2XVFA

Crystal structure of bacterial flavin-containing monooxygenase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
445
structure length
445
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
total genus 137
structure length 445
sequence length 445
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvfA02
5JCIA 4A5LA 2VOUA 1EL7A 4YTNA 4IVOB 1JRYA 4H2PA 4K5SA 5GRTA 3REDA 1KSSA 2R4EA 4GF7A 2ARDA 3E1TA 2BYBA 2C65A 4OPCA 4Z43A 4XWZA 3BI5A 4H4WA 4I59A 3UKLA 1ZK7A 3BHFA 4JNQA 2QA2A 1EL8A 3AE1A 3AEDA 3CTYA 3QJ4A 4A79A 1REOA 3ABVA 1LPFA 1YQ4A 2XFOA 3QVPA 4PAAA 3S61A 2YG3A 2C76A 5IQ1A 3AWIA 2WOIA 3AE8A 3D8XA 2YLXA 1FCDA 4E0VA 4EIQA 1H84A 1TDOA 4YWOA 4AOSA 5BRTA 3QSSA 1PJ5A 4B63A 4U8OA 2F5ZA 3CPJG 2FBWA 4Y4NA 1LVLA 5KOXA 1K0LA 1PXCA 4AT0A 2WP6A 4DSGA 1ZY8A 2YLTA 4H7UA 3T37A 3UOVA 5CKUA 4OPLA 1GXFA 1E7PA 1RP0A 4AT2A 3NIXA 4A7AA 1BGNA 1GNDA 1QO8A 2R0PA 3GRSA 4J34A 4J57A 1KDGA 4X4JA 4P9SA 3RNMA 4EMWA 2A89A 4J31A 1TDEA 1VDCA 2XDOA 2X99A 3M12A 5BVAA 5IPYA 5EBKA 4A65A 2R45A 3VRBA 5JCNA 4BK1A 3K30A 1E1LA 2XFPA 2J3NA 4H2RA 4UDRA 4DNAA 1GEUA 5J60A 2APGA 3GWDA 3G5SA 3QFAA 2JAEA 4CBQA 4EM4A 2V6OA 5KVIA 1NDAA 1FOHA 2R4JA 4OPIA 1GESA 2R46A 3ZYXA 4ZCDA 3V3NA 2RGJA 3NK0X 2BXSA 2FJAA 4TLXA 1N4WA 1EL9A 1N4VA 3I6DA 1F6MA 1MOKA 3CPIG 1NENA 1O5WA 3UOZA 1PDHA 1PBEA 2XVJA 4NTDA 2BCGG 4H2NA 1NHQA 3C4AA 3LZXA 2WP5A 4GCMA 1CBOA 1KNRA 4TM4A 3UCLA 3DK8A 3AEFA 1NG3A 3AECA 3CGCA 1MO9A 3EF6A 2Z5YA 1CJCA 2BK4A 2X8HA 3AE5A 2JK6A 1OJAA 1DOCA 4DSHA 2V60A 1NHSA 1Q1WA 3FBSA 4LU6A 3VRAA 4EMIA 1FL2A 3AE2A 5C3JA 3URHA 4B1BA 2AAQA 1XPQA 4CCRA 1OJCA 1HYUA 1ELIA 5C2TA 3CPHG 3AE6A 4BURA 1H7WA 1GRBA 4MJWA 1FECA 1DJNA 2OAMA 3UOXA 1LTXR 3GMBA 5U25A 5FS9A 4C3YA 4C5OA 3IC9A 1YQ3A 4NTEA 2VVLG 2YVFA 3NGCX 2XYOA 1S2YA 2WDQA 3DH9A 4USRA 3KU9A 3B3RA 2WEUA 2YAUA 5KVHA 4FX9A 4B66A 5M10A 3K7QX 2PHHA 3L1RA 3GRTA 1UKVG 2B76A 1F8WA 3ICTA 2E5VA 2OLNA 2GMHA 1JEHA 2B9WA 2WHDA 1ZOVA 5JCLA 4B65A 3UP4A 3NK1X 4H4QA 3NNEA 4OPTA 1L9EA 3AYIA 3AYJA 2JB1A 2C72A 4AP1A 1O95A 3AEEA 4YSHA 4GRTA 1PHHA 2BS4A 2XLSA 2FJDA 3DK4A 3G5RA 4X9MA 3P9UA 2WS3A 2WPFA 1K0IA 2VQBA 1Y56B 2GQWA 4H4UA 4OVIA 3NH3X 1MXTA 5FMHA 3UKAA 4EMJA 1NAAA 3DMEA 4AP3A 2GEWA 3F8PA 2EQ9A 4H2QA 3KD9A 3NYEA 1GTEA 5FS8A 1H6VA 2Q6UA 5IQ4A 2C7GA 3PS9A 4RSLA 3SGLA 3UKKA 1GRHA 1ZMDA 2BXRA 4H4YA 1XHCA 3KPFA 4UDQA 2VRLA 2WQYA 2YM1A 2FJBA 2Q7VA 4JNAA 4HB9A 4OCGA 4U8KA 4U8IA 3OC4A 3K7TA 4USQA 4Y4MA 3S5WA 1H81A 3BNUA 2BABA 3ADAB 1K0JA 1JNRA 2WPCA 3GYIA 4YSZA 4CNKA 5HHFA 2JKCA 3AE7A 4U2SA 1L0VA 2E1MA 5U1OA 1GETA 3NYFA 1F8SA 3H8IA 5HYMA 4O5UA 3IWAA 3AE4A 1GREA 1D4EA 3GDPA 3V3OA 3IF9A 5JCMA 1NPXA 4GDEA 1COYA 3OZ2A 3P4RA 4K5RA 4CY6A 3NN0X 1N4UA 3GMCA 3VR9A 4TLZA 2A8XA 3M0OA 2GAHB 2O9ZA 4U2TA 1TYPA 3UTEA 4Z2UA 1NHPA 1CJ2A 2JB2A 2AQJA 3NTDA 2GQFA 3AEGA 2B9YA 3Q6JA 2XVIA 2YLRA 3UKQA 3UTGA 2YVJA 3K7MX 2V5ZA 4B69A 1PBBA 4B67A 4YTMA 2VVMA 2YVGA 1IUUA 4JY3A 3UKPA 1PXAA 2VRMA 3ALMA 3GYJA 4Z44A 5JCKA 1H83A 2IVDA 1NG4A 2GV8A 4EQRA 1LJ1A 4YSXA 4A99A 2YM2A 3KKJA 5DBJA 4WCTA 1QLBA 2V3AA 2WESA 2XLRA 4YSYA 3DGZA 2GR0A 3L8KA 3RP6A 1YKJA 3FIMB 2Q0LA 2X8CA 1ZMCA 1TDFA 1Q1RA 3GWFA 2ZZBA 3H8LA 1Y56A 1P2EA 1RSGA 2R9ZA 4GUVA 4J2WA 4JY2A 4TM1A 4U8LA 2XFNA 3IHGA 3UKHA 4EIPA 4EQXA 1DJQA 1IJHA 1ZX9A 1D4DA 4ICYA 4Z2TA 1GTHA 1JNZA 1Z6LA 4FDCB 3FPZA 2C64A 2YWLA 3ATQA 3VQRA 1F8RA 3CN8A 4U8NA 5KRQA 1TDKA 4A9WA 1N1PA 1DOBA 3DJJA 1BZLA 3SM8A 2WETA 3P1WA 3NK2X 3NRNA 1FEAA 1XDIA 2GR1A 1B37A 5KOWA 4B68A 2EQ6A 2IIDA 3BHKA 3CNTA 1QJDA 2RGHA 1BKWA 4GR1A 4OPGA 2RABA 2YR4A 3GDNA 3LOVA 4K7ZA 1JU2A 1ZDLA 4H4PA 4AOXA 4Z2RA 5KXJA 1EL5A 3CGBA 3LJPA 5KWFA 1S3BA 3AXBA 3PO7A 3SFEA 4ECHA 1PJ6A 1EBDA 5FS6A 3SFDA 3CNPA 1H7XA 3DJDA 2GR3A 3C4NA 4U8JA 4ZCCA 3WE0A 1P2HA 1JOAA 3AYLA 3CIRA 5TR3A 3CNJA 3RP7A 2C73A 4K22A 4I58A 1SEZA 1VG9A 1LQUA 4D04A 2JBVA 1B5QA 4JDRA 4A6NA 1D5TA 1PBFA 2VVLA 1ONFA 1ZP0A 2YLZA 4EQWA 1GOSA 2BA9A 4LA1A 1L9CA 3NT6A 2XFQA 4IVMB 1LV0A 1KFYA 3C96A 3CNDA 4H4SA 1PN0A 3B6DA 1GSNA 2GMJA 2H88A 3AD9B 3NG7X 3VRDB 4O5QA 1X31B 2WDRA 2X3NA 3ICSA 3NYCA 2CFYA 5J7XA 4GDPA 2RGOA 2CVJA 3QVRA 2C3CA 3AEAA 2UZZA 1GRFA 3NN6X 4YT0A 1GRTA 3NKSA 2YG6A 1W4XA 1IUTA 3O0HA 1PJ7A 4CCQA 4C74A 1M6IA 2GAGB 4B64A 2VQ7A 1Y0PA 2C66A 4CNJA 2IVEA 4ZN0A 3ATRA 4UDPA 4BV6A 4NEWA 1GALA 1FEBA 1D7YA 1PXBA 1IUSA 1YY5A 3DA1A 2GR2A 2WU5A 2TPRA 4BJYA 3GSIA 4CRTA 1F3PA 1GPEA 4EM3A 2FJEA 3EANA 2PYXA 1V59A 2HQMA 4H4TA 1TRBA 2GH5A 2A87A 2ZBWA 1K4QA 1NHRA 3NTAA 4NZHA 1IUXA 3AEBA 2OA1A 4IA5A 1O94A 2WBAA 1S2QA 2AR8A 1JRZA 2XVEA 1NEKA 3DJEA 1BGJA 4OPUA 2WPEA 5L46A 2BS3A 2CULA 2XLPA 5EB4A 4Z24A 1TYTA 4H4XA 4OPDA 1IUWA 2GRTA 2QAEA 4D03A 4KX6A 3FMWA 1H82A 1DOEA 1Q9IA 1AOGA 3KLJA 2EQ8A 4ADWA 4EQSA 3AE9A 1VRQB 4JN9A 4FK1A 2X8GA 1BF3A 4U8PA 3FG2P 4FK1C 2XLTA 1E39A 3DJGX 4N9XA 5CQFA 4CY8A 1IUVA 1KF6A 2C67A 2XFUA 3PVCA 4H4ZA 1OJ9A 2B7RA 5EOWA 4C3XA 1CC6A 3ALLA 2NVKX 2BK5A 2YLSA 2ZZ0A 4H50A 4Z26A 3JSKA 3Q9TA 2WOWA 3I3LA 3ITJA 3LB8A 4K8DA 1TDNA 2WU2A 4C77A 1CL0A 3F8RA 1CJ3A 1PS9A 3CGDA 2BC1A 3R9UA 4XWRA 1ZKQA 3CNSA 4Y4LA 1GV4A 1JRXA 4RG4A 1OJDA 2V61A 2W0HA 3GD4A 3ISHA 3LXDA 1CC4A 1VG0A 2V3BA 1B8SA 2Q0KA 4H4VA 3UTFA 4U8MA 3RHAA 5BUKA 4DGKA 4HA6A 4JQ9A 5EB5A 1GRAA 5M0ZA 1GERA 3F8DA 4BK2A 1PBCA 3AB1A 2DKHA 1BWCA 2NPXA 3NLCA 2DKIA 3H4KA 2EQ7A 4Z25A 2QCUA 2Y6RA 3UP5A 2YG7A 3KVEA 4XXGA 1D4CA 2OLOA 4X9NA 2YR6A 1RYIA 4K2XA 2R0CA 3BI2A 4WX1A 3VR8A 3ZDNA 3QSEA 2C70A 3QFBA 1L9DA 3HZLA 2GVCA 2TMDA 2YG4A 4IA6A 2X50A 4KPRA 4YXDA 2VZ2A 3RP8A 3UTHA 2CDUA 4J36A 4BJZA 3P4SA 2Y6QA 1E1NA 4TM3A 2BACA 3COXA 3QSMA 1CC2A 1E1KA 1ZOYA 3ICRA 5BULA 1LQTA 1GRGA 4APNA 2YLWA 2Z5XA 3ALJA 2JB3A 2C3DA 4A6NB 2YQUA 3LADA 3GD3A 2E4GA 2B9XA 1DODA 2BCPA 3AE3A 2WP9A 1CHUA 3DGHA 4PABA 2B7SA 4J33A 1DXLA 4BK3A 2YG5A 3AD8B 1D7LA 4IV9A 1CF3A 2XCGA 3V76A 4NTCA 1OJTA 4YTPA 3IHMA 3M13A 2XVFA 2WOVA 2H89A 2GB0A 3P4QA 4H4RA 5U63A 4U2LA 4REKA 1M64A 3CGEA 3P4PA 2XLUA 3EPTA 1S3EA 4J56A 2WDVA 3G5QA 5LV9A 3D1CA 4UP3A 1PBDA 2GF3A 3DK9A 3AD7B 1KNPA 2I0ZA 3II4A 3BNMA 4LIIA 1GT8A 4NEVA 2R0GA 1DNCA 3BI4A 3SQPA 2XVHA 5HY5A 1H86A 4RG3A 1E1MA 1CJ4A 3NHOX 5ER0A 4YKGA 1XANA 2QA1A 3UOYA 2ZZCA 4YKFA 1YQZA 3LZWA 1E6EA 4TM0A 2YR5A 2C75A 5FS7A 3KA7A 1KSUA 4M52A 1VQWA 2ACZA 5GSNA 2BS2A 2OALA 2BC0A 3EAOA 5HXIA 2BK3A 3UKFA 1B4VA
