0A 4JM2A 2P7TB 3QQ4A 3KPOA 4G3YL 3WNOA 3FFCD 3WLWC 3HR5B 1OM3L 3L3IB 4OD3H 2F9BT 1WT5C 5FUZH 1FRGL 4MJ4A 3QNXA 4YO0A 4MNQB 5CMAB 3QSKB 2OR9L 2NX5D 2Y5TB 4U2ZA 4B50A 3VXUA 4I77H 1A4KB 1BQSA 2BVUA 4FQXC 3EYVB 4FXGB 4YQXH 5EB9A 3QQ4B 1T7YA 5HGDA 2VH5L 5BRZA 4YGVA 4PV9A 1X9QA 4OGYH 3RA7H 3P3YA 2CLRA 2AXJA 3QNXB 4YO0B 4XMLH 5CD3A 1GZPA 5E08L 1RUQL 3CH1A 3H9ZA 3SE8L 3VXUB 1KJ2A 4XB8A 1N5YH 1OY3B 1DE4A 5EFIA 5HGDB 2HMID 5BRZB 4YGVB 4PV9B 2AABH 2CLRB 2ESVE 3I50H 2H2SC 5CD3B 1GZPB 4L8CA 3CH1B 5DTFA 1KJ2B 2ENYA 2EKJA 1OQXA 1IC1A 3M1BA 1DE4B 1T2XA 5ISZE 1GHFH 4M8VA 3QEUA 1MFCH 5DD1H 2Y5EA 4N0RA 1INQA 5FO7A 2C3VA 1FNSL 2VLKE 1SBSH 3UYOD 3FOLA 1VGEL 3UYRL 4L8CB 2V5SA 5DTFB 5EWIH 3BMWA 4KTDH 1QSFA 1EO8H 3M1BB 3U9PH 4XI5D 5HHPA 3QEUB 5TQ0L 1INQB 2L4OA 5FO7B 2C3VB 4FFVC 1GIGH 4DUWA 3P4LA 3IS1X 1CK0H 3V5DA 4XXCA 1F6LL 3FFCE 1JWUA 1BGXH 1D3CA 1QSFB 4TNVF 2X4RA 3BIBX 2NX5E 1UFUA 2NY7H 3PWPA 3LIZH 1A6WH 2BRRH 1RUML 1KNOA 3EDEA 3WJJC 3V5DB 5D9SA 5D1XA 3DVNA 3LQAH 2PO6D 2ZCHH 2VXTL 1JWUB 4OZ4B 2WINB 5HHOA 4TNVK 5E2TH 1WIOA 2X4RB 3SCMA 4ENED 2ARJA 2XKUA 2J12B 4JQXC 4ONFH 4OJFH 1C7TA 3TNMA 3PWPB 4AQ1B 3AS3A 3K81A 3SQOL 1KNOB 1YEGL 1R3LA 5D9SB 1AR2A 5D1XB 3DVNB 5D5MF 1SEQL 5EOCL 4UAOB 2XOTA 5K33A 4R7NA 2VXUH 3CFCH 5HHOB 3H3KA 2QSVA 3SCMB 1R3KA 2ARJB 2O5ZH 2MTPA 4NC0B 1FL5A 1MI5D 5JR1H 1J8HA 3TNMB 4YHKH 1R3LB 4PJFF 4Z9KB 4AJ0A 4M7ZB 5DJ8A 3TBYA 3RX8A 4LLWA 1Y6KR 3LKQA 2ZG1A 2YPLA 3GSOA 4MNGE 1FL5B 2LE9A 3QPQD 5EG6C 3MMEA 1U8JA 3IGAA 4KK8C 1IBGL 4YUEL 3RUGF 4R3SA 1LE9A 3R1GL 5DQJA 4OI9A 5FGBC 5DJ8B 2J1KA 4LLWB 3LKQB 4YDVA 3QUZA 3GSOB 2APXA 5IWLC 4UBDD 3RPKA 3F7YA 3IGAB 1U8JB 4HS8L 5D2NA 4Y5XC 4LMQE 3UTSA 2Z31D 4R3SB 1LE9B 4JG0H 5DQJB 1J1OH 5DLMH 1X7QB 4YDVB 5AG9A 3QUZB 2E6PA 1RURH 3F7YB 5DUML 1DQDL 1R5IA 4ZO9A 5D2NB 5KS9A 4XHQA 3OKYA 4MS8C 4PJIE 3QG7L 3V8CA 3MOBL 3UTSB 1S78C 1J1XL 5D6DA 1CGSL 2R0ZL 1JYVA 3FN3A 4CN6A 1OP5H 1HYSD 5LBSH 1FGVL 5D1QC 4X9IA 4WIQA 1N6QL 2EIZB 5T1KA 4UB0L 1P9MA 5JXEA 4WWID 3LVEA 1R5IB 3LRHA 4OLVL 1Q9WB 3I6KA 5J8OA 3D6GA 4KZEH 4DVRL 2FATL 4JRXA 2E8YA 1XGYH 2MCPL 1BOGA 2EEDA 4L4VD 1NBYB 4ORGA 2Q6WB 1NGWB 2IJ0C 1MI5E 2DICA 5T1KB 12E8L 2A73A 2QQKL 2CRIA 5F96H 2IC2A 3I6KB 4WUUD 1KGCD 4XP4H 4JRXB 2VDPL 2NY6C 4JJHA 4DN4H 1WBXA 3EOTH 3TH3T 3REWA 1BOGB 4ORGB 3CDCA 4N68A 4OI7A 1EJ6A 1H3UA 2A73B 3RVTC 3B8SA 1JHLH 5HVGB 3GSNH 1XF5A 4JDVA 1AXTH 1DLFL 1WBXB 4LCWD 3REWB 4GW1A 4RAHA 2VN4A 2YK1H 1KCSH 3DV4A 1I7UA 1I85A 1I1RA 4KDTA 3Q5OA 5SWSD 1FPTH 3VW3H 1XCQA 1AE6L 2RQ8A 2E27L 1VEPA 2LU4A 5D7KD 5E2VL 1XF5B 5FYLL 4JDVB 4JFDA 1MJJA 4GW1B 2LU7A 1U0QA 3O9WD 3KAAA 1KTLA 2DLFL 3DV4B 4PJ8D 2QQLH 2W0KA 4JRYD 1T0MA 1JCKA 