2XVAA

Crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sinefungin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
199
structure length
199
Chain Sequence
GAMVIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDRQYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWERVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TELLURITE RESISTANCE PROTEIN TEHB
publication title Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.265: Tellurite methyltransferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2xvaA00
2PX5A 3GU3A 2ONYA 4WVLA 3T7TA 3LDGA 10MHA 4HGYA 5GM2A 5LR6A 2ADMA 3HP7A 3GXOA 2CKDA 5CVUA 2ZSUA 3FYCA 1SQGA 1X1BA 3GCZA 2OB2A 2PT9A 2O06A 4LWPA 3UJCA 4R6XA 3LSTA 1QZZA 4PNEA 1PRYA 4QDJA 3UA4A 3BWCA 4LG1A 2H1RA 3H2BA 2PX2A 4OQDA 3EPPA 3MERA 3R24A 4Y2HA 5F2NA 2O57A 5K0LA 4GOOD 3K6RA 4KW7A 5U4XA 3EVCA 4HTFB 2PXCA 3KPJA 1QANA 1KIAA 1QYRA 2C7PA 2ZWVA 2P41A 5LQNA 3HCBA 4QPNA 5E2BA 1I1NA 3LDUA 4U7PB 5DPMA 2NP6A 1T43A 4GOMD 1RI2A 8MHTA 3I53A 5EHIA 4CTKA 1G38A 3DP7A 1EJ6A 3QOXA 1Q0SA 4EQZA 2ZIFA 2YXEA 3CC8A 3OZRA 4NECA 5EMMA 1NV9A 1SKMA 4R8SA 3G88A 4E31A 1SG9A 2ZW9A 3HVHA 4IWNA 4OQEA 1RJFA 1XDZA 2DPMA 3PT9A 2JG3A 1O9HA 3WSTA 4PYJA 5CUQA 1BOOA 2OZVA 5E9JA 5DT2A 1AF7A 3RODA 7MHTA 2AOTB 2H11A 4PIMA 2QRVA 3HEMA 1WS6A 3KHKA 3LBYA 5HILA 1XCLA 2ZCJA 4LECA 4OBXA 2ZVJA 4L7VA 3TM4A 4RTOA 4JXJA 2OYRA 2GLUA 3R9XB 4HGZA 5ICEA 5HIIA 2XBMA 3UA3A 1R8YA 2IDJA 1X19A 2PXAA 4QTUB 3GGDA 1WXXA 3FUVA 2PKWA 4RTJA 1JG4A 3EEYA 3A4TA 3E8SA 3DR5A 2WK1A 4YUXA 4XUDA 2EFJA 3KR2A 2O0LA 4CTJA 2WA1A 4CWAA 2Y1XA 4QQKA 4PYOA 2YVLA 4C4AA 3HM2A 2P3QA 3B3GA 2EJTA 4KDRA 2NNWB 3PB3A 2XYQA 3SSNA 4YUZA 4QDKA 2ZBRA 4E32A 3EVAA 3MB5A 5HIKA 3P9CA 3R3HA 3EVDA 4MIKA 4AUKA 4F86A 5BW5A 4MHTA 5C0OE 4AX8A 3P9KA 4PYQA 4GOND 2FRXA 5GWXA 3FUWA 3OCJA 5P8WA 1EIZA 3TRKA 3V97A 2AOTA 1L3BA 2IPXA 1XDSA 4BP3A 2OB1A 3D2LA 2E5WA 2UYHA 4ER3A 3B3JA 5DX8A 3E05A 1P39A 1NW6A 2O07A 2OKCA 3IHTA 4GC9A 4RV9A 5DX1A 3UJ9A 5BW4A 5K0EA 2ZIEA 2ZULA 5DTQA 5FULA 5LQJA 1G8SA 1N2XA 1RI4A 3CJTA 3FPHA 1VIDA 4OA5A 2HTEA 4YUVA 4E2WA 1RJEA 4GQBA 3SM3A 5LQAA 4OA8A 4RTPA 1SUSA 1SQFA 3KPYA 1Y8CA 3T7SA 1XTPA 2CWWA 4QPPA 3LBFA 5GM1A 5EPEA 3SSMA 2JHAA 1YUBA 3EGVA 1NV8A 1H1DA 5DXJA 3CVOA 3SMQA 4DA4A 2IBTA 1AV6A 3GRZA 5E9WA 2HWKA 5FADA 3UJDA 5KVAA 4P7FA 3LX6A 3G8BA 2JHCA 1ZGAA 3SSOA 1OR8A 5FTWA 2QE6A 5FHRA 3OZTA 2HR1A 3NTVA 1NW7A 4EMSA 4QQNA 2AOUB 3BKXA 3FUUA 1RJDA 1R00A 3ER8A 5FCDA 4KVZA 1D2HA 3GNLA 3UJ8A 3X0DA 5DM1A 3GRYA 5E1MA 4C06A 1F3LA 3ERCA 3L8DA 2AN5A 3GRRA 2AOXA 3DMFA 2UZ4A 5K0NA 3T7RA 4ER5A 5H02A 5DLYA 4YMHA 3HCCA 2V7EA 3HNRA 3LKDA 5FA5A 3I58A 5EHGA 2OBFA 3C6MA 3G8AA 5CM2Z 4BLUA 3MCTA 2ZLBA 3T0IA 4E2XA 5CIYA 2G1PA 2PV0A 3REOA 1XXLA 3KR9A 4PYMA 3EVEA 4C04A 4YV0A 3BZBA 2OO3A 3FRHA 3LCCA 4KDCA 3JWIA 2PVCA 3P2EA 3PFGA 2P7IA 3ELUA 4RWZA 1JTEA 1XJ5A 5FHQA 1HMYA 4RYLA 3FPFA 3HA3A 3BXOA 4FSXA 3ELYA 5K0FA 4HC4A 4RTSA 3G2MA 4X63A 1FPQA 3BT7A 2GH1A 3GJYA 5CVVA 5D1HA 1B42A 1WG8A 2G71A 4EK9A 2FHPA 2PJDA 1BHJA 5DX0A 5E1DA 3TKAA 3V8VA 2YQZA 2AOUA 2GAFA 2NXCA 1JSZA 2VS1A 1JG2A 4GEKA 4MTLA 4RSRA 5E2AA 2Z6AA 1DUSA 3B89A 1Z3CA 3KQQA 4IKPA 5HOQA 5HIJA 1XDUA 2BH2A 4IV0A 2B2CA 3G5LA 4KWCA 5C1IA 3FRIA 3BGDA 5B1SA 2VDVE 5HIMA 4FT4A 2ESRA 4RVDA 1HNNA 3ORHA 5FWAA 2QM3A 1ZQ9A 4HH4A 3TR6A 4AZWA 5KQRA 3CCFA 2AR0A 1EQAA 3MQ2A 3EVZA 3JWHA 1VBFA 4GOLD 2P8JA 5CVEA 4EKGA 4A6EA 2CMHA 1TPYA 2PLWA 3HCFA 3PS9A 2XVAA 3QOWA 4ER6A 2GB4A 4PGHA 5E8JA 1NE2A 3CBGA 5E8RA 2BZGA 4Y30A 5EVJA 4F85A 5BXYA 2JH9A 2V74B 3UJ7A 3A27A 1YFLA 4DQ0A 1RI5A 2IH2A 1O9GA 1X1CA 1XCJA 1QAMA 3GDHA 3HCAA 3JWGA 2EG5A 3E23A 3KQWA 3G7UA 5FQNA 3ME5A 4CKEA 4RVFA 5T64A 3P2KA 4FGZA 2Z6QA 2PWYA 3P2IA 4ISCA 2PT6A 2BR4A 1BC5A 2ZFUA 3SVZA 2P3OA 2QYOA 2KW5A 2YR0A 3IYLW 3UFBA 3NMUF 4H0NA 1I4WA 4HTFA 3DUWA 4E70A 1QAOA 3TOSA 5ICCA 3BWBA 2AZTA 3R0QA 4POOA 3KR0A 1O54A 1X1DA 3EVFA 3NVKI 3SR4A 1EAMA 2HV9A 3AY0A 3M6UA 1KHHA 2ORED 1IXKA 1VLMA 2HNKA 4GF5A 5HEKA 3A7DA 1WXWA 3BWYA 1DL5A 2NXEA 3PVCA 4UOEA 1FBNA 3TM5A 1JQDA 4PGGA 1VE3A 4CKBA 4ER0A 1R6AA 5MHTA 2EJUA 3AXSA 3OE5A 3HA5A 5M5BA 3GRUA 4M7RA 4RTNA 3DH0A 3R6TA 4AZVA 2NYUA 3M4XA 2Q41A 3HTXA 3KPUA 3TMAA 1N7JA 2AS0A 1TW3A 3LPMA 5DTRA 3LHDA 3SGLA 2IH4A 3M6VA 4BY9E 1VQ1A 3TLJA 2I7CA 4E2YA 3GIWA 1AQJA 2K4MA 5T6BA 1ZGJA 3NWEA 3GWZA 5DTMA 4RX1A 2XYRA 4PWYA 1KPIA 3PFHA 5LQRA 2B78A 2YUIA 2P35A 4FS8A 2PXXA 4HSGA 3PTAA 5EMLA 3OFJA 5EZQA 5CD1A 3LKZA 1X1AA 2OXTA 3QV2A 1R18A 1V39A 4PYLA 3M6WA 4R8RA 3TQSA 1YB2A 4KRGA 2IIPA 4DZRA 1DCTA 3ANXA 3JWJA 3FTCA 2PX4A 5CVDA 5FA8A 3OFKA 4C07A 3KQSA 2C7RA 2N47A 4X41A 4KIFA 3LECA 2B9EA 4M37A 1R74A 1YZ3A 3HCEA 3BWMA 1ORHA 5EEHA 4GUAA 1WY7A 4K6MA 4PINA 4PIPA 3ER9A 5E9QA 1IM8A 1ZG3A 5ERGB 4R05A 2GS9A 3TKYA 4RTLA 2I9KA 1MHTA 3OPNA 1AQIA 3KPWA 3IV6A 1KXZA 3GRVA 3CJQA 3FUTA 3HVKA 5EIFA 5K05A 4DKJA 1VP3A 4QVKA 3OU6A 3BKWA 1YF3A 4PCAA 4XCXA 4E30A 3FTFA 2GA9A 3F4KA 3PX3A 1P1CA 3P8ZA 1RI3A 1ORIA 3MTIA 3G2PA 4YV2A 5EIWA 5EOVA 3KR1A 3DLIA 5EGSA 1M0EA 2VP3A 4FZVA 5DM0A 2C7QA 1FP2A 4DF3A 2B25A 3B7PA 1JTFA 3UJBA 2PY6A 3HCDA 