chains in the Genus database with same CATH superfamily
5JCIA 3SZ0A 4A5LA 2VOUA 1EL7A 4YTNA 4IVOB 1JRYA 4H2PA 4K5SA 5GRTA 3REDA 1KSSA 2R4EA 4GF7A 2ARDA 3E1TA 2BYBA 2C65A 4OPCA 4Z43A 4XWZA 3BI5A 4H4WA 4I59A 3UKLA 4G6GA 1ZK7A 3BHFA 4JNQA 2QA2A 1EL8A 3AE1A 3AEDA 3CTYA 3QJ4A 4A79A 1REOA 3ABVA 1LPFA 1YQ4A 2XFOA 3QVPA 4PAAA 3S61A 2YG3A 2C76A 5IQ1A 3AWIA 2WOIA 3AE8A 3D8XA 2YLXA 1FCDA 4E0VA 4EIQA 1H84A 1TDOA 4YWOA 4AOSA 5BRTA 3QSSA 1PJ5A 4B63A 4U8OA 2F5ZA 3CPJG 2FBWA 4Y4NA 3SY4A 1LVLA 5KOXA 1K0LA 1PXCA 4AT0A 2WP6A 4DSGA 1ZY8A 2YLTA 4H7UA 3T37A 3UOVA 5CKUA 4OPLA 1GXFA 1E7PA 1RP0A 4AT2A 3NIXA 4A7AA 1BGNA 1GNDA 1QO8A 2R0PA 3GRSA 4J34A 4J57A 1KDGA 4X4JA 4P9SA 4GAVA 3RNMA 4EMWA 2A89A 4J31A 1TDEA 1VDCA 2XDOA 2X99A 3M12A 4G9KA 5BVAA 5IPYA 5EBKA 4A65A 2R45A 3VRBA 5JCNA 3T2KA 4BK1A 3K30A 1E1LA 2XFPA 2J3NA 4H2RA 4UDRA 4DNAA 1GEUA 5J60A 5KMRA 2APGA 3GWDA 3G5SA 3QFAA 2JAEA 4CBQA 4EM4A 2V6OA 5KVIA 1NDAA 1FOHA 2R4JA 4OPIA 1GESA 2R46A 3ZYXA 4ZCDA 3V3NA 2RGJA 3NK0X 2BXSA 2FJAA 4TLXA 1N4WA 1EL9A 1N4VA 3I6DA 1F6MA 1MOKA 3CPIG 1NENA 1O5WA 3UOZA 1PDHA 1PBEA 2XVJA 4NTDA 2BCGG 4H2NA 1NHQA 3C4AA 3LZXA 2WP5A 4GCMA 1CBOA 1KNRA 4G74A 4TM4A 3UCLA 3DK8A 3AEFA 1NG3A 3AECA 3CGCA 1MO9A 3EF6A 2Z5YA 1CJCA 2BK4A 2X8HA 3AE5A 2JK6A 1OJAA 1DOCA 4NNJA 2V60A 4DSHA 1NHSA 1Q1WA 3FBSA 4LU6A 3VRAA 4EMIA 1FL2A 3AE2A 5C3JA 3URHA 4B1BA 2AAQA 1XPQA 4CCRA 1OJCA 1HYUA 1ELIA 5C2TA 3CPHG 3AE6A 4BURA 1H7WA 1GRBA 4MJWA 1FECA 1DJNA 2OAMA 3UOXA 1LTXR 3GMBA 5U25A 5KMPA 5FS9A 4C3YA 4C5OA 3IC9A 1YQ3A 4NTEA 2VVLG 2YVFA 3NGCX 2XYOA 1S2YA 2WDQA 3DH9A 4USRA 3KU9A 3B3RA 2WEUA 2YAUA 5KVHA 4FX9A 4B66A 5M10A 3K7QX 2PHHA 3L1RA 3GRTA 1UKVG 2B76A 1F8WA 3ICTA 2E5VA 2OLNA 2GMHA 1JEHA 2B9WA 2WHDA 3T14A 1ZOVA 5JCLA 4B65A 3UP4A 3HYWA 3NK1X 4H4QA 3NNEA 4OPTA 1L9EA 3AYIA 3AYJA 2JB1A 2C72A 4AP1A 1O95A 3AEEA 5KNLA 4YSHA 4GRTA 1PHHA 2BS4A 2XLSA 2FJDA 3DK4A 3G5RA 4X9MA 3SX6A 3P9UA 2C4CA 2WS3A 3T31A 2WPFA 1K0IA 2VQBA 1Y56B 2GQWA 4H4UA 4OVIA 3NH3X 1MXTA 5FMHA 3UKAA 4EMJA 1NAAA 3DMEA 4AP3A 2GEWA 3F8PA 4GAPA 2EQ9A 4H2QA 3KD9A 3NYEA 1GTEA 5FS8A 1H6VA 2Q6UA 5IQ4A 3T2ZA 2C7GA 3PS9A 4RSLA 3SGLA 3UKKA 1GRHA 1ZMDA 2BXRA 4H4YA 1XHCA 3KPFA 4NWZA 3SZCA 3HYVA 4UDQA 2VRLA 2WQYA 2YM1A 2FJBA 2Q7VA 4JNAA 4HB9A 2BRAA 4OCGA 4U8KA 3OC4A 3K7TA 4U8IA 4USQA 4Y4MA 1H81A 3BNUA 2BABA 3ADAB 1K0JA 1JNRA 2WPCA 3GYIA 4YSZA 4CNKA 5HHFA 2JKCA 3AE7A 4U2SA 1L0VA 2E1MA 5U1OA 1GETA 3NYFA 1F8SA 3H8IA 5HYMA 4O5UA 3IWAA 3AE4A 1GREA 1D4EA 3GDPA 3V3OA 3IF9A 5JCMA 1NPXA 4GDEA 1COYA 3OZ2A 3P4RA 4K5RA 4CY6A 3NN0X 1N4UA 3GMCA 3VR9A 4G73A 4TLZA 2A8XA 3M0OA 2GAHB 2O9ZA 4U2TA 1TYPA 3UTEA 4Z2UA 1NHPA 1CJ2A 2JB2A 2AQJA 3NTDA 2GQFA 3AEGA 2B9YA 3Q6JA 2XVIA 2YLRA 3UKQA 3UTGA 2YVJA 3K7MX 2V5ZA 4B69A 1PBBA 4B67A 4YTMA 2VVMA 2YVGA 1IUUA 4JY3A 3UKPA 1PXAA 2VRMA 3ALMA 3GYJA 4Z44A 5JCKA 1H83A 2IVDA 1NG4A 2GV8A 4EQRA 1LJ1A 4YSXA 4A99A 2YM2A 3KKJA 5DBJA 4WCTA 1QLBA 2V3AA 2WESA 2XLRA 4YSYA 3DGZA 2GR0A 3L8KA 3RP6A 1YKJA 3FIMB 2Q0LA 2X8CA 1ZMCA 1TDFA 1Q1RA 3GWFA 2ZZBA 3H8LA 1Y56A 1P2EA 1RSGA 2R9ZA 4GUVA 4J2WA 4JY2A 4TM1A 4U8LA 2XFNA 3IHGA 3UKHA 4EIPA 4EQXA 1DJQA 1IJHA 1ZX9A 1D4DA 4ICYA 4Z2TA 1GTHA 1JNZA 4II3A 1Z6LA 4FDCB 3FPZA 2C64A 2YWLA 3ATQA 3VQRA 1F8RA 3CN8A 4U8NA 5KRQA 1TDKA 4A9WA 1N1PA 1DOBA 3DJJA 1BZLA 3SM8A 2WETA 3P1WA 3NK2X 3NRNA 1FEAA 1XDIA 2GR1A 1B37A 5KOWA 4B68A 2EQ6A 2IIDA 3BHKA 3CNTA 1QJDA 2RGHA 1BKWA 4GR1A 4OPGA 2RABA 2YR4A 3GDNA 3LOVA 4K7ZA 1JU2A 1ZDLA 4H4PA 4AOXA 4Z2RA 5KXJA 1EL5A 3CGBA 3LJPA 5KWFA 1S3BA 3AXBA 3PO7A 3SFEA 4ECHA 1PJ6A 1EBDA 5FS6A 3SFDA 3CNPA 1H7XA 3DJDA 2GR3A 3C4NA 4U8JA 4ZCCA 3WE0A 1P2HA 1JOAA 3AYLA 3CIRA 5TR3A 3CNJA 3RP7A 2C73A 4K22A 4I58A 1SEZA 1VG9A 1LQUA 4D04A 2JBVA 1B5QA 4JDRA 4A6NA 1D5TA 1PBFA 2VVLA 1ONFA 1ZP0A 2YLZA 4EQWA 1GOSA 2BA9A 4LA1A 1L9CA 3NT6A 2XFQA 4IVMB 1LV0A 1KFYA 3C96A 3CNDA 4H4SA 1PN0A 3B6DA 1GSNA 2GMJA 2H88A 3AD9B 3NG7X 3VRDB 4O5QA 1X31B 2WDRA 2X3NA 3ICSA 3NYCA 2CFYA 5J7XA 4GDPA 2RGOA 2CVJA 3CMMA 3QVRA 2C3CA 3AEAA 2UZZA 1GRFA 3GYXA 3NN6X 3SZFA 4YT0A 1GRTA 3NKSA 2YG6A 1W4XA 1IUTA 3O0HA 1PJ7A 4CCQA 4C74A 3SXIA 1M6IA 2GAGB 4B64A 2VQ7A 1Y0PA 2C66A 4CNJA 2IVEA 4ZN0A 3ATRA 4UDPA 4BV6A 4NEWA 1GALA 1FEBA 1D7YA 1PXBA 1IUSA 1YY5A 3DA1A 2GR2A 2WU5A 2TPRA 3SZWA 3GSIA 3T2YA 4BJYA 4CRTA 1F3PA 1GPEA 4EM3A 2FJEA 3EANA 2PYXA 1V59A 2HQMA 4H4TA 1TRBA 2GH5A 2A87A 2ZBWA 1K4QA 1NHRA 3NTAA 4NZHA 1IUXA 3AEBA 2OA1A 4IA5A 1O94A 2WBAA 1S2QA 2AR8A 1JRZA 2XVEA 1NEKA 3DJEA 1BGJA 4OPUA 2WPEA 5L46A 2BS3A 2CULA 2BRYA 2XLPA 5EB4A 4Z24A 1TYTA 4H4XA 4OPDA 1IUWA 2GRTA 2QAEA 4D03A 4KX6A 3FMWA 1H82A 1DOEA 1Q9IA 1AOGA 3KLJA 2EQ8A 4ADWA 4EQSA 3AE9A 1VRQB 4JN9A 5KMSA 4FK1A 2X8GA 1BF3A 4U8PA 3FG2P 4FK1C 2XLTA 1E39A 3DJGX 4N9XA 3S5WA 5CQFA 4CY8A 1IUVA 1KF6A 2C67A 2XFUA 3PVCA 4H4ZA 1OJ9A 2B7RA 5EOWA 4C3XA 1CC6A 3ALLA 2NVKX 2BK5A 2YLSA 2ZZ0A 4H50A 4II2A 4Z26A 3JSKA 3Q9TA 2WOWA 3I3LA 3ITJA 3LB8A 4K8DA 1TDNA 2WU2A 4C77A 1CL0A 3F8RA 1CJ3A 1PS9A 3CGDA 2BC1A 3R9UA 4XWRA 1ZKQA 3CNSA 4Y4LA 3T0KA 1GV4A 1JRXA 4RG4A 1OJDA 2V61A 2W0HA 3GD4A 3ISHA 3LXDA 1CC4A 1VG0A 2V3BA 1B8SA 2Q0KA 4H4VA 3UTFA 4U8MA 3RHAA 5BUKA 4DGKA 4HA6A 4JQ9A 5EB5A 1GRAA 5M0ZA 1GERA 3F8DA 4BK2A 1PBCA 3AB1A 2DKHA 1BWCA 2NPXA 3NLCA 2DKIA 3KPKA 3H4KA 2EQ7A 4Z25A 2QCUA 2Y6RA 3UP5A 2YG7A 3KVEA 4XXGA 1D4CA 2OLOA 4X9NA 2YR6A 1RYIA 4K2XA 2R0CA 3BI2A 4WX1A 3VR8A 