2XVAA

Crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sinefungin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
199
structure length
199
Chain Sequence
GAMVIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDRQYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWERVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords TELLURITE RESISTANCE PROTEIN TEHB
total genus 65
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.265: Tellurite methyltransferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2xvaA00
2XBMA 3MQ2A 3G2OA 2YR0A 4C03A 3P71T 1ZHFA 2VS1A 1NW8A 2ONZA 3GWZA 3GDHA 4F84A 5ERGB 2OKCA 1FP2A 1QYRA 2YUIA 3KPVA 2OY0A 2AOVA 3GGDA 2O57A 3HTXA 5FHRA 5DPMA 3EVZA 1QAMA 2PY6A 3SR4A 3HCAA 5FQNA 4QVKA 2AN5A 3GRYA 3B7PA 2IGTA 3KQWA 1QAQA 3I5UA 3TM4A 5GINE 1UFKA 1PRYA 2AOTB 1P91A 5E9WA 4CKBA 4C04A 3ELDA 3MHTA 4MTLA 3D2LA 3M6UA 5E2AA 3A26A 4WXHA 4OBWA 3PFHA 4POOA 2IBTA 3DTNA 5DM0A 4DQ0A 1G6Q1 1G55A 1ZGAA 4E2ZA 2LD4A 3DP7A 4ZTBA 4NECA 3LKZA 3TPZA 4RTOA 5B1SA 4C07A 3P97A 1RI3A 3P9KA 2NP6A 4XUDA 3BGVA 4OA5A 1HNNA 3LL7A 4CXMA 3X0DA 1VPTA 3A27A 3OU6A 2QRVA 1KIAA 5K8VA 3KR9A 5JR3A 4ER6A 1IM8A 3KQVA 3TRKA 4FSXA 3HVJA 2P7IA 2ZWVA 1M6EX 2XYRA 5HEKA 4MQ4A 4KWCA 3A4TA 1KHHA 2KW5A 3HEMA 3HCFA 3MB5A 4GEKA 3SMQA 5BP7A 5ICCA 2HNKA 4E2YA 1XJ5A 1JTFA 2FK8A 4AZTA 3KR2A 5EC8A 2PLWA 3MCZA 2Z6UA 2NXJA 1L9KA 1EQAA 2A14A 3DXZA 2VZ9A 2BM9A 5DTRA 4AZSA 5K01A 3O4FA 5DXJA 5ICFA 4R8SA 2CWWA 3ER8A 4YUYA 3BGDA 4RTSA 3GU3A 4RVDA 5CVVA 4CKEA 2JHAA 4LG1A 3LX6A 4LWPA 5EKXA 3UJBA 4U7TB 1VQ1A 2B78A 3DMFA 2AOWA 1JG2A 2UZ4A 2FCAA 5DWQA 5DX8A 2PX5A 4KW7A 2P3QA 3C3YA 5D1HA 3SXJA 5EOVA 4BY9E 3G5TA 2ZLBA 4V0RA 4QVGA 1D2HA 4Z2YA 5M5BA 4PGGA 5E1OA 1F3LA 3V97A 4FP9A 4P58A 1BC5A 2PVCA 3OZSA 3NW9A 4YMGA 1KPGA 4HRAA 10MHA 1DCTA 3TOSA 3Q7EA 2I62A 2FPOA 4BP3A 3REOA 2PXXA 3GRVA 3JWGA 1XDUA 4YUWA 1AQJA 3FPFA 2JHPA 5LQRA 3KQSA 5K0FA 3BKXA 2Q41A 4OBXA 5DM2A 1QAOA 5LQUA 3G89A 1YB2A 2E5WA 4PYJA 4GC5A 3DULA 3TLJA 1NV9A 4R05A 4ER0A 1MHTA 2ZZNA 1Z3CA 1ZQ9A 3DUWA 3HA3A 5HZMA 2HTEA 3FUTA 3P8ZA 3TKYA 2PXCA 4GBED 2AZTA 5GWXA 3EVFA 4OX9Y 1JTEA 3B3JA 3R24A 4HC4A 5HFJA 5GM1A 5HOQA 5GM2A 2WA1A 5LSAA 2IH5A 3KQYA 3DR5A 4AZWA 4BLUA 4KIFA 2ZFUA 3TM5A 5GIPE 2K4MA 3IEIA 5EHGA 2PX8A 4PYNA 4PINA 5C1IA 4X60A 1VE3A 3TFWA 2C7OA 4BLWA 3HVIA 4FS8A 5CCXA 4IV8A 4RWZA 3KU1A 3OZTA 5EZSA 2IDKA 3LCCA 1IXKA 3QOXA 1YZHA 4LECA 4OQDA 1XXLA 3HCBA 4ATNA 2R6ZA 3R3HA 1NW5A 1SUSA 5EGSA 4RTNA 1V39A 2FK7A 3LSTA 2AS0A 4E70A 3G2PA 5DX1A 2R3SA 1JQEA 2P1DA 4O29A 1VL5A 2F8LA 2WK1A 3HM2A 3B5IA 4KVZA 3KHKA 4P7GA 2ZVJA 3HCEA 3IV6A 4DCGA 3PB3A 1NW6A 3G5LA 1P1BA 3UJ8A 2Z6AA 3FYDA 3ORHA 5E8JA 3SM3A 5GP1A 2P41A 1UIRA 2G71A 3DOUA 3NDJA 5EMLA 2C7RA 5EMMA 2IP2A 2OO3A 2IIPA 5IKMA 5EQJB 5CD1A 3EVEA 1ORHA 1VP9A 2ESRA 3MGGA 2CKDA 3ME5A 1O9HA 5CVUA 3G2MA 3DLCA 5LR6A 1U2ZA 2G70A 1O54A 3KPYA 4KDRA 5E8RA 2C7PA 1AF7A 3EMDA 4RV9A 4YV2A 1D2CA 3ELWA 5C0OE 5GOZA 5FCDA 2GA9A 4RTJA 4PYMA 1NBHA 2CMGA 2EFJA 3EEYA 3EGEA 2P8JA 4PYOA 3PLAE 4HH4A 2G72A 2PT9A 2ZULA 3KQMA 4PCLA 1KYZA 2QM3A 3LBYA 2ONYA 3OE4A 2IBSA 1JG3A 4RVFA 2EJUA 2PGXA 3E05A 2G8NA 3EVAA 3BWMA 1X1BA 1NE2A 5LQNA 3NVMB 1L3BA 1XCJA 2ZCJA 2BM8A 3FZGA 2JJQA 5K0NA 3MAGA 4G56A 3BKWA 3QOWA 4GQBA 3M33A 1VIDA 4PIPA 5CM2Z 3FTDA 5F2KA 5CCBA 1NKVA 4PNEA 3LCVB 3PVCA 5DM4A 1RI1A 3MTIA 3P2EA 3KR1A 1KPIA 1FPQA 3DMGA 3F4KA 5LQJA 3THSA 5T6BA 3SSMA 3FPEA 2P40A 4AUKA 5HIKA 3M6XA 5EMKA 1VP3A 3AY0A 3LPMA 3UZUA 2JG3A 1XDZA 2B2CA 2BR4A 3C6MA 2GPYA 3JWHA 3OCJA 3PT9A 2OZVA 4DKJA 2AVDA 4U7PB 5ICGA 1EIZA 1VBFA 5K0GA 4HG2A 1Q0TA 1X1DA 4CTJA 1X1CA 4RVGA 5EIWA 5BXYA 3NVKI 4YV0A 2FRXA 4CWAA 1F38A 3GO4A 1BKYA 5MHTA 1OR8A 2HWKA 3ID6C 5FA5A 1NV8A 2PXAA 2BR3A 2QYOA 5DT2A 3GRUA 3KPWA 1TPYA 3PX3A 2FYTA 4KIGA 3SSOA 1NBIA 3ERCA 5U4XA 2AN4A 4EK9A 3OPNA 5EG5A 2OXTA 3UJDA 2ZSUA 5ICEA 3BGIA 1Y8CA 3I9FA 5LQAA 3EGVA 3HP7A 1WZNA 3RW9A 2PT6A 3K6RA 3CGGA 1G38A 2N47A 2VDWA 3RODA 5K0JA 3HCDA 4PYLA 3R0QA 4RX1A 1YFJA 3B3FA 2P3LA 5HIMA 1VLMA 2IDJA 2HR1A 4QPNA 3FPGA 4FSDA 5FTWA 2XVMA 1FJXA 4X1OA 2AVNA 5EVJA 4GOOD 1WY7A 2ZZKA 2VDVE 3CVOA 3GRZA 4M38A 1YF3A 3R9XB 2PX4A 1RJDA 2YTZA 5C9ZA 5HILA 3G8BA 2H11A 3G8AA 2I9KA 3NWBA 2XYQA 3OE5A 3UA4A 1WS6A 2B3TA 3DXXA 3JWJA 5K0LA 1RJEA 5CVDA 1R00A 4OQEA 1DUSA 5BW5A 2FHPA 2AR0A 4M37A 2UYQA 1Q0SA 5CVEA 4FR0A 3SVZA 4RTMA 1IY9A 2O0LA 3M6VA 5DSTA 4F86A 3BWBA 1AQIA 2O06A 5HIIA 2YX1A 2H00A 3UA3A 4X41A 4E30A 1D2GA 4RTLA 3UJAA 5DLYA 1JG1A 3DH0A 3GXOA 5H02A 4RTRA 4QQNA 3C6KA 3AWIA 5E9QA 5HIJA 3A25A 2BH2A 4KDCA 5FWDA 4YMHA 3OU7A 3PFGA 5T67A 4BLVA 3M70A 4X63A 3G7UA 4B17A 5CIYA 3G2QA 2I6GA 3A7DA 4RYLA 3LDGA 3LGAA 3TKAA 3FUXA 3OZRA 2ZBPA 4RVHA 3EGIA 4ER5A 3ELUA 4HTFB 3LCUA 2AOUB 1KYWA 8MHTA 1EJ6A 4L7VA 3SSNA 2XVAA 3S68A 3TQSA 2I7CA 2ZIFA 4ER7A 4P7JA 2CL5A 4CTKA 5FA8A 2EX4A 1RJGA 2EG5A 5EEGA 3RIEA 1WG8A 2PWYA 1JSZA 1EJ0A 5GIOE 2QY6A 3U81A 1AV6A 3BT7A 4PCAA 3KPUA 2GB4A 2OB2A 1L3CA 4E32A 2Z6QA 3VC1A 2UYCA 4CKCA 3KQPA 5FHQA 3EVBA 1NT2A 3QV2A 4HGYA 4XUEA 5E1DA 1R8YA 3FRHA 4IKPA 4DM3A 3Q87B 1KP9A 2B25A 4PYIA 