1JSXA 3MAGA 1YFJA 5K0JA 2P7HA 4AZSA 3AJDA 3DXYA 2OY0A 2C7OA 4PYIA 1JQ3A 3OZSA 3LDFA 3SX0A 4BLVA 5KQSA 3Q87B 4FSDA 1D2GA 4RVHA 5IH3A 3FPEA 1INLA 3MHTA 4BP1A 3C3YA 5GOZA 1G55A 3KPVA 1L3CA 2P3LA 4WXHA 5G02A 2G70A 4QTTB 5ICFA 2G8NA 3DXZA 3HVJA 4RTKA 2YXLA 2BR3A 4LWOA 3U81A 1QAQA 5DSTA 1VPTA 3DMGA 3DLCA 3HVIA 5GIOE 3DXXA 4HRAA 5K01A 5EG5A 1KYZA 1KP9A 4G56A 4PYKA 2NP7A 1P1BA 2LD4A 3NW9A 3OU7A 4E2ZA 1RJGA 4EKIA 4YUWA 3O4FA 5C9ZA 5LQKA 1RI1A 1MJFA 5F2OA 1M6EX 5GINE 2AVNA 4OBWA 5E1BA 1YZHA 3GO4A 1UWVA 1FP1D 3MGGA 3M6XA 2XYVA 5KS2A 3KQTA 5DRYA 2BM8A 2ZZKA 1I9GA 3AWIA 3LCUA 1N7IA 5K09A 9MHTA 2NXJA 2BM9A 2YTZA 4U7TB 2PWPA 2FPOA 5FUBA 1U2ZA 2YX1A 4C05A 3PLAE 2PGXA 1BKYA 3G2QA 1WZNA 2VZ9A 5JUWA 3C6KA 2QRVB 2AVDA 1KPGA 2ZZNA 2IFTA 5BP7A 2G72A 1UFKA 3ID6C 2FCAA 3KQPA 3LL7A 1JG1A 5HZMA 4DMGA 2H00A 2O05A 4XUEA 1G8AA 2VDUE 5LQCA 2HMYB 5DXAA 5K8VA 4DCGA 2WA2A 4RVGA 2I6GA 2BR5A 3ELDA 1L1EA 5FWDA 3DOUA 4EVIA 3KQMA 2DULA 3RIEA 5EZSA 4ZTBA 3PX2A 3ELWA 3E7PA 4YMGA 3NVMB 2IP2A 1G60A 5EC8A 3K0BA 2IH5A 3FPGA 3P71T 1JG3A 2UYOA 4KIGA 3LGAA 3Q7EA 3C0KA 3I64A 5CVJA 2IDKA 3BGVA 3KQVA 1L9KA 2CMGA 3A26A 3O7WA 4M38A 3UJ6A 5K0BA 1JR4A 2JJQA 3KQOA 1Q0TA 2VDWA 1VP9A 3CGGA 4MQ4A 2I62A 2R3SA 3BUSA 3VYWA 4PONA 3TFWA 3AXTA 3MCZA 4X61A 3HA7A 4AZTA 3G5TA 5GIPE 2PBFA 3VC2A 3P9IA 3THSA 4FP9A 4Z2YA 2GPYA 2XVMA 3O31A 3IEIA 3NDJA 1R8XA 1KPHA 4C08A 2ZZMA 1D2CA 2JH8A 5K0CA 5DRTA 3UJAA 2ZTHA 2UYCA 5DWQA 5D1NA 5CCBA 3EMBA 3C3PA 1NBIA 2UYQA 4E33A 5FQOA 4CKCA 5EKXA 4O29A 4B17A 3NJRA 4RTQA 2AOWA 3EGEA 1NBHA 4RTRA 4C03A 1NKVA 2IBSA 1ZKDA 4CXMA 3UBTA 2FYTA 1M6YA 1SVUA 3KKZA 3EVBA 5CCXA 1IY9A 1L3IA 3CJRA 3RW9A 1PJZA 1ZHFA 4ER7A 4PCLA 1NW5A 3BGIA 5EEGA 3DMHA 2AN3A 3THRA 3FTEA 3M70A 1KYWA 5IKMA 4FT2A 3I5UA 2ZIGA 1F38A 3NDIA 4V0QA 1VL5A 2QY6A 1TW2A 1JQEA 1XVAA 2AOVA 3FZGA 3M33A 3KU1A 1EG2A 2PX8A 3FYDA 3B5IA 4DM3A 2CL5A 2P1DA 4ATNA 2ONZA 2EX4A 3FPJA 5EQJB 3SXJA 4YV1A 3P9NA 4R6WA 5T67A 5JR3A 3DULA 2A14A 5F2KA 2ZBPA 2NXNA 2ZBQA 3B3FA 3G89A 4HG2A 3S68A 2B3TA 3LCVB 5LSAA 2Z6UA 4OX9Y 4IV8A 5EMJA 4P7JA 2R6ZA 2IGTA 3OU2A 4P7KA 2FK7A 2FK8A 3VSEA 5K0GA 4GBED 2OPBA 4P58A 4X60A 4X1OA 3UWPA 1SUIA 1FJXA 3FTDA 5EKUA 3DTNA 4F84A 5KYGA 4M36A 3A25A 5DM4A 2PSSA 1KR5A 4GC5A 1NT2A 4PYNA 3I9FA 5GP1A 3UZUA 4A6DA 1NW3A 1NW8A 5E1OA 3EVGA 5EMKA 3OE4A 2P40A 3A7EA 1EJ0A 3KQYA 5DSXA 5HFJA 2ZWAA 5K03A 1G6Q1 2Y1WA 2ERCA 4BLWA 5DM2A 3EEOA 3G2OA 4QVGA 2AN4A 4XUCA 3NWBA 3P97A 1UIRA 4P7GA 3VC1A 3FUXA 2JHPA 3MTEA 4FR0A 4V0RA 4DCMA 5LQUA 5ICGA 1P91A 2F8LA 3CKKA 4MWZA 3TPZA 2YXDA 4RTMA 4YUYA 3EGIA 3EMDA
chains in the Genus database with same CATH superfamily
1TK9A 4HRXA 3LZDA 4RGVA 2EOAA 1V7QA 3QKSB 2D0IA 1XA3A 3BAFA 2GD6A 2OP0A 3WLRA 2DCMA 2H5IA 4L8GA 3H04A 2JGEA 3KO8A 4OLHA 3UB2A 2EW2A 2NSYA 1XTBA 2JLRA 2QD2A 1FEZA 3ED1A 4FEAA 4FYPA 5AMXA 3UXYA 3DBIA 2UXCB 2XIQA 3C1UA 3LC2O 4OUKX 3W5SA 3ZWAA 2KBFA 2NZXA 2E85A 4BX3A 5JO0A 5HTOA 3EWIA 1S96A 4WA7A 1WW8A 2E4AA 3HB0A 3RSQA 2ZJ5A 4F38A 4BNDB 1JJIA 2B92A 3B8HA 4XWWA 1IMJA 4GOOD 5U4XA 4RVOA 3U1VA 2RIPA 1YONA 1QANA 5JECA 4X90A 4NV0A 3T1QA 4WLUA 4PC3A 3QEMB 3PFKA 4XGIA 4E03A 1DC8A 2UZ0A 2AMLA 5F1KA 4HX9A 1UKVY 3OJCA 2FZ5A 2PU5A 1S8AA 4IXTA 3TNFA 5F7OA 2V03A 1MW9X 3G0HA 4NEQA 5B3LA 5I5EA 5A0TA 1GLNA 4BNNA 1NR7A 2D06A 4XYMA 1TMGE 5AJTA 2DFDA 4N0MA 4Y1FA 3TJRA 1DJMA 1MV5A 7AT1A 2J5RA 2AL7A 1OT3A 4K9NA 4MV6A 3G5AA 4EM6A 4ZOAA 1O87A 1ZD9A 4J1TC 3RC9A 2B36A 2PZFA 2BRUC 4H1VA 5LXTF 4DREA 1MPXA 3LVFO 1E2PA 1NXSA 1QGUA 4UTZA 3NNDA 1XZBA 3Q0TA 3T6KA 3UWSA 2F3UA 3KHKA 2Z95A 3OZUA 2PFSA 4L5IA 2B2XA 2XE6A 5LKAA 1TKRA 3PFFA 4C2BA 5ICEA 3BJZA 3Q85A 3V7WA 1YCFA 3ZDQA 3DB1A 4K40A 4O4IF 1T8UA 4MV1A 3D6HA 3WB9A 2ZRJA 3KXLA 3LUFA 5C5DA 3N70A 3RS7A 1RQXA 1O2DA 2FUG6 2G9ZA 3K2QA 1ZIXA 1YL7A 2YJNA 2R1VA 5ALLA 3IA2A 3O4GA 3DAFA 2EJTA 2C98A 4ONEA 3NDBB 3HDVA 1AUXA 5EZYA 4YS6A 5GVRA 3MB5A 4OJMX 3Q0IA 1FNMA 2REQB 1KYQA 4ZMRA 4RM2A 1DADA 1MB0A 4Y2PA 2IC5A 2IHBA 1H3EA 5BVGA 3P9KA 2UUPA 1QIGA 1RVV1 4BXOA 3TRKA 5L8VA 1CE8B 4ZCIA 2C2YA 3MOGA 3G2NA 3KTDA 4JEMA 2HNBA 5JNUA 1HT2E 1GDHA 5AK5A 1HNXB 2Q3JA 4RFVA 1UBOS 2D00A 3WQHA 2LZ0A 4P3PA 4OMFG 1XEXA 3GDOA 2Q9UA 3FSEA 1BYIA 4AUNA 1XA4A 2IWRA 4DRYA 2PD4A 2XKBA 2JDIA 1R9MA 1XX6A 2QVYX 4UUMA 3PEWA 3TR0A 4W5TA 2A0KA 4ZVMA 4GQBA 5K8IA 1COWA 1EI9A 5EERA 3SFVA 1TKCA 2GPNA 1JQKA 1QUEA 4LA4A 4QO8A 5IUNC 3O0DA 4C4YA 3CVOA 2YFQA 1JNXX 3EVNA 2OGSA 4IGKA 4TMKA 4FR2A 4UPEA 1WB9A 1QZ3A 4B4UA 1CUYA 4RFSB 4DR2B 4BMYA 3C3DA 5PGMA 1HI9A 2EJVA 2V45A 1PR1A 1R8JA 3HU2A 4UCFA 1GPLA 3I9NA 3OT1A 3DD1A 1M6NA 2O59A 1L9XA 2A7XA 421PA 2TMDA 3BKXA 2ONCA 1WF6A 3PDJA 4KVZA 4Y9TA 2D7DA 4IUYA 1U7ZA 5E1MA 3CUSA 2YWEA 3OPYA 2FUG1 3V34A 4G37A 1JZTA 4YJKA 1E7QA 3USZA 2O1WA 1TLFA 2UZ4A 1F6WA 2CFTA 3ZKWB 1RABA 2P3SA 4H4EA 4YMHA 2YV1A 3VO8A 3LKDA 2AI2A 4FI3F 4FX2A 1YL5A 1M34A 3BILA 3V00A 1ZEJA 2WD7B 3X2FA 3W1WA 5BMVA 1FUKA 3ZTTA 1F3OA 1VHQA 3OLCX 2OO3A 2JI7A 1ODKA 3OOSA 2Y0EA 3PQCA 1XRNA 2MYTA 3JWIA 3LYUA 3KOYA 4OB6A 4B2YA 4C4RA 5A4AA 3EIUA 2PBRA 3H86A 2A5GA 1CRPA 4I55A 4QD3A 4RZQA 4MP8A 2XUPA 1XRMA 2JF0A 