2XVAA

Crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sinefungin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
199
structure length
199
Chain Sequence
GAMVIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDRQYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWERVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords TELLURITE RESISTANCE PROTEIN TEHB
total genus 65
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.265: Tellurite methyltransferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2xvaA00
4XCXA 4E2WA 4RTRA 5BW4A 2I62A 3U81A 3FRHA 5BXYA 2YXLA 3TM4A 3G88A 3P97A 2VS1A 2P3LA 2YXDA 4DQ0A 1FBNA 2ZTHA 3KR1A 3G2PA 3PX3A 3UJ6A 2ZSUA 4RTNA 3FUTA 3MCTA 5K0NA 5EMMA 3SX0A 1IM8A 2AOUA 2XYVA 4EKIA 5F2OA 5DWQA 3E23A 3ORHA 3TR6A 2VDWA 5CVVA 3GNLA 5DM0A 5K0JA 2AN3A 3LPMA 4O29A 4G56A 1N7JA 4X61A 4CKEA 4YUXA 2O06A 3HA7A 5E9WA 3GDHA 4FT2A 3UFBA 5DTRA 3CJTA 3LDUA 3P2EA 5EHGA 3EVAA 3TPZA 4C07A 3AJDA 4MQ4A 1G8AA 3T0IA 5LR6A 3F4KA 2HTEA 1V39A 3KR0A 3P9CA 5D1HA 1L3BA 3HVJA 2P1DA 4XUEA 5C1IA 5LQNA 1KYZA 2EJUA 2JHAA 1FP1D 2OKCA 2P8JA 3T7RA 5M5BA 3R3HA 2IH4A 2VDVE 5DLYA 1RJFA 4C08A 2O57A 4X60A 5EPEA 2ONYA 3LCCA 3K0BA 1BOOA 3LDFA 5KS2A 1L3CA 4PCAA 4LG1A 2PY6A 4M38A 3G2QA 3MCZA 3GCZA 1L9KA 4DM3A 1I1NA 3FYCA 3UZUA 4LECA 2H00A 3SGLA 4E30A 2Z6AA 5FTWA 3FTDA 4HGYA 3A7EA 1FJXA 2AN4A 2HNKA 5F2NA 4KDRA 2H1RA 4BLVA 1XCLA 3KR9A 3FPJA 5HFJA 4C06A 5HIIA 5GINE 2E5WA 5K0GA 3HA5A 3LGAA 1NBIA 1X1CA 2ZULA 4HC4A 3NDJA 4M7RA 5E2AA 5E8RA 3MGGA 5KQSA 3P9KA 1NW8A 4E2XA 5EOVA 1XDSA 2IP2A 4QPPA 3O31A 2OB1A 4RTKA 3FUUA 4HH4A 1SKMA 1INLA 4ER6A 3FTEA 1AQJA 3KR2A 4HG2A 4PGGA 1EJ0A 5EMKA 2AOTB 3PLAE 3OFJA 3MERA 5K0EA 3ANXA 2WA2A 4BLUA 2AR0A 4FZVA 2P40A 1NW7A 1XCJA 3OZTA 4PYIA 4QDKA 4CKCA 2ONZA 1XVAA 2GB4A 1NBHA 4Z2YA 5GIOE 1KIAA 3QV2A 2P3OA 3SSOA 2G71A 4YUWA 2C7RA 5EZQA 5K09A 2ZBQA 3KQYA 2BM9A 3KQSA 1JTFA 1YB2A 2AOXA 1QZZA 3REOA 3GRYA 2AOUB 5E2BA 1RJEA 3NTVA 5CVEA 3C3PA 5K03A 3HCFA 2ZCJA 4OBWA 4PYLA 3LX6A 4U7PB 2Z6UA 3I64A 4GUAA 1VIDA 2XYRA 2PKWA 3FPGA 5K05A 3HCCA 4AZTA 1KXZA 3ELWA 1I9GA 3LKDA 2KW5A 2GS9A 4P7JA 2GAFA 2NP7A 4GOOD 2PBFA 3KQOA 1P91A 4PIPA 5HIKA 2PLWA 2GLUA 5CM2Z 5B1SA 4YMGA 1ZHFA 5DX1A 1O9HA 5KYGA 3MB5A 3EMDA 1ZGAA 3CVOA 3BT7A 1O9GA 1WXXA 3G5TA 5D1NA 3IV6A 3SR4A 4CXMA 3MTEA 1WXWA 1XXLA 3I53A 2UYOA 3UJBA 3V8VA 2YVLA 2B25A 3CJQA 2PT6A 3G7UA 4CWAA 5LSAA 2IBSA 4RTOA 4PCLA 5CCBA 1D2HA 5EC8A 2VDUE 3NWBA 3LDGA 2FK7A 3D2LA 3HCDA 3OFKA 5EMJA 3CCFA 3DH0A 2G8NA 2AVDA 3C3YA 4E2ZA 3BGVA 3FUWA 4JXJA 5CD1A 4BLWA 2ORED 3OU6A 1UWVA 3VSEA 1WY7A 5K8VA 1G38A 5HIMA 1BKYA 4A6EA 1KPIA 4RTQA 2PVCA 4OA8A 3TFWA 1NW3A 5FA8A 5ICFA 1PJZA 2IH5A 4WXHA 2BR3A 2I6GA 5HOQA 2OZVA 3HCEA 3UBTA 5DSTA 1X19A 1RI1A 3E7PA 1JQ3A 2NXCA 5U4XA 2AZTA 3BGIA 3RIEA 2FPOA 3JWJA 3QOXA 3GU3A 2YUIA 4CKBA 4F85A 2BH2A 3I5UA 1RI3A 5DX8A 3AXSA 2AN5A 4IV0A 4PGHA 2ZBPA 4ER0A 3THRA 3DLCA 1WS6A 2IH2A 2FCAA 1EQAA 2GH1A 3HVIA 4WVLA 4ISCA 3SM3A 3NW9A 5GM2A 3B3GA 5GP1A 4MIKA 3C0KA 3HVHA 2XBMA 3BKWA 4E70A 2FYTA 4GQBA 4GOMD 4KVZA 2UYQA 2ZZMA 5GWXA 2BR5A 3DMHA 1ZGJA 3P8ZA 4EMSA 3PB3A 4YUZA 1TW2A 3BWCA 5FQOA 1YUBA 2HMYB 4PIMA 9MHTA 4FP9A 1UFKA 3JWIA 4F84A 2QE6A 4YV2A 3KQWA 2XYQA 4RVHA 2FK8A 3T7TA 5ICGA 3HCAA 3PTAA 1M6EX 3DTNA 1VLMA 3CJRA 5C0OE 2ZIGA 3T7SA 4AZVA 1YFLA 3AY0A 2EG5A 4DMGA 1Q0TA 3Q7EA 3DXZA 2OO3A 4M36A 3DXYA 4XUDA 2B78A 3MHTA 2UYHA 1KYWA 2YR0A 3HA3A 3KPWA 4AUKA 2CMHA 3FUXA 2PX8A 3JWHA 5EEHA 2I9KA 4HSGA 3OE5A 3VC1A 4QTUB 1WG8A 3DMFA 1R18A 1M0EA 3SMQA 1XTPA 2H11A 1H1DA 5DM4A 2V7EA 3UJDA 2PX4A 4HRAA 1F3LA 3B5IA 3P71T 3IEIA 4FS8A 4YV0A 4QTTB 3BWYA 4QVGA 3G8AA 4Y30A 1VBFA 1M6YA 3SSMA 2ZVJA 3GJYA 2ZWVA 3R24A 4BY9E 5CUQA 3G5LA 4AZSA 2IDJA 3JWGA 5LQKA 5LQAA 3ER8A 1ZKDA 2G70A 3G8BA 5EVJA 3KPVA 1G60A 3HM2A 3ELYA 4QPNA 4C04A 4IV8A 3BWMA 2JHPA 3TKAA 3TQSA 2JG3A 4YUYA 1VE3A 5ICEA 2OPBA 4DZRA 3E05A 2IIPA 3BUSA 1JSXA 3FTFA 4KW7A 3ERCA 5MHTA 4RVDA 2YQZA 1KHHA 1KPGA 3K6RA 1BHJA 1KPHA 3H2BA 5E1OA 4AX8A 4CTKA 5BP7A 4RTPA 2O07A 2ZIEA 5BW5A 2QY6A 4KWCA 2HV9A 4KDCA 5FHQA 4EKGA 1R74A 1OR8A 3NWEA 3KQTA 2B2CA 2IPXA 3FPHA 4MTLA 1O54A 4PYMA 4FT4A 2IDKA 3HCBA 5JR3A 3EVDA 1G55A 3OPNA 1XDUA 2QYOA 1R00A 1D2CA 3DUWA 4BP3A 4DKJA 1HMYA 2NXEA 3ID6C 2A14A 4GEKA 1VQ1A 4OQDA 1ORIA 3GRVA 3LCVB 2PX5A 4L7VA 1R8XA 2EFJA 2ESRA 2F8LA 5EIWA 5EZSA 4YMHA 3S68A 4PONA 5EEGA 1NE2A 3EGIA 1N7IA 5E1DA 5K0FA 2PT9A 1JSZA 3M6WA 3TLJA 3A7DA 3B7PA 1RI4A 4MWZA 3GWZA 3GRRA 2OBFA 2AOTA 1UIRA 4IKPA 1ZG3A 4F86A 3EGVA 2P3QA 3I58A 4U7TB 4PYJA 5DXJA 5LQRA 2JJQA 3DR5A 3GRUA 2CWWA 2VP3A 2QRVA 3L8DA 5G02A 3KQPA 4OA5A 3P2IA 4ZTBA 1DCTA 4QDJA 4EK9A 1AV6A 3LCUA 1EAMA 3DMGA 4FSXA 2I7CA 3P2KA 4X63A 1QAMA 4P58A 2CMGA 3OE4A 4NECA 3KKZA 2PWYA 4Y2HA 5FHRA 5T67A 2OXTA 5LQUA 5DM1A 2IGTA 3BGDA 4GBED 4PWYA 5EQJB 1IY9A 2WK1A 3A4TA 3M6VA 2AVNA 2FRXA 2ZBRA 3SVZA 3VYWA 3PX2A 5DRYA 4ER3A 3TOSA 1YZ3A 3UWPA 4DCGA 3SXJA 4DCMA 2ZWAA 4FSDA 1EJ6A 2NNWB 2ZW9A 3TRKA 3KU1A 5IKMA 3FPEA 5FULA 1YF3A 5DRTA 3EGEA 3LL7A 1NT2A 1FPQA 4C05A 3TMAA 5LQCA 3CGGA 1NW6A 1MHTA 1I4WA 4GOND 3THSA 