4MWZA 4X61A 4C4AA 1ZG3A 1N7IA 2PWPA 3FPHA 2O05A 3BZBA 3PTAA 1G8AA 2IPXA 1JQDA 2YXDA 4FZVA 1M6YA 3BXOA 4GF5A 5DM1A 3T0IA 1P1CA 3UJ7A 5K09A 1X1AA 1WXWA 3B3GA 1O9GA 3I58A 2PSSA 3DMHA 3H2BA 2OB1A 3MTEA 5D1NA 5DXAA 5EEHA 3SX0A 4PGHA 3P2IA 3B89A 3GCZA 5FADA 4EKGA 3HA5A 3I64A 5LQCA 5DTMA 3CBGA 5KYGA 3UBTA 1R6AA 3FTCA 3EMBA 2NYUA 3KQQA 4K6MA 2CMHA 2ZW9A 5KVAA 2IH4A 3HNRA 3GIWA 3TR6A 1SKMA 2DULA 3DLIA 2VDUE 3EVCA 3OFJA 5EMJA 4ER3A 4MIKA 4DZRA 3ER9A 4E2WA 3LKDA 4RTKA 1SG9A 3AJDA 1G60A 3BUSA 1DL5A 2C7QA 4KRGA 5F2OA 3NTVA 4DCMA 5LQKA 3HVKA 2VP3A 2EJTA 1MJFA 1ZGJA 3HA7A 1HMYA 1JR4A 1QZZA 4FGZA 4XCXA 5FULA 5T64A 3UJCA 4A6EA 5EPEA 4IV0A 5CVJA 2IFTA 2HV9A 4AZVA 4HTFA 4GOMD 2YVLA 3IYLW 3EEOA 4H0NA 3FYCA 1RI5A 1XTPA 5K0BA 1SUIA 1TW3A 4PWYA 1R74A 9MHTA 4V0QA 2AOTA 5DX0A 5FWAA 3TMAA 3UWPA 5P8WA 4AX8A 2ZIGA 3LBFA 4YUXA 5EIFA 5KS2A 1INLA 1SVUA 4LWOA 1BHJA 2JH9A 2ZZMA 1B42A 1N7JA 3HVHA 5E9JA 4F85A 4FT2A 5BW4A 4IWNA 1SQFA 2QRVB 3CCFA 2NP7A 1I9GA 4MHTA 5E1MA 2PBFA 1YUBA 3JWIA 2GAFA 3MCTA 3SGLA 1T43A 1XDSA 3E8SA 2OBFA 4PYKA 2P7HA 3NDIA 2G1PA 3FUVA 4GOND 3CKKA 3L8DA 5IH3A 4QDJA 3GNLA 3PX2A 4PYQA 4E31A 3E23A 4PONA 2ZIEA 5K0CA 5E1BA 2NNWB 3AXSA 4E33A 2YXLA 3MERA 3FTFA 2NXNA 4QTUB 2AOXA 4R8RA 1EG2A 3WSTA 4YV1A 4M7RA 4RTQA 1FP1D 4P7FA 3T7SA 1QANA 2ERCA 2XYVA 3P9CA 1KPHA 2BZGA 2HMYB 1YZ3A 1WXXA 2JH8A 4HSGA 4R6XA 5DRTA 4YUZA 4GC9A 2Y1WA 3GRRA 1JG4A 2O07A 3BWCA 3DXYA 3EVDA 4JXJA 4P7KA 4QPPA 4XUCA 5KQRA 2YXEA 5FUBA 4EMSA 1I4WA 3LDFA 3VSEA 4DMGA 1NW7A 3NWEA 4OA8A 3CC8A 5JUWA 3CJQA 4E2XA 2PV0A 1N2XA 3LHDA 1ORIA 1SQGA 2OYRA 2ZBQA 3V8VA 1JSXA 1KXZA 3O7WA 4QTTB 4R6WA 4EKIA 5DRYA 2BR5A 4EQZA 4DA4A 3G88A 2JHCA 1R18A 3C3PA 2NXCA 4M36A 1R8XA 2NXEA 5CUQA 1PJZA 4QDKA 4EVIA 3T7RA 2ZBRA 3M6WA 5K0EA 2ZWAA 1P39A 1RI2A 2ORED 3ELYA 3P2KA 5EHIA 1L1EA 5K03A 2V7EA 3K0BA 3FUUA 3KKZA 3THRA 3VC2A 4UOEA 3FRIA 3NJRA 5EKUA 4C05A 2UYHA 3NMUF 4PIMA 3KR0A 4Y30A 2PJDA 3CJTA 2PX2A 3HCCA 4FT4A 2IH2A 3KQOA 5G02A 2Y1XA 3CJRA 2GLUA 2GH1A 2UYOA 1BOOA 1L3IA 1UWVA 2ADMA 3IHTA 2V74B 3LDUA 2WA2A 1H1DA 3M4XA 4WVLA 1X19A 5EZQA 2DPMA 1TW2A 3FPJA 3O31A 3R6TA 3I53A 3FTEA 1XCLA 1RI4A 3C0KA 3FUWA 4HGZA 3P9IA 5DTQA 5DSXA 4RSRA 4YUVA 2QE6A 3AXTA 1KR5A 5E2BA 7MHTA 1FBNA 1ZKDA 5F2NA 1YFLA 1M0EA 3EVGA 3KQTA 4GUAA 5K05A 3BWYA 3OU2A 4QQKA 3UFBA 4C06A 3ANXA 3UJ9A 4GOLD 1I1NA 4RTPA 3PS9A 2P35A 2ZTHA 4A6DA 3E7PA 1G8SA 4Y2HA 3GJYA 3LECA 5FQOA 2AN3A 3P9NA 3T7TA 1NW3A 2B9EA 2H1RA 4C08A 3VYWA 4ISCA 3EPPA 3OFKA 1EAMA 2YQZA 1RJFA 1XVAA 2GS9A 3KPJA 3UJ6A 5KQSA 2P3OA 2OPBA 2PKWA 3A7EA 2AOUA 1JQ3A 4DF3A 4BP1A
chains in the Genus database with same CATH superfamily
3AYXB 4HEA1 3TIXB 2XCSB 3PQ2A 5A6SB 1XFAA 1CG6A 1P73A 2X8AA 4I9GA 4OHPA 4GPZA 3HWRA 1N5DA 1QH0A 1GY8A 4WECA 2NUAA 1LSUA 2X58A 3QHPA 2WOJA 3GG9A 4PFJA 2WT8A 2ZIWB 4KXUA 1CV2A 2OY0A 4EUFA 3ZZUA 1QIFA 3F6CA 4FYYA 3GFOA 2C42A 4B80A 3T7CA 1QTNA 1VI2A 2Z9BA 3R5KA 2QN6A 2W0SA 3KWJA 3V7FA 1J2RA 4BVAA 2B8EA 3SEZA 1MA0A 5K6RA 5CB8A 3O26A 1EX9A 3A9SA 3KKOA 1K7EB 3AF3A 2RIPA 3QSYA 3LVBA 3T95A 2F1RA 3IIEA 1KYIA 1ZH8A 2ZUWA 2R1VA 3KWFA 1NLUA 3QV1A 1SBIA 5CW1A 5LZ8A 1M6VA 4ASUD 1QZXA 2VKQA 5EXPA 1N0IA 2H1CA 4KKVA 3T4UA 4E2ZA 1H65A 1LUAA 3LKZA 2E9SA 5AK4A 3QPDA 5G3ZA 4DIBA 4CR7A 4CGYA 4PLYA 1C9DB 5DP1A 4CCYA 4PC1A 4BAZA 3GLIE 3HMKA 1LRJA 5AT1A 4CF4A 1B00A 4KR0A 5HM6A 1I7SB 3NRJA 1T8UA 3MFQA 2ZJ3A 5TF0A 1Z0DA 2OQ2A 2VLBA 1FS6A 1WCXA 2ZE8A 1N8TA 3HXQA 2FMUA 3H9GA 4EPXA 2DKNA 3I83A 4NBUA 721PA 1YHYA 3DCJA 1XAGA 1UFRA 1J2EA 3ONNA 4RXMA 3ZHUA 1B23P 4P3KA 2ECKA 3DS8A 4MQUA 1FDUA 5HP4A 2CDBA 3IEKA 1FB5A 4PPFA 5I01A 3LGSA 1D5CA 3H18A 2GEVA 2Y0EA 5EC8A 1SEPA 4PLGA 4MVJF 2A9FA 2JA1A 1DX4A 4QPDA 2W37A 3E48A 4S0ZA 5J2UF 2XUPA 4IH1A 2DB3A 2YNMC 4RKFA 4H7EA 2ZSFA 1EFCA 1M2OA 2QRNA 4I19A 3HJRA 4DW8A 3E9NA 1LJ8A 3U16A 3DZDA 3AEKA 3VYUB 3F2IA 4RDCA 4C9BA 3KCNA 4DDHA 5CVVA 1IIBA 1QG2A 1XEXA 2JBWA 4FX5A 3AL0C 3ANMA 2HMTA 2AOWA 1JG2A 1THGA 1E63A 1RXYA 3NHLA 4LDAA 1JVBA 2PX5A 3MTJA 5AJXA 3UGKA 4CLHA 2VCEA 3L6OO 1C0PA 4B34A 1PJRA 1ORWA 1M75A 2V55B 1EA7A 3QXGA 1KK3A 2GRJA 1TJ3A 5K2MA 1Q14A 4AU1A 4K0KB 4CN8A 10MHA 1DCTA 1LH0A 1XFDA 1OW3B 3WC4A 4YT8A 4ME6A 1Z56C 1W36C 1DQYA 4UDYX 4P80A 4C7MA 2RAFA 3HXMA 3BCUA 1YVUA 4HDSA 4CZ2A 1T2CA 3I39X 2AEFA 3RPEA 2XB2A 3ZBQA 1JAHA 4OBXA 4ZEVA 2P78A 5BWBA 4AIRA 5BOSA 4C0WA 5LQUA 1NN1A 5HGJA 1SC6A 3SCZA 4GR9A 5CDFE 1IEQA 4RD2A 4GC5A 1N6KA 4B4KA 3U13A 1NVTA 1LGYA 1AMOA 2GILA 2HPZA 3I8SA 1Y9AA 4ER0A 5AXCA 4KWHA 4EYKA 3P8ZA 4JL6A 1N5MA 5KNBH 3RIMA 3NT5A 3OAAD 3ZHYA 2CV2A 4FEGA 4FCCA 1I2AA 1DBSA 2BGUA 1BW9A 3MINA 2VRNA 3OUZA 3N7UA 9LDTA 2PX8A 3VUEA 4J7CA 1CUJA 1OX5A 2Z8YA 3I5MA 4J2HA 4LJ5A 5EVCA 1RDFA 2CE2X 2SHKA 4MKHA 3EVTA 1BFUA 1T5LA 3RUIA 1GPDG 2Q27A 3E5NA 1JEAA 3PE4A 4NBSA 1H93A 2IDKA 4K28A 2W98A 1BVUA 4L28A 2V4MA 1SK9A 3UHOA 2DWQA 1LQTA 3EFOB 4BL5A 5ENZA 4WESA 1Q1QA 1FFWA 4LC0A 4ZIRB 2H5JA 1X2EA 1RCTE 1M10A 2G4VA 1GGJA 3LSTA 3A6KA 4HDNB 4KODA 4U5QA 1C3XA 2ZU0C 1Z4PX 2IEBA 3JSAA 5ALRA 4DMLA 1NJSA 4JJFA 1A1SA 3M3PA 2GBLA 4F9FA 3SZOA 3IV9A 3PB3A 2HGZA 2BEKA 4DLRA 5AHRA 