3D7MA 1PWHA 4BP8A 2W83A 3IKTA 1YJQA 1WG8A 2BI8A 4KQEA 4MO2A 3FVRA 3BEDA 1EWQA 1AK2A 1ODLA 4GLLA 3CXRA 1QGOA 3UCFA 4L9SA 4BVBA 3U44A 4JMLA 3RABA 4TOIA 5CBPB 2H4XA 4RS3A 4LOLA 4XM1A 1AKNA 1NG1A 3H9EO 2JZOA 1TL7C 2QQGA 2R1ZA 3KQQA 2BMJA 3PSHA 4LJYA 4KR6A 3MB8A 4AS3A 3K4QA 1EXNA 3LDAA 5CXXA 4A5SA 3LUGA 1SOVA 5EQDA 3A1SA 4MRSA 2OAEA 4GPEA 4NV1A 3RKSA 3NAMA 2QVBA 4KQ2A 4IP0A 1KE2A 4RELA 3AVWA 4EKGA 2QVCA 3LT1A 3PJRA 2XI4A 1L7DA 2BL4A 3LPDA 2X9GA 1QS0B 5ALKA 4AJIA 5BVHB 2RHRA 3UWOA 5DNUA 2DYKA 2W2XA 3EFBA 4JOCA 4G65A 4F1KA 2H3HA 4DDTA 4ENPA 2D5LA 2HF7A 4OVKA 1XKTA 4WKPA 2XT9A 3RGWS 4GLBA 3I2JA 1UFRA 2IF2A 5ER9A 2OV1A 3IPXA 4KVAA 2BLLA 1MHPA 2YS6A 1P45A 1G19A 2R47A 3NV7A 3S6JA 3TIVA 2BMFA 4IVQA 4LJLA 2X13A 3AHEA 4GL2A 3L92A 4OLBA 1VFNA 3OMLA 1I4OA 3TBFA 4CL3A 3RF6A 1ND5A 1XZCA 2BEUB 4MVJE 1IULA 4KJXA 4QJBA 1ULHA 1FFXB 4CBVA 3CMMA 1NJSA 4FFBB 4PLVA 5DCLA 4EELA 5CG2A 3M1AA 1ICEA 1NBAA 2HWYA 2JARA 3IQWA 1Z22A 3R3XA 1XU4A 1W85B 2Q2OA 3ICCA 4ZQGA 4YQEA 3PGJA 4Q9DA 2DUNA 2GILA 4U2BA 1GTJ1 5CM9C 3ZBUA 3GDWA 5BRAA 3OCVA 1ZWLA 3RF7A 5IS2A 4LXIA 4TS3A 3TLXA 2XTMA 3ANMA 1WZEA 3D0OA 4IJ5A 3OO1A 3S81A 4B9EA 2BGTA 3IQGX 2EATA 3EVTA 1I13A 4GOJA 4FE3A 4N9WA 5LYJF 1E1YA 4P53A 1KJYA 1UPTA 2ZS8A 3RC3A 1DELA 1Z7GA 3MTBA 4LRYA 3PGMA 2PMWB 1AQJA 3OD1A 3QU7A 1BYUA 2CLEB 1QLJA 2R8BA 2QM8A 2WNSA 3CT4A 3GWZA 2ZE5A 2GDZA 3HL0A 4RORA 4D2IA 4ZQFA 1ZM2A 4N03A 3MRSA 4BMZA 3VZRA 4P83A 2GHIA 1B0PA 1SBZA 1SVIA 4ZCTA 2I2XB 3CRMA 3RUPA 3LPCA 3AESB 1XPJA 1R18A 2XMRA 4WOCA 2GEVA 3PI7A 4G0OA 2HEIA 1C2TA 3ANXA 3F7OA 3NETA 1I14A 3IUNA 3RFXA 2ZQ5A 5HWSA 5JCJA 5HM6A 1O4WA 2ZDHA 3JZIA 3Q3HA 3CVYA 1NVTA 2OPHA 1XNQB 2JCVA 5AP9A 4CIYA 2VATA 3OOWA 4R84A 5EPUA 3M5PA 1OLOA 2GS9A 3WLSA 1K63A 3OPNA 3NORA 5AIAA 5AI8A 3VZCA 4IMJB 1A9TA 2QNRA 3IBGA 4JLBA 2D4HA 2A84A 5AJHA 4C4TA 4NG4A 1L7PA 2XKAA 5JDCC 4NIMA 1R4NA 2QQ5A 2VPWA 3DBRB 3H6GA 5C5IA 5EJ5A 3FOBA 3FTFA 4K46A 5GMOA 2EERA 1Q15A 3FTQA 4O2BF 2Z4RA 1US8A 4RD6A 4NV3A 4U02A 5JDCA 3THWB 1IHXA 2ZG6A 1J6UA 1P0QA 2R6GA 4QPZA 1W36C 3EQ2A 2ZIAA 1PFWA 5F78A 5BYKA 1HDOA 1VE7A 2OLJA 2X6TA 3MAGA 3I6MA 3OKPA 3ZLTA 3HXTA 2F3SA 5IJZA 2WOOA 3I32A 4IIBA 3I6YA 1Q14A 1VPLA 4QM6A 3GLIA 1E7WA 1XHLA 1JMKC 1MEEA 2PUHA 4LZWA 4DIUA 1XTIA 2VXYA 1P77A 1DUIA 3FGPA 4A27A 2ODQA 3KLPX 1ZN8A 1Z68A 3K9NA 5EL0A 1V16B 2X15A 2G09A 4D3YA 5EHXA 1ZN9A 4IR7A 1QQ6A 1Y80A 5IKOA 2AX4A 3I52A 3KJEA 3EW7A 4NBVA 4XVCA 1A9YA 3NIBA 3AOEC 4R2JA 4XAQA 2Y1EA 3R6WA 4ZDWA 3TQRA 1I2CA 3AR6A 2AK3A 2QIOA 3CUWA 4QBTA 4QPDA 3RU3A 4HUTA 5KHLB 1TTTA 4N39A 3OCZA 2QPOA 3AF3A 1CQZA 5IWAB 4EATA 4YFYA 3CZ9A 5JROA 2ZQYA 4N54A 4PU0A 3ZZNA 3VR4H 2IXEA 3GO4A 1FP1D 1DFIA 5DOVA 1YMUA 2PUWA 1WXHA 3JPYA 2QDXA 1JQLB 5JMOA 1I9GA 4QYMA 5FPSA 2NXJA 1A95A 4JBLA 4HWSA 3IAUA 1I3OA 4DV5B 1C41A 2VDWB 5IFLA 5FV7A 1ZFNA 1K7CA 4JI1B 1BHQ1 4E0BA 1DKOA 2G72A 3K15A 2JEYA 3GCDA 4IJ6A 4PNPA 1EHYA 1JG1A 2NZWA 2QL9A 3REQB 4QM7A 1WCYA 2J9FB 3EAGA 2QR3A 3B1XA 3VGJA 1PFQA 2JFHA 4ZYTA 2XQJA 1P4GA 4YBZA 3FAKA 3KT0A 3QPBA 1YE5A 1QO9A 3KKNA 3EH1A 4II3A 4EFMA 3TI9A 4RDXA 5SZIA 2W6JA 3R7FA 1YJ5A 3ELWA 4NMHA 2G76A 4FWTA 3JU3A 2BJVA 3K0BA 2H8KA 1D2RA 3L0DA 3DO8A 1QYDA 1C9KA 1U8CB 1KTIA 1SQ6A 1L4YA 1F5NA 2JA2A 3O9MA 2YZNA 5TNXA 4M1EA 1W0JD 4ZOBA 1QG2A 3MIZA 2FG7C 1ZH2A 2K6GA 2YVQA 5AR1A 2H17A 3K6JA 4WASA 1IIRA 4PCVA 4AVYA 3ZLBA 2RGUA 3AXTA 1XZJA 1L4NA 1URPA 2WIKA 4B2PA 2N42A 4F11A 1KEEB 1LGYA 3U3JA 3K1ZA 8AT1A 2ERYA 1O96B 4N40A 4IGFA 4BGEA 4DN6A 4YJ3A 2UU9B 2VP4A 4K9PA 4M55A 2I3ZA 1M8FA 2C2XA 1BH2A 1R8XA 4JA0A 4C08A 2OT3B 1ZIYA 1PQPA 2B4TO 3GJZA 5H1YA 4CCWA 5JJBA 2AUMA 1LQUA 1YVRA 2NU9A 5GTDA 2CBZA 2C3YA 3Q5GA 2WB4A 4RPHA 4R8LA 4QU5A 3FGNA 3KAJA 4KQKA 2QG9A 1U8UA 2NO4A 3PGXA 1IBKB 3GA0A 3HP4A 3FOFC 1HDXA 5AKEA 5KOHB 2WVJA 4A2CA 1XMQB 2AC7A 3EVBA 3ONDA 2QTCA 2OXIA 3F5QA 5EIAA 1T35A 2CMDA 3MRXA 4GMGA 1T6NA 4KO8A 5C8YB 2GA8A 2D1RA 3NX4A 3SC2B 4Y6RA 1QX4A 1QZTA 3ODGA 1USGA 3TLMA 1S3SA 4URZR 2OQVA 3IQZA 2CVHA 4BO5A 4AM8A 3T8YA 3GLGA 1U1EA 2VTDA 3M70A 1RHMA 1USVA 1VKZA 2B4RO 4HFRA 4RZSA 3VSDA 4V0QA 1E4OA 2IRWA 2DFTA 2DKNA 1FX0A 2DJ5A 2R751 2O5EA 4JWTA 3JASB 5AI9A 4QYIB 3L0IB 4FZ5A 1Z6XA 1AUOA 2B0JA 4J0EA 3K72B 1BMFA 2A1UB 2WWIA 4MS1B 4D9NA 2Y3IA 5L7WA 2BKEA 5JZBA 2IOHA 3Q8MA 1ZMBA 4RLHA 2W5UA 1N25A 3JZAA 5F2KA 1ZI6A 2JI9A 3EC2A 3CUTA 5AUOB 2B4YA 4OHCA 2ZR9A 4OFZA 2ZAYA 3UUEA 3J7TA 3UAOA 3FB1A 3L0OA 3TIFA 4P7KA 1X2BA 4BO7A 1MKYA 3VSEA 3UNXA 2OR3A 3L8FA 2D8MA 1EB9A 3TD2A 4PLTA 1FMCA 2ZT8A 5L53A 5CNKA 5KWEA 2AQIA 2I6XA 3ZR4B 1N4AA 2VBGA 2I3BA 2DXIA 1OXMA 1R0WA 1PJ8A 2A0XA 4UAVA 4BMSA 4HYYA 2DX7A 4TLEA 3UZUA 3I28A 2PAFA 2OESA 3OE4A 1N1DA 3ED5A 1XCBA 3M2TA 3WWDA 3CO0S 5K03A 1N9GB 4XIJA 4L6IA 2OLEA 2BGJA 3L7AA 2CXQA 5B57C 1XVUA 1OVGA 3JR7A 3LLCA 1LY1A 4XJSA 4D80A 4ZICA 1ENYA 2VSOA 1GZ5A 4CW7A 1KOGA 4X5OA 4Z9YA 4IWYA 3W6UA 4HUQA 3RHSA 1Z6ZA 4Q02A 3AGQA 3TPZA 3WVNA 3BIFA 1E2MA 4B32A 2XXJA 3Q40A 3HH8A 1YO6A 4AT1A 1WZ2A 2IJGX 3QMVA 4OREX 4D1YA 3F6YA 4N0PA 2CLDX 4EFNA 3CISA 3LFUA 1SQGA 3ESZA 3P2JA 4PQFA 3QG5A 4LWPA 2E5FA 1QGUB 2FEPA 1GYPA 5I47A 1BZYA 