2XVFA

Crystal structure of bacterial flavin-containing monooxygenase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
445
structure length
445
Chain Sequence
b'TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 137
structure length 445
sequence length 445
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvfA02
4HA6A 3QFBA 3CGCA 4YSYA 1F6MA 2B76A 2YLXA 3DMEA 1PDHA 5BUKA 3K7QX 1DNCA 1GTHA 1XPQA 4PABA 4OCGA 2XFUA 4OPUA 4EIPA 5IQ1A 1D4CA 2OLNA 3FIMB 4CRTA 4Z2RA 3LADA 2Q7VA 4AOSA 3B3RA 1CC4A 3S61A 1GRHA 4YXDA 3ADAB 2V3AA 3KLJA 1F8SA 1IUXA 1YQ4A 2C76A 3LOVA 3CNTA 3IHMA 1IUSA 3FMWA 1GETA 2C73A 3DA1A 2J3NA 1PBEA 4E0VA 2YLSA 1REOA 2R9ZA 1COYA 2EQ6A 2JB1A 1MXTA 2FJDA 3ZYXA 2OALA 5KXJA 3P1WA 1KF6A 4A99A 1Q9IA 4K5SA 4OPDA 4U8MA 3CNSA 4H4VA 4DSGA 1KDGA 4RG4A 4EMJA 4LU6A 1CJ4A 1L9CA 4A5LA 1GALA 1GERA 5BRTA 4JY3A 5ER0A 2BS2A 1CJ3A 2WPEA 1RYIA 5C3JA 1XDIA 1ZDLA 4DSHA 3FBSA 2WPCA 4B66A 2VVMA 1FEAA 2BK3A 1ZX9A 3DK8A 2ACZA 1YQ3A 3AEAA 4FK1C 1YQZA 2X3NA 4O5QA 3ICTA 4GUVA 1TDKA 4A9WA 1TDNA 5KRQA 2C3DA 2WP6A 2A89A 1VG0A 4GDEA 2Q0LA 2BXRA 1IUWA 3AEFA 3DJJA 1PXAA 1E1MA 3FG2P 1K0IA 3VR9A 1GTEA 1V59A 1VG9A 3C4NA 1NHRA 4J33A 5KWFA 2GH5A 2GVCA 2V3BA 4OPCA 1KSUA 1GRFA 1W4XA 2BACA 2YR4A 2QA2A 3NYEA 2BABA 3UOZA 3AE4A 3AD7B 1MO9A 1D7YA 1E6EA 4OPLA 4BJZA 5JCIA 3KPFA 2YVJA 4GDPA 2XVFA 2WOIA 1TDOA 3NKSA 4RG3A 4HB9A 3M12A 2BYBA 3AXBA 1Z6LA 5IPYA 4H4YA 4K7ZA 2JBVA 2YVGA 4DGKA 3VQRA 4U8LA 3EPTA 1B8SA 1LV0A 4UDRA 1ZMDA 1BKWA 2RGOA 2WP9A 4ZCCA 2V6OA 2B7RA 3B6DA 2B9WA 4DNAA 4FX9A 1BF3A 5U63A 1B5QA 1QO8A 1ZKQA 4NTCA 2RABA 2YQUA 3M0OA 4BURA 4EQXA 3QSSA 5EB5A 3LZXA 5M10A 1KSSA 1ZMCA 2YR6A 1PN0A 2ARDA 3ATQA 1D4DA 3M13A 3AE8A 2XVJA 4IV9A 4NEVA 3AYIA 4H2NA 3UTGA 1CJ2A 4H2PA 1H7WA 4H7UA 2QCUA 3P9UA 1PJ7A 5HXIA 