3ER9A 1JG3A 5FADA 2O05A 3OU2A 1DL5A 1MJFA 1SQFA 2ZLBA 3B3FA 3ELDA 3LSTA 3M6XA 5E1BA 4B17A 3LHDA 3WSTA 1ZQ9A 3IHTA 2R3SA 3PS9A 4RX1A 3SSNA 2QRVB 2IBTA 2YXEA 3P9NA 5JUWA 4QQKA 1AF7A 5F2KA 5FA5A 5EG5A 5HEKA 2JHCA 2GPYA 5CVDA 1ORHA 3BKXA 2K4MA 5DXAA 5EKXA 1NV9A 3FPFA 1HNNA 2NYUA 2C7PA 4QQNA 1EG2A 2JH9A 2ADMA 3G89A 2ZZKA 4R05A 4FGZA 5EKUA 3KPJA 1SQGA 4RTSA 3EEYA 5K01A 2QM3A 3G2MA 4P7KA 5C9ZA 2Q41A 1T43A 3PVCA 3DULA 4RTJA 1R6AA 5FUBA 1B42A 5CIYA 1F38A 3HEMA 3OU7A 1NV8A 3KQQA 5P8WA 3EMBA 1Q0SA 3FZGA 5T64A 2R6ZA 3UJ7A 3UJAA 4A6DA 3Q87B 3UA4A 4RTLA 1JG1A 4KIFA 2ERCA 2VZ9A 4RTMA 1KP9A 4R8RA 4POOA 3C6MA 5DX0A 3FRIA 4P7GA 3TKYA 2G1PA 2LD4A 3KPUA 2ZZNA 1QAQA 4GOLD 2B9EA 5E8JA 1TPYA 4ER7A 2PX2A 5ICCA 3LBYA 2ZFUA 5E9JA 4PINA 3R6TA 1NKVA 5E1MA 3EVCA 4IWNA 2BZGA 3DLIA 3GRZA 5T6BA 3KHKA 4QVKA 1WZNA 3NMUF 4X1OA 3BWBA 3FUVA 3HVKA 4OBXA 4BP1A 3EVZA 2C7QA 3I9FA 4V0QA 5DTMA 1QANA 10MHA 1TW3A 4M37A 4ER5A 5E9QA 4E31A 3OZRA 3QOWA 2EX4A 2PWPA 1JQDA 1DUSA 2Z6QA 5FWAA 4K6MA 4EQZA 5HZMA 3R9XB 4RYLA 3KQVA 2N47A 5CVUA 1AQIA 2YTZA 1R8YA 4CTJA 3KQMA 1QAOA 2CL5A 2O0LA 1P1CA 5K0CA 1L3IA 1RI5A 3HNRA 3M70A 5EMLA 1JTEA 1G8SA 2PV0A 4LWOA 4RVFA 5K0BA 4PNEA 5KVAA 2BR4A 2NXJA 5LQJA 4V0RA 2AOVA 3DP7A 1JR4A 3ELUA 4X41A 2PSSA 3PFHA 4OQEA 2DULA 2UZ4A 3NJRA 4KRGA 2PXXA 1IXKA 2XVAA 5EIFA 1NW5A 2G72A 2C7OA 1BC5A 2EJTA 3M33A 3MAGA 3O4FA 2GA9A 3CC8A 4OX9Y 5DT2A 4UOEA 3LECA 4HTFA 3RODA 3GIWA 3P9IA 2WA1A 4H0NA 4C03A 1SVUA 4ATNA 5GM1A 5EGSA 4RWZA 3EVGA 1VP3A 2BM8A 4RVGA 1P39A 3EEOA 2PXCA 2OYRA 4GF5A 3BZBA 4GC9A 4HGZA 4PYKA 5DM2A 2XVMA 2Y1XA 5H02A 3UJ8A 1JG2A 1P1BA 2Y1WA 3E8SA 3EPPA 3OZSA 3TM5A 4E32A 2V74B 3NDIA 2NXNA 3IYLW 1KR5A 4RSRA 5GIPE 5HILA 3CKKA 3EVFA 4P7FA 2HWKA 5KQRA 1JG4A 4FR0A 2ZIFA 2OY0A 3V97A 2NP6A 1Z3CA 3M4XA 3GXOA 5DSXA 4C4AA 3DOUA 3PT9A 4GC5A 2P41A 1Y8CA 1RJDA 4LWPA 1QYRA 2PXAA 4XUCA 3RW9A 1RI2A 1X1AA 4PYQA 2FHPA 2PGXA 3CBGA 3A25A 4PYNA 1N2XA 1X1BA 2B3TA 2AOWA 3LKZA 4HTFB 3AXTA 4E33A 2YX1A 5CVJA 3X0DA 3DXXA 4E2YA 2OB2A 5GOZA 8MHTA 4R6XA 3HTXA 3G2OA 3KPYA 3VC2A 4YUVA 2PJDA 1U2ZA 2P7IA 3MTIA 3UA3A 3UJCA 4KIGA 3NVKI 4R8SA 1XJ5A 1EIZA 1SG9A 1D2GA 1PRYA 3LBFA 1VPTA 1FP2A 3PFGA 2UYCA 4AZWA 1XDZA 1L1EA 1SUSA 5DPMA 1VP9A 3BXOA 3FTCA 4YV1A 1G6Q1 7MHTA 4R6WA 2P7HA 3A26A 3EVBA 3M6UA 3A27A 3B89A 3OCJA 4RV9A 5FCDA 5FWDA 3EVEA 3B3JA 5HIJA 1JQEA 1VL5A 4MHTA 2P35A 3FYDA 3ME5A 2JH8A 2DPMA 3R0QA 2IFTA 3GGDA 5DTQA 3UJ9A 5ERGB 4DF3A 2AS0A 3GO4A 4EVIA 1RJGA 1SUIA 3MQ2A 3C6KA 5EHIA 2HR1A 5FQNA 1YFJA 5IH3A 4DA4A 2CKDA 3AWIA 5CCXA 1YZHA 1X1DA 3NVMB 4PYOA 5K0LA 3HP7A 3O7WA
chains in the Genus database with same CATH superfamily
1LKZA 3FN4A 2XNHA 3N5KA 2OCAA 1T0IA 2RCYA 2W6MA 2YN2A 1H4TA 4Q39A 1FBNA 5MF6A 1DMSA 3RC7A 3BCHA 4YY3B 2C1EA 4BNHA 1U0FA 5HWSA 1X8KA 4NU6A 2OILA 2WWFA 3QV1A 4OI1A 2QSUA 4MV1A 3E7XA 1W36D 4G0ZA 4PQGA 6Q21A 1R0WA 4XWTA 1Q14A 1WW3A 5C1BA 1Z3IX 2E5LB 4YRAA 3WNBA 3N2LA 1PL6A 3STWA 3LWBA 2Q1WA 4F56A 2JH3A 4G8BA 1GV0A 2XSZA 1FUUA 4XR9A 5IEBA 2BI7A 4S12A 2O5VA 3MD0A 1ZR4A 3C43A 3OWHA 4EW3A 3H6GA 3HP4A 4L3WA 3UFBA 1E1DA 3P2EA 4TTIA 3DOIA 1NSFA 1L3BA 3GY0A 2OV2A 2Y67A 2YOHA 1CDDA 4LXUA 5KSPA 2RH9B 1WBDA 3EZNA 2I1QA 5DVZA 2LDXA 3FYSA 4YNBA 4DQUA 5IMSA 1QB7A 4Q01A 5KS2A 1W85A 5H1YA 1BW9B 2WWWA 2GI4A 3OPQA 2PFKA 4Q12A 5FV4A 4YPVA 1MGPA 1UQTA 4TUYA 1OHHA 4B4UA 3DMYA 3P45A 1MX5A 1BHSA 1EUZA 3KL2A 3QBTA 4B33A 3UPUA 5FTWA 2V96A 4CRWB 1YUNA 1NA5A 2V1XA 4P5EA 5FBHA 1XCLA 2PS3A 4AIRA 2RC5A 4B9EA 2B69A 1MG0A 2OM6A 3Q1LA 3QI2A 1FX1A 4YK7A 3HA5A 4KRXA 1IWPB 3OEHA 2IF2A 3PNLA 5DCWA 5GINE 1AMNA 3JD2A 2OVBA 2JHGA 1CF9A 2KX7A 2HMTA 3GG2A 2O1SA 3HJGA 2P9GA 3LL4A 3Q7RA 4M0DA 1PJCA 5KNDA 1KJQA 3EIFA 2WJ4A 5I7EA 2FRDA 2FEMA 1O1YA 3DEAA 1QYWA 3FUUA 3GMIA 4HH4A 1HG0A 1LB1B 1N6IA 4RKYA 5HFNA 2WKPA 3WDKA 1FXWF 3AVUA 1BE6A 3DHWC 1FDIA 1YZUA 1NIPA 1HYQA 1OYOA 1OBCA 2JA1A 4IMIB 5TB5A 1BVYF 1WCIB 2IZZA 4KE8A 4JI8B 2BLNA 1YL5A 3NJ4A 2YV4A 4IHAA 5JPIA 5BURA 3UF0A 3IP1A 1P5RA 1F0PA 1V4BA 1XZPA 3L07A 4ZO6A 2FW8A 4JFAA 5CYGA 4MMZB 1NVMB 1QGAA 1A27A 2INGX 2Q21A 4ANFA 5G3YA 4KBGA 3I5XA 5AJWA 1JI3A 4MUEA 1LVUA 2BBOA 1JMVA 2CY0A 3RKUA 1EFVB 2WKSA 1GRVA 1GQFA 1XDBA 4GUAA 4R8VA 5KX5A 4NDAA 1OH6A 2WTUA 1XAHA 1KBOA 2EGGA 3HDQA 4KMRA 5ARDA 3G02A 3VJLA 4DIOA 1SUDA 3I6YA 2J5KA 3H18A 3OX4A 1QVRA 3HH8A 4JUCA 3SQXA 1SC4A 1GKKA 1H69A 4B6PA 1X15A 5BYBA 1TVEA 4LOLA 2OQRA 1ZMBA 2X9QA 4HVCA 2W4MA 1ODTC 5EJMA 4YXWD 4DV4B 1EX1A 3TTUA 1X77A 4K9DA 5FAKA 2XMBA 2CDNA 1WXWA 1XXLA 1KVUA 1TYCA 4MK4A 4KI0A 3ZW7A 1IAQA 1EP3B 5JFGA 4JDUA 5IUJC 4G9EA 3NBKA 3M6IA 1YS1X 1TKCA 4CLRA 4G0UA 4PR3A 2PA0A 3ZD9A 2W6PA 5DHTA 2FK7A 5K2MA 2FUNB 4KHPB 1U3GA 2HGSA 4V0SA 5D85A 3ADCA 2OCXA 3RNOA 1X2EA 3I8XA 4IOKA 3ASYA 1O8BA 3K73O 3QKSB 4PAGA 1EVIA 1A71A 1WKVA 2WJYA 3TLXA 2ZRLA 4AS3A 1CR2A 4HDAA 3IA7A 2XJ9A 3OUTA 5HIMA 5B2FA 1B8OA 3N8IA 1N32B 3A6GA 1P4GA 3DZJA 1N8TA 4LZOA 4Q37A 3QBDA 5HTKA 4Z53A 1BFKA 2C3OA 2GLXA 1OX5A 1Z36A 1EB9A 2ZM5A 2BR3A 1TK3A 1OV6A 1W93A 3H6KA 2CMDA 3LJKA 1BXRB 2DY0A 4UNSA 4Y6RA 3RVSA 5KHOC 3RIEA 1ULZA 3H1GA 3FSRA 1T5OA 4KKVA 4CV3A 