4H6XA 2QZPA 4LG1A 5DO9A 1N9ZA 2O50A 3HJBA 3RJMA 1SGWA 4FUQA 4OXXA 1Y9JA 3ONNA 2XKKA 2WRZA 3EWAA 1TM7E 2QV0A 1A88A 1JBQA 4E1AA 1UK6A 4Q66C 3A2MA 3NOQA 4AKTA 3M34A 1IBLB 2Q6LA 3EDQA 3OLXA 4LJ7A 3ZJTA 3GFSA 5FTJA 3GCWA 4B6QA 1PG0A 2D2XA 3DQPA 3EE6A 4J29A 5H4HA 2ZANA 4DNQA 2HMAA 2O3SA 1V3VA 4L1KA 1VSUA 3EC1A 1I01A 2IYSA 2RBEA 2WE8A 4RQTA 2A9FA 1A8PA 3V8EA 5LPNA 5M2QA 2R1VB 4YONB 1VCNA 1YKSA 4G0WA 3CC8A 3TSWA 2CEAA 2GK6A 4LNUB 8LDHA 4C7MA 5EZYB 2P6UA 3V33A 3RBZA 3KC2A 2PR2A 1VLZA 3GLHA 4GMKA 4I2VA 2G77B 2Z5FA 1OBOA 4OQEA 1M1ZA 4OXNA 3I5YA 1DEKA 2CLKB 1XDZA 3D8RA 3QWHA 3EY4A 2XD9A 3NFRA 4HL6A 5CUQA 6REQB 2N9UA 1A98A 1VCHA 1JWBB 2P1RA 5C7LO 3T7JA 2P0YA 5AXBA 3T5GA 1T2DA 1WKVA 4BTEA 4M9SA 1IOVA 1XEXB 1C2YA 1QC5A 4UVDA 9LDBA 4JI0B 4ZU3A 3CLUD 3VBEA 1FZQA 2PCLA 2VOJA 2HC9A 2X3UA 3E18A 2IDJA 2QI9F 4PSAA 4RJJA 5G3YA 3BWDD 1PEKE 2DTDA 5KI6A 5I4IA 1PR3A 3OLVA 1I3CA 2ZBVA 1CJCA 3LO5A 1T3ZA 2JIQA 1LPNA 3E8SA 4INPA 2HD4A 2A94A 2JDID 4CKZA 2ZIXA 1QYVA 4PX5A 3QX3A 5KJCA 5JJLA 4ZT4A 4QQKA 2YVLA 5IVHA 3MEQA 1COWD 2W2VA 1PFUA 2ASEA 1W48A 5JY1A 4BFUA 4COKA 4MB2A 2D1YA 5DEIA 1ONSA 1ZW6A 2H1VA 3CE6A 4E32A 1U31A 1W1IA 4L8FA 5FTNA 2IY8A 1YZUA 3A70A 4LJ8A 4F86A 2QOEA 1OX6A 2GUGA 3W3AH 2HF8A 1V71A 3EA0A 2CWDA 5CA1B 4R9NA 1SU4A 3H9JA 2PEZA 5GWXA 1DO8A 1PUJA 3BMOA 1T1IA 2R0QC 1JFFA 4BL5A 1ETHA 1UUFA 4QARA 5ALWA 1T4MA 4Y2TA 5TARA 4XR9A 5TF4A 3ZH2A 2UXBB 1AKYA 1H2HA 3NKFA 3OPYB 1ZL0A 4GC9A 5CXSA 1T34A 4AQ7A 4M0LA 5IC6A 4URVR 3EOAI 4EUSA 4KWIA 3FETA 1Z0AA 3K9FC 1N2XA 3P5SA 3K0KA 3FPHA 3SNHA 4JI2B 1GPBA 1M34B 3OQJA 5IAAA 4Y6OA 3D1JA 2MYUA 5LQAA 4U9UA 1XZFA 1ZYUA 3M82A 1X1QA 3A1NA 3P2MA 5AXCA 5BMVB 1OI3A 3GI1A 3WLPA 3V48A 4NU6A 3GJTA 2RSLA 2JAUA 4EHHA 1X87A 3K0FB 4OV6B 3H42B 1UDBA 1IEWA 3QMPA 4I55B 1UMCA 3C3BA 2PPLA 1UKEA 3P7MA 1RRMA 2QZZA 5IW8A 2JCYA 3L0BA 4Q1CA 4OHXA 3ZYZA 1DRKA 2IUEA 2OV4A 3K2BA 4QQNA 4YUAA 3U44B 2Y1GA 2IELA 2VP0A 1EFTA 1N6OA 1G66A 3PFBA 4KWEA 3R0ZA 5TMBA 3JAWA 3VGPA 3H65A 4JQZA 3NBZC 4TLBA 4QOSA 4F0JA 3T7RA 5EKTA 1A5ZA 4OK6A 1BFUA 1ZI9A 2EFEB 2PKQP 1H6CA 2EKLA 2FFBA 2RC5A 4LRQA 4N12A 3DV0B 4WBNF 3HMQA 1G6OA 1GNRA 1NAHA 3BB3A 2OBXA 5IARA 1YZKA 4HVLA 2O19A 4HWTA 1CUCA 2CJYA 5DZSA 2FSHA 3F6SA 3ZDZB 4OF4A 5BSWA 1G7TA 3PG5A 3TDNA 1W4CA 2A9RA 2PL5A 2J3IA 3DEHA 1SD2A 3HV0A 4LSZA 4M99A 4W5OA 3S55A 1QMPA 4HC4A 3ENZA 3WDLA 2C59A 3HKDB 1P2BA 3O4JA 3OMXA 1GDTA 5FWNA 2XGOA 4PLFA 5DX0A 3LL4A 2HJGA 3V3KA 1PE0A 4IM7A 2WUGA 4BVAA 1OX4A 3KEOA 1TU4A 4YY3B 4C1BA 3PDIB 4K9OA 2YOGA 4A7PA 1YZTA 3D8SA 2ZUUA 3EZGA 4WIAA 1G21A 1K86A 5JJKA 3SXUA 4KWCA 4YB8A 4QT4A 3LQYA 4EGCB 2QM3A 4JODA 1N2OA 4YRZA 1SKYB 3RJ5A 4WDQA 1JU9A 3ESDA 8OHMA 3H9QA 3JWHA 1AHHA 4H1TA 1ZSNA 4W9NC 2R8EA 1DC5A 3FTNA 1MGPA 3WGMA 5AVTA 3GIDA 5JI2E 2XVAA 3WYCA 2GJSA 4OOEA 1DBIA 1P73A 4TKMA 5AO9A 4DDHA 4N8DA 1AS0A 5E8JA 1ZM9A 4A0FA 5JJCA 1O1YA 1ND6A 1UEIA 2EQAA 1PJRA 2R6CA 3UMBA 1RI5A 2QQ0A 1SU7A 2R8PA 5IK2D 1T36A 3QVLA 2EG5A 1V5FA 2YMMA 4YMTA 1M8KA 1Z0JA 3FRJA 1MG5A 2YINC 2Z6QA 3DC2A 4LJSA 1XB2A 2VAVA 4K03A 3ZTWA 3BM5A 2ZFUA 2P3OA 2V96A 5DIZA 1EHCA 3VYUB 4Q3OA 3TX6A 3EB9A 1P5HA 1OJLA 1CUUA 3RS2A 5A9RA 4UEOA 5KMGA 2R4TA 3BFPA 4I0WB 2FFAA 1T4CA 1ZEMA 2NO5A 2OGUA 1G8JA 3H2GA 3V42A 1L8LA 4RXTA 1IN1A 3V1LA 2AE1A 2H2GA 1TRHA 2IYEA 4Q9KA 3ZIDA 3HWX1 4GI2A 5ESRA 4ENWA 1Q1BA 1BEUB 3OIWA 4UOEA 2DR3A 1A8QA 3D0QA 4CKBA 1AS3A 1KYIA 4MWOA 4BNUA 5ESXA 1XTJA 2AFHB 2GM9A 2P68A 5KVQA 1RM0A 1YS7A 1W4AA 1K8YB 3GUUA 1DFHA 1GZVA 3DH0A 4HWOA 1XPOA 5NLLA 4RNDB 1HXHA 3TMAA 1O97D 1OF1A 3O93A 3AL2A 3T9BA 1REQA 1QHYA 4U2EA 2EF1A 4G1CA 1P81A 4M7PA 3S7ZA 5CDYA 2JFNA 2G40A 2Z1DA 3DNMA 4GFDA 4XE5A 5FBKA 1US8B 2XYRA 4R0VA 3OQVA 3FSRA 3PFHA 5LQRA 2P2LA 2PXXA 2H31A 1CDEA 2QTHA 2WIFA 2GZDA 2VJQA 3HEAA 5ALIA 3E7XA 1XPUA 1D07A 1MAWA 1OW3B 1V96A 2I6TA 3EGCA 4FJ2A 2O14A 5EMLA 5F2EA 2OXTA 1QOPB 1UBUS 1T2AA 1YH3A 3RSCA 3BZWA 4IDCA 3H97A 2QXUA 1LPPA 4N5NA 2WFAA 4YQFA 1W36D 1C7JA 5KYXA 4DOMA 2NVUB 3LECA 1PNOA 4YAJA 2GX6A 3BWMA 2PAAA 4AG3A 3R1IA 1ML3A 4LISA 3ZZTA 1RACA 1U9IA 2CVOA 4N5DA 1JAXA 1LFDB 3RSSA 1V26A 2MMCA 1A0OA 3GRVA 1KHTA 5EIFA 4PC7A 3B1WA 5EWLB 2JGLA 1E0SA 1FTGA 3U80A 2D2EA 2ZSEA 4GLFA 2GA9A 3VPAA 1Q7GA 2P1ZA 4UHBA 2OHHA 3PV0A 3IESA 3B2NA 4B87A 4DUGA 1TCUA 4RVNA 1C9MA 5D51S 5F5XA 4DLXA 4K3UA 1R0RE 2FPRA 1V9SA 2OBNA 2VKQA 3C3KA 2QEQA 1FP2A 3QVJA 4HB0A 4MDHA 1U2EA 3ZY3A 1IK6A 2I54A 2YHUA 1T5DX 1XQXA 5EKDA 1HYGA 2NQ8A 1W88B 3T5PA 1P74A 3FZQA 4FSDA 4BKPA 3CR8A 4HV4A 1JR6A 2P2ZA 1QGYA 5M3BA 3VNUA 3EA5A 3HSKA 1FU7A 5CFOA 1P60A 1JPVA 4JMPA 4YVFA 2HQSA 2CDBA 2XJ9A 1F6DA 1WW2A 3IDOA 3U81A 4D9HA 3OIGA 2CNWA 1WBBA 1I6LA 3COSA 4RBNA 5TMEA 2C97A 1IM5A 1S2IA 1VIYA 2Q3LA 4FGKA 2NO9A 5HZHA 1KH3A 1IEVA 1Z36A 1KY3A 3CFYA 4RH3A 4DA0A 3I9V6 4ZYZA 1F2UA 1JAYA 1JX6A 3L7IA 4EDFA 4Z0PA 2R7MA 3MUOA 4MV9A 1P3DA 2Q29A 2AJDA 1TVKA 3KTOA 5FLKA 4PX2A 4QNMA 1H22A 2X3FA 2DC1A 3I8SA 4KPGA 4KV9A 1GN9A 2FMUA 2ZVQX 4BQSA 1N1EA 4L5YA 4BQIA 3JVIA 4CM1A 2UUAB 3QHPA 2W6JD 5GONA 3STYA 2L19A 1JKIA 1TF5A 2MDTA 3CZAA 4KR9A 2GKGA 3ESYA 2JAPA 1E3WA 2HJVA 3M6XA 4LZJA 3ESBA 5SYNA 