1JNZA 2XVEA 1N4WA 5U1OA 1H84A 1CHUA 4JDRA 1E7PA 4K2XA 3PO7A 4OPGA 4YT0A 4A65A 3UTEA 1TYPA 3UOVA 1CBOA 4YWOA 3CNJA 3VRDB 3DGHA 4ADWA 4IVOB 2VVLG 5EOWA 2NPXA 4H4QA 1Y0PA 5HY5A 3NHOX 1DJNA 1GREA 3IWAA 1Q1RA 3LXDA 4JNAA 4YKGA 3NK1X 3GDPA 3GMBA 4K22A 3P4SA 2GR0A 3UKPA 1FL2A 4J34A 3AEEA 2X50A 4ZN0A 3AE9A 2AQJA 1PXCA 1N1PA 3H8IA 1BZLA 1DJQA 3UP5A 1PXBA 5KVIA 1E1KA 1YKJA 4GF7A 4U2SA 1H83A 2H89A 5KOWA 3K7TA 4EMIA 1NHSA 4BK2A 2XVHA 3Q9TA 3QSEA 3CGEA 3QFAA 3QVRA 4AT0A 4TM1A 1TRBA 1OJCA 5JCKA 2F5ZA 1LTXR 2OA1A 1JRXA 2C3CA 2WS3A 1F8WA 1E1LA 1VRQB 2VZ2A 3IC9A 2AR8A 1SEZA 1PBBA 1IUTA 3GWDA 2C70A 1GRGA 3AE6A 1GESA 2YG5A 4H4SA 3II4A 1CL0A 3D8XA 3UOXA 1ZY8A 3F8PA 1Y56B 2GAGB 4AOXA 4OPIA 1ZOYA 2GR3A 4ICYA 4JQ9A 2JB3A 3GYIA 2YAUA 2V5ZA 3BHKA 4UP3A 2XVIA 5GRTA 3AYLA 2VRMA 3UTHA 2I0ZA 3AE2A 3VR8A 1N4UA 2CULA 3AD8B 1D7LA 3GD4A 3R9UA 2OAMA 3VRBA 2EQ8A 1GPEA 2E1MA 4J57A 3DJDA 3SGLA 4B68A 4C3XA 1RSGA 3RNMA 2XYOA 2YG4A 1H81A 4P9SA 1DOBA 3NH3X 2IIDA 5JCMA 3SM8A 3DGZA 3UKKA 3VRAA 1N4VA 2Y6QA 3ICRA 4CY8A 1GRTA 2BK5A 3DJGX 4Z25A 1VQWA 1NHQA 5JCLA 1X31B 3ICSA 3JSKA 3UKFA 4OPTA 1NDAA 1F3PA 2FBWA 2R0PA 1JU2A 3NRNA 4IA5A 1BGNA 4J2WA 2X8CA 4H4UA 2XFQA 1VDCA 1P2HA 1GXFA 1K0JA 4LIIA 5GSNA 4C77A 2Z5YA 3GDNA 4UDPA 1NAAA 2GR2A 1QJDA 2E5VA 2Q6UA 2V60A 2WOVA 3C96A 2JK6A 3AECA 2O9ZA 3NN0X 3URHA 4B65A 4NZHA 1H82A 4YSHA 1H6VA 2HQMA 4H4WA 2C67A 4H2RA 5DBJA 2WBAA 4USQA 3NGCX 1FOHA 2W0HA 3EAOA 4AP3A 1Y56A 3UP4A 1GRAA 1XHCA 2AAQA 3LZWA 4TLZA 1FECA 5EB4A 1NG4A 1M64A 2YM2A 2APGA 3P4RA 4XWZA 1EL8A 1NG3A 2Z5XA 4KPRA 1UKVG 4U8JA 3LJPA 2WETA 1KFYA 2CDUA 2FJAA 3CPIG 5CQFA 4ECHA 1B37A 2WEUA 3REDA 3V76A 2YG6A 4C5OA 1KNRA 1S3EA 2NVKX 1PJ5A 2DKHA 3CIRA 1B4VA 4TM0A 5J7XA 4Z24A 2BS3A 2WP5A 4WCTA 3EANA 3G5RA 4X9NA 2C64A 2IVDA 3L1RA 1EL7A 2PYXA 