3ZDNA 3QSEA 2C70A 3QFBA 1L9DA 3HZLA 2GVCA 2TMDA 2YG4A 4IA6A 2X50A 4KPRA 4YXDA 4G6HA 2VZ2A 3RP8A 3UTHA 2CDUA 4J36A 4BJZA 3P4SA 2Y6QA 1E1NA 4TM3A 2BACA 3COXA 3QSMA 1CC2A 1E1KA 1ZOYA 3ICRA 5BULA 1LQTA 1GRGA 4APNA 2YLWA 2Z5XA 3ALJA 2JB3A 2C3DA 4A6NB 2YQUA 3LADA 3GD3A 2E4GA 2B9XA 1DODA 2BCPA 3AE3A 2WP9A 1CHUA 3DGHA 4PABA 2B7SA 4J33A 1DXLA 4BK3A 2YG5A 3AD8B 1D7LA 4IV9A 1CF3A 2XCGA 5KMQA 4NTCA 3V76A 1OJTA 4YTPA 3IHMA 3M13A 2XVFA 2WOVA 2H89A 2GB0A 3P4QA 4H4RA 5U63A 4U2LA 4REKA 3HYXA 1M64A 3CGEA 3P4PA 2XLUA 3EPTA 1S3EA 4J56A 2WDVA 3G5QA 5LV9A 3D1CA 4UP3A 1PBDA 2GF3A 3DK9A 3AD7B 1KNPA 2I0ZA 3II4A 3BNMA 4LIIA 1GT8A 4NEVA 2R0GA 1DNCA 3BI4A 3SQPA 2XVHA 5HY5A 1H86A 4RG3A 1E1MA 1CJ4A 3NHOX 5ER0A 4YKGA 1XANA 2QA1A 3UOYA 2ZZCA 4YKFA 1YQZA 3LZWA 1E6EA 4TM0A 2YR5A 3SYIA 2C75A 5FS7A 3KA7A 1KSUA 4M52A 1VQWA 2ACZA 5GSNA 2BS2A 2OALA 2BC0A 3EAOA 5HXIA 2BK3A 3UKFA 1B4VA
chains in the Genus database with same CATH topology
5JCIA 3SZ0A 4A5LA 2VOUA 1EL7A 4YTNA 4IVOB 1JRYA 4H2PA 4K5SA 5GRTA 3REDA 1KSSA 2R4EA 4GF7A 2ARDA 3E1TA 2BYBA 2C65A 4OPCA 4Z43A 4XWZA 3BI5A 4H4WA 4I59A 3UKLA 4G6GA 1ZK7A 3BHFA 4JNQA 2QA2A 1EL8A 3AE1A 3AEDA 3CTYA 3QJ4A 4A79A 1REOA 3ABVA 1LPFA 1YQ4A 2XFOA 3QVPA 4PAAA 3S61A 2YG3A 2C76A 5IQ1A 3AWIA 2WOIA 3AE8A 3D8XA 2YLXA 1FCDA 4E0VA 4EIQA 1H84A 1TDOA 4YWOA 4AOSA 5BRTA 3QSSA 1PJ5A 4B63A 4U8OA 2F5ZA 3CPJG 2FBWA 4Y4NA 3SY4A 1LVLA 5KOXA 1K0LA 1PXCA 4AT0A 2WP6A 4DSGA 1ZY8A 2YLTA 4H7UA 3T37A 3UOVA 5CKUA 4OPLA 1GXFA 1E7PA 1RP0A 4AT2A 3NIXA 4A7AA 1BGNA 1GNDA 1QO8A 2R0PA 3GRSA 4J34A 4J57A 1KDGA 4X4JA 4P9SA 4GAVA 3RNMA 4EMWA 2A89A 4J31A 1TDEA 1VDCA 2XDOA 2X99A 3M12A 4G9KA 5BVAA 5IPYA 5EBKA 4A65A 2R45A 3VRBA 5JCNA 3T2KA 4BK1A 3K30A 1E1LA 2XFPA 2J3NA 4H2RA 4UDRA 4DNAA 1GEUA 5J60A 5KMRA 2APGA 3GWDA 3G5SA 3QFAA 2JAEA 4CBQA 4EM4A 2V6OA 5KVIA 1NDAA 1FOHA 2R4JA 4OPIA 1GESA 2R46A 3ZYXA 4ZCDA 3V3NA 2RGJA 3NK0X 2BXSA 2FJAA 4TLXA 1N4WA 1EL9A 1N4VA 3I6DA 1F6MA 1MOKA 3CPIG 1NENA 1O5WA 3UOZA 1PDHA 1PBEA 2XVJA 4NTDA 2BCGG 4H2NA 1NHQA 3C4AA 3LZXA 2WP5A 4GCMA 1CBOA 1KNRA 4G74A 4TM4A 3UCLA 3DK8A 3AEFA 1NG3A 3AECA 3CGCA 1MO9A 3EF6A 2Z5YA 1CJCA 2BK4A 2X8HA 3AE5A 2JK6A 1OJAA 1DOCA 4NNJA 2V60A 4DSHA 1NHSA 1Q1WA 3FBSA 4LU6A 3VRAA 4EMIA 1FL2A 3AE2A 5C3JA 3URHA 4B1BA 2AAQA 1XPQA 4CCRA 1OJCA 1HYUA 1ELIA 5C2TA 3CPHG 3AE6A 4BURA 1H7WA 1GRBA 4MJWA 1FECA 1DJNA 2OAMA 3UOXA 1LTXR 3GMBA 5U25A 5KMPA 5FS9A 4C3YA 4C5OA 3IC9A 1YQ3A 4NTEA 2VVLG 2YVFA 3NGCX 2XYOA 1S2YA 2WDQA 3DH9A 4USRA 3KU9A 3B3RA 2WEUA 2YAUA 5KVHA 4FX9A 4B66A 5M10A 3K7QX 2PHHA 3L1RA 3GRTA 1UKVG 2B76A 1F8WA 3ICTA 2E5VA 2OLNA 2GMHA 1JEHA 2B9WA 2WHDA 3T14A 1ZOVA 5JCLA 4B65A 3UP4A 3HYWA 3NK1X 4H4QA 3NNEA 4OPTA 1L9EA 3AYIA 3AYJA 2JB1A 2C72A 4AP1A 1O95A 3AEEA 5KNLA 4YSHA 4GRTA 1PHHA 2BS4A 2XLSA 2FJDA 3DK4A 3G5RA 4X9MA 3SX6A 3P9UA 2C4CA 2WS3A 3T31A 2WPFA 1K0IA 2VQBA 1Y56B 2GQWA 4H4UA 4OVIA 3NH3X 1MXTA 5FMHA 3UKAA 4EMJA 1NAAA 3DMEA 4AP3A 2GEWA 3F8PA 4GAPA 2EQ9A 4H2QA 3KD9A 3NYEA 1GTEA 5FS8A 1H6VA 2Q6UA 5IQ4A 3T2ZA 2C7GA 3PS9A 4RSLA 3SGLA 3UKKA 1GRHA 1ZMDA 2BXRA 4H4YA 1XHCA 3KPFA 4NWZA 3SZCA 3HYVA 4UDQA 2VRLA 2WQYA 2YM1A 2FJBA 2Q7VA 4JNAA 4HB9A 2BRAA 4OCGA 4U8KA 3OC4A 3K7TA 4U8IA 4USQA 4Y4MA 1H81A 3BNUA 2BABA 3ADAB 1K0JA 1JNRA 2WPCA 3GYIA 4YSZA 4CNKA 5HHFA 2JKCA 3AE7A 4U2SA 1L0VA 2E1MA 5U1OA 1GETA 3NYFA 1F8SA 3H8IA 5HYMA 4O5UA 3IWAA 3AE4A 1GREA 1D4EA 3GDPA 3V3OA 3IF9A 5JCMA 1NPXA 4GDEA 1COYA 3OZ2A 3P4RA 4K5RA 4CY6A 3NN0X 1N4UA 3GMCA 3VR9A 4G73A 4TLZA 2A8XA 3M0OA 2GAHB 2O9ZA 4U2TA 1TYPA 3UTEA 4Z2UA 1NHPA 1CJ2A 2JB2A 2AQJA 3NTDA 2GQFA 3AEGA 2B9YA 3Q6JA 2XVIA 2YLRA 3UKQA 3UTGA 2YVJA 3K7MX 2V5ZA 4B69A 1PBBA 4B67A 4YTMA 2VVMA 2YVGA 1IUUA 4JY3A 3UKPA 1PXAA 2VRMA 3ALMA 3GYJA 4Z44A 5JCKA 1H83A 2IVDA 1NG4A 2GV8A 4EQRA 1LJ1A 4YSXA 4A99A 2YM2A 3KKJA 5DBJA 4WCTA 1QLBA 2V3AA 2WESA 2XLRA 4YSYA 3DGZA 2GR0A 3L8KA 3RP6A 1YKJA 3FIMB 2Q0LA 2X8CA 1ZMCA 1TDFA 1Q1RA 3GWFA 2ZZBA 3H8LA 1Y56A 1P2EA 1RSGA 2R9ZA 4GUVA 4J2WA 4JY2A 4TM1A 4U8LA 2XFNA 3IHGA 3UKHA 4EIPA 4EQXA 1DJQA 1IJHA 1ZX9A 1D4DA 4ICYA 4Z2TA 1GTHA 1JNZA 4II3A 1Z6LA 4FDCB 3FPZA 2C64A 2YWLA 3ATQA 3VQRA 1F8RA 3CN8A 4U8NA 5KRQA 1TDKA 4A9WA 1N1PA 1DOBA 3DJJA 1BZLA 3SM8A 2WETA 3P1WA 3NK2X 3NRNA 1FEAA 1XDIA 2GR1A 1B37A 5KOWA 4B68A 2EQ6A 2IIDA 3BHKA 3CNTA 1QJDA 2RGHA 1BKWA 4GR1A 4OPGA 2RABA 2YR4A 3GDNA 3LOVA 4K7ZA 1JU2A 1ZDLA 4H4PA 4AOXA 4Z2RA 5KXJA 1EL5A 3CGBA 3LJPA 5KWFA 1S3BA 3AXBA 3PO7A 3SFEA 4ECHA 1PJ6A 1EBDA 5FS6A 3SFDA 3CNPA 1H7XA 3DJDA 2GR3A 3C4NA 4U8JA 4ZCCA 3WE0A 1P2HA 1JOAA 3AYLA 3CIRA 5TR3A 3CNJA 3RP7A 2C73A 4K22A 4I58A 1SEZA 1VG9A 1LQUA 4D04A 2JBVA 1B5QA 4JDRA 4A6NA 1D5TA 1PBFA 2VVLA 1ONFA 1ZP0A 2YLZA 4EQWA 1GOSA 2BA9A 4LA1A 1L9CA 3NT6A 2XFQA 4IVMB 1LV0A 1KFYA 3C96A 3CNDA 4H4SA 1PN0A 3B6DA 1GSNA 2GMJA 2H88A 3AD9B 3NG7X 3VRDB 4O5QA 1X31B 2WDRA 2X3NA 3ICSA 3NYCA 2CFYA 5J7XA 4GDPA 2RGOA 2CVJA 3CMMA 3QVRA 2C3CA 3AEAA 2UZZA 1GRFA 3GYXA 3NN6X 3SZFA 4YT0A 1GRTA 3NKSA 2YG6A 1W4XA 1IUTA 3O0HA 1PJ7A 4CCQA 4C74A 3SXIA 1M6IA 2GAGB 4B64A 2VQ7A 1Y0PA 2C66A 4CNJA 2IVEA 4ZN0A 3ATRA 4UDPA 4BV6A 4NEWA 1GALA 1FEBA 1D7YA 1PXBA 1IUSA 1YY5A 3DA1A 2GR2A 2WU5A 2TPRA 3SZWA 3GSIA 3T2YA 4BJYA 4CRTA 1F3PA 1GPEA 4EM3A 2FJEA 3EANA 2PYXA 1V59A 2HQMA 4H4TA 1TRBA 2GH5A 2A87A 2ZBWA 1K4QA 1NHRA 3NTAA 4NZHA 1IUXA 3AEBA 2OA1A 4IA5A 1O94A 2WBAA 1S2QA 2AR8A 1JRZA 2XVEA 1NEKA 3DJEA 1BGJA 4OPUA 2WPEA 5L46A 2BS3A 2CULA 2BRYA 2XLPA 5EB4A 4Z24A 1TYTA 4H4XA 4OPDA 1IUWA 2GRTA 2QAEA 4D03A 4KX6A 3FMWA 1H82A 1DOEA 1Q9IA 1AOGA 3KLJA 2EQ8A 4ADWA 4EQSA 3AE9A 1VRQB 4JN9A 5KMSA 4FK1A 2X8GA 1BF3A 4U8PA 3FG2P 4FK1C 2XLTA 1E39A 3DJGX 4N9XA 3S5WA 5CQFA 4CY8A 1IUVA 1KF6A 2C67A 2XFUA 3PVCA 4H4ZA 1OJ9A 2B7RA 5EOWA 4C3XA 1CC6A 3ALLA 2NVKX 2BK5A 2YLSA 2ZZ0A 4H50A 4II2A 4Z26A 3JSKA 3Q9TA 2WOWA 3I3LA 3ITJA 3LB8A 4K8DA 1TDNA 