1JA0A 2OOKA 1Y37A 1BS1A 2BM8A 4MUEA 3RSFA 1JN0A 3PEEA 4DJFC 5C8YF 5JH7A 5K09A 1LTHR 2F1KA 4L76A 5JMPA 1VE6A 1FSPA 1GU0A 2ACVA 2POCA 5DGIA 2QMZA 1FUYB 3C5WP 4XWYA 5KYWA 3I3SR 4ZD6A 1D9ZA 2X5JO 1O57A 4JEHA 4MJ7A 5DVZA 2VH1A 4DCTA 2H51A 3G8DA 4KP7A 5JSHA 5ALUA 1JI3A 1GQQA 2GD2A 4YJ3B 3A36A 2JRCA 1DARA 4XUEA 3CNNA 3QVOA 3S2GA 4XB2A 2GASA 2ZBEA 2JBAA 3ELDA 2BIFA 3T35A 1RZ3A 2CDCA 2CHGA 2NU9B 4B6SA 3PL1A 5LDDC 5EWMB 4JHXA 2WLTA 4MVJI 5LQSA 3QMWA 2IW3A 1A5SB 1PSZA 4Q93A 2PGOA 4JBHA 3RRXA 2X0JA 3MILA 4Q15A 3W5UA 1SBHA 3ORFA 1HSZA 4FC7A 3HXQA 5E4YA 1VPWA 2IH5A 4R2LA 3M6LA 1E7RA 2D1QA 5E4TA 2ZBUA 4L74A 4BV2A 3O7WA 3OZCA 3CKMA 1FUIA 4Y67A 3I9V1 2O8BA 1R9NA 5CYFA 1MOQA 1VE1A 5DM70 4R01A 2ZSJA 2QMEA 3SS7X 1Z74A 2YZKA 3PC8A 3GLGB 3D64A 3F5FA 3NP9A 4AZTA 1P8JA 2WFMA 3UGKA 3QX9A 3VR6D 1ZH6A 4RZHA 4I9HA 1FX0B 1NI4A 4U3JA 5SZHB 4IG9A 1X6VA 2RGEA 2W58A 4BFXA 2JH8A 3HLTA 1N7GA 5BSRA 2AC2A 1ZJJA 4EYQA 5LWQA 3N86A 3U09A 1W35A 1BMFD 4YAIA 2VQSA 4X84A 2BHSA 1EESA 2YXNA 2ZTUA 2BP7A 2XDQA 5DF1A 1L4UA 4M89A 4XLZA 1X15A 1GG9A 3EQZA 1GZ7A 2ZRGA 3ANLA 2VP6A 4Z1MA 2CLMB 4YDQA 1Z6AA 3HFRA 1M76A 5DLDA 4CE6A 5FLXA 2BMWA 1I6WA 1E94E 1P9WA 2GN9A 2L17A 3N6RA 2JK1A 4MUXA 4BEVA 1MIHA 2YXBA 1TUGA 2DBYA 1XNJA 2ZB8A 1U9YA 1N33B 1MX1A 2PUFA 2PRIA 4CG3A 4F46A 2AR7A 2HOQA 3ESCA 1VG0B 3KKKA 4HHEA 2HWXA 2GPAA 4R83A 5L4SA 3ROXA 3WLQA 3WWCA 1HQCA 2OP1A 1LV7A 4FHZA 5I48A 1SXJC 1V1RB 2CB0A 1JEYA 3VU1A 3DDHA 3KWMA 2ZBPA 3P20A 3GQBA 2ONKA 3Q15C 1R5NA 1RTKA 2CEKA 1T5IA 4YBRA 4QJ3A 2G5TA 2G04A 3IEKA 3RS5A 2RD2A 3WNBA 2X8LA 3C5VA 2FK8A 1SVNA 1TO6A 4BMDA 3UTCA 3DHWC 4KBYA 3RVSA 2ZBDA 1N5LA 1UMKA 1T5TA 4CCYA 4GLJA 4DY4A 4UHHA 3PNOA 1GYQA 3SU8A 4AF6A 5HW0A 5KYGA 2XZDA 4OGFA 1OZGA 1DBQA 2P5TB 2YJTD 3AEXA 3V5NA 1YQWA 3DMNA 4GC5A 3CLTC 3FTPA 4JH0A 1Y82A 4JFAA 2A6PA 4INJA 3ZLJA 3CWCA 1EWRA 4CODB 2E4VA 2CLLB 2WUEA 3FX2A 2C4WA 3ZS9A 1NQTA 4TYWA 1J1UA 3TQFA 1WDWB 4DC9A 4YLYA 2XCQA 5CTJA 5FI0B 4JXZA 2Q7OE 3MTQA 3GBSA 4RIEA 4F8YA 3VVCA 4ARUA 3RQIA 4D9EA 1DKRA 4GPIB 4MPDA 5MGNA 2QP4A 3ITNA 5EJEA 3ZXXA 4X45A 2DY0A 2W2PA 2Z1NA 10MHA 1WSAA 3ZI7A 3ULKA 4ESEA 1M54A 1XLWA 4L51A 3TL2A 4BLTA 3GLHB 3FYCA 4F1JA 1X1BA 5CA1F 1FZTA 3I2YX 3I01A 3VPXA 4AWXA 2PKXA 6Q21A 1F7VA 3ND9A 1F8XA 2B5VA 4F96A 3CW2A 2F62A 1U2TA 2WAOA 2AUNA 4PBSA 4EA8A 1U4SA 3TG8A 4XOUA 2IBMA 3MNFA 1UJ2A 1ECBA 1Z45A 4QLAA 1QC5B 4KW7A 3ZX5A 3EVCA 1EM8A 4MARA 3NHSA 2Q07A 2WR8A 1KTVA 5I9BA 4J75A 2IUSA 2VNIA 4U7PB 4S2UA 4D7AA 4EPVA 4FZ3A 5A5GA 2ZIXB 4F6CA 5BMVF 4BKRA 1T9BA 3ZHUA 4BFTA 3P26A 4OHUA 4C76A 2QYTA 3BWVA 4CMIA 3NRBA 2OA0A 1AKRA 1ZIOA 3BE6A 3MLAA 5L4NA 2W11A 2JLBA 3BG5A 4MPTA 4Y2UA 3NTRA 4BC1A 3LDHA 3NO4A 3TMYA 5LM3A 4MGEA 1EFLA 3ANYB 4CM5A 4UHFA 3LQ4A 2HXSA 2XZPA 4G5FA 5CX1A 1OTXA 2O2SA 3BMOB 1BQEA 3E70C 1R0BA 3UYKA 1XE3A 1QFZA 1JFFB 2KI5A 1ISSA 2ZIUB 3EIWA 2AJBA 4RFLA 2ZCJA 2BISA 1FXWA 4IRMA 4BO3A 4DR4B 1XZHA 2RGWA 3TEFA 4DSZA 1E3SA 3CUVA 1Q1NA 1RWMA 3VPFA 4JKYA 1PWZA 4REMA 1MQSA 4R3NA 5BQOA 1B0AA 4MYRA 4WY2A 1NQUA 4FFWA 3FUVA 2IZ5A 2D54A 1PZXA 3L1JA 3ZY6A 3ZVRA 2VZ0A 3O8RA 1ADYA 1W25A 5HF8A 1EVIA 2A86A 3F96A 2HJRA 2ZRFA 3K6KA 4IO1A 2A3NA 4NG5A 1JG6A 2VWQA 4E5VA 3RADC 2BE7A 2CUTA 3FCCA 4GM4A 1ENOA 3Q3GE 4LJ6A 4NEGA 3SSNA 1CW2B 2WTBA 4MCIA 2VTBB 4CEHA 3JS5A 2QXTA 1UMCB 4RD2A 3PVSA 2C4KA 3OIUA 4P4LA 5A5DA 1A9PA 1THZA 2IZ7A 4MHTA 1R12A 4JQCA 2XGGA 5AVYA 4P82A 1E92A 1O0SA 2XNKA 3C6QA 3WRXA 4Z9BA 4RK0A 5HDBB 4M1WA 3RUHA 4UM5A 3TD6A 4WMLA 3JAWB 4UU0A 2FOXA 4M4SA 3GRPA 2NUAB 2G9UA 3TSAA 3IEPA 2I9PA 4HFJA 3ZX4A 4D4JA 1EEXB 3AP3A 2X8WA 3OECA 3OY7A 2QRKA 2QLFA 2VK2A 3L5KA 3K5IA 4HB4A 3CY6A 1SUSA 4TKLA 3FFBA 1RPJA 1BN6A 3OWHA 3R4VA 1MZVA 4CUKA 2HMTA 2HWUA 3FVTA 2QYSA 1TM3E 1M5RA 3CXUA 3MRTA 2J59A 1I3MA 3WNDA 1ISIA 3KEMA 2W8ZA 2I1WA 5ADVA 3CBQA 4EPTA 4YPOA 2HRQA 3N5CA 4TTSA 3COPA 1LSOA 3PRYA 5G4KA 5ITSA 2YJ4A 5JD6A 1LXCA 1XSEA 4RAQA 4LHYA 4MUHA 2DFPA 4ZEVA 4M9UA 1XKQA 1PR5A 3FUUA 5F9HA 1OX4B 3KT3A 4RPIA 2PZLA 4FDLA 3ROQA 5DE3A 1JVBA 1WCIB 3CWZA 3NFYA 2J85A 1G21B 2XCTB 4QOHA 1VI2A 1Z4LA 2IYAA 1MN6A 3CTMA 2X40A 4QRDA 3HCCA 3QXCA 2CL6X 2IXFA 5BSHA 2FOLA 5ILGA 1IHPA 2A78A 3WYGA 1UCFA 1OLXA 1Y1LA 4UU7A 1CR1A 2WTAA 3K0EA 2XITA 4OSOA 4YAEA 4P35A 4JKOA 1H9BA 2QRHA 5HIIA 2Q8QA 1FDTA 2CHVA 3MAAC 4H7HA 1IZ9A 4KTVE 1F14A 1XMOB 4CCAA 4NDAA 4X7BA 1N1GA 3PIRA 2VF4X 1T36B 4U00A 2AIRA 2FPIA 5TS2A 1NVXQ 4PFQA 4TROA 1KVUA 3GHYA 3H84A 1P62B 3D8TA 1QHHA 4OATA 1RXYA 3DL2A 4FGJA 1RZRA 2WIAA 2G9NA 2BWJA 5HBGA 5CFZA 4RSRA 2B9VA 3I2HA 3INRA 3G2HA 8ADHA 3HO1A 3KSMA 4I14A 4MPPA 2ZJ2A 4OQYA 1GP2A 1J00A 4UXJA 4HJRA 1U8ZA 4FNGA 4Y0AA 3NRJA 3DL0A 3X1JA 1ZR2A 4WI1A 3BGDA 5P21A 3BHIA 4BWFB 1TVCA 1HNNA 1K1EA 4FNMA 1T4CB 1A9QA 1GCAA 1SUCA 2I2FA 4M8IA 1EQAA 4AQYB 1MMFB 4JT4A 5DHQA 1VBFA 2PA3A 4IIUA 4F9FA 3PI6A 2HBQA 3WLKX 4GXQA 4F45A 4JBIA 3V8PA 5JD5A 2FPGA 3B1ZA 1RRFA 4MAMA 3UWMA 2QT9A 4CKBB 3PPXA 5EQTA 5JXGA 1Z5NA 1JQAA 1YQDA 4L6AA 3AV0B 5KDOA 1M67A 1C3VA 5HK9A 3A27A 4YMIA 2DWPA 3AHIA 3L8MA 3IVCA 3L8GA 4X7RA 2GM5A 3QH4A 3VH1A 4DQ0A 5J1SB 1XCJA 2GJ8A 2XB6A 3S2UA 3A9CA 3IELA 