2XNJA 3DFFA 1ISPA 4DMLA 3OTHA 3T9CA 3G68A 4BFXA 2H31A 4CEHA 1X7GA 1FSSA 3NHKA 5HKAA 2J3KA 3S40A 4KPGA 5JI3E 1XNQB 2XNCA 1I80A 4CTOA 4DN6A 5HBRA 2XI4A 4BECA 3C0KA 3HKCB 4DAEA 1XRJA 2WJPA 1OLXA 1WO8A 1Y63A 2O4CA 3D1JA 1EM8B 2I6SA 4JLSA 4MWEA 5JLJA 5GOTA 1SCDA 4W6ZA 1ZNXA 4JYMA 3DCIA 5GJCA 1TGYA 4NAUA 3UJ3X 4C5AA 4FDMA 3JYLA 9MHTA 1TECE 3EHDA 4JI4B 1UK9A 4FP9A 1VI5A 4B3IA 5F7ZA 5HGXA 4HLCA 2FFJA 3LOPA 5CRIA 3DTNA 3LX5A 1Y4ZA 2ATIA 1UXKA 3UK1A 3KSDO 1VA5A 1PDWA 2NZVG 4U8HA 4ZRMA 3MHTA 3TO5A 5IWCA 2F90A 1VHLA 2JHFA 3PNMA 4BBZA 1AN0A 2RARA 3TZLA 4R1OA 3DWEX 3ZYCA 2GK4A 4WLUA 1VL8A 4FPXA 4C5CA 4D3YA 3IOMA 5LMZA 1EFCA 3PHHA 3QXCA 4JL5A 5CXSA 4DSNA 1T13A 1NVTA 1ZNZA 3LW7A 4FYJA 4WGFA 5HKLA 3H9UA 4NH4A 3RVQA 1E8MA 1XZQA 3G1TA 3CT4A 1KIFA 1RAGA 5AW0A 2IC5A 4RWEA 4C2UA 2JJ1A 3S1AA 2CJWB 4Y6SA 1ULSA 1LS6A 4OMCA 5CDFE 3VXKA 1M6YA 1QKKA 2HMVA 1ZITA 3PXDA 4JLWA 1I8TA 3R24A 3BCSA 1LBIA 2H2DA 3TNDA 4AMZA 3PQ4A 5TMDA 3JWGA 4BX8A 3WGHA 4LKOA 3J80A 3W6PA 2PJUA 2A86A 1YR6A 5LNK1 1QF6A 2MR5A 2AFHA 1T9HA 1VCOA 4ZAZA 1IHDA 3NH6A 4M89A 1R6XA 4ECAA 3VOBA 4PRKA 3WLOA 4OK5A 4RF5A 5JZSA 1YIDA 3H42B 5EPUA 3EMKA 1GGNA 1VLHA 3EQ6A 3NHWA 2E1RA 4P33A 5K4GA 1QVAA 2VBCA 1IPFA 4AW9A 5E1OA 4CHGA 1BHJA 3M4ZA 4CLXA 4WOPA 2FN3A 3L0SA 4RTPA 1GPWB 1C3XA 1KP3A 4GGPA 1K6JA 4AJPA 4EY6A 1JTVA 3MPOA 3X1YA 1SD1A 3EAFA 3ZV6A 4LW8A 4R68A 2FA9A 4GL2A 4F4CA 1O4VA 2AG6A 5I8ZA 3LQ1A 2NMVA 3QFCA 2ZJ0A 4GLBA 2F3RA 2JIBA 4MQFB 2HT1A 3DMTA 3VI3B 2NSDA 1HMYA 1M8PA 1EFUA 2I6FA 3FWHA 4XYGA 5EXEA 5JSUA 2A7QA 3LCVB 4GRAA 4XWYA 3RKSA 3QHQA 3PQ2A 3VR4A 1KAQA 1TTHA 1HLGA 5E1DA 4O4IB 4X44A 4W5NA 4KYVA 3FOAA 5C8YA 2FPXA 2RHRA 4HUQA 5JRZA 1GN9A 3GWZA 3IB6A 2J8ZA 4QNMA 3SDZA 3IO5A 2VH2A 4WZAA 3I5YA 1NRWA 1XZIA 2WQZA 4X84A 3JVVA 4RULA 3D6VA 1M2FA 5JXWA 5CFMA 4DSUA 5HUJA 2BI8A 3D7NA 3ZUPA 1CHDA 3ML1A 3I5AA 2FVXA 3EEFA 4GDFA 4CMEC 1Y3BE 2G1KA 3F8WA 1XZAA 3VI4B 3K31A 3Q2IA 1HGXA 2BISA 4W63A 3EZ2A 2JDID 3GFTA 3HFRA 2XD4A 3DLAA 2D3WA 1NBMA 4NKRA 1EFHA 1OFHA 2GJ8A 1GRRA 4O4HA 1AT1A 1JAYA 2AVNA 2OV6A 2QTFA 2XCIA 2HY7A 2QP3A 4RLSA 4W9NC 2Y4OA 2OZLA 1Y6FA 2D74A 5DIFA 4F9GA 1JE1A 3VQTA 3BXFA 1NJ6A 2IZ0A 1K7EB 3LP6A 1VZ2A 2QD1A 3LV8A 3PV0A 4U6NA 5BO5A 1KZGB 3ADOA 4HDRB 4CM7A 1Q0RA 2H9YA 3D7LA 3RYFB 3ZZ0A 1LPPA 5E2IA 4RXUA 3H9JA 1XLVA 3OIUA 1COZA 1E1MA 3PHJA 5AMXA 4PO8A 3JSXA 1GL6A 3A05A 4EMTA 2CVPA 2D4HA 2ZWPA 1AF7A 2JF0A 3O8OB 3PF9A 4HAZA 4IRXA 4L0MA 4L8LA 4F6RB 1EDEA 2R44A 3B6IA 3GELA 5ICSA 1RQXA 1MMFB 1GZ3A 1TM1E 1XP5A 2IIQA 2XIQA 1ORHA 3WYAA 2YFKA 1I0IA 5MN5A 3WGIA 3FPFA 4TXJA 4ZHQF 1I94B 1MNQA 3N53A 4BOYA 3OP1A 4PPFA 5CFPA 3FBWA 3G89A 2CL6X 1S8AA 3AOEC 3Q9SA 5EKUA 2YASA 2ODPA 1N6KA 3FJOA 4PHTA 4TLDA 5C9ZA 1J8VA 2XF2A 1B42A 3HSSA 5CIYA 4ERXA 4NBWA 4WK6A 1DBPA 1Q0SA 2H1HA 3MCAA 2H3EA 2C1XA 3R40A 2B98A 4X6LA 1I4DD 3UA4A 2BCJQ 5E7MA 3RSSA 1P6XA 4IKOA 4FYXA 4LNUA 4DV1B 1FUKA 1KP9A 2J3LA 3PRJA 3IBSA 4LE0A 4R8RA 3W5AA 2PQ2A 1PP4A 1T8PA 2LD4A 1S4QA 1XTTA 2VP9A 3AI2A 1XTBA 1O8CA 2GJKA 2IIVA 2WSLA 1Z8DA 2BFFA 2QJFA 3I0NA 2LVBA 3R3JA 4J4HA 3SQDA 1DKRA 4OQLA 1KO1A 5FI0B 3SIPA 4PQFA 2QBYB 5T6BA 2D5AA 1VJ1A 1QG0A 1NYTA 2NM0A 2OLEA 2VHQA 4TXNA 1T4BA 1QBKC 3N05A 1ZUIA 1J07A 1FFAA 3VUFA 2QJWA 4FMDB 2XXJA 5EMNA 5U9CA 5GJVC 1E5XA 2BL4A 2FX2A 2FZLA 1DAKA 3OZVA 1RBQA 1NI4B 5AW8A 1WXDA 4AMUA 1V25A 4AN0A 1GPAA 1ZGBA 2O3QA 5JZ9A 3HG7A 4L08A 2I7DA 4MITA 1MJGA 2CL5A 2O0LA 3VHXB 1WB6A 2RGYA 3DNFA 4DA0A 5K0CA 3O2SB 1U7HA 3TQCA 2M1XA 4DQVA 2D5LA 2PV0A 4LWOA 3UTDA 2O5RA 1RPJA 2G25A 4J1SA 3QFRA 3NCHA 5C3MA 2QN3A 3BAFA 1YZYA 3ELUA 4WW0A 3PFHA 3UT6A 3EDQA 3NJRA 4MZDA 4UBNA 5MN6A 1UM9A 2N1BA 1BC5A 2VXYA 5J9FA 3M33A 4YXWA 5I7VA 1THMA 5DT2A 4HTFA 2JI4A 5IANA 1ODJA 1MOZA 4I3HA 2W11A 4KUEA 2WU3A 1JFRA 2ZJZA 3R3SA 1K0FA 2PZFA 5KINB 1WA5A 2QD3A 4R2IA 1ADBA 5J1TB 1P39A 1X7XA 3FCAA 3KXPA 5J1SB 1HE2A 5IM4A 3UJ8A 2C78A 5LP1A 2C5FA 3MWDB 5IN5A 4OXQA 3WS7A 1T0BA 2IZ1A 5TVGA 4L9SA 1ISSA 2WF9A 4BKOA 1ZIOA 4MZXA 1JP7A 1CY2A 4AI6A 4HFNA 2B20A 2PRZA 4PZZA 1CS4C 1M0SA 5FBWB 2XCTB 1ECFA 4EJ6A 2JLWA 3GXOA 1VE6A 1EWYA 4P9NA 5ALVA 3ZE9A 3V4LA 2F1RA 5AI4A 3PGKA 1BS1A 3OPMA 1W85B 1RJDA 2X3FA 2WDZA 3PJRA 2Y1FA 4P53A 1O87A 4AJNA 3ED1A 1NURA 1E7YA 2DR2A 4B6EA 1FDOA 4RLFA 1KRHA 3DL2A 4FU0A 2B3TA 4CDNA 5A3RA 2DLCX 1G42A 1H66A 4FGUA 1KZ9A 1NHGA 4UAVA 1DBRA 1S2OA 1Z22A 5CVJA 1XTQA 1G63A 1VECA 3JQAB 4W9NA 4YAEA 3URMA 4KO8A 4UHHA 1XDGA 1RZ3A 3CG0A 4G2NA 3SN6A 3PWSA 4NU0A 2P7IA 3VPHA 2W6JD 3L0IB 3WIVA 4OP2A 3TECE 2VEOA 2J3MA 2XGSA 4HFRA 1D2GA 4IIHA 2IYOA 2ZREA 4C88A 1NU8A 2F59A 3AVQA 1K9SA 4N0EA 3G0HA 2ZB7A 1FUYB 2HZBA 2P9FA 3WK8A 1GUFA 2VDMB 4HNAA 4KYTA 3WLLA 3EISA 3R76A 5B7NA 3KKQA 1DV1A 1MO3A 4R6WA 4BKQA 4MDEA 5LP6A 5FCDA 2FW9A 3MLEA 2JCVA 2R1VA 4FKZA 4N0DA 5HIJA 4PGMA 3M1AA 3AEYA 1CUHA 2QUHA 3ADPA 4RL6A 1C9YA 4PZUA 4DNQA 4RMGA 2C0QA 3K0KA 1SUIA 3C6KA 4C3ZA 1XP8A 3I04M 1JJFA 1GGFA 4Q82A 2ARKA 1EZ1A 4WA8A 4Q7KA 4B80A 3N8KA 1O6CA 4FX2A 1YZHA 1X1DA 4DCJA 4GLJA 3HP7A 2I4LA 3HFGA 2XCQA 4BMOB 1IWBB 1FY2A 2YJ5A 4GP6A 3U0BA 1PK7A 1TVCA 2YXLA 4IX1A 3P97A 2P3LA 4KGVA 1DAPA 1ZK2A 