2WU2A 4C77A 1CL0A 3F8RA 1CJ3A 1PS9A 3CGDA 2BC1A 3R9UA 4XWRA 1ZKQA 3CNSA 4Y4LA 3T0KA 1GV4A 1JRXA 4RG4A 1OJDA 2V61A 2W0HA 3GD4A 3ISHA 3LXDA 1CC4A 1VG0A 2V3BA 1B8SA 2Q0KA 4H4VA 3UTFA 4U8MA 3RHAA 5BUKA 4DGKA 4HA6A 4JQ9A 5EB5A 1GRAA 5M0ZA 1GERA 3F8DA 4BK2A 1PBCA 3AB1A 2DKHA 1BWCA 2NPXA 3NLCA 2DKIA 3KPKA 3H4KA 2EQ7A 4Z25A 2QCUA 2Y6RA 3UP5A 2YG7A 3KVEA 4XXGA 1D4CA 2OLOA 4X9NA 2YR6A 1RYIA 4K2XA 2R0CA 3BI2A 4WX1A 3VR8A 3ZDNA 3QSEA 2C70A 3QFBA 1L9DA 3HZLA 2GVCA 2TMDA 2YG4A 4IA6A 2X50A 4KPRA 4YXDA 4G6HA 2VZ2A 3RP8A 3UTHA 2CDUA 4J36A 4BJZA 3P4SA 2Y6QA 1E1NA 4TM3A 2BACA 3COXA 3QSMA 1CC2A 1E1KA 1ZOYA 3ICRA 5BULA 1LQTA 1GRGA 4APNA 2YLWA 2Z5XA 3ALJA 2JB3A 2C3DA 4A6NB 2YQUA 3LADA 3GD3A 2E4GA 2B9XA 1DODA 2BCPA 3AE3A 2WP9A 1CHUA 3DGHA 4PABA 2B7SA 4J33A 1DXLA 4BK3A 2YG5A 3AD8B 1D7LA 4IV9A 1CF3A 2XCGA 5KMQA 4NTCA 3V76A 1OJTA 4YTPA 3IHMA 3M13A 2XVFA 2WOVA 2H89A 2GB0A 3P4QA 4H4RA 5U63A 4U2LA 4REKA 3HYXA 1M64A 3CGEA 3P4PA 2XLUA 3EPTA 1S3EA 4J56A 2WDVA 3G5QA 5LV9A 3D1CA 4UP3A 1PBDA 2GF3A 3DK9A 3AD7B 1KNPA 2I0ZA 3II4A 3BNMA 4LIIA 1GT8A 4NEVA 2R0GA 1DNCA 3BI4A 3SQPA 2XVHA 5HY5A 1H86A 4RG3A 1E1MA 1CJ4A 3NHOX 5ER0A 4YKGA 1XANA 2QA1A 3UOYA 2ZZCA 4YKFA 1YQZA 3LZWA 1E6EA 4TM0A 2YR5A 3SYIA 2C75A 5FS7A 3KA7A 1KSUA 4M52A 1VQWA 2ACZA 5GSNA 2BS2A 2OALA 2BC0A 3EAOA 5HXIA 2BK3A 3UKFA 1B4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JCI A;  4A5L A;  2VOU A;  1EL7 A;  4YTN A;  4IVO B;  1JRY A;  4H2P A;  4K5S A;  5GRT A;  3RED A;  1KSS A;  2R4E A;  4GF7 A;  2ARD A;  3E1T A;  2BYB A;  2C65 A;  4OPC A;  4Z43 A;  4XWZ A;  3BI5 A;  4H4W A;  4I59 A;  3UKL A;  1ZK7 A;  3BHF A;  4JNQ A;  2QA2 A;  1EL8 A;  3AE1 A;  3AED A;  3CTY A;  3QJ4 A;  4A79 A;  1REO A;  3ABV A;  1LPF A;  1YQ4 A;  2XFO A;  3QVP A;  4PAA A;  3S61 A;  2YG3 A;  2C76 A;  5IQ1 A;  3AWI A;  2WOI A;  3AE8 A;  3D8X A;  2YLX A;  1FCD A;  4E0V A;  4EIQ A;  1H84 A;  1TDO A;  4YWO A;  4AOS A;  5BRT A;  3QSS A;  1PJ5 A;  4B63 A;  4U8O A;  2F5Z A;  3CPJ G;  2FBW A;  4Y4N A;  1LVL A;  5KOX A;  1K0L A;  1PXC A;  4AT0 A;  2WP6 A;  4DSG A;  1ZY8 A;  2YLT A;  4H7U A;  3T37 A;  3UOV A;  5CKU A;  4OPL A;  1GXF A;  1E7P A;  1RP0 A;  4AT2 A;  3NIX A;  4A7A A;  1BGN A;  1GND A;  1QO8 A;  2R0P A;  3GRS A;  4J34 A;  4J57 A;  1KDG A;  4X4J A;  4P9S A;  3RNM A;  4EMW A;  2A89 A;  4J31 A;  1TDE A;  1VDC A;  2XDO A;  2X99 A;  3M12 A;  5BVA A;  5IPY A;  5EBK A;  4A65 A;  2R45 A;  3VRB A;  5JCN A;  4BK1 A;  3K30 A;  1E1L A;  2XFP A;  2J3N A;  4H2R A;  4UDR A;  4DNA A;  1GEU A;  5J60 A;  2APG A;  3GWD A;  3G5S A;  3QFA A;  2JAE A;  4CBQ A;  4EM4 A;  2V6O A;  5KVI A;  1NDA A;  1FOH A;  2R4J A;  4OPI A;  1GES A;  2R46 A;  3ZYX A;  4ZCD A;  3V3N A;  2RGJ A;  3NK0 X;  2BXS A;  2FJA A;  4TLX A;  1N4W A;  1EL9 A;  1N4V A;  3I6D A;  1F6M A;  1MOK A;  3CPI G;  1NEN A;  1O5W A;  3UOZ A;  1PDH A;  1PBE A;  2XVJ A;  4NTD A;  2BCG G;  4H2N A;  1NHQ A;  3C4A A;  3LZX A;  2WP5 A;  4GCM A;  1CBO A;  1KNR A;  4TM4 A;  3UCL A;  3DK8 A;  3AEF A;  1NG3 A;  3AEC A;  3CGC A;  1MO9 A;  3EF6 A;  2Z5Y A;  1CJC A;  2BK4 A;  2X8H A;  3AE5 A;  2JK6 A;  1OJA A;  1DOC A;  4DSH A;  2V60 A;  1NHS A;  1Q1W A;  3FBS A;  4LU6 A;  3VRA A;  4EMI A;  1FL2 A;  3AE2 A;  5C3J A;  3URH A;  4B1B A;  2AAQ A;  1XPQ A;  4CCR A;  1OJC A;  1HYU A;  1ELI A;  5C2T A;  3CPH G;  3AE6 A;  4BUR A;  1H7W A;  1GRB A;  4MJW A;  1FEC A;  1DJN A;  2OAM A;  3UOX A;  1LTX R;  3GMB A;  5U25 A;  5FS9 A;  4C3Y A;  4C5O A;  3IC9 A;  1YQ3 A;  4NTE A;  2VVL G;  2YVF A;  3NGC X;  2XYO A;  1S2Y A;  2WDQ A;  3DH9 A;  4USR A;  3KU9 A;  3B3R A;  2WEU A;  2YAU A;  5KVH A;  4FX9 A;  4B66 A;  5M10 A;  3K7Q X;  2PHH A;  3L1R A;  3GRT A;  1UKV G;  2B76 A;  1F8W A;  3ICT A;  2E5V A;  2OLN A;  2GMH A;  1JEH A;  2B9W A;  2WHD A;  1ZOV A;  5JCL A;  4B65 A;  3UP4 A;  3NK1 X;  4H4Q A;  3NNE A;  4OPT A;  1L9E A;  3AYI A;  3AYJ A;  2JB1 A;  2C72 A;  4AP1 A;  1O95 A;  3AEE A;  4YSH A;  4GRT A;  1PHH A;  2BS4 A;  2XLS A;  2FJD A;  3DK4 A;  3G5R A;  4X9M A;  3P9U A;  2WS3 A;  2WPF A;  1K0I A;  2VQB A;  1Y56 B;  2GQW A;  4H4U A;  4OVI A;  3NH3 X;  1MXT A;  5FMH A;  3UKA A;  4EMJ A;  1NAA A;  3DME A;  4AP3 A;  2GEW A;  3F8P A;  2EQ9 A;  4H2Q A;  3KD9 A;  3NYE A;  1GTE A;  5FS8 A;  1H6V A;  2Q6U A;  5IQ4 A;  2C7G A;  3PS9 A;  4RSL A;  3SGL A;  3UKK A;  1GRH A;  1ZMD A;  2BXR A;  4H4Y A;  1XHC A;  3KPF A;  4UDQ A;  2VRL A;  2WQY A;  2YM1 A;  2FJB A;  2Q7V A;  4JNA A;  4HB9 A;  4OCG A;  4U8K A;  4U8I A;  3OC4 A;  3K7T A;  4USQ A;  4Y4M A;  3S5W A;  1H81 A;  3BNU A;  2BAB A;  3ADA B;  1K0J A;  1JNR A;  2WPC A;  3GYI A;  4YSZ A;  4CNK A;  5HHF A;  2JKC A;  3AE7 A;  4U2S A;  1L0V A;  2E1M A;  5U1O A;  1GET A;  3NYF A;  1F8S A;  3H8I A;  5HYM A;  4O5U A;  3IWA A;  3AE4 A;  1GRE A;  1D4E A;  3GDP A;  3V3O A;  3IF9 A;  5JCM A;  1NPX A;  4GDE A;  1COY A;  3OZ2 A;  3P4R A;  4K5R A;  4CY6 A;  3NN0 X;  1N4U A;  3GMC A;  3VR9 A;  4TLZ A;  2A8X A;  3M0O A;  2GAH B;  2O9Z A;  4U2T A;  1TYP A;  3UTE A;  4Z2U A;  1NHP A;  1CJ2 A;  2JB2 A;  2AQJ A;  3NTD A;  2GQF A;  3AEG A;  2B9Y A;  3Q6J A;  2XVI A;  2YLR A;  3UKQ A;  3UTG A;  2YVJ A;  3K7M X;  2V5Z A;  4B69 A;  1PBB A;  4B67 A;  4YTM A;  2VVM A;  2YVG A;  1IUU A;  4JY3 A;  3UKP A;  1PXA A;  2VRM A;  3ALM A;  3GYJ A;  4Z44 A;  5JCK A;  1H83 A;  2IVD A;  1NG4 A;  2GV8 A;  4EQR A;  1LJ1 A;  4YSX A;  4A99 A;  2YM2 A;  3KKJ A;  5DBJ A;  4WCT A;  1QLB A;  2V3A A;  2WES A;  2XLR A;  4YSY A;  3DGZ A;  2GR0 A;  3L8K A;  3RP6 A;  1YKJ A;  3FIM B;  2Q0L A;  2X8C A;  1ZMC A;  1TDF A;  1Q1R A;  3GWF A;  2ZZB A;  3H8L A;  1Y56 A;  1P2E A;  1RSG A;  2R9Z A;  4GUV A;  4J2W A;  4JY2 A;  4TM1 A;  4U8L A;  2XFN A;  3IHG A;  3UKH A;  4EIP A;  4EQX A;  1DJQ A;  1IJH A;  1ZX9 A;  