5I7VA 4QFDA 5JAUA 4FHEA 1Z2DA 2QN1A 4I4CA 4N01A 4Q00A 4NZOA 2JFZA 5IN4A 1QVRA 4NXMB 1UKEA 4J0KA 4PGAA 3CLSC 2EZ8A 5FOWA 3FBGA 5HA5A 4TN5A 4C76A 5BV7A 1VP9A 3OJOA 2WFAA 5C5EA 3UPUA 4CQNA 3FNQA 2ZSBA 3OWOA 1KZYC 2WWRA 3IUEA 5KEIA 5AM1A 1WF3A 3T9FA 3HUUA 3EMDA 4IJ6A 5B36A 2COUA 3CR3C 1ST3A 3OJLA 1PK9A 3F6BX 4RGBA 1BN7A 3ITNA 4MQEA 4PYOA 3PLAE 2P8JA 4BFCA 3OC0A 4QXAA 2HJSA 1PHRA 1MAHA 2NYVA 4JLNA 3CRRA 1O96A 2OV2A 3BMCA 2ONYA 3DMDA 3KEQA 3AB7A 1GILA 3P9QA 1OREA 3ZE9A 2PGXA 2XIJA 1MOPA 2HSGA 2WNSA 2ZPTX 2ORVA 3PJFA 1I3NA 1TE2A 5E6SB 5EY5B 4NG5A 2A2ZA 3MAGA 2AMFA 2OT3B 3CNEA 2DBRA 1E9SA 4LC9A 2O2YA 3QUQA 2VWHA 1V6SA 2QSJA 2PA0A 4PIPA 4I36A 4P4UA 5F2KA 1G21E 3QE4A 3L7CA 1ID8A 3MHPA 2NXWA 3BMQA 4GT1A 1KRXA 1KDOA 3KR1A 1KAQA 3MWFA 4ILEA 2HMSA 4HDRA 3AH8A 1XL1A 5GMOA 1FMCA 4IX9A 4XASA 1LWOA 1XPOA 1USGA 2P6UA 5A05A 1CUHA 4QUHA 4EY6A 3QE9Y 2OAQ1 4QOHA 4JT8A 1JE1A 3KLPX 3C6XA 4TQGA 2WFLB 1EM8A 1F2DA 1Z0ZA 2XSZD 2F1OA 2IOFA 3QY9A 4NX2A 4AMUA 1ZOOA 1NOIA 2E4XA 4HFJA 1CJMA 1P4AA 2FXIA 3KELA 4I1OA 4DJFC 2JIMA 1FFEA 1E7SA 4MVYA 2QVBA 3G8YA 3Q0TA 2HWKA 4W5WA 1D2NA 3R3UA 5M3BA 3KJIA 5FR1A 3DZ8A 3K9CA 1KZ1A 2FYTA 4F5DA 2JLZA 4FJ1A 1W6RA 2G17A 3PL5A 1EDBA 1XYGA 3FROA 3UJDA 1CEYA 3GAMA 4A2QA 2IUYA 3VR5H 4EW2A 4ZT6A 3EPKA 3EF3A 2ZTUA 4OMCA 1KK0A 4ZAWA 1E2IA 1DKOA 2BELA 3FFTA 3K6RA 4ZZ2A 3RVOA 1NKSA 4KWTA 2Q3JA 4BX2A 1R2QA 1QGAA 2R00C 4LHSA 5DW0A 3HL0A 3ETEA 2XDWA 4G9BA 4WW0A 1GPMA 2RHWA 4ITRC 4FDMA 2AL7A 2AVNA 2PQMA 3TAHA 2CXNA 5E3HA 1AQYA 3DMNA 4PLVA 1RJDA 5C9ZA 3FCYA 3G8BA 2P2SA 3G9QA 3IAS6 2C2ZA 4TRJA 5IBCA 4IG9A 2OXFA 1B8NA 1MJGA 1VLZA 4X6XA 3PA6A 1CB0A 4MV6A 4RHTA 5CVDA 4C87A 3ZHOA 5ARCA 3ZWYA 3IPCA 1HL7A 1C4KA 1Q0SA 2W11A 3SNHA 4FR0A 3PJEA 4ZO9A 3RS2A 4F71A 2VQFB 1OT3A 4LJRA 1KRHA 1CR4A 1QGDA 2YN2A 4P4LA 4WCFB 4B4VA 5IK2D 1E92A 3VC3A 2DEUA 3W6ZA 1OGYA 2D6FA 2LCFA 4P33A 3UJAA 1WU8A 1G5FA 3NHRA 5B55A 5HVNA 4LMRA 3A9TA 1NBOA 5AI4A 3ABRB 3O8BA 3PNBA 5DI9A 1RXUA 2UKDA 1SC9A 4X8MA 4BB5A 7REQA 5CIYA 3NHWA 5C1PA 4KP7A 1EFTA 1G18A 2DR3A 3TKAA 1JLKA 3ZWAA 4HDKA 2OZPA 2AX4A 3RHZA 3O0DA 4J75A 3WLFA 1VSVA 3Q2KA 3TCNA 4DCMA 3G9ZA 4KSYA 621PA 3TRDA 4F3CA 5KHLB 1U4OA 1Q95A 3AKZA 3OECA 5GIOE 1FX1A 1E7YA 2C9DA 1EXDA 1CP3A 1GN9A 2PFGA 2FMKA 3OQIA 2IZ1A 4IPTA 3KPUA 3PCTA 1DFHA 1G21B 3Q3GE 3IQXA 3EFHA 3C3BA 4OJYA 3QG5A 1RCUA 1TVKB 2DFDA 5FI0B 1HFKA 1L5YA 3AO0B 3RQSA 3NI2A 4EGSA 1P2DA 1KYQA 4HLNA 1R8SA 4ROSA 1ZJWA 2ZQZA 2NLOA 2JLBA 1SB8A 4NBTA 3UMSA 5A03A 1JAXA 3C4JA 2Q8PA 5DM1A 1L5FA 1X8XA 1ZM2A 2C0CA 2HIMA 3QVKA 5A3VA 3HEBA 1G3IA 4Q18A 5CP8A 1DMRA 4MW1A 5AKYA 1IZYA 4YRQA 3ZK8A 5EWJA 2SECE 5HBRA 3X43A 3LY9A 3QBJA 1G2PA 5AICA 3AW9A 1FX0A 3GQBA 3RSHA 3FKJA 5HIAA 1I7LA 4M8SA 3DV2A 5JNLA 2I6UA 3FA2A 2O5EA 3ZWXA 1M1NB 2O59A 2HXSA 3KLMX 3AYZB 1BGVA 3AQIA 1X8JA 3U4CA 4ND8A 2PZEA 3T3MB 3NTVA 5CCDA 2CXQA 2O19A 1VL2A 2ASVA 1EIWA 3RS8A 1MOSA 1MJFA 4YHHB 1HMYA 1TZ2A 1V7PC 5CVTA 5KTPA 2KWIA 2NN3C 1IULA 4Q9AA 2NTEA 4IV0A 3E1SA 5F3DA 2Z9DA 2LWIA 1A9XB 2RBGA 4FD2A 3FYCA 3GJ5A 1TW3A 4C0LA 4O08A 2WABA 3PC7A 4NZPA 3SC4A 4JSRA 2ZB2A 4B75A 5A7HA 4PQEA 1KTIA 3W34A 4DREA 3K4HA 1AXRA 4A8JA 1M0SA 1PJQA 4YJHA 5CW2A 3PZRA 1NMXA 1D04A 4HGPA 1UZMA 4Q3DA 1P2UA 1XJWA 5FJIA 5GGXA 3QGMA 3GA0A 1P8AA 1XDSA 5EINA 2Z4TA 2E4UA 2DFPA 3E15A 1YH3A 2OE2A 3TTYA 1SCNE 2G0TA 2ZJBA 3AZQA 2ZIEA 3HU5A 3PSAA 5K0CA 4PPGA 4RENA 1YA4A 2C59A 1OWLA 3D8BA 4LBYA 5IW8A 4JQOA 4U8GA 2IC5A 4RSHA 1LV8A 1DKQA 1Y80A 3NP7A 3ONDA 4MA0A 5BW8A 1Z5UA 5C3MA 4TYNA 4NJMA 5KWVA 3ZXXA 3RKSA 4KFUA 3H5IA 5KQRA 3OQIB 5EESA 5JH7A 3NC1C 4NE2A 2O3UA 5FI5A 1A0OA 3A1VA 3RYCA 1I4WA 4ZZIA 3OM8A 1FF9A 4OA8A 3CC8A 1BJTA 3EXAA 1THZA 1KAEA 1IZ8A 1U2PA 2OXEA 2YMMA 1JLRA 3BCHA 3CXUA 3ZW7A 1KDPA 2BEUB 2Q2NA 2PBLA 1G4AE 1YQ9A 3G8DA 3TXYA 1NX6A 3NH9A 3O7WA 1HL3A 2JGRA 4DCUA 1Q0ZA 1YWGO 1POXA 3L9WA 3O3MB 1HDXA 8ATCA 4D4IA 4YRBA 4AQ7A 4I99A 3NTQA 2OCGA 3TDMA 4O4HA 1IBMB 4C4RA 4QDKA 4DV0B 2OXRA 2VHWA 2AC2A 3VR1A 5L7WA 1SKYB 1YBHA 3ZU3A 4BFVA 3LYAA 1RI2A 3P2KA 3S1AB 4HUQB 4F6RA 4UTVA 2OV8A 4Q01A 1E2QA 1UFOA 3HJTA 1EWYA 1U9YA 2JAOA 3QU5A 1BD4A 4LGVA 4V3BA 3D02A 1IY2A 4JZKA 4G0OA 1BFDA 4UHFA 3OQOA 3I4LA 4N65A 4ZGGA 3RNLA 2X0KA 3QVVA 4MIEA 3LVFO 4UUPA 1CUXA 5G02A 4IH9A 1F8XA 3JR3A 4O4IF 3DKVA 4EHBA 1BE1A 1K9VF 3MRXA 4NFLA 2H59A 5ALXA 5JD4A 5TGTA 1X19A 2DPMA 3BTOA 1CUBA 4B7CA 3PFKA 3AFGA 4WKCA 1QIEA 5DTQA 2C83A 2EW2A 1C1XA 3HQ4O 4X95A 5JG7A 3PQ8A 4F8JA 4HZGA 1O7JA 3RFCA 3VVLA 5FD8A 4RDXA 4Y2YA 2UZ1B 1KR5A 4J4HA 4N7JA 4K9OA 1YJ5A 3UKJA 3EQ6A 3FOFC 2O5CA 1Q2UA 2FLVA 4H7DA 1W1WA 5E4YA 4JQSA 3RU2A 1R9NA 2G5PA 3GYGA 4RLHA 1OCEA 4KZPA 4LVCA 5DJ5A 5EPOA 4NPHA 2XCTB 1HYGA 3QVUA 1V6AA 2YIDA 3Q85A 1XRJA 3CO5A 3DFMA 4FCTA 4REMA 4PZZA 1ESCA 3OQVA 2NUAB 3ZX5A 5L3QB 1Q0LA 4GZLA 5FLYA 3F8WA 3T7TA 4BFYA 1GTRA 3KDPA 3LX8A 5JPIA 5AXBA 2XCIA 4F97A 2WKWA 4Y9TA 2CXOA 2Q62A 3BB3A 3STTA 4XYBA 1J09A 5JWRA 5KOIA 1XVAA 2FN8A 3OZIA 1UKCA 1TZCA 2EBHX 1L8QA 1US8A 3B2EA 2YIMA 3ZGNA 2ZRBA 2VLIA 1JU4A 4Y7DA 2ZVQX 1OBVA 1ZRHA 3GB9A 1GZ4A 4FYJA 4A26A 1LDBA 1YRQA 2QAIA 4N5IX 3RRXA 4CGZA 4EGJA 3RROA 