2YXDA 3PEEA 4J4TA 5KX5B 4HEA1 3G7SA 2CV2A 4L9WA 1OBFO 5EWJB 1QLJA 1DP4A 4YPOA 5K99A 3UNXA 4Z0TA 5IVIA 1JQLB 1Y3FE 4RFSB 1NZFA 1VJ5A 3CZ9A 3UMGA 2C42A 3EJ6A 2CV0A 4KB5A 2W9XA 2H57A 3N0TA 5DM0A 3NO4A 2RI1A 4XRGA 3QPDA 2J3JA 2KPOA 4G56A 4II2A 5JCOA 2PMDA 3GVXA 2JVJA 3U7GA 5HHTA 4BQNA 4WFIA 4AKSA 1Q0LA 3GDHA 4UVIA 1U8EA 3VKWA 2VHZA 3LDUA 5EHGA 2C4KA 3OPYA 3MTGA 4KLCA 4EA6A 3I34X 1B8PA 1EHCA 2EWMA 4OQQA 4BNKA 5BN1A 4YP1A 4TWJA 4CKYA 1QFYA 2P1DA 2X42A 4CLRB 2VBFA 3I23A 1JE0A 4BBPA 3OCWA 5DLYA 4B44A 2GERA 4D92A 4EJSB 3H5RA 3GUUA 3VR5D 3KLOA 4BTVA 4B87A 1BOOA 1GL7A 2AWNA 3LDFA 1CJUC 1FUIA 5BR4A 4BGDA 2Q4BA 1OGJA 4F3KA 1EWQA 3TAHA 1DAEA 4FYVA 1N5JA 2N1MA 5JWOA 3V2HA 3RYCB 2Z57A 1T8RA 3V8NA 4E30A 3D7RA 4JJZA 1NXQA 2GCOB 4ZRDA 1CULC 4HZUA 3FCSB 3FTDA 3BRWA 2IUYA 2BJHA 2I4IA 4B32A 1SPBS 4CEJA 2BELA 1AUQA 2RK3A 1IG3A 3EXHC 4N39A 4BLVA 2OUIA 4DDHA 4NMHA 821PA 3FPJA 2H9IA 2P77A 3WGTA 1YZLA 3GFFA 3GBPA 4BRUA 1E63A 4LSWA 3MJ4A 2N75A 4WZZA 2J08A 3GD5A 3MNFA 3ZVKA 2E48A 4D56A 4F96A 4RC9A 3REGA 3EGCA 1CIPA 2B35A 2AEEA 3FR7A 4MPTA 3O31A 3NT4A 3PDUA 4TLBA 5ALXA 3TWOA 3ASZA 5L3VA 1NBME 3AFGA 3IOBA 3AR5A 4NAVA 4EZBA 1WVMA 1BRMA 4XSGA 2O2GA 2FPMA 3BE8A 3K94A 1C8KA 4M1KA 4HUQB 2BV3A 2BW0A 4P80A 3OZTA 4AF7A 4DLWA 4KVFA 4A0GA 2AJDA 4DMCA 4FMBB 1RBZA 1NVVQ 3D7SA 2HF9A 3RRYA 1V4NA 3FG9A 1T0HB 2D7JA 1RC8A 3FLEA 3K8YA 2AOXA 2X77A 2QPTA 1GZ6A 1ZD9A 3G2LA 4W1SA 4A16A 4DLBA 3HB1A 1YDHA 3HYCA 3MTBA 4NULA 4NBRA 3KFVA 1GKLA 3AF1A 3K30A 3ETCA 4CG1A 3E9ZA 5FA6A 2IHTA 1J99A 3FPGA 5LU8A 1JEQA 5H0IA 5C4GB 2DJIA 2NP7A 4XLTA 2BEWB 3ORRA 2HXYA 3GOHA 2ZJ4A 2WZDA 5KAPA 3U3OA 5LMNB 1P91A 1GNPA 3FJ1A 1GQOA 4PIPA 2LCIA 2ODQA 4YAFA 5DN9A 4AO8A 2IEBA 1VSTA 1ZHFA 5DLQC 2GPJA 1YMVA 2GFIA 4EDFA 1UFRA 1I3NA 1ZIXA 1JDBC 1MB9A 1WKBA 2CE7A 2DJ5A 4F4FA 1PJSA 2ASVA 2ID9A 1E3QA 3JD1A 2H2GA 2ZKIA 3DT9A 5IRCD 3EQZA 5BQ5A 3D43A 1TRHA 4BNMA 1QGDA 1M2WA 2XE7A 3L2OB 3AKDA 1PS9A 4N3BA 4RZQA 2WAOA 4FN4A 4RHEA 3VJMA 5B3LA 4P4TA 3REQB 4ZAFA 1TTTA 2WHPB 3EXFA 1U5CA 3OKFA 1BTOA 3WKCA 4ZYUA 3JVUA 2O9JA 4KUHA 4CFYA 5L4NA 2YL2A 4NE9A 1J8YF 2WD8A 1H85A 3CWCA 3HUTA 1DRKA 2NPFA 3K3PA 3IT3A 1LBHA 1I7QB 4ERNA 1KO7A 2I2CA 3ZJUA 4KXYA 1CR4A 4MUYA 3Q1KA 2I2DA 3ZWAA 1XZHA 3RRMA 3T5TA 5JRDS 1Q1NA 1ZAYA 2HDHA 4RZHA 4Y9SA 3EIWA 1BYIA 2AZTA 1DTWB 2RHHA 3FWKA 3JVDA 3NX4A 3PHLA 1PEYA 4GI1A 5JYBA 4L51A 4IV0A 1TB4A 2GCIA 1IM2A 3DDZX 3GWGA 5DK6A 4PSVA 2IH2A 1J70A 4ISCA 3M89A 1JLRA 2EZ4A 2FFAA 1L4YA 1YRYE 1DEKA 5CT8A 1E4EB 4MIKA 1YB6A 5AJYA 2XYGA 1NQUA 3WTBA 1JDZA 1C7JA 3QVSA 4EGAA 5JH7A 2VR1A 3A1CA 1Y1PA 2UYQA 5FUMA 4KDFA 3FOFC 4LJAA 3TZ6A 4E5YA 1XJWA 3CUWA 4FHGA 4A36A 3GA0A 1RZUA 4YJ2F 5FQOA 2WWIA 2XTNA 4OL0A 2QE6A 2OSBA 4YI5A 3EOZA 3CJRA 1JQKA 5CB8A 1KK2A 3GJQA 2JIZD 4MI6A 1WEKA 3WFZA 1SUEA 4EBBA 3ZHTA 4GEGA 1GG9A 4CLEA 2AB0A 1DHTA 3ZQJA 4E5SA 3AHJA 4YASA 4CUKA 4OXIA 1FSGA 2IF0A 2AFHE 1CNFA 3P9XA 4HSGA 1V8FA 4GE0A 4E15A 1GAQA 2BGJA 1OZAA 4GI3A 3OAAD 3WRVA 4V24A 4YT5A 5KWJA 3WNVA 2G4LA 1KDTA 4AMBA 4PLFA 4EW1A 1WVIA 2I3DA 1L7EA 3VR0A 3SIXA 3K9WA 3O4HA 5HKKD 1ZH8A 3FOBA 1HEUA 1MN6A 1WDMA 1JHXA 4ZICA 1CZRA 2Y0BA 5A4AA 4UZEA 3TLCA 2QN9A 3ND7A 2CUTA 3VR5A 1X7YA 4XWKA 3NXSA 1ENOA 1L5GB 3DF7A 3CZ5A 4MAAA 3DE5X 5LQAA 3W77A 4RW0A 2BGTA 4MQFA 3RYIB 1W48A 4FNAA 2G70A 4C6SA 4OU5A 1PVVA 4CE6A 4X1KB 1F6DA 1VKHA 1YJ5A 3RIGA 1P6UA 1GGMA 4FFSA 1ZM3A 3QLVC 2C92A 3TNYA 3ZX4A 4CUZA 4ZCSA 3BGSA 3RVNA 3G79A 3I8SA 2YJZA 3OQMA 4J3NA 3BM5A 4OMDA 1FSPA 3AO0B 4HFMA 4XVUA 1YU9A 2D13A 3OWOA 4E11A 2PX0A 4Z49A 1GG2A 1O6BA 4RVDA 3ERCA 3JATA 1FOEB 1BU8A 3MGKA 5GV7A 1RQ7A 3QLUA 2B83A 1K27A 4EO4A 4EVQA 5CXUA 3OCXA 2QHXA 5FHQA 4PXYA 1XMJA 3FI9A 1LPAB 4QUJA 2G6TA 3KQTA 3RHFA 3RWBA 3THXA 1GSAA 2OPHA 4AULA 3IR6A 1SHLA 3D8HA 4MGIR 3VO9A 2RDMA 3EVDA 3NVAA 3R1IA 5KNLA 1ZZGA 1XDUA 4A3SA 3B48A 3CG4A 2CLOB 1K75A 4CPDA 1EHIA 1AS0A 1N3IA 1HSOA 3OCCA 3VGJA 3PYMA 3ZKAA 2NV2B 4ALIA 3KWFA 4D9MA 2Q6LA 5H83A 5GTDA 2UXBB 5FI1B 3HMQA 3WGZA 2PT9A 3NB0A 3P94A 2D00A 1F3OA 3W2IA 2QRUA 1KWKA 2O20A 4FE7A 2HCFA 2BH9A 3I28A 3L82B 3KETA 3GRRA 3KBOA 5G53C 5AM1A 4E1VA 4B8ZA 3SQOA 3EGVA 1QIKA 3I58A 3QXJA 1LPBB 4YRNA 1QIGA 4LJ9A 4F60A 5LQRA 2A9RA 5AI6A 4QELA 2QRVA 1B6RA 2C4WA 2J31A 2QVZX 2J5QA 3IP9A 4TLMB 5COQA 2QG6A 2BMVA 1RLUA 1T2AA 4NECA 3HJHA 4RD0A 3BXHA 4ZREA 1SHKA 2RB4A 5KHLB 4LF8B 3DL7A 2QW0X 2W8BA 3LLVA 3R4VA 1A7KA 3GYBA 4MWDA 5ALJA 3I01M 5EQJB 4TKUB 2NSLA 5FWXB 5IAOA 3L6CA 4WL0A 2IEDA 4Y6GB 4MW0A 4M0MA 1E4OA 1KFJB 2D1TA 2QGZA 3AFIA 4MS3A 5FTJA 5EJAA 4Q4LA 5KYWA 1RYYA 2CXRA 4NYMR 1JDPA 1Z74A 2NNWB 1BXKA 3F5SA 1QG2A 5TC4A 1JXMA 2OD7A 4HAOA 4OQPA 1V5FA 2DUNA 3EGEA 3H0KA 2ZVDA 1KMQA 3JYQA 4G8DA 4YO7A 4ZOBA 3SU8A 1X7XB 1J8FA 3V7WA 4C29A 5CB4B 2WPDA 1OWNA 1SKUA 2MSWA 5IDXA 1DCKA 3N7AA 4BGUA 4O59O 4WLVA 3CSUA 4G24A 5AVRA 4GQAA 3B13B 1FXSA 3SC6A 4E03A 2XCRB 3H5NA 1OU4A 5FFFA 2IYTA 2I29A 4CIAA 4KMSA 4CV1A 1DXQA 3WQSB 4QQFA 4E4TA 1M83A 3DOHA 5E3JA 4B74A 2XZLA 2PUCA 4M9SA 4EZIA 2IHKA 1XI2A 3F0TA 3H3FA 4H3HB 4H1UA 2CFCA 4TTPA 1PZHA 5B3JC 1RRFA 1P8AA 2CJPA 1H4VB 2YBEA 3GXBA 1E1QD 3L8ZA 4IG9A 