1FEBA 3UKLA 4CCRA 4Z2UA 3QSMA 1HYUA 2E4GA 3AEGA 3ZDNA 3O0HA 4WX1A 1CC6A 4A6NA 4H4XA 3BI2A 2Q0KA 3AE5A 2EQ9A 2BC0A 1PBFA 1PJ6A 5TR3A 5U25A 3UTFA 4B64A 3UKQA 1PHHA 3GMCA 2R4JA 5BULA 2XFNA 2UZZA 3CNDA 4XWRA 5C2TA 2BA9A 2OLOA 3P4PA 2C75A 4GR1A 2WQYA 2XDOA 4EQSA 3GD3A 2V61A 4FK1A 1GEUA 4REKA 2H88A 1DOCA 2YG3A 3DH9A 3K7MX 4OVIA 1D4EA 4AP1A 1OJDA 2JAEA 1IUUA 4JY2A 4UDQA 1K0LA 3BNMA 4EQWA 3ITJA 1BGJA 1RP0A 3AEDA 3IHGA 4NEWA 1GV4A 3NT6A 3GSIA 3UKHA 5FS8A 1PS9A 3SFDA 1O95A 2JB2A 4H50A 4C3YA 2BCPA 4U2LA 1L9EA 4EM3A 5FS9A 1GT8A 2BS4A 2YG7A 3ABVA 4K5RA 4Z26A 1LPFA 4U8IA 1ELIA 1TYTA 2ZZCA 1BWCA 4IA6A 2Y6RA 5M0ZA 1IUVA 3RP7A 4A79A 1O5WA 2YM1A 3CNPA 2GV8A 4X9MA 3NTAA 2X8GA 3NTDA 4B63A 4CNKA 1O94A 1ZOVA 2GAHB 1XANA 4XXGA 4B1BA 2B7SA 4USRA 4YKFA 3DK9A 3NYCA 5CKUA 2A8XA 4J31A 4O5UA 3SQPA 4MJWA 1L9DA 3KVEA 1DOEA 3V3NA 4TM3A 4YSXA 3SFEA 4BJYA 3ALJA 1NEKA 2GQFA 3OZ2A 2C7GA 2WDVA 2R0GA 3E1TA 1JOAA 4LA1A 4GCMA 3NK2X 3RP8A 2VRLA 3WE0A 1S2YA 3IF9A 3ALMA 1ONFA 2C65A 2B9XA 1E1NA 3UKAA 1YY5A 4J56A 3OC4A 2QA1A 3AYJA 1DXLA 3NN6X 1GOSA 2VQBA 4APNA 2WU5A 2XFOA 3ALLA 1QLBA 1NPXA 4NTEA 4CBQA 4Z44A 3ATRA 2X99A 1JRZA 3F8DA 1CJCA 2EQ7A 3F8RA 3HZLA 2VVLA 3LB8A 4NTDA 4EMWA 4J36A 5KVHA 1P2EA 3CGBA 3G5QA 3GRSA 2RGHA 4A7AA 4EIQA 4U8KA 3Q6JA 1LQUA 3AB1A 2BCGG 2WPFA 3CGDA 3CPJG 4YTNA 2XCGA 2R45A 5LV9A 2B9YA 3BHFA 4X4JA 3S5WA 3H4KA 3BI5A 4H4PA 2XLUA 4A6NB 2GR1A 1EL9A 1IJHA 3L8KA 1KNPA 3NIXA 4AT2A 3NK0X 1OJTA 1PBCA 4IVMB 3KA7A 5JCNA 5KOXA 5IQ4A 3GWFA 3P4QA 4C74A 3QJ4A 1DODA 2WU2A 2YR5A 3COXA 3I3LA 4YTMA 1NENA 1OJAA 2YLRA 2WOWA 4TM4A 4Y4MA 4K8DA 4B69A 4D04A 4EQRA 2YLTA 1S3BA 2TPRA 4H2QA 1JRYA 1LJ1A 2GEWA 1CF3A 4ZCDA 1JEHA 2A87A 4U8OA 1Q1WA 2XLSA 3CPHG 3FPZA 3K30A 2XLPA 3RP6A 1OJ9A 3UCLA 3AWIA 4JN9A 4YTPA 4Z2TA 2DKIA 1MOKA 