1ZI8A 4OU4A 4Q16A 1ZM3A 4G41A 1KO1A 4PAMA 3EXG2 3IQWA 5ERGB 1LDMA 3F78A 1ZJZA 2H4WA 3EJWA 3KPVA 1N2OA 2NM0A 4FINA 3VH3A 3QTLA 5DPMA 5IUKC 1YZQA 2PY6A 1NONA 3EIQA 3TH5A 1QS0B 1ZY2A 2O0KA 3DL4A 3IVXA 1IPHA 3Q8XB 3TQCA 2XUFA 1R7RA 3LX4A 4XYLA 4TMYA 2C2YA 4LYEA 1BO6A 3HG7A 1Z4IA 2C92A 4BCDA 4FIDA 3T5CA 2QSYA 4ZZ0A 2DFLA 3OPYI 4FI3F 4U6SA 2ZBFA 3BD6A 1ARZA 5B5SA 5K6AC 1M54A 1XZBA 3X1ZA 1Z2PX 1JHDA 4CIVA 1RLJA 1PLKA 1V5EA 1P7CA 1LY1A 2FSVC 1GUFA 2Q9CA 1FQOA 4PZUA 4RD4A 4ZALA 2BHTA 1BDIA 1R0CA 2VP0A 1MDFA 4DQLA 2CLCX 1GNRA 3P97A 1VIYA 2YQ5A 4U00A 4UVIA 3U09A 3SF8A 2RAPA 3C15C 3OCUA 4QE3A 3GEDA 4H1WA 3FMOB 1CRQA 1SHZA 3FFBA 1BS2A 3T12A 4A4DA 4BATA 2ZQ5A 4YRSA 4IDEA 5KTOA 1GR0A 4R16A 3KR9A 4WOKA 3WZMA 2FN4A 4M6WA 4OUDA 4YRGA 1KKLA 4AUEA 1LPMA 1F17A 2DR2A 4IWYA 4RPKA 5IT9A 1RTTA 1KEKA 2Y76A 1OD6A 3B12A 3FAKA 3I28A 4IDPA 1ECGA 2YS6A 1GEGA 4BWGA 3ABQB 1QHNA 1TM4E 3U0VA 3TJMA 1ZJ5A 4WXMA 2BMDA 3BTVA 4WD3A 3C1UA 1HLFA 4CDNA 3KHTA 3KNZA 1S1CA 2NQTA 4S12A 4ZCMA 2RE8A 4TTQA 2WQ6A 3GW8A 5HK8A 1E1DA 3AL2A 1EHIA 1YONA 4FOLA 2GM9A 4WFQA 3U1TA 4FFSA 1QV6A 4GUDA 4XARA 4IDOA 1XQ6A 5DM60 4Z0TA 4JEMA 4J76A 4F1KA 1WWKA 1Q0QA 1C7QA 3IKTA 5JZBA 3NASA 5K5EA 1ADFA 4BY9E 4JVNA 3IV7A 5F7JA 1IM5A 3KLBA 4CQMD 4D96A 1XRLA 2VQDA 4W7HA 5EIEA 1TUIA 3OEED 3QHAA 4FJ2A 5ERXA 1ICEA 5KJEA 2RD2A 1YAHA 3UJNA 4W9RA 2WYIA 3MMSA 2AJLI 5HX7A 4F5ZA 1ISHA 4O2BB 4GKVA 4AWBA 1IQUA 1WW8A 3D4LA 4UTPA 4C1NA 2VDKB 3LWZA 3OKCA 4M0FA 4NQRA 4X6UA 4IF6A 4YBRA 5ALJA 4J7XA 1YQUA 3SFVA 1ZK1A 5H82A 1N25A 4HVAA 3G5MA 5KZMB 4DDMA 1ZLYA 4NOKA 4LMPA 1A8IA 1R4MB 4MQFB 5JZ9A 4L5BA 4B33A 3A3YA 4F2WA 2AZXA 3W06A 1WKCA 4TX1A 1ZONA 3KYDA 2V1UA 1BXGA 3OSZA 1MRSA 1BRTA 1N77A 1QRUA 3VOSA 4JX9A 1FQJA 1YRAA 3ET4A 4G0VA 1UC4B 2X86A 1E2EA 2GD6A 4BLUA 4HFRA 2A9VA 1AM4D 2K4MA 4TOIA 5EHGA 4PYNA 5COBA 1Y6RA 5K3OA 1L7XA 4YP1A 5ULLA 1JEEA 3B48A 4FFBB 4ND8B 4UE3S 1ZXXA 4YRPA 3JQPA 3U3XA 1MBZA 4UHCA 4N82A 3GPCA 1UEJA 2CC2A 1OYYA 4GAEA 2QJRA 3L1HA 1QYWA 5IAOA 4EHNA 1XB2A 3B9RA 1RRGA 2OECA 3OCZA 4R2IA 5CFNA 1Y4SA 1HDIA 3FTQA 3ONEA 4OHMA 2A5LA 5D01A 4MARA 2R3SA 2XODA 4U3JA 2XWPA 5JS2A 3FZNA 1KIFA 2O3SA 5BR1A 5CEFA 4RY0A 1MFZA 4PLZA 1ZBQA 4OOEA 3RIYA 1KE1A 4B43A 4S2EA 4EBFA 3Q6NA 1NSTA 2QW1A 1S2OA 5T8KC 3R75A 2CJFA 1Z6XA 3EDRA 4KQWA 2CVHA 3M3DA 1FXUA 1MUUA 5IYZF 4ZANA 4JQZA 4XGKA 1WQ3A 2FW7A 2QSZA 2XB6A 4MO9A 5F51A 5HKKA 4AS1A 4ZVNA 3BK1A 3M8KA 1RE1A 4RK5A 5LXTF 2PWAA 3ZDAA 3QW4B 4X20B 4OK6A 3VTAA 4EO7A 3ADKA 4F5EA 3BRCA 2JZCA 4S04A 2Q6IA 3HXOA 5FPTA 3MCUA 1CDDA 1JILA 3EGEA 2Q2QA 3DKKA 3GRPA 1WOYA 2G72A 1U1GA 2NU9B 4JMPA 2JHFA 1DWPA 2QM3A 1BDJA 3ND5A 1QOQB 3PQ6A 4OK3A 3HXLA 1MAAA 5B1EA 5IUNC 1Y1LA 5AW5A 3S27A 9ABPA 5JNRA 2IBSA 1CDOA 5CAEB 2F7SA 5EMHA 2BM0A 5JSZA 1F0NA 1QR2A 1Q11A 2PVSA 5B7GA 4L8FA 1P5HA 2QL5A 3UHFA 4PXAA 4G36A 3SEAA 4V39A 3EX7C 3CLRC 3UB4A 2A58A 1WL8A 5IJZA 2Z09A 3T3IA 3ZEAA 3PVCA 1GIAA 2WIFA 1YMVA 1RI1A 3GLHB 3MW8A 3GJTA 4WCFA 3WRXC 1KH2A 3H1TA 4MB2A 2A0YA 3ORFA 4P9NA 1ZJ6A 3WDSA 5CLJA 3B1FA 2F3QA 4Z51A 1FE8A 3U0BA 5HIKA 5JBIA 4DLLA 3VKFA 4AMGA 4ARSA 4TYWA 3A6ZA 1V4VA 3RT7A 4BLSA 3N2EA 1NXWA 3UOAB 1TT7A 2ONKA 2ZRHA 2OV4A 1C7FA 3EA0A 3C6QA 4K88A 1O1YA 2OA0A 1Z5VA 5THKA 3JAMA 1P7YA 4QXRA 2W6CX 4XQ0A 4GKAA 4ILKA 1JN0A 3OIYA 3QLJA 2HLDD 4L27A 2HRBA 5IC6A 5IS2A 2QYOA 5CT4A 1OI3A 1SIBE 1X7YB 1NBIA 4Z7OB 2H16A 5LWHA 1M72A 3WMGA 3L5KA 2IYOA 1PUXA 2BTQA 4QNNA 3E9RA 5AVRA 3COZA 5FF9A 4NEHB 1KH3A 2PUWA 4KRYA 4PC6A 4ARUA 3ZNQA 4KN6A 4KQGA 2B5OA 4QM7A 1K8YB 3N59A 3KOXA 1SHKA 1BXZA 2Q3BA 4G5GA 1GQFA 3SJUA 4ZFNA 3L7KA 1YFJA 2F90A 1ISGA 1NXSA 4J16A 2IDJA 4NBWA 4RWEA 4YFYA 3ZZ1A 2BY4A 4NULA 4UBLA 5EQTA 1HX7A 1ZMOA 4UNRA 3LHIA 4F3KA 1KJ9A 3H9UA 2FG6C 3MJDA 1J70A 4IOLA 3SHFA 1G8PA 3GT4A 4MLPA 4PO1A 3C6BA 2HZ7A 2XQVA 3LIIA 3U56A 4OQLA 3GPLA 5IEBA 3IMCA 4Y6GB 4JBLA 1DHTA 4EHFA 3PQ5A 5F21A 2V5VA 2RGNC 4PLWA 4YK7A 2IYRA 4E33A 4ZMSA 2Q9AA 3H9QA 2V6JA 3HHPA 2ZEJA 4RKRA 1YR8A 3M6VA 2XOKD 1QXSA 4IGAA 4DR1B 1KEZA 2WR8A 4L16A 4CM7A 4L9AA 4M54A 4M9CA 5DLYA 1TCUA 1N5IA 3BRSA 3HWX1 4TYYA 3D4OA 5C7YA 5NLLA 4JOCA 3BM5A 4WZBA 1J5EB 4Z0HO 3M70A 1M6VB 5JHHB 2Q1TA 2XUKA 3EXG1 3DO5A 3BJEA 5LDDC 1JDUA 3WWZA 3DTYA 3JZFA 5PGMA 2QUJA 1II9A 2WIGA 1AE1A 4LVNA 4YAJA 3R8XA 5JAHA 3TGPA 1A2KC 1P4HA 2WAAA 3EDYA 2J30A 3P45A 1A3CA 3INYA 4HK4A 4D9GA 1OX4A 1TX4B 2R8OA 3G59A 1RJGA 1BNCA 3DPIA 1L6IA 4MOWA 3FB4A 1YNOA 1MEJA 4O5AA 5CMLA 4QJ5A 5F3RA 3ZV3A 2PQ6A 2FPXA 3P52A 1PSZA 4PWZA 3ZCVA 3AHFA 5DBOA 1JBQA 5H0IA 4ERXA 1VL1A 2F8MA 1S3IA 5BNFA 4E32A 3COYA 2ADFA 3CU5A 1R10A 1W4ZA 3EVBA 4X24A 2OBMA 5D7BA 3QV2A 1QBKC 3AFNA 3EODA 3ED5A 1KP9A 3N2ZB 1SOWA 1TLLA 2VKTA 1XXHE 4QELA 2QUIA 1X42A 3IA2A 1SBTA 2PUFA 1G8AA 4DYDA 2IPXA 2OCAA 4FZVA 3GHYA 3GK3A 3EC7A 2UUOA 4QO7A 2FUNB 1O9GA 3MTEA 4TS9A 5GGYA 3AEKB 3WQHA 1YJXA 1WXEA 1Y34E 1XA4A 4UU8A 5FTKA 3OZAA 4BB9A 1NG9A 2VZEA 3I6ZA 2GWRA 2Y2UA 5L53A 2Y1GA 4UHBA 5I7OA 4EJ6A 3HNRA 3I73A 4AP9A 4Z7JA 3KB2A 3WISA 3G0HA 1D7OA 3DCYA 4WMLA 4LQ4A 3M6FA 3B6KA 3IL2A 3UT0A 2P9ZA 4FGKA 4J9UE 5FH9A 4FHCA 3GLIA 2GO7A 2XZOA 2O8FB 4R0VA 1CLUA 