1Z88A 4M8NE 1HDOA 4QQNA 4YMIA 2PWZA 4KQXA 2ADMA 4EPXA 2IY9A 1II8A 1UZAA 5AW7A 3UN1A 2O2ZA 4G36A 5KNCH 1DAOA 5EWLA 1T43A 1Z68A 1C8BA 3A4LA 3DE2X 2GRJA 1AXGA 2PUAA 2CHEA 2RGDA 2Y9PB 2QXTA 1Z6TA 1SBQA 1KEVA 2IHJA 4JWKA 2L69A 2Q1YA 2Q49A 4JNCA 2GD1O 4A6DA 4NJEB 5DGHA 1L7OA 3CH4B 5IBRA 5KYUB 1P29A 1SAYA 4X3CA 1JIXA 1PR0A 4NL4H 5LBIA 3DMTC 3Q3EA 1EPUA 2ID4A 4YQFA 5ICCA 2EEPA 1OLXB 1G66A 2R6CA 3ZY3A 4DY6A 4US1R 2WJHA 1UK7A 2H1SA 3P2OA 5CM8B 1NN3A 1ZKMA 1UQRA 4LGCA 4X1OA 3GX1A 2OE2A 1LH0A 5DNVA 3DUFB 2J0VA 2I3GA 2NTYC 4RU1A 5EIOA 3U37A 3AFOA 1KJZA 3LUAA 4L4SA 4X85A 5IBPA 1UMBA 3OZCA 2OORC 3OOJA 4UC0A 5DHPA 2DWUA 5HS6A 3VR6D 5CD9A 2P1ZA 1L8AA 4PF1A 1OXKB 3ZVLA 2JC3A 3UAOA 3LZCA 2L42A 4N5LA 1K8YB 3IJ5A 1DI0A 3ZBTA 1H6AA 3PJGA 3R9XB 3AP3A 5J59A 3SYLA 4BO7A 2YTZA 1WZCA 1WPXA 4N5IX 1QAOA 1RWQA 3EGXA 1YK1A 4IXMA 1W19A 2BFBA 3L8FA 1NLZA 2QLTA 1I3KA 1QQTA 3JSAA 1ZYUA 3HY3A 3WBFA 5HXAA 3SVLA 1QHXA 1WX1A 2Q6VA 2UZIR 4BQRA 3HDTA 5FLKA 4D6XA 5IU6A 4X66B 5DXFA 1L5LA 3ZWVA 5FOXA 3U4DA 2H85A 1JR4A 3ND5A 5AQEA 3TDNA 3QY9A 3T9BA 2DULA 4PV7A 1RXCA 2R8RA 2R25B 2D0PB 1L5HB 1N25A 2HFKA 4M1YA 4BV3A 4J91A 5DI3B 4AY4A 1AGXA 9ATCA 2V7WA 3MJRA 4FDVA 4WNAA 4EM6A 3FDZA 3AM5A 2Q4EA 3I39X 5J23A 3RAFC 2DTXA 1WETA 1Y7LA 2G0AA 3ITDA 3QVUA 5I7UA 5DP2A 1CZLA 2FRDC 1GTJ1 1SVUA 1ZX1A 1CEEA 1E8NA 1P81A 2IYQA 1PIWA 2YWRA 1WXGA 2OYRA 1XHLA 4WN9B 4G6ZA 4LDQA 5EERA 1H2YA 4K81B 3BH0A 4PZCA 4XVQA 4E32A 4MINA 2J7KA 1VE7A 4YQZA 3V8MA 3ZOZA 1J56A 2HXGA 2WVGA 2YMPA 3I2FA 3IYLW 1ODIA 9ABPA 2XCUA 4CIBA 1FJGB 1SBZA 1LPNA 2HEIA 4ALKA 2ZIFA 1U3UA 1A2QA 5ESDA 5J2TA 3U44A 4Y9TA 4UJ5A 1F2TB 2GCEA 1U8TA 2CNOA 5B4VA 4HWGA 1SK8A 2VP5A 1C0IA 2WBLC 2H1VA 3DD1A 1NC3A 1NQTA 4CM4B 3VDRA 3DW3X 3DCNA 1EK5A 3DFZA 4N7BA 3RU3A 2H0QA 1N2XA 2RBKA 2DSNA 1NWHA 2HIHA 2XSZD 5ALPA 2JGLA 3TZQA 4DDTA 2PV7A 1WQ1R 4HYYA 1JDUA 2QYHA 8MHTA 2PLNA 3GEEA 5EQTA 1AC5A 3H1FA 4MYSA 3KP1A 4R01A 2BYTA 4OJMX 2P0EA 3RK4A 4J0JA 3O83A 4KIGA 3QENA 2HWYA 3GJXC 3I2HA 1PRYA 4JLAA 3WISA 4QUAA 1FFGA 5SYMA 2EP7A 3RPEA 3AR3A 5JFOA 3D1LA 3SSAA 5DTJA 4YV1A 2GYVA 3CRQA 2X1MA 1W2WB 4TV8F 3M6UA 2BF7A 5A5FA 3BQNB 1B74A 1RKXA 1VL5A 3HCPA 4M8LA 4DC9A 4BLTA 3ORYA 4ZZ1A 1YDWA 2V3CC 2JH8A 2NU6A 1P9OA 5EJ8A 1IEXA 1Z33A 3UJ9A 1D2MA 1MDBA 1ELOA 3Q5EA 4K46A 5DLPA 3COSA 4UVGA 4NOMA 2XYHA 2HR1A 2YMQA 2VHUA 3AJ9A 2C9DA 3WTCA 3GLIB 1HM5A 1KQPA 4NZPA 2IEGA 1EVKA 3LKVA 3PT5A 3QE9Y 3L7NA 4PYOA 2WHQA 3DMDA 5GVSA 3ETJA 1SXJA 3E9QA 1QMPA 5HE9A 3U81A 3J7TA 1IHYA 2CDRA 2PS9A 4G01B 1FJ2A 2ODNA 4BVKA 1OJLA 1CUFA 3RVBA 2AZXA 1OLUB 2AC7A 4WH0A 2J5RA 3EAGA 5DBGA 2YWBA 1KQNA 2F4NA 4XM2A 1FVHA 1XELA 2J3IA 2BMJA 3H3XA 4GKBA 3TKLA 4DR5B 1UWKA 3H0EA 3NHZA 2Z3WA 4LOIA 1OI7A 1OC4A 3DE7X 2H7XA 4V0NA 5IAGA 5BXQC 2QXUA 2PIDA 2R8EA 3FI0A 4BVEA 5I47A 1UBJS 1C7ZA 3TAXA 3PENA 5CHYA 4ZXPA 3A58B 3SF8A 4DZZA 1RBYA 3MTDA 1AQ6A 1KJ9A 1X1QA 1VG9B 5FJJA 3KKPA 1REQA 2XY4A 1NASA 3IH5A 4HS9A 1M8FA 4FMPA 3DTTA 4BFZA 1IQUA 2GEBA 3OQVA 2QV0A 3ZZ1A 4YT8A 1NJSA 4J0KA 3VOTA 3RB8A 5BOVA 4ZYVA 2EYUA 1HE8B 1C1DB 2AH5A 4P84A 4UUBA 3SICE 5A4JA 4RX1A 1HE4A 3DDHA 4DFDA 4D9FA 3Q8LA 1U9CA 2O2HA 1V11A 1JEAA 1F2TA 1ZHHA 4PFJA 4U6QA 5SICE 1J5EB 1OXSC 1ZQ1A 3EPHA 3GPIA 4LECA 5KNCA 4LYFA 2Z6AA 2GN4A 4MYHA 3K1TA 2V0NA 3A7EA 3LRXA 5F2NA 3X1MA 3ZV3A 2YBDA 4HZIA 2MSNA 4BU1A 4XWAA 1PEAA 5F9MA 3E0XA 1IEWA 2BUBA 2ORIA 4P2BA 4JI6B 3F7OA 3V00A 5DNAA 3I1YA 1OT5A 4F3NA 5C5IA 5K0GA 1PI3A 1M7GA 4A91A 3NG1A 4HC4A 1FNCA 2ZI5A 2OGUA 4M9RA 1R0XA 5CLGA 3IPYA 1E2MA 2YRXA 4LMBA 1XDSA 1JLLA 4GLLA 2AV6A 1E0JA 1DDGA 4WERA 2Z2JA 4Y1EA 4EYSA 2YVQA 1OH5A 3FYUB 4XTCS 4BNZA 2REOA 2DPYA 2QY9A 3Q15C 4MLPA 2P6NA 4X7BA 4WKNA 1H1TA 5B58T 4BLOA 2R4TA 3HB9A 4Q1BA 4MCIA 3D3QA 3URKA 1U7ZA 2GZSA 1CDOA 2WVAA 4U6SA 4J7XA 1GD1O 3AR4A 5LYJA 5I7SA 3G13A 1KIAA 5KCMA 1TJNA 2WV7A 1XL1A 2DHEA 2OORA 2EERA 4MRAA 1RFLA 4MJ7A 1C3LA 1ZN7A 3VSCA 2BM9A 2EGHA 2YH2A 16PKA 1TT7A 5A0VA 1NUAA 2J4DA 1KO4A 3KVOA 5A6SA 3BMXA 4CNBA 3PK0A 1WB5A 2X19A 3IAUA 3QTTA 3EX7C 3CLTD 4BB0A 2ZCJA 3KSRA 3IKLA 4JLVA 1K1EA 4BMDA 5EJ6A 2B34A 4IH9A 4PG7A 4QA9A 4C2BA 3R5HA 1GRQA 2FPKA 1NWCA 2GS9A 4WACA 1GZUA 2RGGA 4B40A 4OFZA 3HL4A 3KQOA 2NUPB 2WHRA 4QHTA 5JO0A 1T6BY 1YNSA 5TR9A 1QCYA 4Q7EA 3NOVA 2PUEA 3QITA 2CNWD 2O4UX 4GSYA 4FNOA 5LXTB 1TTQB 4FW9A 1OLSA 1TEXA 4YRLA 1CRZA 4INAA 4Z7NB 3M0EA 1Y9JA 3JS5A 3QU4A 3RCBA 3O82A 1KAMA 3NORA 5CT5A 1P4JA 3CUUA 3RVOA 3WLPA 3H4TA 4K1LA 5CCBA 5JD6A 2PYZA 3UMFA 1Z06A 1FXWA 1TJYA 3FKSD 5H8WA 1K6EA 1H8ED 2VAPA 4K0RA 4OHPA 3TL6A 2WSYB 1T2UA 3NTUA 3K0FA 4D1YA 5CA0A 3N39C 3GBSA 3L7DA 3Q8WA 3LQFA 1NMSA 1H1LB 3O5AA 4GYYA 4BS9A 1NAHA 2QR2A 3B2EA 4E2ZA 3QMWA 4F72A 3K0AB 1S6YA 1ADFA 3BFKA 3JQEA 1R8JA 1IB0A 1YB4A 1PR6A 4YECA 1T2NA 2C2XA 3EC2A 3W2GA 2ZIZA 2ZI4A 3L5OA 1H4SA 3K2IA 4Q4CA 4QDTA 3TFWA 3GBVA 3VNRA 1PJZA 3WMWA 1LSOA 3HEAA 1H3FA 4YJFB 1ZOIA 2HCRA 5A2QA 4MVJH 1HRKA 3RC9A 5H82A 3A2KA 3V33A 2VAXA 4GT1A 1JBKA 3ESXA 4MQEA 1JL3A 2HJ9A 1A7AA 4H7EA 3ZU5A 3PXXA 2BH2A 5IJAA 1QVWA 2BFCA 3HB4X 4PAWA 5DNUA 1AHIA 3JTEA 3THRA 1ONNA 4FGJA 5U1PA 2V5UA 3P32A 2F17A 1DKLA 