1D4D A;  4ICY A;  4Z2T A;  1GTH A;  1JNZ A;  1Z6L A;  4FDC B;  3FPZ A;  2C64 A;  2YWL A;  3ATQ A;  3VQR A;  1F8R A;  3CN8 A;  4U8N A;  5KRQ A;  1TDK A;  4A9W A;  1N1P A;  1DOB A;  3DJJ A;  1BZL A;  3SM8 A;  2WET A;  3P1W A;  3NK2 X;  3NRN A;  1FEA A;  1XDI A;  2GR1 A;  1B37 A;  5KOW A;  4B68 A;  2EQ6 A;  2IID A;  3BHK A;  3CNT A;  1QJD A;  2RGH A;  1BKW A;  4GR1 A;  4OPG A;  2RAB A;  2YR4 A;  3GDN A;  3LOV A;  4K7Z A;  1JU2 A;  1ZDL A;  4H4P A;  4AOX A;  4Z2R A;  5KXJ A;  1EL5 A;  3CGB A;  3LJP A;  5KWF A;  1S3B A;  3AXB A;  3PO7 A;  3SFE A;  4ECH A;  1PJ6 A;  1EBD A;  5FS6 A;  3SFD A;  3CNP A;  1H7X A;  3DJD A;  2GR3 A;  3C4N A;  4U8J A;  4ZCC A;  3WE0 A;  1P2H A;  1JOA A;  3AYL A;  3CIR A;  5TR3 A;  3CNJ A;  3RP7 A;  2C73 A;  4K22 A;  4I58 A;  1SEZ A;  1VG9 A;  1LQU A;  4D04 A;  2JBV A;  1B5Q A;  4JDR A;  4A6N A;  1D5T A;  1PBF A;  2VVL A;  1ONF A;  1ZP0 A;  2YLZ A;  4EQW A;  1GOS A;  2BA9 A;  4LA1 A;  1L9C A;  3NT6 A;  2XFQ A;  4IVM B;  1LV0 A;  1KFY A;  3C96 A;  3CND A;  4H4S A;  1PN0 A;  3B6D A;  1GSN A;  2GMJ A;  2H88 A;  3AD9 B;  3NG7 X;  3VRD B;  4O5Q A;  1X31 B;  2WDR A;  2X3N A;  3ICS A;  3NYC A;  2CFY A;  5J7X A;  4GDP A;  2RGO A;  2CVJ A;  3QVR A;  2C3C A;  3AEA A;  2UZZ A;  1GRF A;  3NN6 X;  4YT0 A;  1GRT A;  3NKS A;  2YG6 A;  1W4X A;  1IUT A;  3O0H A;  1PJ7 A;  4CCQ A;  4C74 A;  1M6I A;  2GAG B;  4B64 A;  2VQ7 A;  1Y0P A;  2C66 A;  4CNJ A;  2IVE A;  4ZN0 A;  3ATR A;  4UDP A;  4BV6 A;  4NEW A;  1GAL A;  1FEB A;  1D7Y A;  1PXB A;  1IUS A;  1YY5 A;  3DA1 A;  2GR2 A;  2WU5 A;  2TPR A;  4BJY A;  3GSI A;  4CRT A;  1F3P A;  1GPE A;  4EM3 A;  2FJE A;  3EAN A;  2PYX A;  1V59 A;  2HQM A;  4H4T A;  1TRB A;  2GH5 A;  2A87 A;  2ZBW A;  1K4Q A;  1NHR A;  3NTA A;  4NZH A;  1IUX A;  3AEB A;  2OA1 A;  4IA5 A;  1O94 A;  2WBA A;  1S2Q A;  2AR8 A;  1JRZ A;  2XVE A;  1NEK A;  3DJE A;  1BGJ A;  4OPU A;  2WPE A;  5L46 A;  2BS3 A;  2CUL A;  2XLP A;  5EB4 A;  4Z24 A;  1TYT A;  4H4X A;  4OPD A;  1IUW A;  2GRT A;  2QAE A;  4D03 A;  4KX6 A;  3FMW A;  1H82 A;  1DOE A;  1Q9I A;  1AOG A;  3KLJ A;  2EQ8 A;  4ADW A;  4EQS A;  3AE9 A;  1VRQ B;  4JN9 A;  4FK1 A;  2X8G A;  1BF3 A;  4U8P A;  3FG2 P;  4FK1 C;  2XLT A;  1E39 A;  3DJG X;  4N9X A;  5CQF A;  4CY8 A;  1IUV A;  1KF6 A;  2C67 A;  2XFU A;  3PVC A;  4H4Z A;  1OJ9 A;  2B7R A;  5EOW A;  4C3X A;  1CC6 A;  3ALL A;  2NVK X;  2BK5 A;  2YLS A;  2ZZ0 A;  4H50 A;  4Z26 A;  3JSK A;  3Q9T A;  2WOW A;  3I3L A;  3ITJ A;  3LB8 A;  4K8D A;  1TDN A;  2WU2 A;  4C77 A;  1CL0 A;  3F8R A;  1CJ3 A;  1PS9 A;  3CGD A;  2BC1 A;  3R9U A;  4XWR A;  1ZKQ A;  3CNS A;  4Y4L A;  1GV4 A;  1JRX A;  4RG4 A;  1OJD A;  2V61 A;  2W0H A;  3GD4 A;  3ISH A;  3LXD A;  1CC4 A;  1VG0 A;  2V3B A;  1B8S A;  2Q0K A;  4H4V A;  3UTF A;  4U8M A;  3RHA A;  5BUK A;  4DGK A;  4HA6 A;  4JQ9 A;  5EB5 A;  1GRA A;  5M0Z A;  1GER A;  3F8D A;  4BK2 A;  1PBC A;  3AB1 A;  2DKH A;  1BWC A;  2NPX A;  3NLC A;  2DKI A;  3H4K A;  2EQ7 A;  4Z25 A;  2QCU A;  2Y6R A;  3UP5 A;  2YG7 A;  3KVE A;  4XXG A;  1D4C A;  2OLO A;  4X9N A;  2YR6 A;  1RYI A;  4K2X A;  2R0C A;  3BI2 A;  4WX1 A;  3VR8 A;  3ZDN A;  3QSE A;  2C70 A;  3QFB A;  1L9D A;  3HZL A;  2GVC A;  2TMD A;  2YG4 A;  4IA6 A;  2X50 A;  4KPR A;  4YXD A;  2VZ2 A;  3RP8 A;  3UTH A;  2CDU A;  4J36 A;  4BJZ A;  3P4S A;  2Y6Q A;  1E1N A;  4TM3 A;  2BAC A;  3COX A;  3QSM A;  1CC2 A;  1E1K A;  1ZOY A;  3ICR A;  5BUL A;  1LQT A;  1GRG A;  4APN A;  2YLW A;  2Z5X A;  3ALJ A;  2JB3 A;  2C3D A;  4A6N B;  2YQU A;  3LAD A;  3GD3 A;  2E4G A;  2B9X A;  1DOD A;  2BCP A;  3AE3 A;  2WP9 A;  1CHU A;  3DGH A;  4PAB A;  2B7S A;  4J33 A;  1DXL A;  4BK3 A;  2YG5 A;  3AD8 B;  1D7L A;  4IV9 A;  1CF3 A;  2XCG A;  3V76 A;  4NTC A;  1OJT A;  4YTP A;  3IHM A;  3M13 A;  2XVF A;  2WOV A;  2H89 A;  2GB0 A;  3P4Q A;  4H4R A;  5U63 A;  4U2L A;  4REK A;  1M64 A;  3CGE A;  3P4P A;  2XLU A;  3EPT A;  1S3E A;  4J56 A;  2WDV A;  3G5Q A;  5LV9 A;  3D1C A;  4UP3 A;  1PBD A;  2GF3 A;  3DK9 A;  3AD7 B;  1KNP A;  2I0Z A;  3II4 A;  3BNM A;  4LII A;  1GT8 A;  4NEV A;  2R0G A;  1DNC A;  3BI4 A;  3SQP A;  2XVH A;  5HY5 A;  1H86 A;  4RG3 A;  1E1M A;  1CJ4 A;  3NHO X;  5ER0 A;  4YKG A;  1XAN A;  2QA1 A;  3UOY A;  2ZZC A;  4YKF A;  1YQZ A;  3LZW A;  1E6E A;  4TM0 A;  2YR5 A;  2C75 A;  5FS7 A;  3KA7 A;  1KSU A;  4M52 A;  1VQW A;  2ACZ A;  5GSN A;  2BS2 A;  2OAL A;  2BC0 A;  3EAO A;  5HXI A;  2BK3 A;  3UKF A;  1B4V A; 
#chains in the Genus database with same CATH topology
 5JCI A;  3SZ0 A;  4A5L A;  2VOU A;  1EL7 A;  4YTN A;  4IVO B;  1JRY A;  4H2P A;  4K5S A;  5GRT A;  3RED A;  1KSS A;  2R4E A;  4GF7 A;  2ARD A;  3E1T A;  2BYB A;  2C65 A;  4OPC A;  4Z43 A;  4XWZ A;  3BI5 A;  4H4W A;  4I59 A;  3UKL A;  4G6G A;  1ZK7 A;  3BHF A;  4JNQ A;  2QA2 A;  1EL8 A;  3AE1 A;  3AED A;  3CTY A;  3QJ4 A;  4A79 A;  1REO A;  3ABV A;  1LPF A;  1YQ4 A;  2XFO A;  3QVP A;  4PAA A;  3S61 A;  2YG3 A;  2C76 A;  5IQ1 A;  3AWI A;  2WOI A;  3AE8 A;  3D8X A;  2YLX A;  1FCD A;  4E0V A;  4EIQ A;  1H84 A;  1TDO A;  4YWO A;  4AOS A;  5BRT A;  3QSS A;  1PJ5 A;  4B63 A;  4U8O A;  2F5Z A;  3CPJ G;  2FBW A;  4Y4N A;  3SY4 A;  1LVL A;  5KOX A;  1K0L A;  1PXC A;  4AT0 A;  2WP6 A;  4DSG A;  1ZY8 A;  2YLT A;  4H7U A;  3T37 A;  3UOV A;  5CKU A;  4OPL A;  1GXF A;  1E7P A;  1RP0 A;  4AT2 A;  3NIX A;  4A7A A;  1BGN A;  1GND A;  1QO8 A;  2R0P A;  3GRS A;  4J34 A;  4J57 A;  1KDG A;  4X4J A;  4P9S A;  4GAV A;  3RNM A;  4EMW A;  2A89 A;  4J31 A;  1TDE A;  1VDC A;  2XDO A;  2X99 A;  3M12 A;  4G9K A;  5BVA A;  5IPY A;  5EBK A;  4A65 A;  2R45 A;  3VRB A;  5JCN A;  3T2K A;  4BK1 A;  3K30 A;  1E1L A;  2XFP A;  2J3N A;  4H2R A;  4UDR A;  4DNA A;  1GEU A;  5J60 A;  5KMR A;  2APG A;  3GWD A;  