2ZJ6A 3HC7A 4TMWA 5K4HA 1ZN8A 2GM5A 4OG2A 4JWKA 2F9FA 2GSDA 2AMYA 1BROA 3EVNA 1KXJA 2WE8A 3CMMA 4KHZA 4UNNA 1Y4DE 4E08A 2C4UA 5EIOA 4QPZA 4BFLA 1NP6A 1BW9B 1DP4A 3MINB 2A88A 2EFHB 5J2TF 2XGSA 1FTYA 1E6UA 2GPSA 4R41A 1VIAA 4OIMA 4OCZA 4QIHA 2YVLA 1I2MA 4GRIA 2N0SA 3C5EA 4PAGA 5KWEA 4WN3A 2V7QA 5F23A 3ZCSA 3AEQA 2BVNA 4MAFA 5L3VA 2ZIGA 4AYXA 4GXRA 2W2LD 4YRJA 1XEWX 3ES9A 3FSJX 4F4IA 5DHSA 4NJEB 1B42A 5BW4A 1PU2A 4YCDA 4DILA 1P5ZB 4KH1A 4AWAA 3BQNB 1GEEA 1UCFA 1KAOA 4U7GA 1CX9B 4OXKA 5KTKA 4JT2A 1E4VA 3CEPB 2H85A 3E8SA 1DPGA 2OBFA 4FGJA 1YTUA 5IXJA 5IASA 4IF4A 4HQ0A 2H4FA 4KQCA 1D8AA 2GTIA 4QDJA 4TYQA 2J32A 4LGMA 4YP0A 4KN5A 4J3FA 4E31A 3BE8A 2PFKA 4P83A 2R62A 3OEWA 3WNCA 1OXBB 2YYZA 4O4IA 2ZJAA 4P5DA 5JZSA 8OHMA 2QRUA 4AY3A 4IZ6A 4GDFA 4M7RA 3Q9NA 4ZO4A 4R83A 4XIYA 2VQ3A 3MT0A 1JZSA 5TJHA 3P9CA 3R8FA 2O2JA 1QIDA 2OGWA 3KOMA 2CBGA 4DC1A 3GP8A 4JP2A 1VMEA 4P7KA 4DSAA 4QEZA 2E1PA 4HNAB 4NF2A 3EW9A 5FUBA 4O4JB 3TTUA 3W04A 2A9JA 1L5RA 2IHJA 2BRUA 5IKEA 2ID4A 2JAUA 2B4TO 4G0NA 4XCVA 4LK2A 4GYJA 3STYA 4MUKA 4GM4A 2ERXA 7ABPA 5IKPA 1FDRA 2DRIA 3JU3A 1N92A 4QECA 4U3JB 3V8VA 1JPUA 3OJWA 4KPEC 3I1YA 1VRCA 1MCZA 4JN6B 1ST2A 4GPTA 1ZIPA 4OL0A 5AUQA 3V8PA 4DM7A 5JROA 1RSZA 2ODEA 2O7SA 4MRPA 4RH3A 1LD3A 1KQNA 2P9EA 4N5LA 5EE9A 1JHMA 4HNUA 1CZNA 3C98A 4MVJD 1EMDA 2IIQA 4R98A 3THXB 2W6NA 1XXHB 2J9FB 1SU7A 3EZYA 1DIAA 2NSDA 2FMFA 4CI0B 1PWXA 3JASB 1H2BA 1I3OA 3X2EA 4J0DA 1LEHA 1HTWA 2YOFA 4KHPB 2W0MA 3IO3A 1I6LA 5J5VA 1M7BA 3DNPA 4X0EA 5KVQA 3VKUA 3ZCUA 1NUQA 4O1HA 2LIPA 2R84A 3HU2A 1WZCA 1WPRA 4JU9A 2VDMB 5FBWB 2RAVA 2C4NA 3FGZA 3LI2A 4KPGA 1NRWA 1Z3IX 4RLFA 1GRVA 3K2IA 1MO2A 2NUBA 2EFGA 2WHYA 1S4MA 1Z22A 3FPJA 1DSSG 3D54D 3JQ8A 2PLNA 3ZK7A 3WYEA 4L4XA 2HF9A 1GU7A 4RSMA 3IUPA 1P33A 1LVGA 2FMIA 1VE6A 1U7DA 3EFBA 2DR0A 4BX0A 3JQAB 2HY7A 2BIFA 3WWPA 1ECLA 5C2JB 3KE9A 4MVJE 1U0TA 1PD1A 5F2NA 1PS9A 5JCJA 3HSYA 3UK2A 1N2CB 2B4AA 1DAOA 2OFXA 2QL9A 4CUZA 1NTRA 1QWOA 2OCKA 1XCGB 3LT0A 4HPWA 4DFDA 4V1CI 2D3TA 5IH7A 1XHEA 3IEXA 5AK6A 1LW6E 3GJYA 2GPWA 4X3PA 5F35A 3PP8A 2VF2A 3IIJA 5LJIA 1KZGB 1DEXA 3F5DA 3L8FA 3AVXA 1IN8A 2WTNA 3L7OA 1HDCA 1YZLA 3FWZA 3R6LA 3WQBA 6REQA 1FXWF 1KETA 4HP8A 4R0MA 2N1BA 2R7NA 3CG4A 1JSRA 2ZRKA 3EQ9A 3SN6A 5DBFA 3ND6A 3QF4B 3JQGA 2ZIUB 4GYWA 4W6QA 2HB6A 3ETHA 1ZYUA 1I32A 1JPJA 1UJ5A 2GCOA 4OSPA 5FHRA 1JKJB 1KGDA 1P0FA 1Z74A 2C88A 2HSWA 2J6HA 1V8OA 2QDKA 4FFBA 2LV8A 3PHJA 4PSAA 1N32B 2WFZA 4EZBA 5JIBA 1KY5A 5E95A 1PS0A 4C0AC 2IGTA 4LBVA 4JT4A 3ZDDA 2IHBA 2AOTB 4PX2A 4TSRA 2NTVA 1G8HA 2EEPA 3EY4A 2H7CA 1C5KA 5SZKB 5E2AA 4EP1A 1F6WA 4HVLA 1O97C 3IUNA 5I51A 4FFDA 5KCZA 1T2FA 1KEVA 3AEXA 5LP6C 4CM8B 2MR5A 3ZD7A 2P67A 4DQ0A 3NX4A 4I14A 4J3NA 1CHDA 2GMWA 1EE9A 2LD4A 2CW5A 2GDJA 3QOYA 1V8DA 1WHSB 4HHEA 4M46A 2CMFA 2H4ZA 4PRKA 3TPZA 2WG0A 2DFTA 2R8PA 3F9RA 3RVDA 2VUSA 3GN1A 3SS8A 1W29A 4E2FA 3GVPA 2GAAA 3AK4A 2HBRA 1WCIA 1U9JA 3V5NA 1Z45A 3IP9A 3OU6A 2DE0X 1ZNYA 2HPAA 3LBAA 4CM6A 4OHRA 2WIDA 1F5SA 3CUWA 5ALYA 5G40A 2QI9C 3QA3E 4MH0R 2VTEA 1U4SA 5DFAA 2NO1A 4HLDA 4KXVA 3G13A 5AI5A 3N5KA 2QN7A 4KH0A 1QRRA 3DZKA 4LYAA 3WQRA 3ZJYA 4DJDC 4WFIA 3ZLUA 3PX7A 4RVUA 1P61B 4BO8A 3CPEA 2QAJA 1JECA 2HK9A 3OTWA 5K6AA 5JMPA 5GV8A 1JALA 4CEIB 1QWSA 3VR5D 2Y0PA 3NGXA 4J1QA 1JTFA 3K6KA 5BWLA 5I6DA 2AXPA 4WLOA 5AOBA 1O94A 2VZ9A 5DEOA 4D0GA 3O4FA 2MYNA 2QU8A 2CWWA 5LNK1 5FBHA 1NYTA 1L4UA 1TGYA 2XE8A 4FHGA 4XD7A 5WRFA 2R1TB 4NG4A 5DB4A 2RGDA 4M1QA 1U9IA 4LG1A 3W3ZB 5KBYA 1XZHA 5MGNA 4TSFD 1IWPB 2BUBA 2FRVA 4JAVC 4MWCA 2J85A 3FMPB 1L7MA 2Q3MA 1XGKA 4FMDB 3UAGA 1OZ0A 3QXJA 4FMCB 4UOZA 2FRDA 4JGGA 4FFWA 1XZEA 1S8AA 2MTBA 2IYLD 2ZWMA 4HY3A 4NQZA 4E7OA 5JNVA 1N9GA 2JD0A 4I6EA 5TNXA 2D8MA 2I67A 2AC7A 2HJHA 4HQFA 3ZVMA 2OYCA 3R74A 3W5AA 1H4VB 1RRVA 5C51B 4MKGA 3V4SA 1W0JA 3GUCA 4EG7A 1Z0AA 2WWWA 4BWFB 4FBMA 2B6NA 4Y2QA 2QUHA 1QO7A 4PZLA 4FYKA 4CKWB 4PR0A 4RIGA 1QAOA 5A4KA 4HI0E 4ISBA 1KQPA 1PI3A 1YB2A 1RBYA 1VKHA 1NR7A 3CT6A 3TPFA 4XD2A 2PMCA 3U7RA 1I2BA 1DBIA 2RHDA 1MHTA 1EWQA 1O6CA 3HA3A 5C46F 2WEKA 4AKIA 1RM5A 1EFUA 3ZS9A 4B32A 5HMLA 1G291 3C41J 4QD3A 1ZD8A 2GTHA 2YDYA 1RHMA 3RO7A 2P65A 5A62A 1N75A 1Z0UA 5KOJA 2XNJA 1KAMA 2R85A 4ZHQA 2XOKA 3SZLA 1MOZA 1QG6A 4BFSA 3DVQX 1JIXA 2WW8A 5LB2A 1JNXX 5IEJA 1YDGA 4KQXA 5LM3A 3GLHE 4IV8A 1RPTA 1P18A 2GI4A 4YMSA 4CCSA 4WTOA 4ATNA 4AVYA 2J33A 2UXDB 1Y5MA 3HRKA 4E5NA 1FS4A 2R60A 1I4LD 2RCYA 3KOWA 3M2TA 4BCBA 2PE5A 1IOZA 2P77A 2JLRA 1PLJA 4HB4A 5DX1A 5KNBA 2R7KA 4OLAA 1E2GA 4LIPD 2RHJA 5LA6A 4F04A 1PR3A 4JC0A 1L4GA 4X3OA 4DCGA 2Q5QA 4BMVA 4WLVA 1MGOA 1L4NA 2ZUDA 3O8QA 1K7CA 3FGPA 3TE6A 4AG6A 4MPPA 3F90A 3WZLA 1PFKA 3FYDA 4AB1A 5BY2A 3FNFA 2EYQA 2ID7A 3DOUA 2QA5A 3A6JA 2R4UA 4Y9DA 4CMBA 2AFHA 4BV3A 4I5FA 1XVIA 2JGDB 1UBMS 1IU9A 1GGEA 1UINA 5C8ZA 2NVWA 3L84A 5KUTA 1UADA 3AI3A 3HXTA 3FH0A 221PA 1U9IC 3AF1A 1MORA 1WLSA 1U0LA 3A6GA 4TKZA 3QX7A 1PZGA 2HV8A 4KDRA 4EL5A 1SOUA 5I7SA 3KD3A 1D2CA 5J47A 1TM2A 3ELWA 5IAGA 1W93A 4OYRA 3V34A 1HK7A 1KMNA 2BLLA 3OJXA 2TYSB 3H4IA 5KHOC 3HUTA 2G36A 4U0KA 2YUTA 2WE7A 3LUBA 3WQQA 3J7AC 1OXMA 