4QJIA 5BWMA 1EQAA 4GNRA 4LY3A 3ZE2B 3I09A 1MOPA 5B1IA 1PGJA 3IESA 3FNFA 4OD0A 1O5TA 3X43A 4ZYYA 1W9MA 2YFQA 1DQPA 2VDKB 2ZTMA 3OZIA 2C4TA 5FEMA 1DMRA 4EG1A 5E4YA 3F73A 3SXUA 3KALA 4XD2A 5BWBA 1FZQA 2DPLA 3O8QA 4Y2RA 3ZY5A 3B78A 2BR5A 2ZE6A 1ZGJA 1B6SA 2OKGA 5DT9A 3RLFA 1MEOA 2HMYB 2LCFA 2FMHA 3AWDA 3S27A 3UAYA 6YASA 1MO4A 1UBFA 3MAAC 4KNVA 4JA2A 3GFOA 3EQ9A 2LDBA 3JPYA 2Y2VA 2QS9A 2WNSA 3HCAA 4RVHA 4C89A 5IT4A 1A0OA 1JS1X 3VSAA 3SKYA 4NXMB 5JMOA 3C39A 4X0EA 4HGNA 4M0CA 1G3MA 3PC8A 3HU1A 4YROA 2A6PA 3ZY2A 2J3QA 3GN1A 3A10A 3PA6A 2CMHA 1IEVA 1WCV1 5EWMB 3WZLA 4F1WA 4O4HF 1GADO 5SYNA 4A03A 2I2WA 2PRYA 2TS1A 3KB8A 4RDHA 4MHOA 1M0EA 5EJFA 4HT3B 2VNJA 1IOLA 1O4WA 2ACWA 2Z9DA 4IO0A 1UKAA 4TGLA 4PPQA 3M82A 2WIAA 3D6AA 3IEIA 3V9PA 4YV0A 5L3SA 4M6WB 1Y6GA 3STXA 3VYRB 4DLZA 2J1LA 1KZ7B 4BY9E 3PQCA 1BGWA 1BXGA 1PJRA 4RL4A 3W8RA 2DBQA 4EDHA 5D5HA 3ZBUA 5FKJA 5G2OA 5REQB 3VRHA 5GAJA 4D5EA 1O97D 1XA4A 4JQZA 1SVNA 2JA2A 5D6OA 4DPLA 3QEAZ 1PG5A 4FKMA 3FF1A 4J03A 4ZCTA 3EXG2 2DQ4A 1N2IA 1KEEB 5CTJA 1KKLA 2P5UA 1T2CA 5EP4A 2GUGA 4CMEA 2RI6A 1NYLA 2JGDB 1PSWA 1R10A 2PU5A 1G8KA 1XAGA 3LWZA 1V9CA 1VBKA 4KQKA 4YJ3A 5BP7A 1R16A 3AEKA 4Q3EA 3LGSA 3UG7A 3OQJA 3N2NA 3ZXIA 3AVTA 4KPUB 4UD2A 1N6RA 4PZ0A 2IPXA 3I73A 4LJ6A 4Q1DA 1N2CA 1Z5ZA 1ZVKA 1UOEA 2P78A 3HCBA 4TWZA 1AB6A 1G55A 4OY3A 1PDOA 1W5AA 1G8HA 1DWPA 4BP3A 3QM1A 1HL7A 1NJ1A 2I78A 4KXMA 4UHEA 2FEWB 2GF9A 1I4TD 3E84A 5AVQA 1HDZA 1RE0A 1IZZA 3FNRA 4K9MA 5EIWA 4YMHA 4CKEB 3V4RA 1CKEA 3S68A 5CG1A 3EXIA 5LOVA 1N7IA 5CH3A 3G85A 1L7DA 2O3RA 1XU7A 3COVA 1QHEA 3R8FA 3NWOA 1NF2A 1XKLA 2GCPA 3E2MA 1GYRA 1QRSA 1UINA 1XN4A 3F6SA 3HDGA 1ZG3A 2Z4RA 1P62B 1WDWB 1KK3A 2QLMA 3I6ZA 4XRRA 2DCUA 3B38A 3THOA 5HCNA 2CWWA 4QPDA 4U9IS 4YRJA 1I01A 2P62A 3IKMB 3LBIA 4L22A 2WI8A 2Q0XA 1F5SA 2XRYA 3PC6A 1EAMA 2KSQA 3MFQA 3DGFC 4FCWA 4UHDA 4X63A 5GVRA 2G9NA 2RHWA 5LUAA 2EKDA 1PG2A 2ZIXB 2NUAB 3QYPA 4C6HA 1CBUA 1MEJA 2O8EB 5C8DA 2ZITA 2ZVPX 4M83A 2AFIB 2G76A 4H6WA 4X45A 1E1RD 4FD2A 1E7RA 5JBQA 4TL6A 4MRNA 4MWCA 4OI0A 2VDPB 4BVJA 2DERA 4NHOA 1WW8A 3CEMA 5ALEA 3FPCA 2W2MA 3G0CA 4OGLA 1Z6ZA 4IBOA 1I1QB 5LZ8A 3T3DA 2ZW9A 2QAGA 3OCVA 4NYMQ 9LDBA 1EEHA 4GRDA 1Z6AA 3QIVA 4M1QA 4Q3AA 1MC4A 3IOCA 3WR5A 1LQ2A 3BE5A 3U7RA 4YAUA 5KO2A 3VX3A 1E9FA 2QTWB 2XRFA 4ZAVA 4C4OA 2WWRA 2O3SA 4OQXA 2O05A 1C3VA 3JRWA 1VCMA 4R3WA 5E1BA 4YJHA 3ISTA 2UUAB 1U2DC 2BFMA 3KJZA 3LHDA 5BR1A 1T25A 1XEXB 3LFUA 3P9NA 1FS5A 4IQ4A 4P4NA 4KAAA 3QVMA 4YEDA 1LJLA 2PBZA 1XYVA 1WTCA 3FE2A 1T6ZA 5AOCA 2VT6A 3D3EA 2A57A 4ZHSA 4YYZA 4LNHA 3HZOA 3BILA 3OQ6A 2A5DA 4MUHA 5JATA 2EYQA 1J25A 4EB0A 3AF2A 5CXQA 1G0OA 3OECA 2ZJ5A 3QXGA 1EG2A 2DQKA 3H5IA 1M7HA 2IPMA 3F7TA 1C80A 2R751 1E96A 2JL1A 1L7QA 4NZYA 4R1UA 2VC2B 3ZK8A 2GAJA 5AKJA 1Y3CE 2JRCA 3ZHYA 3THYA 4DLTA 3DULA 1Q12A 4EARA 2XD9A 1F38A 4XYBA 1PQ4A 1S2GA 2BFWA 2R2GA 4FI3C 5B3AA 1DEAA 3Q4GA 4I8DA 3Q87B 4U0KA 1JZQA 2EKZA 3Q7TA 4J1NA 4WLOA 1H0KA 3WGJA 1Z7GA 3GA7A 1CXZA 5DX0A 2Q5HA 4BB9A 4N0PA 4EF6A 1GTMA 4HJXA 2AG8A 2H52A 2WJZB 2NVUB 1Q1EA 2B9EA 1G21A 2O2JA 1D8TA 4E07A 2C8LA 1I30A 4MOWA 4RGYA 4KQHA 4QE3A 4HH0A 5IYZA 5KIAA 1NR5A 1LSJA 1V7CA 3N5CA 4BCBA 4JLBA 1A9SA 1EFDN 2XVYA 3HVKA 3JU3A 2XWBF 1E8DA 1GR1A 1J9EA 1C1DA 1JNXX 1PWEA 2BEJA 2IOFK 3RS2A 5AVJA 1TYBE 3AKZA 4BV8A 2B4AA 2X86A 3UAGA 3QLEA 2CUKA 2GM5A 4GOXA 3NNNA 1P1RA 4RHTA 3PUVA 5CFQA 3T6KA 5HZMA 1YUMA 3IIKA 4PTZA 3T1OA 1H65A 1N2HA 1IMJA 3KQMA 4YJFA 3ASVA 1GLGA 3DQQA 5IK2A 4AG5A 3EF0A 3PTLA 2J09A 5C32A 2PT7A 2FX3A 1RI5A 1U3DA 2GM9A 3HNRA 1VPEA 3MFYA 3S1AB 4CG0A 3CSDA 4J0QA 2I54A 4OV6B 1IAVA 3EZ7A 3ZY4A 2VWHA 3CO5A 1UMDA 2DFNA 3ER6A 4GW3A 4B6SA 3ZCUA 5JWRA 3H65A 4QGBA 4K6HA 3TZCA 4JLDA 3P0FA 1T8SA 3R9KA 5LJLA 1Y7TA 2UZ4A 4N5MA 5G40A 2I1LA 3OZXA 4RK0A 3GK3A 1LK0A 3N28A 2VLIA 2ZR7A 1H5UA 4M8KA 3AFMA 3F2IA 2I80A 4ZO7A 1YTUA 2OBNA 1YTLA 3OOEA 2GEFA 1AK1A 4MJXA 3WKBA 2WAYA 4D79A 3NM5A 5D84A 4O1IA 5EXXA 2QMQA 4PX3A 3SX2A 3VR1A 3LA6A 4FC7A 3EPPA 1RRGA 3KEQA 3ZDQA 4HVTA 2GPAA 2J7PD 4B7UA 5JISA 2FWJA 2QLNA 5JSYA 3U4CA 1QQAA 2IK8A 3PIRA 5A1JA 2OY0A 4TQGA 4A27A 3ZXSA 3WHKA 5IVPA 1DXOA 5JNWA 4Q7QA 5LP6C 2DKOA 3DOUA 3P9PA 3KT0A 4ROSA 2B99A 2NSYA 4DSOA 3U61B 1K92A 4CCAA 3ET4A 5CXXA 4PYQA 2IRWA 2IE0A 2NW6A 3ESCA 2Y1DA 2I67A 3A25A 3GDFA 4RHCA 5DEOA 5C3UA 4A15A 5FNVA 1ZIYA 2C5EA 4PLGA 5TARA 1I0ZA 3WZ2A 3DEHA 1FYWA 3L8GA 4OXRA 1NY6A 5E6UA 2VHVA 3DNMA 1Y8QA 1XEWY 2FPRA 2I5PO 4J6EA 4IIGA 1DAGA 4CV0A 4M1TA 1FX0B 1A76A 2DT8A 4XI9A 3K8QA 3MTIA 2IW1A 3DW1X 3WFJA 1A9OA 1QP0A 5G0WA 1G5RA 2F00A 2ZUVA 4CIDA 5I45A 1GNQA 1UM8A 1XDZA 1YVEI 1ISJA 2DPXA 3E1SA 3QF7A 3CUYA 4CL0A 1TMOA 2BTQA 3BEDA 4PHHA 2A5LA 4OKIA 4K9SA 5DPMA 2ZT5A 5FDFA 3AZPA 3BL8A 3H4VA 1NQXA 4DARA 3EEQA 3H2IA 4IRMA 1UMCB 1QR2A 5DGDA 4ZMBA 2HHJA 2CCJA 3ZCXA 1MX1A 3BIJA 3KOZA 1ZN8A 4GKAA 1ZK1A 2GWHA 2W8ZA 1WP9A 1CVLA 1U9ZA 2GN6A 5FQNA 4L28A 4N7RA 4UQPA 2NSJA 1LNQA 2GHTA 1K2WA 2IJGX 2Y93A 3HI4A 4WSOA 2FP3A 1IHOA 4GYWA 4YFVA 3WL5A 3FDFA 4NU5A 4ZDJA 5K0LA 1FW8A 1X7ZA 1RIIA 3DB2A 3PNOA 3E3NA 3TG2A 2FWIA 4RD1A 5BXYA 3QFHA 2BTEA 1NF8A 3PDIA 1KVTA 