4MINA 3GJXC 3KQWA 1B00A 3G7UA 3V46A 3R75A 1Y3DE 3D1VA 4I3FA 5CB4A 2XNJA 1REQB 3GZJA 3ZU2A 2Z9DA 4DZZA 3WB2A 3RQSA 5AVVA 3LWBA 4FOTA 3TNJA 4YDRA 4QBKA 2C2OA 2YR0A 2I1VB 4ZCSA 3MC1A 1E9FA 1CTQA 3DUWA 2LP4Y 2RGAA 3W7AA 4A0SA 1FP4A 3GC6A 5F73A 3T9FA 3VZPA 3DT8A 4KO3S 1E2HA 4WJLA 3E2MA 4B8ZA 1XU9A 1Z2OX 3ZQ4A 1EMDA 3V1NA 1EWVA 1NJFA 2GZRA 4JCOA 1N78A 4KRYA 1E8DA 3GY0A 1DL5A 3KXKA 2L2QA 1RYEA 2W4QA 4FKMA 4N8SA 3OX1A 5KYXB 4OL9A 2ODBA 1VE3A 1H3NA 1N0IA 1U0RA 2V4ZA 4BQQA 4EPWA 1XYVA 3I1JA 2Q99A 2HJWA 1PFGA 4GZ5A 4R1LA 4E3WA 4C0QC 4C7VA 1KKMA 4CGYA 3WYFA 4ZI7A 1JHZA 3W2EA 2Q2NA 3RVNA 4B83A 4LHVA 3JX9A 5AKGA 1ATIA 3PNSA 1DGQA 3AVQA 2I1LA 2TMGA 5JDIA 4PWYA 5DYIA 3BH7A 5HR5A 1C1YA 4LBWA 2WWHA 2OEPA 1IXSB 1K9SA 4F5YA 3W5CA 4DUGD 4MQEA 1ZITA 4MX8A 4K6GA 4ALKA 4C5AA 3F1LA 4K26A 1P61B 5KEIA 2VQ3A 2X1VA 3KAPA 5F51A 4MVCA 4C6HA 1OKKD 1EFVA 2KE5A 4OKNA 3QPAA 2ZR0A 5IAKA 3IMGA 3L02A 3PQ8A 4HN2A 3G9XA 1ZUIA 2GN2A 1THGA 3JQ8B 2WQ7A 3V2HA 3AL0C 2O2ZA 3EDRA 1XRSB 2PZ8A 3UMRA 2BHLA 3ZNOA 3CZCA 1W9MA 2C99A 4YJ3F 1YVDA 5HCIA 1L7OA 1KXZA 3VMMA 3CJQA 2JGAA 4I4TF 3CSSA 4MRAA 2BSXA 2CNWD 2ZI6A 4U6QA 5BR4A 3TZCA 5EHZA 2QN6A 4OQLA 1F2UB 4C6TB 1K27A 1PU2A 1GD1O 2PHZA 4RVCA 1SCKA 2MR5A 2PVSA 5AIBA 1HOXA 2NUBA 1O6CA 1ISPA 3ACCA 3K53A 4RQAA 5AM0A 4BLOA 1O4VA 1X1SA 2B8EA 1Q7BA 2EGUA 3K2EA 3KXDA 3GGOA 2IPLA 3Q3VA 3VHXA 4ZJZA 2VP3A 1GG5A 3PTLA 2WG1A 2ZTSA 4IKOA 1QK3A 4K8RB 2P77A 4KQWA 3B7PA 4NMWA 3LF1A 4PAGA 4C7BA 1HTWA 1GSOA 3ZJVA 1E3WB 1KDTA 4LK2A 1ANKA 1BWPA 1WP9A 4IILA 1JW9B 5JH7B 1C7QA 2NO1A 3H8VA 4RHXA 2I4NA 2G17A 3MBKA 4WKGA 5IBPA 4WZBE 3T3MB 4BP1A 1YB7A 2FN3A 3QF7A 1ISMA 5BYBA 2VZLA 1NUSA 1HF3A 3ZWQA 1KH2A 1QOQB 2H5JA 3IQFA 5GOTA 1Q1AA 3KIPA 1F7UA 3H5TA 5EXTA 2YXLA 4D6PA 5KYWB 4AI6A 4RA9A 2ZM6B 1PVVA 5YASA 4FCCA 4BAUA 1C0LA 3RVRA 4PZPA 2EZ9A 3TKLA 2CB9A 1PQYA 4KXYA 2XPCA 5GGXA 5HOEA 2JBAB 3LI2A 1L6RA 3NW9A 1O94A 4R4JA 1UXHA 1WVIA 4S2EA 5AFSA 3MWGA 3X1YA 3E81A 3ETGA 3I9LA 4AAYA 2ZT7A 1A82A 3H5LA 2WF6A 4OM8A 2R44A 1JFTA 1OU0A 3KTFA 5HYVA 4NCAA 5GINE 4OGLA 3DF7A 1Z0IA 4HXFB 5LCXA 1HE1C 3HVUA 4H3KB 1M2HA 2BFWA 2CJWA 4UQPA 2D5BA 3GPDG 3JXEA 2CMFA 3LCUA 1XAHA 4C05A 2WD8A 3B9BA 3KJIA 2PGXA 1WSWA 3UW1A 2O8BB 3FMPB 3PNBA 2Q1UA 1KPGA 3CNOA 2EX1A 1RADA 4YAKA 1HT1E 1JE0A 3NM5A 3KQPA 1SCQA 3IL2A 2R7NA 4DAEA 2ZQZA 5AVKA 1IOWA 1YDEA 5DHSA 3HYTA 4FYMA 1KZHA 3ZHVA 1U3DA 1ETUA 4FXPA 4U3JB 5A5FA 2ZP1A 5A05A 1QU2A 2B7CA 2I6GA 1VRCA 1HRDA 2I1QA 3IVRA 4LJ4A 1TZJA 5BWBA 4ZVSA 3RT7A 1I3NA 1ZZEA 3CVUA 4MQUA 3H5OA 1LLFA 3M8KA 3NIWA 3QKWA 3KQKA 1P4JA 2FWNA 2BP7B 1YJAA 2X1LA 1P4SA 3OP4A 4IDBA 1GPNA 3BIXA 4D4GA 4A4DA 1XQ1A 1Y1QA 2X4DA 2DFLA 3ZY4A 1JLSA 3A26A 2WKPA 4MYSA 4BBPA 1OCEA 3KELA 5KQLA 5K0BA 3C6ZA 4EFDA 4GVPA 3WA7A 3QF4A 5ALHA 3I9JA 3GAFA 3CF4A 3R74A 4AP6A 3TFWA 2IHTA 1P4AA 5DN6A 1JTVA 1ZLXA 2WJJA 1GSHA 4ZEOA 3WK7A 1MR3F 1RXWA 1YVPA 5CIWA 1N3YA 1LW6E 3E5RA 2FXVA 4LF4B 3GD7A 3V32A 4FFRA 1GAQA 1MDBA 1BKDR 2AMVA 1KSFX 1PJ3A 1QBGA 4QASA 4WLEA 4FMDB 1VKOA 3K9BA 1JEYB 5C37A 1OIVA 2I7TA 2HJ9A 3C3PA 4GXNA 2UYQA 2SKCA 5ALTA 4D92A 4F4DA 3WGVA 5JRZA 2X8JA 3ZU4A 1KRHA 2C5EA 1LD3A 4TTTS 5CM8B 2BOVA 1EGMB 3QLEA 3JQPA 4LDPA 3RTBA 4CKWA 2YS7A 3WJAA 3KWFA 5AVJA 3D2CA 4AECA 3RW9A 2V4UA 4PLPA 1QTIA 4EUKA 5IUJC 1M7BA 4K9SA 5DTIA 2LPMA 2FX3A 2O7SA 4HBGA 1Z83A 3F78A 4J43A 3TNYA 4YHBA 5FXMA 4BASA 1QO0A 3L7KA 3LUPA 1YZVA 3WADA 1KYWA 6LDHA 5HFAA 2FPWA 3VPCA 5JXHA 2VWHA 5JSUA 4K6HA 2J6BA 4PVCA 3GFPA 2FB9A 1VL8A 2Q5IA 3ASVA 5DW0A 2O48X 3BRQA 4YPFA 1V7ZA 4GU5A 2P4EA 1J06A 4PF1A 3TGPA 2P1DA 1MX9A 3AK4A 4ATNA 4U7HA 1CT9A 4QAJA 2XUAA 2C31A 2R6AA 3IBTA 2FQQA 4G1MB 1E6LA 3G6WA 4G01B 5G40A 1MRZA 3MCWA 2BM0A 2J0UA 1TZMA 4A0RA 3I5XA 4PO3X 1O0BA 5LA6B 3DV9A 3OH8A 3R09A 5DGDA 1YZGA 2XSZA 4GAEA 5CGZA 3SJCA 2G67A 1LI7A 3WK8A 1PZMA 4AC9A 5E3JA 1L1RA 4UKDA 1CLEA 3GMSA 2AJ8A 2RAVA 4G8DA 2LCQA 3SHOA 3UPDA 1T4GA 3H1GA 2QWXA 1Z75A 2FZCA 3UT5A 4B7AA 3FTDA 4MUNA 4F84A 2JEZA 1FSZA 4P5EA 4GT1A 3CTPA 3HKBA 1VG1A 2X0EA 3LA8A 4LKOA 3OQMA 4MLZA 1TTHA 5E1OA 5MGBA 4CEJA 2P4SA 2QN8A 4BS9A 5DNYB 3SZGA 2JBWA 3H2KA 1EM8B 2JATA 2BSQA 4L8YA 1VTKA 1SUPA 2C2GA 2R8RA 2ERCA 3L79A 2BGIA 2C3UA 5EUQB 2PS1A 1WY5A 4MGYR 5K3OA 3TTTA 3IJRA 4E15A 5LQUA 2J3EA 5ARBA 2F8LA 4TQGA 4Q3BA 1S89A 1JAHA 4CMIB 5BWOA 3A6PC 5TQVA 4EEKA 1Q17A 3RU2A 1C0IA 1IWPB 2BJWA 5JNVA 5LR6A 2JD2A 3EAFA 4G25A 5FLEX 1K2VN 3UJNA 2XY4A 1FYEA 2VNAA 4A5OA 4D25A 1ENPA 4OHRA 2Z2IA 3PITA 3FWYA 3KUCA 3LSTA 2WWYA 2J6IA 5DIFA 4KWTA 5I9TA 1RQGA 4ZU1X 3ZCPA 1SQ0A 3W8FA 4OQDA 3IC5A 1EB8A 3TQTA 4EGSA 1T15A 2HIAA 3R4CA 2VVTA 3SS8A 1DCKA 3V80A 2E6UX 1PX0A 4KAJA 3K5WA 3AM1A 1G3QA 1ZLYA 3JRXA 4I9NA 2XCUA 3G5UA 1M1YE 4Q6WA 1ZC3A 4Z9AA 2V3CC 4HEHA 2VHWA 5AJZA 1N0VC 2HT1A 2CLHB 4JSRA 1FFGA 4L7QA 4CV3A 9ABPA 1MB3A 2B1QA 1LDBA 1Y98A 1TCBA 2EWMA 2OCLA 1GT6A 2YXEA 2WU1A 4US1R 4BUCA 3S40A 4XSGA 4LXUA 2CCKA 3I8XA 1G5HA 2CVPA 2COUA 2UUBB 5AUNB 2UV8A 3IVXA 2XT0A 2DQ4A 2OV6A 1WS6A 1QH0A 2NUTA 5HILA 4G07A 2ZVJA 3D3WA 3ROFA 1EX6A 1TIBA 1ODTC 4RTOA 1GTVA 2EJBA 2OYRA 2NPOA 3T1TA 5CAEA 2CV2A 4HTAA 3H99A 1L5KA 4HWRA 