2H2GA 2PRYA 1NBAA 2Y0CA 3BMQB 3G6KA 2ZXUA 3FOEC 1JAYA 3OZWA 1EESA 2XE4A 5ENVA 3RAPR 5I8WA 4BQPA 3KFVA 4DCOA 2AHRA 2G8NA 3E05A 3IMGA 2EL9A 2GRAA 3L1VA 2GM3A 1XCMA 1IG3A 4X8LA 4BV9A 1FSGA 4BFXA 4ENPA 1BVHA 2NYAA 2EL7A 5IF3A 1E2BA 3V4LA 1CC1S 4J8PA 4NLLA 1CZRA 1FMTA 1FMLA 2E49A 3E0QA 3I01M 4MI3A 5FKJA 4F45A 4I5GA 2ADOA 1NKVA 8LDHA 2J9XB 1JXMA 2BZ0A 1XQ1A 1AHNA 1J42A 1N1GA 1OI7A 2PAFA 2VJYA 2EVWX 4XIGS 3L04A 4ARBA 3CNLA 4S1OA 2N42A 1P5JA 1A88A 5GJVC 3RVRA 1C3OA 4Z7NB 1P74A 3IAFA 3MILA 3B60A 2V7UA 5FNVF 2CFOA 2CJWB 5AM5A 3TIFA 3U7HB 4CIXA 5AUNB 3K70D 5K0GA 1OGIA 4KX5A 4JI2B 4RAOA 4BAUA 3K2EA 2VT3A 3FOBA 2FMHA 5EIWA 1BCSA 2XT6A 4JVOA 3VU0A 2XHEA 3DAFA 4Z5XA 3FPBA 1HQCA 4KGDA 1O95D 3CZ9A 2WICA 2X5OA 3EG5A 1QF7A 4P2BA 5BN5B 3X44A 1E32A 1KQOA 1SH7A 1K75A 1OXSC 4R81A 1KOLA 4C0XA 4DAEA 2NU6B 5AW7A 1Y8CA 1XAHA 3MGAA 4N4AA 3S8EA 3SR0A 3OZ7A 2VHTA 3G6WA 4UULA 1TF5A 3CGGA 1ESZA 3KTDA 2VATA 4ZWNA 1XD8A 2XCUA 2OD7A 2BKUA 2Y3IA 3OPQA 4HX2A 4ZOLA 3E22B 5IJXA 4D9NA 2CBXA 3ZDRA 5KTTA 1FYEA 3FPGA 5EJ9A 2FJ0A 5JPDA 1BTOA 1QGOA 3TD6A 3CPSA 1BQ4A 2QG4A 2E21A 4S1NA 4GU5A 4D7AA 2GCGA 2XE6A 2XMPA 3AL3A 1LU9A 3OIFA 1O5IA 2WZBA 2P4SA 4INJA 5DYNA 3PA8A 5I9IA 3D6UA 3EASA 3HEAA 3ILXA 1A7AA 1Z88A 4RFVA 1F5NA 1FPMA 1DQZA 3CR8A 4IGKA 4JC4A 4JC8A 3IXMA 3GUZA 3BD8A 3D8TA 4R2JA 4MYDA 5BQPA 4B2IA 4EYOA 4OMUA 5CLFA 3NNNA 3C24A 1G5TA 2ID9A 3IKJA 3O8LA 2DVMA 2QVYX 1E3QA 4LSZA 4A36A 3IC5A 4UE2A 4UU0A 3H42B 2VI5A 2Y67A 4P4SB 2R8YA 1K7YA 2J3DA 1JHAA 3RFFA 4GOKA 3UAWA 4MVJH 5ER6A 4IHJA 3SKYA 4F11A 2FPUA 4QDUA 4JFAA 2P2LA 4BKMA 3S3TA 4MVJA 4GVXA 4GBMA 3TSOA 1E89A 3NBXX 3BFKA 1ZL0A 2AW5A 4CT0A 5K3CA 5HK9A 3UXYA 2DUMA 1QRAA 3G2QA 4MUXA 3PEVA 4E4TA 4B3JA 4E5VA 1R6XA 1RLTA 4U7DA 1F14A 1PHPA 1ISFA 1Y37A 3OCYA 3KZVA 1YVEI 4J1TC 4PANA 4ZJPA 4U2EA 2ZYRA 1I7NA 3B13B 3FWKA 4CHTA 3UT5A 3BXZA 3QEJA 3G1UA 3ORRA 4ER7A 2IZ5A 3E2MA 1Q91A 3KSUA 1HT3A 4PQFA 4CTKA 4F4CA 2WF8A 2YY7A 3MWYW 3OLXA 1ACJA 1MB0A 3CISA 5DGTA 4C0BA 4CPDA 4G1UC 1OJLA 2QMYA 4D3ZA 1T10A 1RQRA 1KFKB 3AP3A 3KZCA 2PKYX 4Y3UA 2B61A 5JSYA 4B8WA 4GSLA 2Z2JA 3JTEA 4D9KA 4BO1A 5C8YB 4WUTA 4JNCA 4FK8A 3R2JA 2L19A 1WCWA 2F1IA 5HPYB 4DB2A 4MYSA 1CUCA 1R8YA 2C1ZA 2MINB 1EU1A 1UZNA 2CLHB 3Q87B 4MWZA 4CMIA 4FLEA 4KMOA 4JLJA 3DT6A 4UBMA 1EM6A 3T0IA 1KS9A 4N0MA 1X1AA 1BE6A 3BH6A 3PDUA 1H05A 1KNQA 4OXQA 4JQYA 4GXQA 4XJVA 5FADA 1GV1A 1XZNA 1RWNA 3HA5A 4G81A 3J81A 3KCQA 3JR7A 4PF1A 1QR6A 3URKA 1E60A 3EMBA 1EVIA 5JU6A 2E1RA 2KMLA 2ZAOA 2D54A 4R51A 4Q15A 4M88A 1A9QA 2CXXA 3EVCA 1X1RA 4DSTA 5AVOA 3V8RA 1UM8A 4OYHA 4CCYB 1G59A 4R84A 1AGYA 2C20A 1YCHA 1TMGE 3AVYA 4KR6A 5BSMA 1HLPA 3KUCA 4KIUA 2X76A 1Q6YA 2IS2A 1P3DA 1JJVA 1OASA 4X71A 4AK9A 2Q4RA 1EK0A 4H17A 2DPXA 3FLEA 2O3JA 1V8PA 3EQZA 3FCEA 1JU3A 2WSSA 1C3LA 3IOEA 4MKRA 5FULA 3S40A 4DPKA 2C9YA 1VA4A 3R5FA 4KE6A 2XF2A 4RKYA 4DPLA 2FDRA 3DLTA 1ODJA 3N7AA 5JC8A 4R2XA 3EPLA 1H8EA 2HOQA 3BVPA 2X23A 1NY6A 1Y4AE 2CV0A 1O03A 5FWAA 2EXXA 2HC9A 3RYTC 4EKNB 1BXRA 2GYVA 2QN2A 1PFQA 1TMKA 4AW9A 4B8ZA 1O0BA 3CEJA 1X7DA 3HFGA 1YD7A 2ATEA 2XZLA 4GYKA 2HMVA 4BC1A 1NQWA 1L5HA 4Z4HA 1Z6ZA 3F6SA 4C4SA 5IJWA 1LBTA 1Z0KA 1U8FO 2EBWA 2G40A 3JWIA 4IRMA 2GJAA 3BTSA 2R6HA 4JC5A 2C1EA 3QNMA 4QRIA 4WJKB 1Z4OA 2J08A 2J3IA 2QBYA 1G3QA 2XUJA 5CR9A 3RWOA 2XHZA 3DTTA 1VIMA 1L4MA 4Z1OA 5KQPA 1R0LA 4K05A 3FCCA 3RF6A 2YFKA 3ESXA 5I4IA 2WWYA 4ML3A 4M2LA 1L7EA 1T8WA 4UFNA 2WVGA 2GQ0A 4NR0A 5K3FA 2XE7A 1AUQA 2AFRA 3F3KA 1AG9A 1J99A 1WXXA 4V02A 1SZPA 2FW6A 1CLEA 1IEVA 4PU0A 4OQYA 2FPIA 3BWCA 3DXYA 3AR3A 5EN4A 2MSWA 4HB0A 5CLLA 3WWDA 4WJLA 5EJ5A 5MDHA 4ESEA 3TWOA 4EMSA 3V8NA 1QLHA 1KP2A 1NN5A 1P8JA 1Q3KA 2X4GA 3MELA 2W2KA 3T41A 4ZQIA 1PR0A 3BAFA 2VNHA 4HAIA 4PG5A 2GA8A 2ZBQA 3HKDB 1PFWA 1DDIA 1Q83A 1T35A 2CBZA 2ZYSA 4EF5A 1V16A 2GUWA 2CUKA 1Z16A 3DPSA 2BI8A 1KU0A 4C6TA 5AW8A 4PZPA 1GITA 2MOKA 2ZS9A 4WERA 1KK1A 2BFDA 5AYVA 2FX2A 4UNSA 5B2ZA 3R09A 3QU9A 2X4IA 1EVKA 4YB8A 1OLXA 4HYEA 5G41A 4LZLA 2PMBA 4BQQA 4N47A 2WV9A 4CEJB 5EKUA 1TFUA 5CLHA 5IDYA 2G88A 2RONA 3IAEA 2NU8B 1CQXA 2O2IA 1X8KA 3MIIA 3GGPA 4MTCA 1L5GB 4JI3B 5IG2A 3T9CA 3U3MA 4K8RB 3WLSA 4L15A 3E3NA 1ENZA 2QORA 1CF2O 1M2WA 3QG1A 4LY3A 2Y1XA 4AY2A 1ODTC 3TR6A 4WLNA 1W2HA 4HXFB 1KJQA 4ZVSA 3I4FA 1GPLA 3HFJA 3BERA 4L76A 3KU4A 4UHJA 4D2IA 4PPQA 4FEEA 3EMVA 2CV1A 4OEHA 2BGMA 2W9XA 1IRIA 1X2BA 5KYWA 5DHUA 1QTIA 1S96A 4RDHA 2GARA 1FP7A 4CNQA 2MINA 5LBTA 3L6BA 4OGKA 3LKVA 3EVGA 3K09C 3LPLA 1UK8A 5K05A 4MDEA 4Z9BA 2JCGA 4MV4A 1XMPA 4R8VA 1WB9A 1GKUB 3S5JA 4DJ5X 2X1VA 1D1SA 2W22A 3QVXA 4HWRA 4LYGA 4NJOA 3DV9A 3SM9A 4NZMA 2A5GA 4IIJB 1OV6A 3TOVA 1JT2A 5TV2A 1YBAA 2J0UA 1DINA 4DTIA 3REQB 3HB1A 4BJ1A 3VYWA 5B3LA 2VRCA 4FDTA 3FX2A 2ZRLA 1UM9A 2A0XA 3TD2A 5KQSA 3KPJA 4NECA 4RTRA 4GPEA 4C4PA 4NABA 2IPNA 1TO6A 2Q99A 1K5HA 4PZ9A 5ILGA 4F60A 5LD2C 4R2KA 1GXSA 3QUCA 4BN4A 1P9NA 3R7AA 2DHRA 4Y1GA 1W35A 2GHRA 1C2TA 2OOKA 3OESA 3OY7A 5K51A 4EVRA 1FNDA 3VR4D 4I08A 4TXNA 2VHYA 5MF6A 2G83A 2IKQA 4GWGA 1R66A 3RJMA 2G25A 3F0TA 1FTNA 4F6RB 4E1BA 1T9AA 1NUUA 2GUGA 3H5TA 4QEKA 4IXDA 1E96A 2ECFA 1YCGA 3NTXA 