3WL9A 1JTPA 2G60L 5JW4N 15C8L 1NL0L 1XCQB 4K9EH 1DDHA 2VZUA 1P4BL 5CZXC 2HTLD 2FIKA 1AD0A 1MJJB 1PBYA 5T33H 3EOAA 3QWOA 4ODTL 4WO4A 2EZ0C 1RJZA 1T0MB 5J11B 3WL9B 4Y8DC 4P4RA 5L2KA 1CCZA 3G9AB 1DDHB 1UZ6E 5AYUL 4L4VE 4LASH 3LZFL 5I76B 2YKLL 3ARDA 1X5YA 4ZO6A 2FIKB 1F4WH 1AD0B 3NCEB 4LDEB 1UWXH 1NFKA 3EOAB 3QWOB 3STLA 4WO4B 2BVQA 1WSST 4PG9A 1RJZB 2R8SH 2GJJA 2EH7L 1YEIL 3V9FA 5L2KB 4P4RB 5I1DA 1ZMYA 1I9JH 4DTGH 1N7MH 4J7RA 5HD8C 1F13A 2ZSWA 3SOBL 1NEUA 1TITA 3ARDB 4ZS7H 5L9DL 5I19H 1RUPH 4LHUA 3STLB 2BVQB 4PG9B 2NYYD 3J7HA 3PHQA 1PKQA 3BVNB 5I1DB 4E9LA 1F8TL 1VPOH 3DUHA 3DI3B 2ZSWB 4MXVE 4LCWE 3PP4H 3L3OA 5J1AA 3WS6A 1ACYH 5AWNL 3U36A 4Y4KC 5SWSE 1NC4B 1OAQH 4N8PA 2X1QA 4LHUB 1VADA 3JVGA 1JZ2A 1GH7A 2O5XH 5ADPH 4PJEA 3SE4C 3PHQB 5D7KE 1PKQB 1CL7L 4JZNA 4OLWH 4PIRF 3J8F7 1CE1H 5K9JL 3L3OB 5FGSA 2Q1EA 4NN7B 5J1AB 4OZIF 3U36B 4G9DA 4JRYE 4GW4A 4J3OC 1VADB 5I1KH 2EDWA 4PJEB 1FBIH 4JZNB 3CLEL 4D9LL 1URLA 1KXQE 1RJYA 3NA9H 4P5TC 3MLWL 3CFIC 3GJFK 4JHZA 4KHTH 4L4TE 1MIML 4G9DB 1I8KA 4OCMC 4GW4B 1H9VA 4R26L 4P9MH 4G6JL 4Z7OF 4HWZA 3VA2C 1NFDF 5EU7C 3BT2L 5I15H 1RJYB 2UWEA 2EH8L 1HKLL 5DC4B 1MJ7L 4KQ4H 1QFHA 5EOQH 4LKXA 1J7VR 1O0VA 1I8KB 5KTEH 32C2A 4RQQA 4TN9A 2DQCH 3VMOA 2F58L 4QRRA 3SJVD 1PG7X 2X4NB 4U2YA 5AZ2L 3H42L 4HWZB 3NZ8A 4JDZA 4HBQA 5C0IA 3S9DB 3AS2A 3KR3L 3PP3K 2UWEB 1Z0NA 3UP1A 2X4UA 1LO0H 4TPRH 2WUCL 1U3JA 1UJ3C 4GG6A 4GBXA 4LKXB 1PG7L 2EXYD 3MBXL 3EO9L 3GO1H 1AC0A 1KIQA 3ZKMC 3MXWH 4AEEA 32C2B 5CHNA 4RQQB 5I9QB 3WD5L 2GY5A 4NBZB 4QRRB 4F7MA 2RGSA 3CXDL 2XTLA 3HI1A 1JGLH 4WWKA 5EBGA 3NZ8B 5F7EH 4JDZB 5LCVH 5C0IB 4H1LA 3IAGC 4TOYL 5CLWA 1ROWA 4XC1L 2F53D 4DEPB 4ZXBA 4GG6B 4GBXB 1T83A 5C8JA 4WEUD 1KIQB 4LLQA 5CHNB 4UIMA 3GSUA 4F7MB 3A6CH 3HI1B 4WWKB 5DVMA 3HNTH 2M26A 1ZLSH 1V8HA 4H1LB 2Q7YA 5IHBA 4Y0GA 1JYWA 2ZWLT 4KK6D 4YHPA 4K94L 5GRYA 4TULL 4ZXBB 5BJTA 3TVMB 5C8JB 2PR4H 4LLQB 4UIMB 1PZUB 3GSUB 3W9DA 4BUHA 3ZKNC 3TBSA 2Q7YB 2J7LA 2R29H 2FRGP 2CUMA 2GITB 1UACH 4YHPB 3W39A 5E1AA 3BRDA 1IRAY 3RVUD 3E6FA 3RAJH 4XP5H 1MCDA 1PLGH 4HPOH 4ZUWA 1GXEA 3W9DB 3LEXA 3JBG7 1ZLUK 4GRWF 1Z9LA 3TBSB 5J13C 2BOCA 1P4IL 2ZKHL 3W39B 1RAMA 3GEWB 3D25A 3SJVE 4NQSA 2BDNL 3E6FB 5ABDE 4ZUWB 1FDLL 4KKLC 3MUJA 1F11A 4Z95H 2FEDD 3LEXB 1GAFL 5TH2A 5HGAA 3O2WH 5E8DH 2BNRA 4O02H 4U1KA 3PV6A 1DFBL 3WDHA 2BOCB 3C6SA 3EJZD 2FYYA 3G6JA 1D6EA 1L9MA 3D25B 3RWFA 4NQSB 4PBVC 2Y6SC 3QDGD 5FDWA 1P7KA 3TCLA 5H37H 1F11B 5A2LH 3CMOL 5TH2B 1VFUA 1NSNH 5HGAB 4XBEL 3O4OB 1IEBB 2F53E 2BNRB 3QIBD 4G6FD 1UWEH 4U1KB 3PV6B 3MLRH 4HIHB 5I1EH 3C6SB 1DQLL 2FYYB 1IAII 3G6JB 1D6EB 5IP4A 1Q1JL 3LS5L 5ALCL 2DB8A 4XPTH 3RWFB 1V3LA 4JO4L 5FDWB 1P7KB 3A6OA 