4I46A 5EJ2A 1JZTA 1I14A 2AW5A 1JGTA 1OYVA 3ESAA 4LV5B 4OJNA 4WD3A 3UJ6A 3BHNA 3ODGA 2O8DB 2CBGA 4QGAA 2H5JA 3JZAA 2A2ZA 4J3JA 1LLFA 1JXAA 3CUKA 4Z4EA 2FW0A 1Q1GA 5JQGF 1BS9A 2BFDA 3S44A 2A3NA 5HCIA 2ZJ2A 3MUEA 3INNA 4L6IA 4O63O 2NU9B 3V8BA 3ZQ6A 4G89A 4LK2A 2Q3DA 4U1RA 2CE2X 1MNAA 2VHJA 5EHZA 2F67A 5K0JA 1N7JA 2IYPA 3QBVA 4I1PA 1EUYA 4Q4AB 1ZH0A 1HBJA 2MMCA 4PCVA 3IJEB 1SR8A 4KNYA 5A71A 2REQA 3OI7A 2HIMA 4H4EA 5CFOA 1TM2A 1Z35A 4IAOA 3T1TA 2GASA 4MB2A 1G8AA 2PANA 2UKDA 2HMSA 4WI1A 5DBIA 3A37A 4ZV9A 4A5SA 3UFXB 1KYZA 2EJUA 2FH5B 1RYNA 3DKKA 2P8JA 3KDSE 4ZAGA 1T6YA 2VF4X 2VRNA 3A0UA 4UMEA 3TZBA 1A4IA 3KJNA 1D1TA 3NHSA 4ZGWA 2WIGA 1XVTA 3RT1A 2IX9A 5IWAB 1OFVA 1HZZC 1RQNA 3ZV4A 4FR2A 2WJVA 3UIEA 5HM6A 5D3ZA 1V0JA 3L7LA 3OO1A 2W83A 1RDFA 1EESA 3SGLA 3HUEA 2B5OA 4LZWA 4TMXA 3F3YA 5INTA 2FP4B 2BGKA 1SKQA 2GGSA 2GBGA 4IV5A 4RSMA 3WFIA 3ZI0A 1UEJA 4XVRA 6GPBA 1P75A 1S96A 3VH1A 4HJRA 3IQXA 2AYXA 2C31A 4URZR 1NBIA 1XQ1A 2B3DA 3OC6A 4HGPA 2RAPA 5ITSA 5C53B 3PJFA 1NW8A 1HKUA 4EUNA 5B36A 2QPOA 2VPXA 4QPPA 2JZNA 2Y71A 4BAZA 1E2FA 1XNHA 2QSZA 4P93A 4U7HA 3RRXA 4OIFA 4DJDC 3BH7A 3OOWA 2D1RA 2WT4A 2VFAA 1B8UA 3LCRA 4KLRA 4CF3A 3WLIA 3ANXA 2MMGA 3NYIA 4PN3A 1YFJA 5AK6A 5GIOE 5EE5B 4HLUC 1IDN1 1QIEA 1O6ZA 1VI2A 5THKA 4YJ2A 1S2LA 1PV4A 2VJDA 1VYHA 2VKTA 3TVTA 1M75A 2K7ZA 5CH5A 4DDUA 5FOWA 1R0SA 1IY0A 3R3WA 3T94A 2ODTX 4MMYB 2AXPA 2FWBA 4Y6QA 1DKQA 3REOA 2EZTA 3NHLA 3C3PA 1ACMA 2COKA 1HYHA 4NNOA 1R5BA 1ZH6A 4OBWA 3KT8A 3LX6A 2WVHA 2WG0A 4ZVKA 4DV2B 2J5XA 3A1TA 1Q0PA 1SC9A 1K66A 4BXOB 1UR5A 2X5XA 4DJTA 4KH0A 3TPFA 2PUBA 3AR6A 4L27A 1HTWA 3ELWA 3ENZA 4B6RA 2P9QA 1UCFA 3DOOA 4Y2QA 1GFIA 3S29A 4PG5A 1TIBA 3KDAA 4KQ1A 3WIOA 4TRNA 2QTBA 4LBYA 2AFRA 3K1AB 1FTSA 3MB5A 1V5IA 3L0ZA 3EUWA 4PZPA 2VKQA 3LTNC 1EVYA 2YVLA 3BD7A 1TX4B 5LSAA 3LVBA 4XGRA 3DLHA 1IPHA 2O14A 1G20B 2KE5A 2N9UA 3P7MA 3BMQB 1NXTA 1HT2E 3E81A 4QHYA 2APJA 5COBA 5K3DA 1FRFS 3HL0A 5FXMA 4MPPA 5BRAA 2RHMA 2FJ0A 4Q9NA 1WP4A 3RK0A 3DYVA 4GQIA 1RXUA 3NV7A 3OPXA 1PVDA 3K6SB 4Z1OA 3BGVA 4IHJB 3SZRA 5JC1A 3PG5A 4KQ6A 4ZVNA 3SCZA 5ALIA 4ZZ0A 3VSEA 4K9RA 3Q40A 4I9UA 4K9LA 2JIPA 4TN1A 1MW8X 1S8FA 4XD7A 2B9VA 3TLBA 4O3MA 2FUCA 3AEQA 1VL6A 2B8WA 1JT9A 2G36A 4AXBA 4CU2A 3UBMA 1BDIA 5LYYA 3TLGB 4AYTA 4BN5A 1B1CA 4J1TA 4NWIA 1Z8NA 1O96A 3QELB 1WUKS 4R54A 3H1PA 4DWOA 5DOVA 4YCCA 1PYGA 3IT0A 1V35A 1F9AA 2ZIWB 3WLAA 1B4DA 5FT9A 3PNYA 4QDUA 5BR7A 4L95C 5IKXA 1J21A 3WIBA 2EQAA 2ZJ7A 1CFZA 2VJOA 3CTPA 4OQFA 3SM3A 4M1SA 1BDBA 3LUJA 4UUOA 5F3DA 1DIGA 3H11A 3VH4A 1DZIA 1U2EA 3B1KA 3E22B 5IZCA 1QTRA 1ZVVA 3PQ7A 2L18A 3CPHA 1AKMA 1O6FA 3AK4A 2ISSD 2PZMA 2DB3A 1Z0SA 2ZJOA 4KR0A 5KMGA 2XWQA 3JQGB 2GARA 3EXEA 2QUAA 2YIVX 2AQHA 4NE2A 4W1PA 3W6ZA 4F1JA 5HA5A 3LT0A 4KN6A 5REQA 2EHDA 2EU8A 5HQJA 3T7SA 4BO8A 1YFLA 4CEIA 1U0JA 4ZQIA 3L92A 1M76A 1P0CA 5B12A 2IYRA 3AI3A 4HHEA 2F9FA 2KB0A 3DXYA 5K51A 1CR1A 1E3WB 1SG0A 2AHRA 3GGPA 4FOPA 4LHWA 3RSFA 3QP9A 1X80A 3N2EA 5A9RA 4DR3B 3G0GA 5AVVA 3EPRA 1MQ9A 5GGXA 3CLKA 2I9PA 4LDNA 4R0VA 4IDAA 4AYWA 1XTPA 4QUHA 1CY8A 3GFSA 1ST2A 2V7EA 3VNVA 4XLLA 4LF6B 3GFGA 1J90A 1Y48E 5K0ZA 1OZ0A 2VCEA 3PQEA 1ZCBA 4QTTB 4BWYA 1VMKA 1GTZA 4NMMA 2BFNA 1KJNA 4EHLA 1Y9EA 1K8QA 2ZVJA 4QJ4A 4XM0A 3DVAA 4X64B 4MWOA 2AG5A 2Z3VA 4XQGA 4ZJYA 1RCUA 3UV3A 1COWD 3KQKA 1B23P 1I9CA 4MCAA 4LYDA 5CH8A 4EAAA 1M74A 1OXBB 4I1UA 5FRDA 3U5ZB 3ER8A 1GQQA 3G8BA 3MLBA 3LY7A 2LIVA 4R1NA 4J76A 2I4RA 3RV3A 4K3VA 1S7CA 4MLDA 3SVTA 4AC9A 3PRKE 1KEKA 4Y9DA 1BQ3A 5EJ7A 2Y77A 4Y0AA 3IURA 2UZ0A 1X94A 3KKKA 4PW0A 2EJWA 4WEQA 4LJ4A 3FVVA 2XT9A 3TW0A 5HUHA 2G9VA 1Z15A 3WWYA 1YBVA 4HLNA 2Q3FA 4J4BA 1XDDA 1DADA 2KI5A 1LTQA 2P4EA 2PUHA 4IIYA 2PGAA 3LA8A 3QVWA 4IHQA 1HNXB 3IDFA 4H31A 4OXKA 3ZNPA 4CMIB 1ZOPA 1QGED 1G7TA 1KI4A 1R00A 5JLAA 3TX6A 8ADHA 3GARA 3KAKA 2XNDA 1EUDB 1QK4A 1V6SA 1BJRE 1DE0A 3FNEA 4S2EA 2B0CA 5K3FB 4WY5A 2BKEA 2NVWA 3DEZA 4EI8A 1IU9A 1M5UA 3T0GA 3ZWNA 4TYNA 3D54D 1U6JA 2IUUA 1OAKA 1Q1QA 2XBLA 1C2TA 3AV0B 3GGCA 3PXGA 1NXOA 4AJLA 4DWVA 2V3VA 2OAEA 2VH5R 5TEVA 5JEEA 4M1ZA 3DE1X 2VZ8A 3IP7A 4RMIA 4U7TB 5F1KA 2VZ0A 2Q5LA 1JMYA 1JDSA 3GIDA 4IGAA 3HU5A 3KNZA 3KYDA 5F21A 4I99A 3GRUA 1EFPA 1EVEA 1QFMA 2VP3A 3OICA 4M76B 4OA5A 3P2IA 4IM7A 4EITA 1VE5A 3KIPA 4BEJA 3E3AA 1ZW1A 2ZE7A 2V7BA 1RVDA 2GCGA 1A3CA 2I4NA 2X6RA 1OZGA 1VLZA 1C30A 3EB9A 1I3CA 4HDQB 4KWEA 1MC8A 4PWYA 4QG7A 2C9CA 3OWXA 4XFDA 4UNPA 5D3KA 3B6KA 2HK6A 3M6VA 4H77A 4RGBA 2PZBA 1T6NA 2EFDB 4RPHA 2AQIA 3ACDA 3K92A 2GXUA 3GQBB 5CJ2A 4Z9XA 4DCMA 2ZWAA 1N2JA 3VTFA 1JQJC 3LQYA 3QXXA 2CT8A 5E6RB 1KI6A 2UXDB 5ALRA 4AJIA 4LHXA 5HZKA 1RT9A 1QWSA 1NBMD 2EBHX 3SD7A 3H5WA 4KXLA 4YRPA 5EIEA 3KQLA 1JHOA 2A9PA 1AKEA 1I4WA 3BTUA 4LOHA 1JG3A 4B4KA 2XKKA 3U3XA 1M6HA 3WSWA 2FSUA 3CXUA 2I03A 3UCFA 3WSTA 4PQEA 2JFNA 2RMKA 2PUJA 2QM7A 4L8YA 4WNAB 1GP2A 2G1AA 2H0RA 3LAWA 1QNLA 3NYWA 2ZJ1A 1JW9B 5EE3A 2Y1KA 4DGSA 1TVKA 4FONA 2OOKA 4M0PA 3PPIA 3NIFB 4CETA 4PNZA 1SCNE 2W58A 4C21A 1NNEA 3TXAA 2HEGA 4DMFA 2WF8A 3CRZA 2GO1A 3LH5A 1ULHA 2WOOA 4RPLA 3V3TA 4ARIA 3PNQA 2F8SA 3EE6A 1BN7A 3C7AA 1FUEA 