2JIDA 4JELA 1CD5A 1C30B 1IAVA 4KQ1A 5E2IA 4FYWA 5B53A 1MIOA 2E4WA 3A4TA 2GNPA 2WK1A 4M0EA 1Q91A 1LK7A 3F90A 2EFJA 4YDHB 4A6XA 2O0LA 4BWGA 4CDMA 2Y93A 3EH2A 2HO4A 3OLYA 4QBFA 1T26A 3ZGXA 1MUUA 1T0IA 1LLCA 1QKKA 1JWAB 1PR2A 5K3BA 2UVPA 1OX5A 3B3GA 1AZTA 2X6QA 1K97A 1VSQA 3IEUA 3E35A 1EX7A 1KEVA 2HA4A 3EGOA 1N8KA 1OFHA 2HL6A 3E9NA 2O0HA 3IJ5A 4LMBA 4ZT7A 1I2DA 2VA9A 1X2EA 3EVDA 4D0LB 4ALJA 4EWLA 5CT4A 3M9LA 5G4KB 3MJFA 4OQFA 1KK2A 2O8CA 1ODIA 3OTOB 1O58A 1XDSA 1RZUA 4AJKA 1WUKS 2XQIA 1YC2A 3AHGA 4B7ZA 4D41A 5DX1A 3KV3O 5CA0B 1GAJA 5LQJA 2PBLA 3X1WA 4ON9A 1VIDA 2N0SA 4XB1A 5KOIA 1SR8A 2OSVA 4U7FA 1R37A 1KWGA 3RANA 2C2KA 1ZCJA 5AI6A 1Y8CA 4NI5A 2ODEA 1XTPA 3R5HA 4I5EA 4MSUA 3AC0A 1ZXXA 3P0JA 1M2FA 4WEQA 2G6BA 3D43A 3JZMA 3WMGA 1W6UA 3PJDA 3MT8A 1DC3A 4M0MA 1A5BB 2IBTA 1OVMA 2NSDA 4H27A 5FADA 4LF5B 4UBMA 2O7VA 1R88A 3G8BA 4HNQA 1W29A 1TQHA 1QM5A 1WX1A 3B36A 4NLLA 2IOFK 3W8NA 1OR8A 1U1FA 2JGJA 5DCWA 5FHRA 4F5ZA 3H9GA 4PO8A 2FPIB 3MCAA 3SR0A 1ZJWA 1GPUA 1I0IA 2AZDA 4F97A 1HLFA 4JC8A 4QXPA 4RULA 3ZGZA 3T38A 3B7GA 3PLNA 5DM1A 1RZRD 4KB5A 1DBRA 4QEDA 5K4HA 4EL0A 5HK8A 1NE7A 3KXIA 3N2NA 1XHFA 4X54A 1H2EA 2RHWA 4X8OA 3C8UA 4GSLA 1B16A 4MI6A 3WGGA 4D45A 3DQQA 3HABA 2AN9A 4UMEA 1Z6QA 1XFDA 3W4JA 2EFCB 4KLZA 3BCRA 1K08A 3PJEA 1UM9A 1EINA 5JANA 1Z63A 1L4BA 3FRHA 2FR1A 3G02A 5B58C 2FSUA 3ELUA 3P1JA 4GSKA 3O5AA 4Z6KA 1TVEA 3ENVA 1XALA 1KDVA 1O5OA 3B2QA 2R7KA 3K31A 3WLTA 1A1SA 3KJHA 4RTSA 2RGGA 3AR4A 3GFFA 2D7JA 3IR6A 1N3IA 5BPFA 1GR1A 5H7XA 3H3XA 2H9AA 3HBMA 4KGDA 3OZ7A 1GO2A 5CB4B 5DYNA 4O1IA 4LJ5A 1DUSA 4MIOA 1D2EA 3DMPA 4LBZA 2BH2A 4RXMA 3KYCA 1N8SA 1U0TA 2QG4A 3X3HA 5HTKA 4CMKA 4DDUA 1FP4B 2Q1YA 2VDVE 4J03A 1HPLA 3Q5EA 4GMDA 1N2HA 4JDPA 5JBIA 3HBNA 3K4HA 1ZY2A 1PQWA 2AR0A 1UH5A 2ZI5A 4C0AC 2I7DA 4EDHA 5BV8A 2GM4A 1NBME 3GGJA 4Z8YA 2ZSDA 1KYYA 4LMPA 4V24A 2VYVA 3VNVA 4ZEWA 3W2GA 1PR9A 2DKOA 4J91A 1T1RA 4G9BA 1CETA 4QODA 4G85A 2D2IA 1TOAA 4Y30A 1FFWA 4FJ1A 1UK7A 3UKDA 4RGBA 2P90A 4L85A 2ZVDA 1YDHA 3BGWA 1S01A 1G98A 1P0FA 4NCHA 3ZGOA 1KYTA 2LIPA 4ZI7B 1C7FA 3MCVA 3UMSA 3HXKA 4Q7EA 1MTZA 1Y9AA 2QR2A 5FPTA 3RWMB 4BLSA 1JQ5A 1HEIA 2GRAA 4JEIA 2B1GA 3IYLW 4PZZA 4ZHQA 4RA6B 1ZMOA 2XQVA 1XK6A 2WKQA 3R9KA 1Y8AA 2UVQA 4BATA 1WULS 2W2LA 3RRBA 5U1PA 2A5YB 2BPOA 3B6IA 1D4ZA 1XQ6A 5EIHA 5F33A 1OYWA 1CUDA 2EBUA 4MKRA 4MQEB 3P94A 3IAHA 3SYMA 1Z7EA 2WNHA 3HLKA 3PUWA 2VDNB 4X3CA 3T7CA 4D3SA 2YV4A 3BWYA 1RPNA 3BXZA 3GP3A 1JECA 3J81A 3FNEA 4TWBA 1G5IA 4HKTA 1KVRA 1NOIA 2EJUA 3ABZA 3KJZA 4PLGA 1RQRA 1RTTA 2VPIA 3A11A 1GT91 3ZWMA 5CT8A 1E8NA 5FOWA 1E6CA 5ADHA 3B1JA 3RAPR 3UATA 5TX7A 3U6BA 2OAQ1 5BWLA 1L1QA 3I5MA 1X14A 3MTAA 2I8LA 4FE7A 3DTTA 1GV1A 1PEDA 4BRUA 2P9CA 2BTEA 2OOSA 3NBFA 2GXSA 4BZZA 4JSTA 3OJEA 5A3VA 4J76A 1U2SA 1EBFA 4EARA 5REQA 5LLTA 1U28C 1KOJA 1T10A 1F5SA 3LE8A 5IF9A 5DLQC 1S8NA 2HQRA 3C2QA 3N8GA 3DFMA 5AK4A 1I7PA 2PRKA 3NEAA 2O8EB 4LTNA 5EZQA 4J0DA 2GPJA 3QSGA 1U28A 2NYAA 4O59O 1E3IA 3LKZA 4JJ4A 2ADOA 4E22A 3T1HB 3DC7A 3NXKA 4NENA 4PVDA 1JHOA 2PX4A 3LQKA 5BUSA 3SMVA 4FM9A 1QF6A 4GYJA 1YZ3A 5EEHA 1V6AA 3MINA 4N76A 2QRMA 4DV7B 4E4YA 2E3JA 4ARIA 4E5YA 2XX3A 3UV7A 3VVLA 3IIIA 4NICA 3ZWWA 1YCGA 3ZE9A 1SXPA 3G2LA 1U0BB 3FCAA 3GUVA 3VR5H 4EJFA 1EXWA 2HXYA 4LE0A 2B20A 1FS5A 4E30A 4N4AA 2PYZA 5ETJA 2JFXA 4E5DA 2J9XB 1JEEA 3DE7X 4I50A 5J5CA 3SJAA 1B2LA 2ABWA 3PC7A 4YV2A 2OBMA 5IHXA 4G4SP 4GP7A 3DLIA 1EP2B 1O94D 1RYFA 4WV3A 3VR4D 5BN3B 1C80A 5KNDH 5DBGA 4JA2A 2HDNB 3BN3A 1PCXA 1HDZA 3UQZA 1IY8A 5FWYA 4ZAWA 3I61A 4ZWNA 2Q5EA 4CU5A 4QXOA 1IN4A 3AJDA 3NANA 3QLUC 1OGJA 5CH5A 4V2UA 2E1PA 4OQZA 1T2VA 4K0KB 4J8PA 4B2LA 4IGEA 1D2GA 3T9EA 3IT0A 3R8XA 4RUKA 4Q9JA 1OBHA 3QLUA 5H9VA 1Z4OA 1G55A 1QYIA 1YZLA 2ZGVA 4G67A 4L3VA 5GV7A 3A4IA 4A2PA 3HUTA 3K9WA 3IDAA 4D0GA 2NTNA 3CB4A 1Z15A 5JADA 4ENTA 3TQIA 3NP7A 4WXMA 1EA5A 1KZ7B 2D74A 4TL6A 2WJGA 2HKIA 4CLEA 4G8BA 5J2TA 3ZDBA 3HVIA 4KN5A 2X2PA 1Q50A 3H5WA 5KAPA 4Z4CA 5F7XA 1QPZA 1EUZA 4R31A 4UVGA 2EGHA 5LZ5A 4ZOLB 2AYYA 3IBCA 3IPYA 2CNNA 3A6GA 3I12A 1MVLA 3RYHA 1RJGA 4AZ3B 3BMCA 1CUIA 3K20A 4WFKA 4DB2A 1JPJA 1FVHA 3H2SA 1P9NA 1NAIA 2H16A 2D1FA 2AWOA 4LOJA 1QV7A 1M6WA 3QLJA 2B35A 4UATA 2C1EA 1UWVA 5K6TA 3ENWA 1GPAA 2XYVA 2QN7A 5DRYA 2VWPA 3M4NA 4IHJF 1GGVA 3PUHA 2HM7A 2Y2UA 4HUJA 9MHTA 1JIUA 1TTPB 4WK4B 3QF4B 2UDPA 3FLMA 3QFCA 2Y9PB 1FU4A 5AICA 4PG4A 4FW9A 5I4BA 4N3BA 4QICA 1SZDA 1X7ZB 4JLVA 4Q1BA 3VKWA 5DN6D 3D8HA 4K9DA 5DN9A 3BQNB 1X42A 4MS4A 2MSWA 1K68A 5GV8A 2DOKA 5G0UA 4YRIA 2GCEA 3KOMA 1A96A 3SZLA 5BRJA 8ABPA 4TUYB 5SYAA 4JI5B 4EENA 5CEJA 3NAQA 1LJLA 4OP1A 3TB4A 3TRHA 3WGHA 5LA6F 3P0RA 1T24A 3R3SA 3A1DA 4K86A 3KUKA 4YMWA 1C3OA 5HG0A 3RIEA 3E7PA 4ZT2A 3PCTA 3IP5A 5J2UF 3VKUA 2XVZA 4CQMB 4HCJA 4CKWB 4IX1A 4EKNB 1K6JA 4PTLA 4M38A 3PIIA 4YFVA 3RC1A 4CQMD 1Y4SA 3FMVA 2AKEA 2BMVA 2C78A 4D99A 1KF0A 1UBEA 2GYYA 1T2NA 2X3YA 2WT9A 4EG1A 4O4HA 1AZSC 1Q2UA 1LCIA 4XD7A 1RFLA 1H2AS 2ANCA 4B73A 3QVXA 4E94A 1QO0D 2J0SA 2DU8A 4DPMA 4ITRC 1DTEA 3THSA 4BMNA 4FP9A 4M1ZA 4KWHA 1A9XB 2VT3A 3QKUA 3V8MA 4L9RA 2ZZMA 1ZM4A 3KNZA 2WWXA 2RG1A 