3EF6A 2C72A 3AEBA 2YLZA 4H4TA 4FDCB 3CTYA 4KX6A 4YSZA 3GRTA 3H8LA 1ZK7A 2BC1A 4H4RA 4N9XA 1CC2A 2PHHA 3UOYA 1AOGA 2R0CA 4M52A 4Y4NA 5FMHA 2GMJA 2VOUA 2RGJA 2FJBA 4Y4LA 1JNRA 2ZBWA 4BK3A 3DK4A 2WDQA 4D03A 2GRTA 1E39A 4GRTA 5HHFA 3KU9A 3T37A 3V3OA 3AE1A 4I59A 5BVAA 1TDEA 3BNUA 4CY6A 3DJEA 2YVFA 3GYJA 4Z43A 1FCDA 1GRBA 1F8RA 3ISHA 4RSLA 3I6DA 1M6IA 3NG7X 3PS9A 4TLXA 2GMHA 2XFPA 1EL5A 4BV6A 5J60A 4H4ZA 2CFYA 1LQTA 2R46A 1L0VA 1NHPA 2GF3A 2BK4A 3D1CA 1GSNA 2GQWA 3AD9B 2JKCA 2TMDA 2ZZBA 2CVJA 3NNEA 4JNQA 4U8PA 4CCQA 2VQ7A 3G5SA 2ZZ0A 2WDRA 4U8NA 3NLCA 3KD9A 1H7XA 2XLRA 2WHDA 2IVEA 3CN8A 4B67A 2GB0A 2QAEA 4PAAA 1ZP0A 3C4AA 1S2QA 2XLTA 2YWLA 3KKJA 1LVLA 4CNJA 3NYFA 1H86A 1EBDA 1D5TA 2FJEA 2X8HA 5FS7A 2C66A 2YLWA 2WESA 3AE7A 3BI4A 4EM4A 5FS6A 4U2TA 3QVPA 5L46A 1TDFA 3AE3A 2BXSA 4BK1A 3PVCA 5EBKA 5HYMA 3RHAA 2R4EA 1GNDA 4I58A 1K4QA 1PBDA
chains in the Genus database with same CATH superfamily
4HA6A 3QFBA 3CGCA 4YSYA 3T31A 1F6MA 2B76A 2YLXA 3DMEA 1PDHA 5BUKA 3K7QX 1DNCA 1GTHA 1XPQA 4PABA 4OCGA 2XFUA 4OPUA 4EIPA 5IQ1A 1D4CA 2OLNA 3FIMB 4CRTA 4Z2RA 3LADA 2Q7VA 4AOSA 3B3RA 1CC4A 3S61A 1GRHA 4YXDA 3ADAB 2V3AA 3KLJA 1F8SA 1IUXA 1YQ4A 2C76A 3LOVA 3CNTA 3IHMA 1IUSA 3FMWA 1GETA 2C73A 3DA1A 2J3NA 1PBEA 4E0VA 2YLSA 1REOA 2R9ZA 1COYA 2EQ6A 2JB1A 1MXTA 2FJDA 3ZYXA 2OALA 5KXJA 3P1WA 1KF6A 4A99A 1Q9IA 4K5SA 4OPDA 4U8MA 3CNSA 4H4VA 4DSGA 1KDGA 4RG4A 4EMJA 4LU6A 1CJ4A 1L9CA 4A5LA 1GALA 1GERA 5BRTA 4JY3A 5ER0A 2BS2A 1CJ3A 2WPEA 1RYIA 5C3JA 1XDIA 1ZDLA 4DSHA 4G74A 3FBSA 2WPCA 4B66A 2VVMA 1FEAA 4NNJA 2BK3A 1ZX9A 3DK8A 2ACZA 1YQ3A 3AEAA 4FK1C 3T2KA 1YQZA 2X3NA 4O5QA 3ICTA 4GUVA 1TDKA 3HYWA 4A9WA 1TDNA 5KRQA 3SZWA 2C3DA 2WP6A 2A89A 1VG0A 4GDEA 2Q0LA 2BXRA 1IUWA 3AEFA 3DJJA 1PXAA 1E1MA 3FG2P 1K0IA 3VR9A 1GTEA 