1CE8A 4P08A 3OPVA 1PSDA 1DPGA 1QQ5A 2CVOA 3C7CB 4LV8B 5I5GA 3UKJA 1F9EA 3ZD7A 4UU1A 2PYIA 1KDOA 3N1UA 5CNKA 2IEIA 4BJ6A 5JCZA 3FZGA 4BX3A 5KKCA 4X7MA 1U3FA 3G0DA 2QYSA 4P4UA 1JIKA 4EEKA 2XUKA 1N9ZA 3V46A 4WGGA 3FRIA 4DIMA 2HF2A 2VEDA 3BXXA 2BM0A 5CK4A 1JDNA 5L51A 1VYUA 1P72A 3DFKA 3NGLA 4OHUA 4OMFG 1U80A 4FD3A 1KF0A 5JXHA 1SEPA 4B79A 1DQRA 2GPNA 5A62A 3NM6B 5LP6F 221PA 2DWOA 3MWKA 4UASA 3PLRA 1QH9A 1HLPA 3FFBA 2X3UA 2VJPA 2B92A 2XUHA 3JQCA 1KGDA 2IXBA 2OBMA 1AE1A 1N2EA 2H17A 2ZIAA 3RFVA 2EHJA 4IDQA 1EFRD 3ENQA 1RCFA 4QBIA 4QYMA 2O1XA 4IJ5A 5HM8A 4NCKA 4REOA 1QPBA 2ECOA 3GCXA 3UK0A 4UEJA 1F1JA 3QJYA 4Q3BA 3QI7A 5AICA 4V1CA 1L2TA 2J0UA 1L5FA 3DTVB 3RBAA 5K0BA 5A5GA 3HGQA 3CW8X 5EAIA 1IUKA 5IHXA 3KLNA 4NFHA 1QONA 4X41A 5E9AA 1VZ3A 4EJMA 1QU3A 4FFBB 2Q3JA 2R65A 1BEZA 2COEA 1JFLA 4GPIB 1H2FA 2B7BA 5EIFA 4XARA 4E4RA 4JIMA 1K4KA 4J16A 4EZEA 4Y6LA 2HF7A 3A4VA 3CC8A 4TL7A 4R71A 5ALMA 3EG9B 2EF1A 1IK4A 4U8GA 5DOZA 3GIWA 4RACA 1OPRA 1MJNA 1SY7A 2R1TA 5FNVB 1SURA 1TF2A 3RH0A 3R0IA 4AKIA 4N9WA 3PNVA 3SC3A 2QU7A 4ZPJA 4KWIA 2AX3A 3AKEA 4XQ0A 2G67A 2HA3A 3BULA 4QM6A 4JELA 1T26A 2Q46A 5C81A 4DQDA 2CSXA 3DTVD 4R31A 4M1WA 4RSRA 3GV0A 3F6BX 3PE6A 4UZFA 1HDCA 2P69A 3DS8A 3FPBA 4FR0A 4PYRA 2HSWA 4Q34A 1Z3CA 2VP2A 3RUIA 2JEYA 3AVWA 2QZ4A 4ZHQA 3H2GA 3R6GA 3A3OA 2A9OA 2P91A 1J23A 2JD1A 4FFLA 4M0LA 2NQTA 1L4LA 1L8QA 2JKVA 3BMNB 1CZHA 4HATA 5JS8A 1U9IC 4WK0B 5ALOA 1XZKA 2QVGA 1X1AA 5DHAA 1W7AA 5AOAA 1MORA 2J9ZB 3ETEA 1BNCA 3MSCA 3D02A 4RD2A 2YY7A 3NC0C 3PD1A 2JB9A 5JARA 1S89A 2QI9F 3IBYA 5TQ2B 3JRNA 1II8B 4MVJA 1KOLA 4JKOA 3O2JA 3UFXA 4Y2VA 2YX1A 5DGIA 4RJIA 4Z9YA 1PNRA 2LRHA 1A77A 1SBIA 4EUEA 2WW8A 2ZTLA 5FPSA 2XUZA 2EFCB 2F43B 1ECBA 4CYMA 2KLBA 1ZJ4A 4RK5A 1IXZA 1XALA 2W2TA 3M5PA 4R8SA 3RIMA 1C7QA 3VDNB 3ZHXA 2GN8A 3GP8A 2O52A 3DJYA 1FP2A 4BNGA 3O1HB 1Y1SA 5KSWB 4EYGA 2XBUA 4HOYA 3GLHB 3MRVA 2QKYA 1DC6A 4UTVA 1WD5A 4XA8A 1QQ7A 3G8YA 4KE7A 1Y89A 3INRA 1LD3A 2Y1EA 2ZE5A 3JASB 3W04A 3U4QB 2HWXA 1YVRA 2ZI6A 4MR9B 4O8ZA 5K3OA 2GSWA 1D7OA 3DGEC 2YJ4A 4OH7A 4S35A 2XQIA 1T8WA 2XZPA 3IVMA 1Z2DA 4U02A 1QHIA 2NZWA 1C4OA 2G06A 3E4DA 2VTKA 1LDBA 3DVLA 3MQ2A 4OK6A 2NT3A 3ZZMA 1VM6A 4S1NA 1QYVA 1I7PA 2BP7A 3OCZA 5H9VA 2ZETA 3AL2A 5IYZB 4KTTE 1O03A 3QJGA 2C97A 4V03A 2J4CA 2V97A 3R6WA 3SHFA 3P9YA 3C4VA 3KQNA 2HA6A 3QGMA 2ZTSA 6NULA 5IK2D 4LTDA 2J6CA 1YKGA 3TQTA 3VJRA 4Z8YA 1SZDA 2MSEB 1UZNA 3OJFA 5WRFA 2BY4A 4RDCA 4X1KA 1XCGB 1IBMB 1T5BA 1JF8A 2RHLA 4R9NA 1K3UB 4TXLA 1GQSA 1TZBA 2JAQA 4K9OA 3TSZA 4GS5A 1K7XB 3VFDA 2XYVA 2YJTD 4YJGA 5J47A 4BO1A 5KQGA 3WYBA 2OWDA 3MT0A 3ORHA 3T7AA 2R6GA 2EBUA 4MW9A 3BRCA 4LBWA 1V7ZA 5K20A 1E2DA 1UKEA 4NPAA 3GNLA 4Q7LA 1ZINA 1U1GA 4WXPA 1GWNA 1PT6A 3I6QA 1SOMA 2IELA 4CKEA 3ZLVA 4JZYA 5E9WA 3SG0A 5I4KA 4W99A 2VAWA 5H80A 2HJGA 4JI2B 1G8FA 4RO0A 5LR6A 1TL7C 1NJ2A 3P9CA 1SXJE 1DC8A 1JSLA 2WILA 2FPLA 5A9SB 2XLBA 2AJTA 1NJ8A 2H65A 2JW5A 1AO0A 2IH4A 2VDVE 1KKMA 4GM4A 3U3MA 1QHYA 3HPRA 1G8MA 1H8HD 4DBLE 2Z4SA 3R5KA 4CUJA 1A5AB 3PYLA 3N2YA 3ZHUA 3RSLA 1E3JA 2XOKD 2C84A 4AY5A 5H59A 2PZKA 4DM3A 4EFDA 4QG3A 1ML3A 4NC9A 3UZUA 4IIJF 1CNMA 1P9WA 3QEMA 1WPGA 5JAPA 3VU8A 3WLEA 1THGA 1Z4MA 1YBMA 2HNKA 1Z4NA 3G5AA 3VUEA 3I2KA 4HXYA 5JU6A 1G8JA 2ENWA 2WM3A 1RAEA 1XPJA 4GI2A 1H2RS 4QEZA 1HT0A 4CF7A 3GLGE 1AZLA 3ZXYA 3DLBA 2OFPA 1F8YA 3C8ZA 3H5VA 5F7JA 5L3QA 3NQ41 4HNVA 2V6JA 3B3QA 4PC1A 1LRLA 4C43A 2RHJA 3ZTYA 3KBBA 4XYMA 4ND5A 4IPTA 4RF2A 5GPBA 1KQOA 5LZ9A 1GDHA 2F3TA 2R4QA 3F2VA 1GSOA 2IV2X 3BQ9A 5LYJB 3TRDA 3R7SA 4DMRA 3L79A 3E1KA 4M9ZA 3MERA 3HMKA 3DAFA 3EIEA 1WD7A 1XJQA 3ZHCA 1UJ2A 3F6YA 4LBZA 2MYUA 4XXHA 4OP1A 4WK4B 2CZQA 3PFKA 3QRWA 2JLQA 5EWMA 3TR0A 1EHYA 4TSRA 3F7NA 2YXPX 3IGFA 3O8OA 4KH1A 4GR4A 2GDJA 2GO7A 4GWGA 4RV5A 2BKXA 1UJNA 3DDCA 4CN8A 2JD0A 2ZDHA 1FYDA 3OOHA 4GPBA 4K1XA 4IDPA 1QO9A 2NUTB 1NLUA 3CF4G 3KD3A 3ZY6A 4JLKA 1E92A 1W0JD 5K03A 3HKBA 3UXYA 1I32A 1IPEA 1KXJA 2Q2QA 1WDKA 1JQAA 3VPGA 3V7YA 2F1OA 2FQQA 2RH8A 1JDTA 4EH1A 5LLDA 3MUNA 5FLEX 4JXZA 1M1NA 5K05A 5K2OA 4GKKB 1KOJA 4G5HA 4FZ3A 5DDIP 4EB6A 1HLFA 5K7SA 1T34A 2YS6A 4FBMA 2FMKA 4Z5XA 2J6BA 3MWDA 4FLMA 4CGYA 1M67A 1A5TA 4OEHA 5JD4A 3LIIA 1O9GA 4Z4FA 3WRYC 3IRUA 4TZTA 5ECGC 3I1JA 4MR8B 3HSKA 4TL8A 3UW1A 4YRBA 1L4BA 1RC1A 2C82A 3DTYA 3IP6A 5ESWA 1AU9A 4L5AA 1JU4A 1QM5A 4J2TA 2JDIA 3EASA 3DQZA 3IIIA 4ZCQA 4CKZA 1T36B 2PO7A 2ZJFA 4MQEB 2QTCA 3W5VA 1Y5IA 5ADWA 3D8SA 3TTXA 4M9CA 2DG2A 3L0BA 4Y2JA 1KO5A 1CUZA 5BOSA 4LXXA 2ODBA 1UJBA 2RHCA 4CQMB 5B2ZA 1JKFA 3C3YA 1IYZA 4NZMA 5I8WA 3QF4A 2GOYA 3VZDA 5KJ1A 5LDDC 3RUPA 5FH9A 4DR2B 4HDSA 4OUDB 4DG9A 3CPEA 3TLEA 4UXIA 3CZQA 4W8HA 4Z7OB 1BKYA 5K8LA 4IHJF 2VZLA 4CMHA 9LDTA 4LY0A 2PVSA 3GZJA 2VDNB 2C2BA 4C14A 7REQA 2M32A 1MAWA 3R7FA 4P8RA 2I1VB 3LC1O 3VZQA 3PJDA 2JGJA 4QX6A 1F14A 2Y4NA 1KY5A 2A35A 3L7MA 2O6LA 5FPTA 2YIDA 3AUFA 2GKOA 2PQ0A 1HDGO 3SXPA 3WMXA 2FAXA 4FUTA 3TE7A 3J81A 1CZOA 2DR0A 2VYNA 4MEAA 3PQ6A 1U1DA 1JAZA 2VDOB 4X97A 3FJYA 5FL7A 5TEWA 3SQNA 3GW8A 2B7CA 2CLFB 4PSUA 4N7MA 4NBKA 2YCBA 2C2OA 3MBOA 4TV9F 3T3PB 3TW8A 1RHQA 1SH7A 1NQWA 4R7TA