2AJUL 4X7SH 3TCLB 4M61A 4WW1A 5I16A 5MHSE 2DTMH 5HHXH 3G6AA 5DD6A 2OMBA 2YHGA 2IADA 5EN2A 5IEHA 2CIIA 2GYSA 2X70A 1GGUA 4JHWH 1GGIL 5IB1A 5CZVL 4CMHC 3OF6D 1MRCL 3ZT5A 5B4MC 3QDAA 4M61B 4M6ML 4WW1B 5BV7C 5I16B 5KVGL 3G6AB 4XAWH 1X6LA 5DD6B 5HVFB 2IADB 5EN2B 1ZGLM 4EDWL 5IEHB 2CIIB 5ELIA 2X70B 5IB1B 2LTQC 3NBNA 4NWTL 3WKMH 1JUFA 3BW9A 5IFAH 1G9NL 4EXPX 3AU1A 3BPLB 4F7EA 1N3NA 1WBYA 3MV9A 4ODXA 5C9JA 4JO3L 3CZFA 4YHLL 1E4WL 4OT1H 4GW5A 1JF5A 1RZ7L 2B1AH 3GRWH 1CFVL 1K8IA 3OAUH 4GAYA 3KLHD 2Q8AH 3X11A 5BMFH 1NCWL 1JUFB 3BW9B 3WN5C 3AU1B 4HKJA 4F7EB 1N3NB 1NGPL 1WBYB 1RK1A 4ODXB 3BQUA 4MJIA 4QRTA 3HLAA 3RI5K 3CZFB 1FAIH 5C92A 5C6PB 5GRXG 2E9WA 4GW5B 4Q97A 3QDGE 3L7EB 3RZCD 1K8IB 4GAYB 3X11B 1IZKA 2VUOA 2E6JA 5H2BA 1V5JA 2GJ6D 1A7QH 4UBDC 4HKJB 2ZUTA 2D7TL 4HJJL 1RK1B 5BS0D 3BQUB 4MJIB 4QRTB 4R8WL 2WIMA 3HLAB 1R0AH 2Z31C 2ATPA 1IC5L 4R2GC 4YHZL 3MV01 4F7CA 3Q6GH 2AXHA 2EYRA 3RDTD 3CX5K 5H2BB 1TJGL 4H0IA 1N2RA 1D9KA 3VWKC 3T2NL 4CKVX 5HTSA 3IJYA 3V4UH 3C60D 3Q0HA 4OIIH 5KSAA 2ATPB 3DROA 5K59E 4F7CB 4FQIH 5I71C 2EYRB 4H8WL 2NZ9C 4FQLL 4P2OD 1A5FH 4IS6A 1N2RB 1D9KB 2IH1A 3F6LA 5DMIL 3RVWD 1AI1L 4OV6F 3DJ9A 3VG9C 3IJYB 5J3HD 1LK2A 1YYMH 1HNGA 1KEGH 2J3SA 3GBNH 3DROB 4Z7VE 3WFBH 4JE4B 4MCZA 2NY5H 1NCAL 3MROA 4NGHL 5L8KB 3HFMH 2R0WH 2FO1A 5IJVA 3GGWA 5DUPH 4HUXA 4FG6C 5EO0B 3BWAB 1HILA 4IS6B 4R4NC 4OUUA 5FYJH 1K8DA 2IH1B 3BKJH 1LK2B 1YPZF 3NFPA 3WDIA 4DKAA 3KYOA 5DJYA 1FLTX 4OM0L 4MCZB 3MROB 3L5HA 4G8IA 1B6DA 1CU4H 5IJVB 3GGWB 4JZJA 1BZ9A 4HUXB 4PFEA 3RWHB 4OUUB 1K8DB 1LO2H 4PJ9D 4NRXA 2CKNA 3NFPB 5LQBH 4GAJL 5IHUH 4F3FA 4F15B 3KYOB 5DJYB 4CMMA 1CTOA 2GJ6E 4D0DA 3QFJD 4G8IB 4YAQA 2H6PA 4JZJB 1BZ9B 5BS0E 3VXMD 4NRYA 5HHMD 3NGBB 3MV8D 3DARA 4M1DL 4NRXB 3TYGH 3LEYL 1I9IL 4NBXB 5SV3A 3VFGL 4F3FB 4WI3A 3TH4T 4CMMB 3SDCD 1CFSA 4D0DB 4NQCA 5GGQH 1I1AA 4YAQB 2H6PB 1CG9A 4NRYB 4X5XA 3LPGA 3TT3L 4EOWL 1DEEA 1I8LC 2VN7A 2J88L 1YNLL 4K8RC 4Q0XH 3OJVC 1CFSB 2BNUA 4NQCB 5IVXF 1I1AB 3PWVA 5FV1L 5DXWA 1A0QL 4S0SD 5C86A 4WU5A 3ZTNL 3ORJA 3V6OA 3C09B 3IDMA 5HYJD 2VXQL 2CGRL 5E8PB 3HS0A 3EJYD 2V5MA 2BNUB 3MGTA 1NBVL 3PWNB 1KPUA 4UT6H 3BN3B 1U41A 5D2LA 4WU5B 3EDFA 5GGVH 4L8SA 1UG9A 4I1NB 1BEYH 4MYWB 1WZKA 3IDMB 1CBVL 4FFWC 4H5SA 3QH3A 2XZZA 1AIFA 1CDGA 4NUGH 3PNWA 4G7YL 5MI0C 3VXSA 2X09A 1SJHB 2VZSA 2XKSA 3MGTB 1FV1A 4XNYL 1G6RL 1QPXA 1KPUB 1RZKC 1LO3L 1WTGT 3ZDZE 1OTSD 2HFFA 4YHYC 2YEZA 5D2LB 1Q9KB 5TGBA 4L8SB 4Y5VA 5I6XB 5IQ9A 2VE6B 1G0DA 2LQRA 4H5SB 1CDUA 3QH3B 1AIFB 3DHMA 2RIKA 3QFJE 3HC4L 3PNWB 3VXSB 3VXME 5KW9L 5HHME 3FO0L 1FV1B 1J12A 3Q48A 4KVCL 3MV8E 1I9RL 2GQHA 2HKHH 4EI5C 4U0QB 5TGBB 3HKFA 4Y5VB 5DMYA 1IAIH 1WBZA 5T1DH 