3G5S A;  3QFA A;  2JAE A;  4CBQ A;  4EM4 A;  2V6O A;  5KVI A;  1NDA A;  1FOH A;  2R4J A;  4OPI A;  1GES A;  2R46 A;  3ZYX A;  4ZCD A;  3V3N A;  2RGJ A;  3NK0 X;  2BXS A;  2FJA A;  4TLX A;  1N4W A;  1EL9 A;  1N4V A;  3I6D A;  1F6M A;  1MOK A;  3CPI G;  1NEN A;  1O5W A;  3UOZ A;  1PDH A;  1PBE A;  2XVJ A;  4NTD A;  2BCG G;  4H2N A;  1NHQ A;  3C4A A;  3LZX A;  2WP5 A;  4GCM A;  1CBO A;  1KNR A;  4G74 A;  4TM4 A;  3UCL A;  3DK8 A;  3AEF A;  1NG3 A;  3AEC A;  3CGC A;  1MO9 A;  3EF6 A;  2Z5Y A;  1CJC A;  2BK4 A;  2X8H A;  3AE5 A;  2JK6 A;  1OJA A;  1DOC A;  4NNJ A;  2V60 A;  4DSH A;  1NHS A;  1Q1W A;  3FBS A;  4LU6 A;  3VRA A;  4EMI A;  1FL2 A;  3AE2 A;  5C3J A;  3URH A;  4B1B A;  2AAQ A;  1XPQ A;  4CCR A;  1OJC A;  1HYU A;  1ELI A;  5C2T A;  3CPH G;  3AE6 A;  4BUR A;  1H7W A;  1GRB A;  4MJW A;  1FEC A;  1DJN A;  2OAM A;  3UOX A;  1LTX R;  3GMB A;  5U25 A;  5KMP A;  5FS9 A;  4C3Y A;  4C5O A;  3IC9 A;  1YQ3 A;  4NTE A;  2VVL G;  2YVF A;  3NGC X;  2XYO A;  1S2Y A;  2WDQ A;  3DH9 A;  4USR A;  3KU9 A;  3B3R A;  2WEU A;  2YAU A;  5KVH A;  4FX9 A;  4B66 A;  5M10 A;  3K7Q X;  2PHH A;  3L1R A;  3GRT A;  1UKV G;  2B76 A;  1F8W A;  3ICT A;  2E5V A;  2OLN A;  2GMH A;  1JEH A;  2B9W A;  2WHD A;  3T14 A;  1ZOV A;  5JCL A;  4B65 A;  3UP4 A;  3HYW A;  3NK1 X;  4H4Q A;  3NNE A;  4OPT A;  1L9E A;  3AYI A;  3AYJ A;  2JB1 A;  2C72 A;  4AP1 A;  1O95 A;  3AEE A;  5KNL A;  4YSH A;  4GRT A;  1PHH A;  2BS4 A;  2XLS A;  2FJD A;  3DK4 A;  3G5R A;  4X9M A;  3SX6 A;  3P9U A;  2C4C A;  2WS3 A;  3T31 A;  2WPF A;  1K0I A;  2VQB A;  1Y56 B;  2GQW A;  4H4U A;  4OVI A;  3NH3 X;  1MXT A;  5FMH A;  3UKA A;  4EMJ A;  1NAA A;  3DME A;  4AP3 A;  2GEW A;  3F8P A;  4GAP A;  2EQ9 A;  4H2Q A;  3KD9 A;  3NYE A;  1GTE A;  5FS8 A;  1H6V A;  2Q6U A;  5IQ4 A;  3T2Z A;  2C7G A;  3PS9 A;  4RSL A;  3SGL A;  3UKK A;  1GRH A;  1ZMD A;  2BXR A;  4H4Y A;  1XHC A;  3KPF A;  4NWZ A;  3SZC A;  3HYV A;  4UDQ A;  2VRL A;  2WQY A;  2YM1 A;  2FJB A;  2Q7V A;  4JNA A;  4HB9 A;  2BRA A;  4OCG A;  4U8K A;  3OC4 A;  3K7T A;  4U8I A;  4USQ A;  4Y4M A;  1H81 A;  3BNU A;  2BAB A;  3ADA B;  1K0J A;  1JNR A;  2WPC A;  3GYI A;  4YSZ A;  4CNK A;  5HHF A;  2JKC A;  3AE7 A;  4U2S A;  1L0V A;  2E1M A;  5U1O A;  1GET A;  3NYF A;  1F8S A;  3H8I A;  5HYM A;  4O5U A;  3IWA A;  3AE4 A;  1GRE A;  1D4E A;  3GDP A;  3V3O A;  3IF9 A;  5JCM A;  1NPX A;  4GDE A;  1COY A;  3OZ2 A;  3P4R A;  4K5R A;  4CY6 A;  3NN0 X;  1N4U A;  3GMC A;  3VR9 A;  4G73 A;  4TLZ A;  2A8X A;  3M0O A;  2GAH B;  2O9Z A;  4U2T A;  1TYP A;  3UTE A;  4Z2U A;  1NHP A;  1CJ2 A;  2JB2 A;  2AQJ A;  3NTD A;  2GQF A;  3AEG A;  2B9Y A;  3Q6J A;  2XVI A;  2YLR A;  3UKQ A;  3UTG A;  2YVJ A;  3K7M X;  2V5Z A;  4B69 A;  1PBB A;  4B67 A;  4YTM A;  2VVM A;  2YVG A;  1IUU A;  4JY3 A;  3UKP A;  1PXA A;  2VRM A;  3ALM A;  3GYJ A;  4Z44 A;  5JCK A;  1H83 A;  2IVD A;  1NG4 A;  2GV8 A;  4EQR A;  1LJ1 A;  4YSX A;  4A99 A;  2YM2 A;  3KKJ A;  5DBJ A;  4WCT A;  1QLB A;  2V3A A;  2WES A;  2XLR A;  4YSY A;  3DGZ A;  2GR0 A;  3L8K A;  3RP6 A;  1YKJ A;  3FIM B;  2Q0L A;  2X8C A;  1ZMC A;  1TDF A;  1Q1R A;  3GWF A;  2ZZB A;  3H8L A;  1Y56 A;  1P2E A;  1RSG A;  2R9Z A;  4GUV A;  4J2W A;  4JY2 A;  4TM1 A;  4U8L A;  2XFN A;  3IHG A;  3UKH A;  4EIP A;  4EQX A;  1DJQ A;  1IJH A;  1ZX9 A;  1D4D A;  4ICY A;  4Z2T A;  1GTH A;  1JNZ A;  4II3 A;  1Z6L A;  4FDC B;  3FPZ A;  2C64 A;  2YWL A;  3ATQ A;  3VQR A;  1F8R A;  3CN8 A;  4U8N A;  5KRQ A;  1TDK A;  4A9W A;  1N1P A;  1DOB A;  3DJJ A;  1BZL A;  3SM8 A;  2WET A;  3P1W A;  3NK2 X;  3NRN A;  1FEA A;  1XDI A;  2GR1 A;  1B37 A;  5KOW A;  4B68 A;  2EQ6 A;  2IID A;  3BHK A;  3CNT A;  1QJD A;  2RGH A;  1BKW A;  4GR1 A;  4OPG A;  2RAB A;  2YR4 A;  3GDN A;  3LOV A;  4K7Z A;  1JU2 A;  1ZDL A;  4H4P A;  4AOX A;  4Z2R A;  5KXJ A;  1EL5 A;  3CGB A;  3LJP A;  5KWF A;  1S3B A;  3AXB A;  3PO7 A;  3SFE A;  4ECH A;  1PJ6 A;  1EBD A;  5FS6 A;  3SFD A;  3CNP A;  1H7X A;  3DJD A;  2GR3 A;  3C4N A;  4U8J A;  4ZCC A;  3WE0 A;  1P2H A;  1JOA A;  3AYL A;  3CIR A;  5TR3 A;  3CNJ A;  3RP7 A;  2C73 A;  4K22 A;  4I58 A;  1SEZ A;  1VG9 A;  1LQU A;  4D04 A;  2JBV A;  1B5Q A;  4JDR A;  4A6N A;  1D5T A;  1PBF A;  2VVL A;  1ONF A;  1ZP0 A;  2YLZ A;  4EQW A;  1GOS A;  2BA9 A;  4LA1 A;  1L9C A;  3NT6 A;  2XFQ A;  4IVM B;  1LV0 A;  1KFY A;  3C96 A;  3CND A;  4H4S A;  1PN0 A;  3B6D A;  1GSN A;  2GMJ A;  2H88 A;  3AD9 B;  3NG7 X;  3VRD B;  4O5Q A;  1X31 B;  2WDR A;  2X3N A;  3ICS A;  3NYC A;  2CFY A;  5J7X A;  4GDP A;  2RGO A;  2CVJ A;  3CMM A;  3QVR A;  2C3C A;  3AEA A;  2UZZ A;  1GRF A;  3GYX A;  3NN6 X;  3SZF A;  4YT0 A;  1GRT A;  3NKS A;  2YG6 A;  1W4X A;  1IUT A;  3O0H A;  1PJ7 A;  4CCQ A;  4C74 A;  3SXI A;  1M6I A;  2GAG B;  4B64 A;  2VQ7 A;  1Y0P A;  2C66 A;  4CNJ A;  2IVE A;  4ZN0 A;  3ATR A;  4UDP A;  4BV6 A;  4NEW A;  1GAL A;  1FEB A;  1D7Y A;  1PXB A;  1IUS A;  1YY5 A;  3DA1 A;  2GR2 A;  2WU5 A;  2TPR A;  3SZW A;  3GSI A;  3T2Y A;  4BJY A;  4CRT A;  1F3P A;  1GPE A;  4EM3 A;  2FJE A;  3EAN A;  2PYX A;  1V59 A;  2HQM A;  4H4T A;  1TRB A;  2GH5 A;  2A87 A;  2ZBW A;  1K4Q A;  1NHR A;  3NTA A;  4NZH A;  1IUX A;  3AEB A;  2OA1 A;  4IA5 A;  1O94 A;  2WBA A;  1S2Q A;  2AR8 A;  1JRZ A;  2XVE A;  1NEK A;  3DJE A;  1BGJ A;  4OPU A;  2WPE A;  5L46 A;  2BS3 A;  2CUL A;  2BRY A;  2XLP A;  5EB4 A;  4Z24 A;  1TYT A;  4H4X A;  4OPD A;  1IUW A;  2GRT A;  2QAE A;  4D03 A;  4KX6 A;  3FMW A;  1H82 A;  1DOE A;  1Q9I A;  1AOG A;  3KLJ A;  2EQ8 A;  4ADW A;  4EQS A;  3AE9 A;  1VRQ B;  4JN9 A;  5KMS A;  4FK1 A;  2X8G A;  1BF3 A;  4U8P A;  3FG2 P;  4FK1 C;  2XLT A;  1E39 A;  3DJG X;  4N9X A;  3S5W A;  5CQF A;  4CY8 A;  1IUV A;  1KF6 A;  2C67 A;  2XFU A;  3PVC