3P2OA 4AICA 1IUOA 4DNOA 5TQ0A 2YXBA 3WGHA 3W77A 3OEEA 5FO1A 4JYAB 1VCOA 1WP9A 1QHSA 2HQRA 2ISSD 3VNRA 4HGNA 1EKXA 4OBWA 4DSZA 1OYOA 1K06A 5U9CA 3A31A 2GBGA 1PT5A 2G06A 3C5HA 5AVXA 2FETA 1ZGAA 2JLUA 4Z4IA 1TAUA 4XWAA 3BWEA 4D4LA 4NOJA 1LBIA 3KVRA 2MSEB 1EZ4A 3TUJC 4WBSA 3IVAA 4P5PA 5C32A 1STOA 5H16A 4YROA 5JQWA 1A7KA 1PGNA 1A98A 3IBFA 3P9KA 4MQMA 2HX1A 4PRYA 2BSXA 4DDVA 5DHQA 1HNNA 1T6XA 4MUMA 1OBFO 4WK0B 4RADA 4NJMB 5EQDA 4D80A 4Z6KA 5KC9A 2W58A 4N3CA 5BQOA 4B71A 1H6BA 5LUAA 2JVKA 4ITVA 3HE3A 5AH0A 5INTA 2JIZA 1HA3A 5JR3A 5UKDA 2H57A 4G8JA 4B09A 1S2MA 2V59A 121PA 4IFBA 1UXKA 5M34A 5CURA 1XMVA 2I33A 3D8HA 2I6SA 4CN9A 4DBZA 2VTBB 2YV4A 3Q8LA 3RIHA 3IT3A 2JGJA 1LV7A 3QPWA 3EXFB 1T1EA 1JLLA 2XBUA 1J8YF 3HCFA 4AZ0A 1LPNA 2JGDA 2IEGA 5DTJA 1PFUA 1RNLA 1BEEA 2PUTA 4G37A 3V7WA 3ORYA 1EWKA 1WBJB 1ZM9A 5ETJA 2V8OA 5AKHA 2IP1A 4QU9A 3WJ2A 2WVHA 5L4LA 3U7FB 1SD1A 2O1EA 3GU3A 1QV7A 5DCUA 5AKJA 4RM2A 1ADGA 2NG1A 2C84A 1RHUA 1RQPA 1J06A 1W2GA 5KKCA 1JG6A 1UK7A 2HTFA 1B2LA 4LQCA 3TNDA 1KFEB 1ZEJA 1DLIA 3FLMA 3NHBA 4XYGA 3NEYA 4U7JA 3A14A 5DX8A 2Z8YM 4KW7A 4YA6A 3VU3A 2DUWA 3FETA 4KRXA 4LAFA 3RTDA 4C7JA 2ZS8A 3EMKA 4CQMB 4LC1A 2E4WA 1PJCA 3EN0A 1GG8A 1LI7A 2C97A 2WJGA 1NMQA 2XPCA 3G5TA 3GR6A 4KO4S 4UATA 5ITVA 4G65A 1SRQA 5A0TA 3N1UA 2AHOA 5HXAA 1L5ZA 1J90A 2Q3HA 4KLCA 4N8EA 5EJAA 4ZYZA 1L8AA 1XX6A 4X92A 2WSBA 5F4ZA 3L4EA 4P1ZA 1WV1A 1Y7IA 2GXQA 2QD2A 5JCOA 2QT9A 5LOVF 3F7OA 1AQJA 1TQ2A 4MIOA 4BMCA 3R40A 3IEMA 1IK4A 1S5PA 3H3FA 4N0PA 5A7FA 3K0AB 2TMYA 3INGA 1QHGA 1A69A 3UTDA 3FSGD 1XLUA 2GZ3A 4PSCA 3W1WA 2DY1A 2R44A 3LP8A 4FZ5A 2ZJYA 1XZJA 1ZQ9A 1S9DA 1R6DA 1JF8A 4L0QA 3E9DA 1VKRA 3NO4A 2VF4X 3UW1A 3J81k 1EFHA 1TDJA 1UBSB 4AKTA 4D9MA 5I9NA 3EPHA 2ZFUA 1KC3A 2EZ9A 2C96A 4JLMA 5LL6P 3OBBA 5JXJA 2NSJA 5F5NA 4NESA 1B0AA 1QUFA 4M9ZA 2Q5OA 2ZAYA 4H27A 4X00A 3IUSA 1ZUNA 3DEZA 1QZTA 4FD3A 3A1FA 3NTUA 1FU7A 4KPUA 1RABA 4Q7LA 4F9GA 2B0JA 2IUTA 3TJZA 1NXXA 4S0XA 5YASA 2FI1A 3GBSA 3PT5A 1SUSA 4HDMB 2WJIA 2ZI9A 4BWYA 3T1NA 2AS0A 1RXCA 2X2EA 1FNMA 5A6SA 4J03A 2JH3A 2P1DA 4LBZA 3KJGA 1MB4A 1ML4A 2CLSA 2VZ0A 4XUGB 4EI2A 1R15A 3AF4A 4CIWA 3NJ4A 3HCEA 1MLDA 3L4KA 1ZUIA 5AW2A 4LJLA 3TW4A 3WO1A 3OM9A 1RACA 4Q37A 4WBNF 1TVKA 4XDYA 4ZCRA 1H94A 4CUJA 4HB2A 1DTEA 2XKBA 2XKAA 3CSDA 1TKRA 4N9WA 5EQJB 1EWRA 2D2XA 4IDDA 1ORHA 2GNAA 4PBSA 3RIGA 3V1TC 2FW1A 1Y5IA 1QKKA 4QAQA 3BMOA 1ORTA 3K2QA 4FC6A 1TL7C 2FKAA 2JFPA 1WUKS 2E87A 1ECPA 2RCNA 3CV3A 3JATA 2F2TA 4MW7A 4UUMA 2O7QA 2FZ5A 1NN0A 3N53A 2FGKA 2O20A 2P91A 1XWFA 3H5WA 4ZYUA 5K20A 5KOHA 1ZGHA 2HCFA 2HQ1A 3FMIA 4JQCA 4F4UA 3CF4G 5KO2A 3BSYA 4F5YA 2J3LA 1PL8A 3IAXA 3HL4A 4PCLA 2XD9A 3FKQA 3K8OE 4UTRA 3UJHA 1Y6JA 4BE9A 5LLSA 1BKSB 5JS7A 4B3SB 1LNZA 2J6BA 5AM4A 2EJUA 2WJ4A 4YRKA 2IZOA 1S3SA 2OSBA 5AMXA 2K87A 4WZAB 4K3UA 2W70A 3VUFA 5KINB 5KREA 5HQJA 2BE9A 4KNWA 4D9JA 1RFGE 3QFFA 1DXHA 2H4YA 4I81A 3AOGA 3TAUA 2EW8A 5SZIA 4P3NA 2KPOA 1P45A 1S8FA 6REQB 2XMGA 2PZAA 2V54A 4O4LB 3MIZA 1A71A 2CFTA 1ONSA 1ABFA 1V8ZA 2Y77A 1XAJA 1A5SB 1NN3A 2GZ1A 3ND8A 5BORA 1XF1A 3QNWA 4ZVVA 1QLJA 1MPTA 3UZUA 1H3FA 4UEQA 5A0VA 1BMFD 4Q4AA 4R31A 1XCPA 4KOAA 1ZHOA 3T9DA 2ZTMA 2ZJOA 4KYVA 3TBFA 3U4DA 4GEGA 1X1DA 3O47A 3RYCB 1GDTA 4RZHA 3AUTA 4OB8A 7YASA 3AHDA 4BNKA 2V7WA 4L5JA 2H63A 2AXEA 2M2IA 3M5PA 5KVVA 1YUNA 4NAVA 4CIYA 1ECBA 3Q10A 2RHLA 3R7NA 1VPVA 1TPYA 3WOVA 3TG2A 5A9RA 1ODSA 1ZD1A 4DABA 3O8OA 4HX9A 2AUTA 1V35A 2YCBA 1OV4A 4UAJA 4B5LA 4L78A 1OBOA 1RRPA 1DXQA 2FMXA 6ADHA 2Z95A 4P0PB 4QM6A 1IN1A 1LA2A 3AKEA 1XIVA 3VNAA 5L6MB 5IWAB 5CG2A 4E12A 1AGRA 2VDWA 3EIXA 3BYZA 1Y8QB 5HE9A 1P0QA 1JHRA 1YXMA 2YJNA 1T1SA 2JW5A 4CU5A 2Y9MB 4W5OA 3RVQA 3HYTA 3ZV7A 5KNDD 4OHBA 4UM9D 4FWIB 4HDAA 2X9GA 3VOBA 2PSFA 3LO8A 3KT8A 2OPHA 1RP1A 4MR9A 3LTEA 2BEWA 3WP0A 1WSBA 2HBQA 3CUYA 2CXTA 3ILSA 5TMBA 4JUFA 4RL4A 1LBHA 1TK9A 3C5VA 4GZ5A 4I1YA 4M0UA 4IMJB 3UA4A 5BNIA 2DKOA 4M87A 1JLSA 1UJMA 3QIAA 1M8KA 3OZCA 4D25A 2OWEA 4FB4A 1UANA 3FNGA 2CHFA 2B82A 4GKJB 1E0AA 5AVQA 1V1MB 1II8A 1MT3A 1YV9A 2P9YA 1AGXA 2RMKA 2DSTA 4OREX 3UWSA 1OOEA 3VYSB 4RD3A 5HSGA 4A0RA 2J5KA 3AV3A 4R1TA 2H00A 2OK8A 5ARBA 1PP4A 4RTLA 4OXXA 2QRZA 3QELA 4G6ZA 2ZYUX 1UZUA 3CZ4A 3ZE6A 5AW4A 3ZVNA 3PC8A 4UFPA 2BH2A 3ADDA 3LC7O 1KA9H 4PN3A 3LQFA 3G7UA 3IRUA 4HXYA 2I1WA 2LCIA 3IO5A 3RDPA 1TVMA 1YZYA 3CA8A 3I09A 2J9GA 3PNMA 3B6JA 2QB5A 3DDNA 2D0DA 3ELUA 4JJ6A 3W2GA 4FONA 3DQPA 5LCXA 1AURA 2IH4A 2ZJ4A 1DRKA 3VZRA 5CA1F 4UBKA 3RRBA 1X13A 4MPJA 4E6PA 5BOVA 3WGKA 1YE3A 2OO7A 3AM3A 5JVDA 2EQBA 4RK7A 4XVRA 5CD9A 1SXJC 2ONJA 2ZRNA 1U7ZA 2QTHA 4CKCA 1CUEA 2BSAA 2EX1A 1SA0A 2CJPA 2LE0A 3IJRA 4HRYA 4IIUA 4UJ3A 5DMHA 2PV7A 1RHQA 3NDPA 5E1DA 3FYUC 3U37A 4FYIA 3LFTA 1JI0A 3SQDA 3A32A 3JD2A 4WXYB 5F77A 1GZ5A 1K0FA 2PN1A 4RKQA 4CKZA 1G17A 1ZG3A 3E84A 3F6EX 1CQJA 2O05A 3FPHA 3QVLA 4K9NA 1EG7A 5BUCA 2A33A 1UK6A 3GT0A 2X14A 4KXNA 4EPWA 1M6YA 2JANA 3LRPA 4IMIB 1XA0A 1P1CA 1JQAA 2FEAA 4WESB 2QQ5A 3SBEA 3JXEA 3I58A 5C5DA 3QYJA 4QYXA 4PAQA 4W1QA 4PGHA 1PR6A 2PMEA 3WLRA 2B2XA 1GL9B 1HSZA 1MB9A 1X1SA 4P81A 4PNZA 1H2WA 4UASA 4X85A 