5TQ2L 3WXVL 5IQ9B 3S3JA 5HVHB 1F90H 2YBRA 3FKUS 2B2XH 1X44A 5F71A 2AEQL 2V17L 4OFVA 4U31A 1S5IH 3OHXA 1F58H 2AGJL 1NH6A 4M5YL 5IGXL 2E5EA 4N1HB 1T1XA 1ZT1A 2G5RA 2FB4L 1JPTL 3UJIH 1YMHB 1WBZB 4IRZL 4XNUH 3IJSA 3DTXA 3I3DA 3C2AL 3UTTD 3TFKC 4FZ8L 2JJVA 3OHXB 4GQ9H 4LVNB 5MERA 4S1QL 4UQ3A 3S96A 1MWAL 1T1XB 1ZT1B 5HYJE 3ARZA 3IJSB 1DVFC 1KYOJ 3DTXB 4C58B 1JIBA 4PRPA 4ZAKC 4M48H 2A9NL 1ZT4A 5MERB 4HIXH 1NC2A 4UQ3B 3S96B 3G5ZA 4M6AA 2NR6D 3MLVL 1Z5LB 4UINH 1A6UL 5T5FL 4WI8A 4G9FD 1CDCA 3PDGA 1EIBA 3TA3C 3ULSA 4A6YL 1JJUA 4Z5RA 4JJ5B 2H9GA 4PRPB 3I9GH 1ZT4B 3KPNB 4KQ3L 2FECI 4LIQL 1NC2B 3V0WH 3OL2A 1J0JA 4CDHA 3QIUC 2AI0H 4WTZG 2YSSA 4AZ8A 4JG1H 4MJ5B 3ULSB 4HIEA 3SDYL 3IFOA 4Z5RB 3KPPA 2H9GB 1IQDA 4PJCF 5FHBH 4JPKH 1A6PA 1UQSA 1W0VA 3QDMA 3L1OH 3HCVA 4MCYA 5D7JD 4LPXA 4P9HC 5C0AD 3RVVC 5J12B 3QWRA 4N0CD 1N0XL 1UVQA 5GS0D 2EDFA 2BJML 4Q58C 2NXYC 1UC6A 2YSSB 5E00B 1X5KA 5IUSA 1RVFH 4HIEB 3IFOB 3EGSA 1KLUA 1IQDB 3BYYA 1IGYA 4Y4HA 1UQSB 3QIWA 1W0VB 1YJDL 3QDMB 5EUOA 3HCVB 3QULA 2HRPL 4MCYB 5CSZA 5IVNA 1UVQB 2UUDK 1WFUA 1ZVSA 2BMKA 3OJDA 1G6VK 4M02A 3F7VA 4MAYD 3UTTE 2Y06H 1Z9SA 5E6ZA 1VENA 5CD5D 4GO6B 1MLBA 4X4ME 3EGSB 2ERJB 1KLUB 2CJUH 1IGYB 4Y4HB 3CSPA 1UB6A 3KHOA 2R69H 5CSZB 4J3UA 1ZV5A 4HX1B 4RIRA 2OJZH 4ZSOA 1ZVSB 1JRHI 3OJDB 5D1ZA 5E1HB 3F7VB 4JGUA 4XVSL 3ZKSD 1U8HA 1CFTA 3JTTA 3WIIL 4Y2DC 4PV8A 1MLBB 4JPWL 3S6CA 1P84K 2IFFH 1IAIM 2OL3A 5EIQA 2XWBA 1UB6B 2WW8A 4JQIL 3JWOC 4G9FE 4RIRB 4F7PA 5D1ZB 3QI9C 3ARBD 2LAAA 3OX8A 1V3JA 5EULV 2YN5A 4X80H 1FZOA 1U8HB 1CFTB 3VRLF 5JMOC 3DURA 3JTTB 3DGGA 4PV8B 3T4AA 5T5NF 2VXVH 2OL3B 1NAKL 2XWBB 1LWRA 1SM3L 3JV0A 5CP3A 2EDKA 1MFBH 5KVFL 2MWCA 4CU6A 3JSSA 1O7SA 4F7PB 3LQZA 2KUTA 3OX8B 1KULA 1Y6MR 3LB6D 1FZOB 3G5XA 3DURB 3RTQA 3DGGB 3T4AB 4MNQD 2IG2L 1KLGA 5F9OH 2GCYB 1F4XL 3GNMH 1GGTA 3WNMA 4K3JH 4ZTOL 4NQXB 5C0AE 2ICWJ 2XPGA 4JM2D 1BQHA 5E6IA 1U91A 5IVZA 3MUY1 3O4LE 2YUXA 4P23A 1A7NL 3LQZB 2E9BA 5CJOL 4PJHE 3QEQA 3G5XB 3RTQB 3GB7A 3QO1A 1JMZA 2YD1A 4OCWH 1KLGB 5F9WB 3LS4H 4OLZL 5TE6L 2HFTA 5KJRL 3NPSC 2X9WA 3VXUD 4DK6A 3T0WA 1BQHB 2X4TA 1U91B 4O2FA 5E6IB 2R2BA 5IVZB 2F5AL 1NUGA 4P23B 3VI3E 4IHOA 4PJDF 3FHQA 4Q9BA 5E2UH 3GB7B 3QO1B 5F88A 1JPGA 1PX3A 4WFFD 2Y07H 1ZHBA 2XKNA 3JV5A 4F7TA 4RBPK 1UM4L 3VGHA 3OR6A 2X4TB 4O2FB 4LPUA 2R2BB 4WHDA 1FYTA 1R3HA 1UADC 3SGEI 3TESA 4IHOB 1SBBA 2C7UA 4WFED 5I66A 3QPXL 3QNYA 1VFMA 5F88B 1JPGB 5BOZG 4FQHA 1ZHBB 2XKNB 4F7TB 4ZTPL 5D5MA 5I1LA 4QRPA 3OR6B 4PB0H 4RGNB 3C2SA 5A43C 1FYTB 1R3HB 1Q0YH 5E95B 2C7UB 3B9VA 5I66B 3QNYB 1GGBL 1NMAL 1XGUA 1T2JA 3D1MC 4FQHB 3BKML 5D5MB 2B7DT 4PJFA 4QRPB 3DNKA 4XXDA 4R97C 3O2VH 5MEPB 4FN0A 2DYPD 3WJLC 