1V59A 1VG9A 3C4NA 1NHRA 4J33A 3CMMA 5KWFA 2GH5A 2GVCA 2V3BA 4OPCA 1KSUA 1GRFA 1W4XA 2BACA 2YR4A 2QA2A 3KPKA 3NYEA 2BABA 3UOZA 3AE4A 3AD7B 1MO9A 1D7YA 1E6EA 4OPLA 4BJZA 5JCIA 3KPFA 2YVJA 4GDPA 2XVFA 2WOIA 1TDOA 3NKSA 4RG3A 4HB9A 2C4CA 4II2A 3M12A 2BYBA 3AXBA 1Z6LA 5IPYA 4H4YA 4K7ZA 2JBVA 2YVGA 4DGKA 3VQRA 4U8LA 3EPTA 1B8SA 1LV0A 4UDRA 1ZMDA 1BKWA 2RGOA 2WP9A 4ZCCA 2V6OA 2B7RA 3B6DA 2B9WA 4DNAA 4FX9A 1BF3A 4GAPA 5U63A 1B5QA 1QO8A 1ZKQA 4NTCA 2RABA 2YQUA 3M0OA 4BURA 4EQXA 3QSSA 5EB5A 3LZXA 5M10A 1KSSA 1ZMCA 2YR6A 1PN0A 2ARDA 3ATQA 1D4DA 3M13A 3AE8A 2XVJA 4IV9A 4NEVA 3AYIA 4H2NA 3UTGA 1CJ2A 4H2PA 1H7WA 4H7UA 2QCUA 3P9UA 1PJ7A 5HXIA 1JNZA 2XVEA 1N4WA 5U1OA 1H84A 1CHUA 4JDRA 1E7PA 4K2XA 3PO7A 4OPGA 4YT0A 4A65A 3UTEA 1TYPA 3UOVA 1CBOA 4YWOA 3CNJA 3VRDB 3DGHA 4ADWA 4IVOB 2VVLG 5EOWA 2NPXA 4H4QA 1Y0PA 5HY5A 3NHOX 1DJNA 1GREA 3IWAA 1Q1RA 3LXDA 4JNAA 4YKGA 3NK1X 3GDPA 3GMBA 4K22A 3P4SA 2GR0A 3UKPA 1FL2A 4J34A 3AEEA 2X50A 4ZN0A 3AE9A 3T2ZA 2AQJA 1PXCA 1N1PA 3H8IA 1BZLA 1DJQA 3UP5A 1PXBA 5KVIA 1E1KA 1YKJA 4GF7A 4U2SA 1H83A 2H89A 5KOWA 2BRYA 3K7TA 4EMIA 1NHSA 4BK2A 3T0KA 2XVHA 3Q9TA 3QSEA 3CGEA 3QFAA 3QVRA 4AT0A 4TM1A 4GAVA 1TRBA 1OJCA 5JCKA 2F5ZA 1LTXR 2OA1A 1JRXA 2C3CA 2WS3A 1F8WA 1E1LA 1VRQB 2VZ2A 3IC9A 2AR8A 1SEZA 1PBBA 1IUTA 3GWDA 2C70A 1GRGA 3AE6A 1GESA 2YG5A 4H4SA 3II4A 1CL0A 3D8XA 3UOXA 1ZY8A 3F8PA 1Y56B 2GAGB 4AOXA 4OPIA 1ZOYA 2GR3A 4ICYA 4JQ9A 2JB3A 3GYIA 2YAUA 2V5ZA 3BHKA 4UP3A 2XVIA 5GRTA 3AYLA 2VRMA 3UTHA 2I0ZA 3AE2A 3VR8A 1N4UA 2CULA 3AD8B 1D7LA 3GD4A 3R9UA 4G6GA 2OAMA 3VRBA 2EQ8A 1GPEA 2E1MA 4J57A 3DJDA 3SGLA 3T2YA 4B68A 4C3XA 1RSGA 3RNMA 2XYOA 2YG4A 1H81A 4P9SA 1DOBA 3NH3X 2IIDA 5JCMA 3SM8A 3DGZA 3UKKA 3VRAA 1N4VA 2Y6QA 3ICRA 4CY8A 1GRTA 2BK5A 3DJGX 4Z25A 1VQWA 1NHQA 5JCLA 