5T41A 4LMBA 5T5QA 4AY4A 4YNBA 1ZK4A 1B6SA 2ZUUA 4F92B 5JSQA 2XYPA 4DZTA 1TZKA 4K1LA 1SKAA 3IS3A 3OF5A 3EULA 1FLVA 4MQ6A 1UXOA 4QTYA 2O8CB 1X39A 2G9NA 4DA8A 4BMYA 4XQEA 3QBVA 1PDVA 1AOXA 2QNIA 3GAAA 3O90A 4XFKA 5EPUA 2VH1A 3BN3A 2XYGA 1AHHA 1MX9A 2Z83A 2Q5EA 4AS3A 3D9QX 2IYVA 2QP9X 2R8XA 4PICA 1PEDA 2X0NA 4E46A 1S2DA 1ND5A 5EA2A 5TVGA 4UFOA 1OT5A 2HM7A 4ZEXA 1O4VA 1JHYA 1RYYA 3CVJA 1L8XA 3FI9A 3U44B 3HY4A 3IR6A 1E4EA 1T5HX 5CBPA 4OL9A 3NEPX 3LUFA 5BRJA 4H0CA 4JA0A 1C7IA 1XEFA 1NVFA 2BUAA 4JLBA 4P84A 4JVMA 1L8LA 5EFOA 4E5KA 4QBTA 4JJGA 1EUCA 2NO5A 5BNZA 3GXBA 3WE7A 5CDGA 1NM5A 2XUGA 4IHJF 4TSFA 2JD2A 5E1MA 1Y3DE 1WKVA 1B8UA 5LZ4A 1UMBA 1HRDA 2I2FA 3KDAA 1V8BA 5IVPA 3ICEA 1VXOA 3FUVA 2J6IA 4HDOB 4Q4LA 5IH3A 4A3SA 1L6RA 1C7RA 3GNLA 3PX2A 4UDOA 4Y2PA 4PYQA 4UARA 5CJJA 3F2VA 4B9EA 2RK3A 2OO5C 2ZPAA 1V2GA 2VUTA 3A2NA 3AR7A 3GDOA 3IVRA 3M4YA 4HH3C 1HGXA 3AXSA 4G0QA 5EWLB 4DMUB 3PUXA 4FEYA 2AWOA 4QYWA 4JGBA 4C2AA 2FQ1A 1LDGA 1XTJA 3BAZA 3SLGA 3SIWA 4AFNA 4NZ9A 2W4IA 1E1KA 1K9SA 3E8XA 5DRTA 3ZI7A 1O9BA 2GAJA 4A82A 3ZVRA 2NZJA 1HE8B 2IV7A 2NPIA 1F8YA 4IGFA 2WUGA 1T9BA 2CVQA 3GF4A 3NOQA 3MJVA 3KWLA 3L0CA 1CF9A 4EH1A 5LD2B 1XDDA 3P96A 3BRQA 3ZK9A 4HNGA 3RS7A 2EV9A 2MSNA 4H3KB 2A5DA 4PLCA 3TQTA 2B94A 3LPDA 1A2QA 2CNWD 1KXZA 4WZAE 1PUJA 3OOEA 3NT4A 2CLKB 4FOSA 4HBZA 4FGSA 3RUHA 3UAVA 4DWVA 3QEAZ 4TMXA 3VDNB 2KBFA 1DC5A 4RETA 1REQB 1MHPA 2FEKA 5AHXA 3MWEA 4GOJA 5IZCA 1NVEA 1U7UA 5CA1A 2ORED 3ND9A 1CJTC 3BMNA 3SYLA 1FEZA 1K8QA 4V2IA 3THRA 2D5CA 1C14A 1CQIA 3E53A 5JAPA 4URWR 3CRZA 1N57A 4C4ZA 1G5IA 4ZC8A 1SXQA 3SQLA 4PTLA 1NNEA 4QUIA 1XYVA 2YC2C 2J4DA 2WP8J 1XZMA 2Y1KA 3VV3A 2VWPA 2Y66A 1GTG1 1T9DA 4N3AA 2IH2A 2GEDA 3UUWA 3KJXA 4MJXA 4EUSA 5ESRA 1TJPB 2R1ZA 3UWOA 1T1GA 4M1OA 4LZOA 2NU6A 5CHEA 1JFTA 1T34A 1ZNQO 5EP2A 2J0UB 4IDNA 1JH9A 2HO4A 3AVQA 3KM0A 5D3MB 2WNHA 4HEJA 5JW6A 4CIAA 4Y2RA 2YHAA 3EHEA 5E7JA 1WXIA 4IV5A 5DNCA 3AG6A 5JFTA 2VPWA 3DUFB 4DS3A 4GUAA 4BGDA 3OU2A 2VAPA 3C39A 2J3MA 3Q0EA 4UCQA 4OI4A 1ZD3A 4ZGBA 4LV5B 1WMDA 4LRTB 1DOHA 4EMTA 2WYUA 2Y71A 3NPMA 3VKGA 2RGGA 3E2IA 4BFWA 5DCYA 4AI6A 3WTBA 2O3QA 1JFLA 2DOKA 3QKSA 4G8CA 4ISCA 3CH6A 3G5UA 4PV7A 2QTMA 5HZKA 1WMSA 3CURA 3OX3A 4W5QA 2XBMA 3I6IA 1W94A 2QTCA 3HDHA 1RQLA 4JUBA 4PHCA 4KLZA 4LMAA 1GPKA 4R4JA 4TMKA 4BEWA 5CFOA 1RP7A 1CPYA 2YR0A 4IDQA 1SHLA 4ZCSA 1DEHA 5KIAA 1KBOA 1NFRA 2A0UA 3W2HA 2AXQA 1NX9A 2ZP1A 2I4LA 1JVSA 3OIGA 1GNLA 1CZHA 1TJNA 1UPUA 2D5IA 2HK8A 3PU6A 2QQFA 3QVGA 1IHOA 5F1OA 4NATA 3O4RA 1MC4A 3DV0A 4YJGA 2H9AA 3OJCA 4FE4A 3RRJA 1QE3A 5ALSA 1PR4A 2FWBA 1KYYA 3KYCA 3MRTA 4B31A 5AHKA 1LPOA 2I4IA 4QGBA 2FJUA 1U9CA 3EOAI 3I5UA 3OVMA 1KI7A 4BP9A 3CKMA 4FFOA 4CL8A 4CKBA 3EXEB 1ZM4A 1BA2A 1A96A 3GMTA 3D2LA 5HJ2A 2J3HA 3ZN2A 3PFHA 3O4JA 3NANA 5DM0A 3BHMA 1VSUA 1CBUA 5E6UB 4MA4A 1Z25A 4RHUA 1ONPA 2D2EA 5AHWA 3UV7A 1U5AA 3V1NA 3QK7A 4DQKA 1JH8A 4RTOA 5HWSA 4BU1A 3AMVA 2O5VA 3PC3A 5KVSA 1YJCA 4ZHQF 3D6VA 2VAXA 2O2DA 2Z6VA 3USES 3ZE0B 5BV8A 1GPBA 1VE1A 4FQ7A 2J6CA 4TTJA 3NUGA 1KIAA 3P0FA 3LYUA 3UWDA 4OU5A 1HE1C 3HZHA 5EJ2A 1N33B 4E94A 4F0JA 5JISA 1SXHA 4KQFA 2ST1A 5FEUA 1DKRA 5F1PA 4U63A 5FPQA 3WFIA 2VJBA 4NL4H 2G07A 3DF7A 1BWRA 2AZ4A 1H2AS 1X7ZB 3DL0A 1M1YB 3NCHA 2Q46A 1HH4A 2X1HA 4FFPA 4PGFA 4EW3A 1O89A 2C4WA 3NHZA 4QYIB 2WTUA 3CW8X 3KR2A 2PLWA 2HRRA 1QVZA 2NXJA 4EECA 1TKBA 1Y9EA 3GGCA 4HAXA 1OZHA 4JBXA 5ICFA 3ANSA 3ER8A 1SHJA 2QRMA 4LKRA 2AG0A 3B52X 3DM9B 2WQ7A 2ZB4A 4LRXA 2FPWA 3MQFA 2JGIA 2X6RA 3LX6A 4JHLA 3W5IA 2PXHA 5IHPA 1UKZA 2QLTA 1VE7A 2GYYA 4RKWA 1CUSA 2P27A 1XZIA 5HUHA 2GDZA 1L1QA 3F97A 1TQ4A 4JKIA 1MF7A 1U65A 4Q34A 1RAFA 3L1UA 5JAMA 3HLKA 2ZLBA 1HYEA 3FCSB 3TAXA 4EKYA 2G1JA 4IXWA 4HPXB 3LC2O 4YWJA 1FDIA 2O1XA 2JGFA 3I32A 1KPGA 2EZ4A 3KKPA 2LTAA 5I7EA 1LF5A 1V6CA 2XOXA 2VRBA 4Z9YA 1Z7BA 1PTKA 2E18A 1ESDA 1QF9A 1A8QA 3CUSA 2AR9A 3B2QA 2B21A 4II7A 2HMWA 1BX1A 5JHGB 1R37A 1YRHA 4EPRA 3UICA 5HM8A 4URHA 2QLNA 1F6DA 1Q3HA 3S2YA 2IXAA 3NUQA 2VP5A 3LP5A 3QMWA 1M0WA 4MDHA 3TLJA 4BNIA 4BO5A 4HTAA 5JZOA 2P2ZA 4AMVA 3VKHA 4M21A 3QWHA 4LHYA 3UUEA 4EHDA 5AP9A 1W5FA 2VJDA 1KARA 2LVBA 3ZYZA 1ADBA 1XZAA 1MNAA 3HDVA 1E59A 4QOJA 1C9KA 4ZAYA 2ZJ2A 3A70A 4XB1A 5K8JB 1VJRA 4YJFB 3W5UA 5GIPE 2GPJA 1ONBA 2I55A 1C9YA 4H4EA 2OQVA 2C8JA 2HF7A 2G6TA 5C1IA 3MBOA 5CYOA 2ZUTA 3W5VA 3OMWA 5EUBA 2HIAA 2GPAA 1E1NA 4MKZA 5KAMA 3G49A 2Y9PB 3EXIB 3N2GA 2MCFA 4ZAGA 3V32A 5HGXA 1L5MA 4UVHA 2G9UA 5AUOB 5KTRA 4EJSA 1PO7A 5FT9A 1UMCA 2CDNA 3E58A 4DV5B 1BQ3A 1HUQA 4BBAA 1T6YA 2WUFA 1AZWA 1DUVG 2UZIR 2EGUA 1RQ7A 3B8HA 5ED0A 5HFAA 4KN9S 5JWOA 1WCYA 1B41A 1VL5A 4P7GA 1L7AA 1T5SA 1VM6A 3UMRA 2W2OA 3NHKA 4RK4A 2G0NA 3HCWA 1PZHA 4TTIA 4D6PA 3IPYA 3OOYA 4CU2A 4AQYB 3FFAA 3ZHTA 1XCOA 3KAPA 1KO7A 3SM3A 5B1YA 1MW8X 4BMPB 3IQHX 2IP2A 5IBPA 4AP5A 5CDHA 1TIKA 3UMMA 4F3NA 2IDMA 3SAJA 5CD1A 4AG5A 2H54A 4QYTA 1EI9A 3PQCA 3RFUA 1AGNA 3QELB 2AC4A 3FW1A 4UJ5A 1RAGA 1U2ZA 5HJ5A 1CW2B 1JDZA 1FXWA 1FP4A 2F67A 3EZFA 3NNDA 3LQ1A 4LNUA 4BRSA 1Z7WA 2P75A 3Q7TA 4R5HA 4YV2A 4MCJA 3NM5A 2VPPA 4UUAA 2V1XA 1OSNA 2AZMA 4RPLA 4ABYA 4ESHA 4BMSA