2ZREA 3QUCA 3QE2A 4IYJA 4ZVLA 3UJAA 5K0CA 3TZBA 3QIVA 1HETA 4ZT5A 2WMOB 2PZMA 3K1TA 4NH4A 4UEKA 3VHRA 1RHUA 3IV9A 4QWMA 4ALLA 4O29A 2H65A 3MRVA 1P1IA 2AOWA 1Z29A 1VI6A 4DILA 1SZPA 3FCXA 1PSDA 3T5BA 3SQWA 3TN7A 3AF1A 1MABA 4B85A 1N6RA 4U5XA 1N2BA 2C9MA 3G0OA 1E2FA 2XSZD 2YICA 3HJGA 4WE3A 1GM5A 3JQBC 1WTAA 2H0AA 1BAPA 1CVLA 2P2DA 4HLUC 4YLGA 5DHFA 3U4AA 2X14A 2GFQA 1G2OA 1RBZA 2ZUVA 3BGIA 4HQ6A 3UMFA 3UT5B 3GEGA 4PQGA 4Q5IA 3JQBA 1NYRA 2XRMA 1CULC 1NVMB 4P9NA 4B33A 1P18A 2RC6A 3HKBB 1AIPA 2RHLA 2OBLA 3GLFE 2R7AA 3D7RA 4X93A 3NEJA 2R79A 5FL3A 2B21A 1DV2A 5JXWA 2V6FA 4NU5A 4WLVA 1OOEA 2YWHA 3ZWVA 2QUBA 3J81k 3RUIA 3SP1A 1YHZA 3HJFA 3L01A 2NIPA 1TM2A 1NIPA 1T0PA 2N1MA 4R1NA 1R0YA 3EHDA 1JAZA 3NS7A 3QTLA 4WOKA 1C50A 3IPRA 2VUIB 3DLHA 5CEFA 4XWOA 3C6YA 3CIOA 1A8UA 3L2OB 5B6PA 3GZNB 3PXDA 2EFYA 2ZR8A 5F52A 2ID8A 2FK7A 3WLOA 2WEKA 1LPMA 1O95A 5FFFA 3W5HA 4CDRA 2IUFA 1IOLA 4WN9A 1AMUA 3NOOA 4TQ9A 1SUIA 2M32A 4MW7A 1E6UA 3X43A 3PPWA 2YIJA 4P3NA 4I46A 2OCKA 3MUFA 4V38A 2DR2A 2BT4A 3HHPA 3RTAA 1PDVA 5A3JA 1XQYA 4GZ3A 1S7CA 2IUTA 1UKBA 4MVJP 5EKSA 1CY4A 3WRYA 2B8TA 5I7SA 4Z4HA 1TQ6A 1E2DA 4LDJA 2FG5A 5G1NA 3N2ZB 5CG1A 2A4KA 4F71A 1XEWX 2RGBA 2R6HA 2VEOA 4N5LA 3FUXA 2WJYA 3VC1A 2NU8A 1H9CA 5EWJA 1UT6A 3A4YA 1NM5C 4I66A 4XCVA 1B76A 3AVVA 4C5CA 5IWCA 5FBLB 2VHXA 2CUZA 5FPPA 1R8QA 3DPSA 4WVLA 1DIRA 1HEUA 1NM5A 1ZMRA 3OZIA 1OBCA 2ZYDA 1NYLA 4HAWA 1WJGA 5ALVA 3LUHA 4IUBS 2CKDA 3KL4A 4JJIA 5KJFA 1I5RA 1YJXA 2CN1A 5CLGA 1R64A 2ZYGA 1K06A 1YS6A 3D9QX 2DFNA 5JS6A 3TX2A 1E99A 1JG7A 2Z4SA 3X1ZA 2WHXA 2C3OA 2WZCA 3EQ9A 4ROSA 3RLIA 3D3WB 5KIAA 1WHTB 4Y2VA 3BBLA 1FC0A 5CA0F 4DLSA 3LYHA 4H1HA 3KPJA 3BWXA 2ZS7A 1DIBA 2C7PA 2Q5HA 1E3QA 1SD5A 1NNLA 1QMGA 2W22A 2O8DA 5CJPA 3L43A 1BROA 1KO8A 4FMCB 4EX7A 4GOMD 5JBNA 3E9EA 4D4KA 1OTHA 2AUTA 1CFZA 1ILWA 1NP3A 2G1AA 3CZPA 4BVGA 4BE7B 3W3ZB 4ZXPA 4KFRA 5THXA 3GG9A 4OFWA 4H16A 4ZU6X 2XRZA 1P6XA 4HNUA 4LNAA 4M1OA 4R8SA 3W3AD 4IIJB 4HGQA 5EJ4A 3F97A 3DD5A 3E5HA 3X1DA 1DV1A 1RU3A 3ZD9A 4IWNA 1OYYA 3BHMA 3LPLA 5CVCA 2FUCA 2JG3A 2EAUA 1QRSA 4PN7A 1JU4A 4J9UE 2O8CB 2QL7A 2WJZB 2WWTA 4W99A 5DNAA 4B3HA 1E3MA 4OBXA 1UFOA 1D7OA 1ZW1A 2ZRKA 3NONA 5JEEA 2NUPB 5E3IA 1RKUA 3QNUA 4G5HA 3RHFA 3RIXA 1GG2A 2PYIA 3FHOA 2FMHA 1D0IA 3L40A 4NYJQ 1PIWA 5B58T 4Q9AA 4BLRA 4TV8A 4AW9A 1RWNA 1AURA 2MSDB 2ZYSA 4XUDA 2YCBA 2WJ3A 4BCDA 1A7JA 3T94A 3DOFA 2IKSA 2PS0A 3QE0A 1CEQA 1Y9DA 1PEAA 1RWOA 1TA9A 2C04A 3FFWA 3UGQA 1H3FA 3CA8A 4ZOCA 2RHGB 1DQPA 2QJOA 2C92A 2FEXA 4UVIA 1WMEA 4E21A 5IZCC 2ZUTA 2QN9A 4QDKA 2W2TA 4Z4FA 2P11A 4B75A 4D8YA 2YJGA 3MYRA 1SFRA 3JZDA 1QKJA 3M3HA 3ZCQA 3N5KA 3Q7RA 4DDMA 4PXSA 5LUBA 2CGEA 2F17A 2NNLD 1I32A 3GLTA 2H63A 2VWGA 2AOTA 3QKTA 4H4DA 5CB4F 5FAKA 5KSYA 3PGKA 4EGAA 2B61A 1KARA 5LB4A 1J90A 3MXOA 3DEZA 4C0SA 4CG1A 3LUBA 4TKZA 4Y2QA 3RVOA 3ANNA 2I2BA 1Y1PA 3QYFA 3IOBA 1F1JA 4EF6A 1A9SA 2BLNA 5FULA 4YCSA 1E1QA 4I08A 3LMKA 1EPUA 1ZM7A 1DLJA 2A0UA 1I51A 2Z2YA 4QGGA 4KZKA 1X9GA 3O84A 4RKFA 4B74A 4P5PA 5DISB 4URFA 3PC3A 1V5WA 4OK5A 4YJ2B 1UM9B 3MWEA 1BX3A 2X6RA 1Z12A 3L82B 3O82A 3FOEC 4DLZA 1NQXA 3EGVA 2GJAA 4N49A 1BXRA 1NMXA 3OZBA 2AR9A 1MRSA 4MEAA 2JI4A 2DSTA 4PG6A 3FSGA 5B7PA 3THXA 3RFTA 4ZRNA 2H6EA 3UG7A 5KX5A 4HLDA 2BMAA 2YWDA 2ZOSA 3NJ8A 1JIXA 2QTTA 5AM1A 3RFVA 5A9SA 621PA 3SIPA 5U9CA 4FBMA 3R76A 1P0MA 1QF7A 4ZI7F 3IP1A 5KYUA 1YOBA 1L6IA 1QIEA 4UVHA 2ETVA 3AM4A 1L5ZA 3CM0A 5T3UA 3T52A 4CHTA 4WKBA 3GPIA 2IEZA 3CURA 3KYCB 3Q6MA 4MS3A 2QUKA 2AOXA 2HMVA 4YRQA 3FWZA 5TR9A 1BMTA 1L0BA 2FW7A 1GSAA 1NUAA 3HNRA 1SCNE 3ZU5A 5KPJA 3OZWA 4JI3B 1IXYA 4K88A 3I58A 5EHGA 3FZNA 3NALA 4UQOA 5ECDA 5JSZA 4G1FA 5DGTA 1RXVA 5B1YA 1KJ8A 2IXGA 1XJWA 2BCJQ 1NOJA 3L0SA 4AJNA 4MA4A 4EW3A 3FPKA 3I83A 4OXYA 2IU0A 3I04M 3ELYA 3G23A 2VYVD 1KA9H 3D54D 1FVFA 2J0EA 3G2MA 5TT1A 2JJYA 1ECLA 3AR3A 4LK3A 2I55A 4HAYA 1SVLA 2R8XA 5EJAA 4CEHB 1R9JA 1E1DA 1VLJA 4LCBA 1HTBA 3KT8A 3TKAA 2YQZA 4B48A 4RSHA 5A4DA 1YR3A 2DFVA 3G0IA 2XWSA 1BDIA 5A62A 2R86A 5A7GA 2DBQA 4QNRA 1SN7A 2Z2KA 4DUPA 1Y8ZA 1JSCA 1QQ7A 5TGDA 2J7KA 1FVXA 3L7DA 2ASVA 3N0XA 4NYIQ 4F6RB 4ZHQB 2OBYA 1P5JA 3SNKA 3NC4A 4MROA 4ZZ2A 2GYWA 3V3TA 4EY7A 5KQRA 2W2LD 3BMQA 5ESDA 3B5EA 4D26A 4MITA 1Y6ZA 2ZPTX 3K1AA 4B43A 4IDDA 3KLOA 1JJVA 3TIXB 3HCFA 1J8VA 4WY5A 5T4HA 4AMZA 1U0LA 4XQCA 1RCTE 3H1PA 3DJFA 4OHZA 4EHBA 1FJGB 2QPTA 1JLLA 2QXYA 2CLOB 3B6JA 4RHFA 3GUYA 1IYZA 2ZB2A 3OSZA 5T4EA 4B81A 3ZHRA 1X1CA 1N8NA 1ZD2P 4NJOA 2XW6A 2JKZA 1NVBA 2F43A 1QIIA 2P67A 4CKEA 5I51A 4OB8A 4UAJA 1Q16A 2R84A 2ZYIA 3WKDA 3NB0A 3DVAA 1DJQA 2HT6A 3UUGA 3S2IA 3AERA 4KDEA 4C4OA 2P2CA 3JWEA 4JGBA 4XGRA 3ZWKA 3ICQB 4JYAB 4QYXA 4F1WA 5EE9A 1I4WA 3UMVA 2ZE6A 4LBVA 3G9TA 4E70A 4HK4A 5IVKA 1CUXA 1OV6A 1MP0A 4I6EA 4D42A 1GQ2A 1O54A 3G49A 1KIMA 4PSUA 3ZHXA 2PUBA 2WZQA 2FMXA 4Q3CA 1C0EA 2J08A 2HV9A 3AY0A 1E9BA 3VZSA 4UVEA 1FL9A 3IILA 3RSLA 2FPLA 2WUVA 1YAJA 2FZEA 4RH1A 4B9AA 4E46A 3C4JA 2CW5A 4RTJA 4JUCA 5E6RA 3OT5A 3RYCB 3MINB 4LV8B 3FJYA 3ZVLA 2KB0A 4BGDA 4BZWA 2GJKA 3WBKA 1K66A 2J5QA 4II7A 4M2LA 4X8LA 3W90A 3TK1A 1TZCA 4KC0A 4EYOA 5JI3E