1X31B 3ICSA 3JSKA 3UKFA 4OPTA 1NDAA 1F3PA 2FBWA 2R0PA 1JU2A 3NRNA 4II3A 4IA5A 1BGNA 4J2WA 2X8CA 4H4UA 2XFQA 1VDCA 1P2HA 1GXFA 1K0JA 4LIIA 5GSNA 4C77A 2Z5YA 3GDNA 4UDPA 1NAAA 2GR2A 1QJDA 2E5VA 2Q6UA 2V60A 2WOVA 3C96A 2JK6A 3AECA 2O9ZA 3NN0X 3URHA 4B65A 4NZHA 1H82A 4YSHA 1H6VA 2HQMA 4H4WA 2C67A 4H2RA 5DBJA 2WBAA 4USQA 3NGCX 1FOHA 2W0HA 3EAOA 4AP3A 1Y56A 3UP4A 1GRAA 1XHCA 2AAQA 3LZWA 4TLZA 1FECA 5EB4A 1NG4A 1M64A 2YM2A 2APGA 3P4RA 4XWZA 1EL8A 1NG3A 3T14A 2Z5XA 4KPRA 1UKVG 4U8JA 3LJPA 2WETA 1KFYA 2CDUA 2FJAA 3CPIG 5CQFA 4ECHA 1B37A 2WEUA 3REDA 3V76A 2YG6A 4C5OA 1KNRA 1S3EA 2NVKX 1PJ5A 2DKHA 3CIRA 1B4VA 4TM0A 5J7XA 4Z24A 2BS3A 2WP5A 4WCTA 3EANA 3G5RA 4X9NA 2C64A 2IVDA 3L1RA 1EL7A 2PYXA 1FEBA 3UKLA 4CCRA 4Z2UA 3QSMA 1HYUA 2E4GA 3AEGA 3ZDNA 3O0HA 4WX1A 1CC6A 4A6NA 4H4XA 3BI2A 2Q0KA 3AE5A 2EQ9A 2BC0A 1PBFA 3SXIA 1PJ6A 5TR3A 5U25A 3UTFA 4B64A 3UKQA 1PHHA 3GMCA 2R4JA 5BULA 2XFNA 2UZZA 3CNDA 4XWRA 5C2TA 2BA9A 2OLOA 3P4PA 2C75A 4GR1A 2WQYA 2XDOA 4EQSA 3GD3A 2V61A 4FK1A 1GEUA 4REKA 2H88A 1DOCA 2YG3A 3DH9A 3K7MX 4OVIA 1D4EA 4AP1A 5KMRA 1OJDA 2JAEA 1IUUA 4JY2A 4UDQA 1K0LA 3BNMA 4EQWA 3ITJA 1BGJA 1RP0A 3AEDA 3IHGA 4NEWA 1GV4A 3NT6A 3GSIA 3UKHA 5FS8A 1PS9A 3SFDA 1O95A 2JB2A 4H50A 4C3YA 2BCPA 4U2LA 1L9EA 4EM3A 5FS9A 1GT8A 2BS4A 2YG7A 3ABVA 4K5RA 4Z26A 1LPFA 4U8IA 1ELIA 1TYTA 2ZZCA 1BWCA 3SZCA 4IA6A 2Y6RA 5M0ZA 1IUVA 3RP7A 4A79A 1O5WA 2YM1A 3CNPA 2GV8A 4X9MA 3NTAA 2X8GA 3NTDA 3SX6A 4B63A 4CNKA 1O94A 1ZOVA 2GAHB 1XANA 4XXGA 3SY4A 4B1BA 2B7SA 4USRA 4YKFA 3DK9A 3NYCA 5CKUA 2A8XA 4J31A 4O5UA 3SQPA 4MJWA 1L9DA 3KVEA 1DOEA 3V3NA 4TM3A 4YSXA 3SFEA 4BJYA 3ALJA 5KNLA 1NEKA 2GQFA 3OZ2A 2C7GA 2WDVA 2R0GA 3E1TA 1JOAA 4LA1A 4GCMA 3SYIA 3NK2X 3RP8A 2VRLA 3WE0A 1S2YA 3IF9A 3ALMA 1ONFA 2C65A 2B9XA 1E1NA 3UKAA 1YY5A 