4X6CF 4MNQE 3N0PB 4LCCC 4EQ3A 2BHZA 4JFFA 4WFGD 3U0TA 1XGUB 4MAUL 3RUGA 5C0ND 3A67L 2AKRA 3ALPA 5AD0B 4ZG1A 5IESH 4PJFB 3VD4A 4XXDB 4RDQG 1IGFH 4ESKA 2JTDA 3N1PC 4RRPA 1LO4H 2X1OA 1W72L 3U0TB 3VXUE 3RUGB 1VGKA 3P77A 5D1XD 5BRZE 5HHOD 2QADC 4KKBC 1DSFH 1F3RB 3SCMD 1Q72H 4UV7L 4WFFE 1LK3L 3TCXA 4F58L 4Z77A 2X4OA 4J4PA 1VGKB 3GSWA 3P77B 4OCLC 1IM3A 3FAXA 4CJ1A 3UDWC 4MQ7A 3JWDH 1I75A 5GHWL 4EZMA 1RULL 3EO1A 4FQPA 3FB6A 1J8HD 3JV4A 1PGRB 4JY5H 4FRWA 4Z77B 2X4OB 2CK2A 4KROB 4OFPA 4UMGA 1FVDA 1YEJL 4JAMA 1IM3B 4PLKC 4XRCA 5DO2D 4X9FA 2LAGB 1RIHL 2YPLD 1CLZL 2KZ1B 3KHQA 5DWUH 3EO1B 3FB6B 3JV4B 3K8KA 1XGTB 2UY6A 4U6YA 1MREH 1YEFH 1QSFE 1FVDB 1F4HA 4JAMB 4XRCB 4WHTA 3QUZD 4WFGE 2HJLA 4AL8L 2HJKB 3QEHA 1YY8A 4U6YB 3TWCL 3DPBA 2YOCA 2ENSA 1AQKL 3F58H 5TDOB 4KJQC 2X5PA 5I1AA 3S34L 4NJAH 1EMTH 4WHTB 1GOHA 4H20H 2PN5A 4LSPL 4KRPB 3P30H 4TTDC 2HJLB 4ZFOB 2W0FA 3BPOC 1YY8B 3QEHB 3BAEL 1IFHH 4R90H 2Q3AA 3S5LG 5HHOE 3GIVA 5I1AB 4G7VH 3QZWA 4DAGL 5J9PA 3MGAA 3C6LD 1S7UA 1TETL 1FNHA 2BRQA 2J8HA 5EOTA 2XZQH 3LKOA 2W0FB 3S88H 1E27A 4HEME 5CUSH 4HUUA 4JRXD 3M8OH 5DJ6A 3GIVB 1DTUA 4OCSH 5JQ6L 1JRHH 4HW6A 1FNGA 2GTZA 3QZWB 5J9PB 5F6HJ 1W0YT 3SKNA 5CJBA 3T77B 1S7UB 3AVEA 4UQ2A 1J8HE 1RZJH 4U1IA 4F9PA 5IM7A 3AB0C 3ULUD 2WUBL 5EOTB 3LKOB 1E27B 1FVCB 4HUUB 4LQFL 1HCFX 2WWMD 5DJ6B 1DBAH 1OTSC 5J1SC 3U30C 1FNGB 2GTZB 1NDMA 4XCCH 3NCJH 2YPLE 2DDQL 3SKNB 3L3GA 4MLIA 4OUOA 3MRCB 4UQ2B 3O2DH 2H41A 4U1IB 5IM7B 1EGJL 4QNPE 3CLFH 5I8KH 1UKTA 1KJMA 3MLXL 3ROLA 2UV3A 5EH1A 5DGRA 3L3GB 3HE6C 3ULVC 5D2NE 2YRZA 4LRNH 3BDYH 4G8FA 3S37X 3QQNA 3UTSE 5CKAA 3ZE2E 1P1ZA 2IPKA 1KJMB 4JFDD 1YC7A 3ROLB 5EZIH 3MXVL 3KG5A 1CD1A 3NA4A 3S37L 3IYLW 2AK4A 2DQIH 5KS9E 1CF8L 1IC4L 1F6FB 3MCLH 2F54A 4G8FB 5C0FA 4C54A 1EHAA 1IGCL 2E7MA 1EERB 4MX7A 1P1ZB 5I1IL 4OZIA 2IPKB 4HH9B 5JW4Q 1FE8L 4KKAC 2XACC 1CD1B 2CUHA 4WO4D 2IAMA 3GMLB 4N1EA 2AK4B 5L2KD 1GRWA 3OSKA 3IDYB 5EO9A 4BSVA 4JRXE 2F54B 1OAUH 4BZ1H 4S1SL 5C0FB 2XZAH 3CK0H 1MCRA 4MX7B 2XV6B 4OZIB 2W59A 2JK5A 5LAXA 5L6YH 5IKCA 4HT1L 4NRZA 6FABL 2IAMB 3ULUE 2BK8A 5F3HA 4L29A 3TP4A 3KYKL 1AO7A 1IL1A 2E7HA 1ITBB 5EO9B 4BSVB 4AEHL 1MAML 1MWAA 2AK1L 3A0OA 5IBLC 3VE0A 2CDGA 4XPBL 3O6ML 1DQTA 3FT4A 4FQXA 2JK5B 1CT8A 4LHUD 3BE1L 4M1CD 5LAXB 4NM4L 4TSAL 2VWEC 1NFDB 4L29B 3UO1L 1YDPA 1AO7B 2PYED 4OZFA 1UA6L 1G9MC 5HI3D 1IL1B 4LPTA 5K9OB 3SKMA 1MWAB 3NABL 4FFZL 3VE0B 2CDGB 1HHKA 1TDQA 3FT4B 3HB3C 4QT5A 2HJFA 4FQXB 4JFYA 4QXUL 4A6YA 1CT8B 3CSYA 3ALWA 1CI5A 2I27N 5LWYH 1DN0B 1YDPB 4M7JH 4OZFB 1CD9B 3EYOA 3SKMB 4X7FC 1TCMA 3WEXA 5HI4C 4JFDE 1QSED 3UJTL 5I1GL 1HHKB 3UZEA 4QT5B 4Y16C 2HJFB 4JFYB 1IM9A 2GSIA 4I2XA 4BUGA 