A;  4H4Z A;  1OJ9 A;  2B7R A;  5EOW A;  4C3X A;  1CC6 A;  3ALL A;  2NVK X;  2BK5 A;  2YLS A;  2ZZ0 A;  4H50 A;  4II2 A;  4Z26 A;  3JSK A;  3Q9T A;  2WOW A;  3I3L A;  3ITJ A;  3LB8 A;  4K8D A;  1TDN A;  2WU2 A;  4C77 A;  1CL0 A;  3F8R A;  1CJ3 A;  1PS9 A;  3CGD A;  2BC1 A;  3R9U A;  4XWR A;  1ZKQ A;  3CNS A;  4Y4L A;  3T0K A;  1GV4 A;  1JRX A;  4RG4 A;  1OJD A;  2V61 A;  2W0H A;  3GD4 A;  3ISH A;  3LXD A;  1CC4 A;  1VG0 A;  2V3B A;  1B8S A;  2Q0K A;  4H4V A;  3UTF A;  4U8M A;  3RHA A;  5BUK A;  4DGK A;  4HA6 A;  4JQ9 A;  5EB5 A;  1GRA A;  5M0Z A;  1GER A;  3F8D A;  4BK2 A;  1PBC A;  3AB1 A;  2DKH A;  1BWC A;  2NPX A;  3NLC A;  2DKI A;  3KPK A;  3H4K A;  2EQ7 A;  4Z25 A;  2QCU A;  2Y6R A;  3UP5 A;  2YG7 A;  3KVE A;  4XXG A;  1D4C A;  2OLO A;  4X9N A;  2YR6 A;  1RYI A;  4K2X A;  2R0C A;  3BI2 A;  4WX1 A;  3VR8 A;  3ZDN A;  3QSE A;  2C70 A;  3QFB A;  1L9D A;  3HZL A;  2GVC A;  2TMD A;  2YG4 A;  4IA6 A;  2X50 A;  4KPR A;  4YXD A;  4G6H A;  2VZ2 A;  3RP8 A;  3UTH A;  2CDU A;  4J36 A;  4BJZ A;  3P4S A;  2Y6Q A;  1E1N A;  4TM3 A;  2BAC A;  3COX A;  3QSM A;  1CC2 A;  1E1K A;  1ZOY A;  3ICR A;  5BUL A;  1LQT A;  1GRG A;  4APN A;  2YLW A;  2Z5X A;  3ALJ A;  2JB3 A;  2C3D A;  4A6N B;  2YQU A;  3LAD A;  3GD3 A;  2E4G A;  2B9X A;  1DOD A;  2BCP A;  3AE3 A;  2WP9 A;  1CHU A;  3DGH A;  4PAB A;  2B7S A;  4J33 A;  1DXL A;  4BK3 A;  2YG5 A;  3AD8 B;  1D7L A;  4IV9 A;  1CF3 A;  2XCG A;  5KMQ A;  4NTC A;  3V76 A;  1OJT A;  4YTP A;  3IHM A;  3M13 A;  2XVF A;  2WOV A;  2H89 A;  2GB0 A;  3P4Q A;  4H4R A;  5U63 A;  4U2L A;  4REK A;  3HYX A;  1M64 A;  3CGE A;  3P4P A;  2XLU A;  3EPT A;  1S3E A;  4J56 A;  2WDV A;  3G5Q A;  5LV9 A;  3D1C A;  4UP3 A;  1PBD A;  2GF3 A;  3DK9 A;  3AD7 B;  1KNP A;  2I0Z A;  3II4 A;  3BNM A;  4LII A;  1GT8 A;  4NEV A;  2R0G A;  1DNC A;  3BI4 A;  3SQP A;  2XVH A;  5HY5 A;  1H86 A;  4RG3 A;  1E1M A;  1CJ4 A;  3NHO X;  5ER0 A;  4YKG A;  1XAN A;  2QA1 A;  3UOY A;  2ZZC A;  4YKF A;  1YQZ A;  3LZW A;  1E6E A;  4TM0 A;  2YR5 A;  3SYI A;  2C75 A;  5FS7 A;  3KA7 A;  1KSU A;  4M52 A;  1VQW A;  2ACZ A;  5GSN A;  2BS2 A;  2OAL A;  2BC0 A;  3EAO A;  5HXI A;  2BK3 A;  3UKF A;  1B4V A; 
#chains in the Genus database with same CATH homology
 5JCI A;  3SZ0 A;  4A5L A;  2VOU A;  1EL7 A;  4YTN A;  4IVO B;  1JRY A;  4H2P A;  4K5S A;  5GRT A;  3RED A;  1KSS A;  2R4E A;  4GF7 A;  2ARD A;  3E1T A;  2BYB A;  2C65 A;  4OPC A;  4Z43 A;  4XWZ A;  3BI5 A;  4H4W A;  4I59 A;  3UKL A;  4G6G A;  1ZK7 A;  3BHF A;  4JNQ A;  2QA2 A;  1EL8 A;  3AE1 A;  3AED A;  3CTY A;  3QJ4 A;  4A79 A;  1REO A;  3ABV A;  1LPF A;  1YQ4 A;  2XFO A;  3QVP A;  4PAA A;  3S61 A;  2YG3 A;  2C76 A;  5IQ1 A;  3AWI A;  2WOI A;  3AE8 A;  3D8X A;  2YLX A;  1FCD A;  4E0V A;  4EIQ A;  1H84 A;  1TDO A;  4YWO A;  4AOS A;  5BRT A;  3QSS A;  1PJ5 A;  4B63 A;  4U8O A;  2F5Z A;  3CPJ G;  2FBW A;  4Y4N A;  3SY4 A;  1LVL A;  5KOX A;  1K0L A;  1PXC A;  4AT0 A;  2WP6 A;  4DSG A;  1ZY8 A;  2YLT A;  4H7U A;  3T37 A;  3UOV A;  5CKU A;  4OPL A;  1GXF A;  1E7P A;  1RP0 A;  4AT2 A;  3NIX A;  4A7A A;  1BGN A;  1GND A;  1QO8 A;  2R0P A;  3GRS A;  4J34 A;  4J57 A;  1KDG A;  4X4J A;  4P9S A;  4GAV A;  3RNM A;  4EMW A;  2A89 A;  4J31 A;  1TDE A;  1VDC A;  2XDO A;  2X99 A;  3M12 A;  4G9K A;  5BVA A;  5IPY A;  5EBK A;  4A65 A;  2R45 A;  3VRB A;  5JCN A;  3T2K A;  4BK1 A;  3K30 A;  1E1L A;  2XFP A;  2J3N A;  4H2R A;  4UDR A;  4DNA A;  1GEU A;  5J60 A;  5KMR A;  2APG A;  3GWD A;  3G5S A;  3QFA A;  2JAE A;  4CBQ A;  4EM4 A;  2V6O A;  5KVI A;  1NDA A;  1FOH A;  2R4J A;  4OPI A;  1GES A;  2R46 A;  3ZYX A;  4ZCD A;  3V3N A;  2RGJ A;  3NK0 X;  2BXS A;  2FJA A;  4TLX A;  1N4W A;  1EL9 A;  1N4V A;  3I6D A;  1F6M A;  1MOK A;  3CPI G;  1NEN A;  1O5W A;  3UOZ A;  1PDH A;  1PBE A;  2XVJ A;  4NTD A;  2BCG G;  4H2N A;  1NHQ A;  3C4A A;  3LZX A;  2WP5 A;  4GCM A;  1CBO A;  1KNR A;  4G74 A;  4TM4 A;  3UCL A;  3DK8 A;  3AEF A;  1NG3 A;  3AEC A;  3CGC A;  1MO9 A;  3EF6 A;  2Z5Y A;  1CJC A;  2BK4 A;  2X8H A;  3AE5 A;  2JK6 A;  1OJA A;  1DOC A;  4NNJ A;  2V60 A;  4DSH A;  1NHS A;  1Q1W A;  3FBS A;  4LU6 A;  3VRA A;  4EMI A;  1FL2 A;  3AE2 A;  5C3J A;  3URH A;  4B1B A;  2AAQ A;  1XPQ A;  4CCR A;  1OJC A;  1HYU A;  1ELI A;  5C2T A;  3CPH G;  3AE6 A;  4BUR A;  1H7W A;  1GRB A;  4MJW A;  1FEC A;  1DJN A;  2OAM A;  3UOX A;  1LTX R;  3GMB A;  5U25 A;  5KMP A;  5FS9 A;  4C3Y A;  4C5O A;  3IC9 A;  1YQ3 A;  4NTE A;  2VVL G;  2YVF A;  3NGC X;  2XYO A;  1S2Y A;  2WDQ A;  3DH9 A;  4USR A;  3KU9 A;  3B3R A;  2WEU A;  2YAU A;  5KVH A;  4FX9 A;  4B66 A;  5M10 A;  3K7Q X;  2PHH A;  3L1R A;  3GRT A;  1UKV G;  2B76 A;  1F8W A;  3ICT A;  2E5V A;  2OLN A;  2GMH A;  1JEH A;  2B9W A;  2WHD A;  3T14 A;  1ZOV A;  5JCL A;  4B65 A;  3UP4 A;  3HYW A;  3NK1 X;  4H4Q A;  3NNE A;  4OPT A;  1L9E A;  3AYI A;  3AYJ A;  2JB1 A;  2C72 A;  4AP1 A;  1O95 A;  3AEE A;  5KNL A;  4YSH A;  4GRT A;  1PHH A;  2BS4 A;  2XLS A;  2FJD A;  3DK4 A;  3G5R A;  4X9M A;  3SX6 A;  3P9U A;  2C4C A;  2WS3 A;  3T31 A;  2WPF A;  1K0I A;  2VQB A;  1Y56 B;  2GQW A;  4H4U A;  4OVI A;  3NH3 X;  1MXT A;  5FMH A;  3UKA A;  4EMJ A;  1NAA A;  3DME A;  4AP3 A;  2GEW A;  3F8P A;  4GAP A;  2EQ9 A;  4H2Q A;  3KD9 A;  3NYE A;  1GTE A;  5FS8 A;  1H6V A;  2Q6U A;  5IQ4 A;  3T2Z A;  2C7G A;  3PS9 A;  4RSL A;  3SGL A;  3UKK A;  1GRH A;  1ZMD A;  2BXR A;  4H4Y A;  1XHC A;  3KPF A;  4NWZ A;  3SZC A;  3HYV A;  4UDQ A;  2VRL A;  2WQY A;  2YM1 A;  2FJB A;  2Q7V A;  4JNA A;  4HB9 A;  2BRA A;  4OCG A;  4U8K A;  3OC4 A;  3K7T A;  4U8I A;  4USQ A;  4Y4M A;  1H81 A;  3BNU A;  2BAB A;  3ADA B;  1K0J A;  1JNR A;  2WPC A;  3GYI A;  4YSZ A;  4CNK A;  5HHF A;  2JKC A;  3AE7 A;  4U2S A;  1L0V A;  2E1M