5KMQA 4J56A 3OC4A 2QA1A 3AYJA 1DXLA 3NN6X 1GOSA 2VQBA 4APNA 2WU5A 2XFOA 3ALLA 1QLBA 1NPXA 4G9KA 4NTEA 4CBQA 4Z44A 3ATRA 2X99A 1JRZA 3F8DA 1CJCA 2EQ7A 3F8RA 3HZLA 2VVLA 3LB8A 4NTDA 4EMWA 4J36A 5KVHA 1P2EA 3CGBA 3G5QA 3GRSA 2RGHA 4G6HA 4A7AA 4EIQA 4U8KA 3Q6JA 1LQUA 3AB1A 2BCGG 2WPFA 3CGDA 3CPJG 4YTNA 2XCGA 2R45A 5LV9A 2B9YA 3BHFA 4X4JA 3S5WA 3H4KA 3BI5A 4H4PA 2XLUA 4A6NB 2GR1A 1EL9A 1IJHA 3L8KA 1KNPA 3NIXA 4AT2A 3NK0X 1OJTA 1PBCA 4IVMB 3KA7A 5JCNA 5KOXA 5IQ4A 3GWFA 3P4QA 4C74A 3QJ4A 1DODA 2WU2A 2YR5A 3COXA 3I3LA 4YTMA 1NENA 1OJAA 2YLRA 2WOWA 4TM4A 4Y4MA 4K8DA 4B69A 4D04A 4EQRA 2YLTA 1S3BA 2TPRA 4H2QA 1JRYA 1LJ1A 2GEWA 1CF3A 4ZCDA 1JEHA 2A87A 4U8OA 5KMSA 1Q1WA 2XLSA 3CPHG 3FPZA 3K30A 2XLPA 4G73A 3RP6A 1OJ9A 3UCLA 3AWIA 4JN9A 4YTPA 4Z2TA 2DKIA 1MOKA 3EF6A 2C72A 3AEBA 2YLZA 4H4TA 4FDCB 3CTYA 4KX6A 3SZFA 4YSZA 3GRTA 2BRAA 3H8LA 1ZK7A 2BC1A 4H4RA 4N9XA 1CC2A 2PHHA 3UOYA 1AOGA 2R0CA 4M52A 4Y4NA 5FMHA 5KMPA 2GMJA 2VOUA 2RGJA 2FJBA 4Y4LA 1JNRA 2ZBWA 4BK3A 3DK4A 2WDQA 4D03A 2GRTA 1E39A 4GRTA 5HHFA 3KU9A 3T37A 3V3OA 3AE1A 4I59A 5BVAA 1TDEA 3BNUA 4CY6A 3DJEA 2YVFA 3GYJA 4Z43A 1FCDA 1GRBA 1F8RA 3ISHA 4RSLA 3I6DA 1M6IA 3NG7X 3PS9A 4TLXA 2GMHA 3HYXA 2XFPA 1EL5A 4NWZA 4BV6A 4H4ZA 5J60A 2CFYA 1LQTA 2R46A 1L0VA 1NHPA 2GF3A 3GYXA 2BK4A 3D1CA 1GSNA 2GQWA 3AD9B 2JKCA 2TMDA 2ZZBA 2CVJA 3NNEA 4JNQA 4U8PA 4CCQA 2VQ7A 3G5SA 2ZZ0A 2WDRA 4U8NA 3NLCA 3KD9A 1H7XA 2XLRA 3HYVA 2WHDA 2IVEA 3CN8A 4B67A 2GB0A 2QAEA 4PAAA 1ZP0A 3C4AA 1S2QA 2XLTA 2YWLA 3KKJA 1LVLA 4CNJA 3NYFA 1H86A 1EBDA 1D5TA 2FJEA 2X8HA 5FS7A 2C66A 2YLWA 2WESA 3SZ0A 3AE7A 3BI4A 4EM4A 5FS6A 4U2TA 3QVPA 5L46A 1TDFA 3AE3A 2BXSA 4BK1A 3PVCA 5EBKA 5HYMA 3RHAA 2R4EA 1GNDA 4I58A 1K4QA 1PBDA
chains in the Genus database with same CATH topology