3ZT6A 3H2WA 3D0LA 3QQ3A 1Z9OA 4A6YB 3CSYB 4TUKH 5CINH 4W6YB 2Q8BL 4XT1C 4KGJA 2AJVL 4X9HA 3EYOB 3WEXB 3CH8A 2A0LC 4JPVL 5GGTA 3VJ6A 4UNUA 1CLOH 4BH8A 4PRBB 1NCTA 4XTRC 4PGJA 1IM9B 2FJGA 2GSIB 3MJGX 4I2XB 4OZGF 4BK4A 3QQ3B 3ISWA 3B5GA 5L2KE 3O6LL 1OL0A 2CKBA 5CBEA 5I2IA 3GBLA 3NIGE 3QCTH 1EBAA 4UT7H 4BH8B 3GHBL 1YECH 2VDNH 3ZSTA 4YEFA 2FJGB 4LLYB 1OARH 1LD9A 3X12A 4GFTB 3D18A 4QRRD 2CKBB 5CBEB 5I2IB 4OGXL 1JN6A 4LDOB 1ZA6A 3NFSL 4PRHA 3LHPL 3WJJA 4GBXD 1WEJH 3RGVC 4H25A 3I2CH 1IILE 3C87A 1LD9B 1H8NA 1ZT7A 3X12B 3D18B 3E8UH 1PKQE 4GRWB 4WWKD 1HNFA 3RBGA 1JN6B 1ZA6B 2B20A 3OKKA 1WZ1H 4H25B 4Z0BL 3QHTC 4D9QD 1ZT7B 4PJEE 4HS6A 3BKYL 4ODUA 3RX7A 4ONOA 4QEGA 2B1HH 4EVNA 4G8GA 2Y9RT 1WWCA 3B2VH 1HIML 3K3QA 3LQAC 5ALBL 3OB8A 2B8OT 3OKKB 4UOW1 3E2HC 3HR6A 3OQ3B 4RMUA 2EO9A 4HS6B 5HYQA 3ZE0F 2F5BL 4ODUB 4QTIH 1I3GL 5TE7H 3T3PE 1ZS8A 3O3BA 4YE4L 4EVNB 4G8GB 4J8RA 3LMJL 2G75A 5AEAA 1C8PA 5HYQB 1HZHL 4UTAH 2VO5A 1BJ1J 2UWEE 4RA3A 3VG0H 5IWLA 1ZS8B 3BN9C 3G04A 3O3BB 4J8RB 4ZO7A 4BKLA 1EZVX 2XA3A 3ARTA 4Y5XA 2VUYA 4PTUA 3V4PH 3LQMA 4TRPH 3BZEA 4QYOA 4QRRE 2G75B 4OSUL 4HXBL 3LN4A 2FX9H 3H9HA 5FM5M 2XFXA 3K2UH 5J89A 1DBKH 1DBJL 4GG6E 4S1RL 3T2OA 4BKLB 5JXAL 4Y5XB 2YPKA 5DVLA 3KPRA 3BZEB 4PRAA 4I13B 4QYOB 2Z0BA 1KELL 3LN4B 5KVDL 3H9HB 5D1QA 2XFXB 1UKQA 5HPOA 1JZ5A 1C1EH 1VACA 2DQDL 5GS1C 2HKFH 3N1QC 2WM0A 4AENA 1OAXL 2YPKB 2BFVL 3F65A 4D9QE 3KPRB 4I3RL 2J8OA 4PRAB 5B38G 1UM5L 2ZUYA 4NC2B 1ZVYA 4EN3A 2Y1VA 5M95B 5D1QB 1A4JA 1JGUH 1VACB 4HFWA 2F19L 2DQGL 5A2JH 4AEIL 3WKNA 1MAKA 4UAOC 4AENB 1ERNA 1X5LA 1JFQH 3BD5A 3IFLL 4XHJD 4N8CL 4EN3B 7FABL 1A4JB 4MQXC 3SPVA 5HDBF 4NHCL 3HZMA 4N0UA 4HFWB 3EYUH 3OKDA 3RVXD 1Z6JT 2HYMA 3CPLA 2NY6B 4M7ZC 1QP1A 4IEFB 4DW2L 1W72A 1B3JA 1VFAA 1NEZG 3ZLQC 1MFEL 4OQ1A 5IOPA 3SPVB 2X40A 4XVTH 4K8RL 5D71L 1J88A 3HZMB 2R0LL 3MV9D 4H0HB 4N0UB 4OCRL 2JKXA 4PD4K 4HQQL 3BGFB 4PP2A 5D7IA 3CPLB 1FNAA 2YC1A 2FGZA 3K46A 1MY7A 4KRLB 1W72B 1VFAB 5IOPB 1RIUH 2D7NA 2BNRE 1M1SA 3VXPA 3BQUD 5C0JA 1BD2A 4PP2B 1YPZA 3G6JE 5GIRA 4D0BB 5D7IB 2EKSA 2ZZUT 3CU1A 1DQML 2YC1B 3U1SL 3TT1H 3VRIA 5IW3A 3BPNB 2UYLA 4H88L 1KCRH 2E6QA 2DBLL 1RZFL 1T6WA 1NUDA 3P4MA 3VXPB 5DHVH 3TIEA 5C0JB 1BD2B 1YPZB 1HXYA 2Q7NA 1RZKL 1C5CH 5FKPA 5GIRB 2EKSB 1MCQA 1UJTA 2ZUXA 4Y5YC 3HRZA 3VRIB 1I4FA 2UYLB 2WBJC 5DZLA 3E0GA 5C2BL 5JTWA 1IARB 3P4MB 1H3VA 3DBXA 3TIEB 2P48B 3MRQA 5HHVH 4M3KB 1HXYB 4GSDL 5KSAD 2W07A 5FKPB 4GMSH 3GBMH 3GSVA 4KVNH 3HRZB 1I4FB 4O9HH 3WUWA 5J6GA 4UILH 1P9MC 1FFRA 5JXEC 5JZ7C 3ULVF 4CVUA 4G3YH 3QNZA 4KPHL 3QRFM 1JF1A 3MRQB 4JKLA 4RGMC 1OM3H 3PL6A 1T0NA 1TMCB 4HIJA 2X4SA 1FRGH 3GSVB 4N1CA 1OCWH 4ZD3H 4Y4KA 1KTKE 3WUWB 