A;  5U1O A;  1GET A;  3NYF A;  1F8S A;  3H8I A;  5HYM A;  4O5U A;  3IWA A;  3AE4 A;  1GRE A;  1D4E A;  3GDP A;  3V3O A;  3IF9 A;  5JCM A;  1NPX A;  4GDE A;  1COY A;  3OZ2 A;  3P4R A;  4K5R A;  4CY6 A;  3NN0 X;  1N4U A;  3GMC A;  3VR9 A;  4G73 A;  4TLZ A;  2A8X A;  3M0O A;  2GAH B;  2O9Z A;  4U2T A;  1TYP A;  3UTE A;  4Z2U A;  1NHP A;  1CJ2 A;  2JB2 A;  2AQJ A;  3NTD A;  2GQF A;  3AEG A;  2B9Y A;  3Q6J A;  2XVI A;  2YLR A;  3UKQ A;  3UTG A;  2YVJ A;  3K7M X;  2V5Z A;  4B69 A;  1PBB A;  4B67 A;  4YTM A;  2VVM A;  2YVG A;  1IUU A;  4JY3 A;  3UKP A;  1PXA A;  2VRM A;  3ALM A;  3GYJ A;  4Z44 A;  5JCK A;  1H83 A;  2IVD A;  1NG4 A;  2GV8 A;  4EQR A;  1LJ1 A;  4YSX A;  4A99 A;  2YM2 A;  3KKJ A;  5DBJ A;  4WCT A;  1QLB A;  2V3A A;  2WES A;  2XLR A;  4YSY A;  3DGZ A;  2GR0 A;  3L8K A;  3RP6 A;  1YKJ A;  3FIM B;  2Q0L A;  2X8C A;  1ZMC A;  1TDF A;  1Q1R A;  3GWF A;  2ZZB A;  3H8L A;  1Y56 A;  1P2E A;  1RSG A;  2R9Z A;  4GUV A;  4J2W A;  4JY2 A;  4TM1 A;  4U8L A;  2XFN A;  3IHG A;  3UKH A;  4EIP A;  4EQX A;  1DJQ A;  1IJH A;  1ZX9 A;  1D4D A;  4ICY A;  4Z2T A;  1GTH A;  1JNZ A;  4II3 A;  1Z6L A;  4FDC B;  3FPZ A;  2C64 A;  2YWL A;  3ATQ A;  3VQR A;  1F8R A;  3CN8 A;  4U8N A;  5KRQ A;  1TDK A;  4A9W A;  1N1P A;  1DOB A;  3DJJ A;  1BZL A;  3SM8 A;  2WET A;  3P1W A;  3NK2 X;  3NRN A;  1FEA A;  1XDI A;  2GR1 A;  1B37 A;  5KOW A;  4B68 A;  2EQ6 A;  2IID A;  3BHK A;  3CNT A;  1QJD A;  2RGH A;  1BKW A;  4GR1 A;  4OPG A;  2RAB A;  2YR4 A;  3GDN A;  3LOV A;  4K7Z A;  1JU2 A;  1ZDL A;  4H4P A;  4AOX A;  4Z2R A;  5KXJ A;  1EL5 A;  3CGB A;  3LJP A;  5KWF A;  1S3B A;  3AXB A;  3PO7 A;  3SFE A;  4ECH A;  1PJ6 A;  1EBD A;  5FS6 A;  3SFD A;  3CNP A;  1H7X A;  3DJD A;  2GR3 A;  3C4N A;  4U8J A;  4ZCC A;  3WE0 A;  1P2H A;  1JOA A;  3AYL A;  3CIR A;  5TR3 A;  3CNJ A;  3RP7 A;  2C73 A;  4K22 A;  4I58 A;  1SEZ A;  1VG9 A;  1LQU A;  4D04 A;  2JBV A;  1B5Q A;  4JDR A;  4A6N A;  1D5T A;  1PBF A;  2VVL A;  1ONF A;  1ZP0 A;  2YLZ A;  4EQW A;  1GOS A;  2BA9 A;  4LA1 A;  1L9C A;  3NT6 A;  2XFQ A;  4IVM B;  1LV0 A;  1KFY A;  3C96 A;  3CND A;  4H4S A;  1PN0 A;  3B6D A;  1GSN A;  2GMJ A;  2H88 A;  3AD9 B;  3NG7 X;  3VRD B;  4O5Q A;  1X31 B;  2WDR A;  2X3N A;  3ICS A;  3NYC A;  2CFY A;  5J7X A;  4GDP A;  2RGO A;  2CVJ A;  3CMM A;  3QVR A;  2C3C A;  3AEA A;  2UZZ A;  1GRF A;  3GYX A;  3NN6 X;  3SZF A;  4YT0 A;  1GRT A;  3NKS A;  2YG6 A;  1W4X A;  1IUT A;  3O0H A;  1PJ7 A;  4CCQ A;  4C74 A;  3SXI A;  1M6I A;  2GAG B;  4B64 A;  2VQ7 A;  1Y0P A;  2C66 A;  4CNJ A;  2IVE A;  4ZN0 A;  3ATR A;  4UDP A;  4BV6 A;  4NEW A;  1GAL A;  1FEB A;  1D7Y A;  1PXB A;  1IUS A;  1YY5 A;  3DA1 A;  2GR2 A;  2WU5 A;  2TPR A;  3SZW A;  3GSI A;  3T2Y A;  4BJY A;  4CRT A;  1F3P A;  1GPE A;  4EM3 A;  2FJE A;  3EAN A;  2PYX A;  1V59 A;  2HQM A;  4H4T A;  1TRB A;  2GH5 A;  2A87 A;  2ZBW A;  1K4Q A;  1NHR A;  3NTA A;  4NZH A;  1IUX A;  3AEB A;  2OA1 A;  4IA5 A;  1O94 A;  2WBA A;  1S2Q A;  2AR8 A;  1JRZ A;  2XVE A;  1NEK A;  3DJE A;  1BGJ A;  4OPU A;  2WPE A;  5L46 A;  2BS3 A;  2CUL A;  2BRY A;  2XLP A;  5EB4 A;  4Z24 A;  1TYT A;  4H4X A;  4OPD A;  1IUW A;  2GRT A;  2QAE A;  4D03 A;  4KX6 A;  3FMW A;  1H82 A;  1DOE A;  1Q9I A;  1AOG A;  3KLJ A;  2EQ8 A;  4ADW A;  4EQS A;  3AE9 A;  1VRQ B;  4JN9 A;  5KMS A;  4FK1 A;  2X8G A;  1BF3 A;  4U8P A;  3FG2 P;  4FK1 C;  2XLT A;  1E39 A;  3DJG X;  4N9X A;  3S5W A;  5CQF A;  4CY8 A;  1IUV A;  1KF6 A;  2C67 A;  2XFU A;  3PVC A;  4H4Z A;  1OJ9 A;  2B7R A;  5EOW A;  4C3X A;  1CC6 A;  3ALL A;  2NVK X;  2BK5 A;  2YLS A;  2ZZ0 A;  4H50 A;  4II2 A;  4Z26 A;  3JSK A;  3Q9T A;  2WOW A;  3I3L A;  3ITJ A;  3LB8 A;  4K8D A;  1TDN A;  2WU2 A;  4C77 A;  1CL0 A;  3F8R A;  1CJ3 A;  1PS9 A;  3CGD A;  2BC1 A;  3R9U A;  4XWR A;  1ZKQ A;  3CNS A;  4Y4L A;  3T0K A;  1GV4 A;  1JRX A;  4RG4 A;  1OJD A;  2V61 A;  2W0H A;  3GD4 A;  3ISH A;  3LXD A;  1CC4 A;  1VG0 A;  2V3B A;  1B8S A;  2Q0K A;  4H4V A;  3UTF A;  4U8M A;  3RHA A;  5BUK A;  4DGK A;  4HA6 A;  4JQ9 A;  5EB5 A;  1GRA A;  5M0Z A;  1GER A;  3F8D A;  4BK2 A;  1PBC A;  3AB1 A;  2DKH A;  1BWC A;  2NPX A;  3NLC A;  2DKI A;  3KPK A;  3H4K A;  2EQ7 A;  4Z25 A;  2QCU A;  2Y6R A;  3UP5 A;  2YG7 A;  3KVE A;  4XXG A;  1D4C A;  2OLO A;  4X9N A;  2YR6 A;  1RYI A;  4K2X A;  2R0C A;  3BI2 A;  4WX1 A;  3VR8 A;  3ZDN A;  3QSE A;  2C70 A;  3QFB A;  1L9D A;  3HZL A;  2GVC A;  2TMD A;  2YG4 A;  4IA6 A;  2X50 A;  4KPR A;  4YXD A;  4G6H A;  2VZ2 A;  3RP8 A;  3UTH A;  2CDU A;  4J36 A;  4BJZ A;  3P4S A;  2Y6Q A;  1E1N A;  4TM3 A;  2BAC A;  3COX A;  3QSM A;  1CC2 A;  1E1K A;  1ZOY A;  3ICR A;  5BUL A;  1LQT A;  1GRG A;  4APN A;  2YLW A;  2Z5X A;  3ALJ A;  2JB3 A;  2C3D A;  4A6N B;  2YQU A;  3LAD A;  3GD3 A;  2E4G A;  2B9X A;  1DOD A;  2BCP A;  3AE3 A;  2WP9 A;  1CHU A;  3DGH A;  4PAB A;  2B7S A;  4J33 A;  1DXL A;  4BK3 A;  2YG5 A;  3AD8 B;  1D7L A;  4IV9 A;  1CF3 A;  2XCG A;  5KMQ A;  4NTC A;  3V76 A;  1OJT A;  4YTP A;  3IHM A;  3M13 A;  2XVF A;  2WOV A;  2H89 A;  2GB0 A;  3P4Q A;  4H4R A;  5U63 A;  4U2L A;  4REK A;  3HYX A;  1M64 A;  3CGE A;  3P4P A;  2XLU A;  3EPT A;  1S3E A;  4J56 A;  2WDV A;  3G5Q A;  5LV9 A;  3D1C A;  4UP3 A;  1PBD A;  2GF3 A;  3DK9 A;  3AD7 B;  1KNP A;  2I0Z A;  3II4 A;  3BNM A;  4LII A;  1GT8 A;  4NEV A;  2R0G A;  1DNC A;  3BI4 A;  3SQP A;  2XVH A;  5HY5 A;  1H86 A;  4RG3 A;  1E1M A;  1CJ4 A;  3NHO X;  5ER0 A;  4YKG A;  1XAN A;  2QA1 A;  3UOY A;  2ZZC A;  4YKF A;  1YQZ A;  3LZW A;  1E6E A;  4TM0 A;  2YR5 A;  3SYI A;  2C75 A;  5FS7 A;  3KA7 A;  1KSU A;  4M52 A;  1VQW A;  2ACZ A;  5GSN A;  2BS2 A;  2OAL A;  2BC0 A;  3EAO A;  5HXI A;  2BK3 A;  3UKF A;  1B4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...