1VDGA 5J6GB 2AERT 4QXWA 3MV9E 1Q94A 5SX5K 4BFEA 5C9KA 3AGVA 3SE4A 3V6ZA 5J57B 4X4XA 4CL7A 4MDJA 3MNZA 4OTXL 3PL6B 1T0NB 3FN0L 2X4SB 5DA4A 1K3ZA 4XC3H 3X3FL 4Y4KB 4DKEH 5IVXB 2D9CA 2UZIL 5E08H 5CSGA 4MJIE 3V6ZB 4G42A 1U8KA 1RUAH 1AY1H 1QD0A 4X4XB 1QRNA 4P5TA 4MDJB 2K7QA 1YYLL 3U4EA 4KK9D 1T6VN 3EYFA 3BZ4A 4X9GA 2HLFC 1I85C 4KDTC 2PTVA 4OFIA 3WFEL 2ZNWA 3WFDL 4G42B 1U8KB 4G6ML 3GI9L 1QRNB 2EIDA 2CPCA 4P5TB 4UNTA 3ZYJA 3U4EB 3C5ZC 3EYFB 4F9LA 3BZ4B 4WEMB 2I24N 3O8XD 1RFDH 1BFTA 1J9CT 1VGEH 1EGJA 5J11C 1I1AD 5LGKA 4NZTL 2BY1A 5CEYA 3IETA 3DXAA 1KUMA 2ICEA 5TQ0H 4P9HL 3AFLA 2DWDA 1UJ3A 3EYSL 3WDJA 3LV3A 4N5UA 4PYHA 5C2UB 2OYPA 4KI5D 1B9ZA 1MCPL 3GKWH 1I3UA 4XAKD 3MJ8A 4U3XA 1CL7I 4MZ2A 1L0QA 1A7OL 5FYLD 4PS4L 3WFHA 1OSPH 5CEYB 4JVWA 2I5YH 4NT6A 3IETB 3DXAB 2ICEB 1WITA 4OB5L 1RZIA 3ARDC 1KLFA 2DWDB 3LV3B 5DD0H 2FD6H 3L5IA 1S5HA 4I4WA 4KXZI 2HTKC 3ZDXF 3MJ8B 2XNAB 2E7LC 4G5ZL 4HAGA 5FCSH 1D6VL 3H3PL 4X5WA 1F3DJ 1T5WA 3WFHB 4NT6B 4KY1L 4L1DA 4LHUG 1KB9K 1RZIB 5INDB 1WC7A 1CE6A 3F62A 4H26A 1BBDH 4NO0A 4ODSH 3HMXL 3VXSD 4P0DA 1AGEA 1PY9A 3B9AA 3D9AH 3EIFA 3Q2CA 3BGAA 4J1UA 1YEGH 3KPSB 3FQRA 4E0RB 1CLYH 4JFEA 4X5WB 1T5WB 2C9AA 3MQIA 2O5YL 4KKCD 4XNQA 3JWOL 3WS6C 1WC7B 1CE6B 4H26B 5JO5A 4ZYKA 1QFOA 3JVGC 5CGYC 1ACZA 5C0GA 2V5YA 1AGEB 4U05A 4APQA 5GSVA 4XWGH 2FLRT 4J1UB 3FQRB 4JFEB 1I7RA 5DUBA 3OKEA 5GJTH 1UXWA 4HXAL 4NFBA 4M93B 2DQEL 2ZG3A 5FGCE 3IS0X 4ZYKB 3MLUL 3TPKA 4NQCE 4PJCA 3M07A 1XT5A 5C0GB 1IBGH 4APQB 4OGAC 5GSVB 1M71B 1JNNL 3R1GH 1I7RB 1YQVL 2XG5A 3INUL 4MD5A 5DUBB 2ZCKH 1V7NL 3OKEB 1L7IL 4NOBA 1VA9A 5IT2L 2EE6A 1UXWB 2H32H 3HHRB 1VSCA 3QQ9C 4M9OA 3RIFF 5I8OL 1GC1H 5FGRA 3O3AA 4XAKE 4PJCB 4HS8H 4OAWA 2C4FU 5JNYA 5JHLL 2LABA 1U6AH 1LGVA 2NY0C 2BSTA 4QHKJ 2X9XA 5HDQH 3V6OE 4MD5B 4NIKB 3O3AB 5GS2D 3HNVL 4KGLA 4M7LT 5I9QC 4PRPD 4QTHA 5JNYB 3QG7H 4ZUUA 5D2LE 1F4YL 5EZOL 1J1XH 3STZA 2BSTB 2EDHA 1A1MA 2R0ZH 5I1CL 4MGXA 4DEPC 5CJ5A 1N6QH 1EAJA 3AY4A 3VXSE 4CW1A 4MXWL 3MOAH 3DVIA 4I3SL 4QTHB 4ZUUB 3STZB 4Z8FL 2B4CH 2MCPH 1A1MB 3P9LB 2EIEA 4G6AC 3RGHA 5F9DC 4MXQD 3MA7A 1OGTA 4M6NH 4ZXBC 4YHNA 3TVMC 2O61A 1T83C 1XIWC 1U58A 4W6WB 12E8H 2XA8L 4CW1B 3KXFA 4N5EC 1OVZA 3NCFB 5D93B 4NZRH 2VDPH 3B3IA 1HSBA 3WO4B 3QWRD 4DQOL 3W11D 5IROA 3MA7B 1OGTB 1EPFA 4YHNB 2O61B 1U58B 1QG3A 3KXFB 1JZ6A 1U3YA 1Z2KA 4Y4HD 3QIWD 5CILL 1QZ1A 1FL6A 3B3IB 1HSBB 2AJSL 2AJZA 4NNYA 1Z3GL 2D0FA 4OD2A 1JPFB 2BSSA 2YD9A 4LSQL 4JN1L 4YDIH 3VWJA 3KYNB 4TTGA 2E27H 5CGMA 1IMHC 4KAQL 2GI7A 3R06A 5FYLH 1R24A 3OAYH 1FL6B 3VFNA 3UAJD 4NNYB 5TFSL 5J6HA 4OD2B 2BSSB 4PJDA 4ORZC 5D1ZD 1G0YR 2APVA 2WLYA 2DWEA 4PJ5D 1RK0A 4PRPE 1P5UA 3VWJB 1NL0H 4D3CL 1ULVA 1EHXA 3E6HA 2CRZA 3R06B 3QP3A 3ZT7A 1R24B 4GAGH 4HK3J 3GK8L 3VFNB 5B3NA 5J6HB 4PJDB 3VWKA 5HVWA 2ZUQC 3OZ9L 4J3XA 4UUJA 1NUNB 2DWEB 1RK0B 3ZE1E 4R2GB 1MPAL 4WGWB 1NAML 1OP5K 1H15A 3LZFH 3PF2A 1FIGL 2YKLH 5E5UB 5I1HL 4PRIA 1N64L 5F72S 3K80A 1GOFA 1G7PA 4S1DC 3W82A 1YEHL 2COQA 4LCIH 4UUJB 3RTQD 2XQYK 4P3CH 1D5IL 5CJQL 3QDME 2VC2L 3ILQD 4M8QA 4Z6AT 2MSPA 1H15B 5JW3L 2C3HA 5L9DH 4PRIB 1OD9A 5E6ID 4Q9CA 4PJAF 1G7PB 4P23D 4PG2A 4GRLC 4YPJA 4X6CA 3VG9B 3QEQD 4LK4A 1ZVHA 3ZKXC 3TBVA 4OF0A 4HBCL 5EUOE 4M8QB 3CMGA 5HJ3A 4MMXC 1KB5L 3TH2T 1GPOL 3HUJF 4X6CB 2XY1A 1XGQA 5DR5L 4MA3B 3PDDA 3OKLA 3UC0H 3TBVB 5HHQA 3OWEA 3FT2A 5HJ3B 3U6RA 4G6KH 4ZSOE 1H3PL 2J5LB 4ONHA 4RGND 5FHAL 4Z0XB 1FLRH 1J5OL 2PKDA 4PJ5E 4V1DA 1XGQB 5JPNA 4KXZH 5HYIA 2OI9C 3VXOA 3QUMA 3CLEH 3OKLB 4D9LH 5HHQB 3FT2B 3U6RB 3O3DB 4QRPD 3K4DA 1UM6H 4YWGH 4ONHB 1MIMH 3BQUC 5B3JF 5LKNA 4V1DB 3B5HA 4DGIH 4BSWA 5JPNB 1I8LA 3VXOB 3BT2H 3DLQR 3QUMB 5EO1A 1HKLH 1MJ7H 1U8LA 1DQQA 5IBTH 4NP4L 3CNKA 1KV3A 2F58H 2W9LA 5AZ2H 3IKKA 4BSWB 1NCBH 3CGTA 4JFFD 2IPTL 4JANA 4GXUM 3F7PC 5EO1B 3KR3H 4PGCA 1UWXK 1LNUA 4RX4D 1PG7H 1D9KC 2DQHL 3CFEA 2YD6A 3EO9H 3MBXH 4MVBC 2X4PA 1FNFA 3QEQE 1W0WA 5EBWB 1DBBL 1CIDA 1QA9A 2PTUA 3U2SA 1B0WA 4HV8A 3BHBA 1LO5A 5MENA 4JANB 2DD8L 3EYQC 3TIDA 5CIPH 4PGCB 4TOYH 3ULVL 2NLJA 4XC1H 1ED3A 2VQTA 3G6DL 3CFEB 1KG0A 2X4PB 1MJUH 1W0WB 3S3PA 3PIQA 1MCCA 1PSKL 3U2SB 1N8ZA 4HV8B 3BHBB 1LO5B 1T21A 3OBAA 2PXYB 3TIDB 3MBED 4RFEA 4Y4FC 5FDYA 4J4PD 2NLJB 2SEBA 2BHYA 4KROD 4RGNE 1ED3B 3NTCH 5MI0B 4TULH 1FYTE 3F12A 1KG0B 3LD8B 1FJ1A 4YHYB 1KIPA 3PIQB 4EI5A 3KLSA 1N8ZB 3OPZL 3LH2H 3T09A 2P45B 1U8OA 1T21B 2VERN 4I18C 4X98A 4DGYL 5D5ME 4QRPE 4RFEB 4LHJB 5C70A 4M7LL 5GRJH 3MACH 5E9DB 3F12B 4XBGA 1AD9A 1FJ1B 2JIXD 1KIPB 3GMMB 3WHXA 2A77H 1UZ6F 1HH9A 2EIBA 3C5SA 1U8OB 4X98B 4OCNC 2VDQH 4JGJA 3PDOB 1HINL 3QCVH 3O41B 4RWHA 2DF3A 4XBGB 1AD9B 4NO5A 2AJYH 1QR1A 4JFFE 3C5SB 1HH9B 4KRPD 2HRLA 1G1YA 4Z7UA 3RUGE 4MD0A 3MJ7A 1WTLA 1KB9J 4G8EA 4ONGH 3RWDA 5E0QA 4ZAKA 1F00I 4KTYA 1G9ML 1T04B 4U6TA 3GDBA 1KCVH 4YXKL 4NO5B 1QR1B 2PTTB 1T2QL 3TA3A 4GKOA 4HUKB 2A74A 3CXHK 4Z7UB 3CMOH 1BFSA 3QAZB 3MJ7B 4XBEH 4G8EB 4OD3L 3RWDB 1QHOA 2YUZA 5FUZL 2R39A 2A83A 3FONA 4JQVC 3NOIA 1DQLH 3U0WH 4LAJH 5C09A 2PNDA 4I77L 5ALCH 1JE6A 4JO4H 2BP3A 5KVMC 4K55A 3TA3B 2AXFA 4HUVA 3RA7L 2A83B 3FONB 3O6FA 3S97C 4XMLL 1OW0C 5C09B 4BQBA 1SYVA 5I73C 1MRCH 3D48R 5I6XC 1N5YL 4MNHA 4M6MH 1J10A 1QLEH 4OM1L 2DN7A 1V3KA 1E6JH 2AXFB 4HUVB 2AABL 2DKSA 4L3ED 4NWUH 4P59L 4TSCH 3O6FB 3I50L 5I18L 2VKWA 3LN5A 4GMTH 1SYVB 1MCEA 3QDHA 2NXYB 4MNHB 5CJXA 1MFCL 5DD1L 3WLBA 3CSBA 4YHLH 4O5LH 2QL1A 5CCKL 4KU1A 3MLPA