4HA6A 3QFBA 3CGCA 4YSYA 3T31A 1F6MA 2B76A 2YLXA 3DMEA 1PDHA 5BUKA 3K7QX 1DNCA 1GTHA 1XPQA 4PABA 4OCGA 2XFUA 4OPUA 4EIPA 5IQ1A 1D4CA 2OLNA 3FIMB 4CRTA 4Z2RA 3LADA 2Q7VA 4AOSA 3B3RA 1CC4A 3S61A 1GRHA 4YXDA 3ADAB 2V3AA 3KLJA 1F8SA 1IUXA 1YQ4A 2C76A 3LOVA 3CNTA 3IHMA 1IUSA 3FMWA 1GETA 2C73A 3DA1A 2J3NA 1PBEA 4E0VA 2YLSA 1REOA 2R9ZA 1COYA 2EQ6A 2JB1A 1MXTA 2FJDA 3ZYXA 2OALA 5KXJA 3P1WA 1KF6A 4A99A 1Q9IA 4K5SA 4OPDA 4U8MA 3CNSA 4H4VA 4DSGA 1KDGA 4RG4A 4EMJA 4LU6A 1CJ4A 1L9CA 4A5LA 1GALA 1GERA 5BRTA 4JY3A 5ER0A 2BS2A 1CJ3A 2WPEA 1RYIA 5C3JA 1XDIA 1ZDLA 4DSHA 4G74A 3FBSA 2WPCA 4B66A 2VVMA 1FEAA 4NNJA 2BK3A 1ZX9A 3DK8A 2ACZA 1YQ3A 3AEAA 4FK1C 3T2KA 1YQZA 2X3NA 4O5QA 3ICTA 4GUVA 1TDKA 3HYWA 4A9WA 1TDNA 5KRQA 3SZWA 2C3DA 2WP6A 2A89A 1VG0A 4GDEA 2Q0LA 2BXRA 1IUWA 3AEFA 3DJJA 1PXAA 1E1MA 3FG2P 1K0IA 3VR9A 1GTEA 1V59A 1VG9A 3C4NA 1NHRA 4J33A 3CMMA 5KWFA 2GH5A 2GVCA 2V3BA 4OPCA 1KSUA 1GRFA 1W4XA 2BACA 2YR4A 2QA2A 3KPKA 3NYEA 2BABA 3UOZA 3AE4A 3AD7B 1MO9A 1D7YA 1E6EA 4OPLA 4BJZA 5JCIA 3KPFA 2YVJA 4GDPA 2XVFA 2WOIA 1TDOA 3NKSA 4RG3A 4HB9A 2C4CA 4II2A 3M12A 2BYBA 3AXBA 1Z6LA 5IPYA 4H4YA 4K7ZA 2JBVA 2YVGA 4DGKA 3VQRA 4U8LA 3EPTA 1B8SA 1LV0A 4UDRA 1ZMDA 1BKWA 2RGOA 2WP9A 4ZCCA 2V6OA 2B7RA 3B6DA 2B9WA 4DNAA 4FX9A 1BF3A 4GAPA 5U63A 1B5QA 1QO8A 1ZKQA 4NTCA 2RABA 2YQUA 3M0OA 4BURA 4EQXA 3QSSA 5EB5A 3LZXA 5M10A 1KSSA 1ZMCA 2YR6A 1PN0A 2ARDA 3ATQA 1D4DA 3M13A 3AE8A 2XVJA 4IV9A 4NEVA 3AYIA 4H2NA 3UTGA 1CJ2A 4H2PA 1H7WA 4H7UA 2QCUA 3P9UA 1PJ7A 5HXIA 1JNZA 2XVEA 1N4WA 5U1OA 1H84A 1CHUA 4JDRA 1E7PA 4K2XA 3PO7A 4OPGA 4YT0A 4A65A 3UTEA 1TYPA 3UOVA 1CBOA 4YWOA 3CNJA 3VRDB 3DGHA 4ADWA 4IVOB 2VVLG 5EOWA 2NPXA 4H4QA 1Y0PA 5HY5A 3NHOX 1DJNA 1GREA 3IWAA 1Q1RA 3LXDA 4JNAA 4YKGA 3NK1X 3GDPA 3GMBA 4K22A 3P4SA 2GR0A 3UKPA 1FL2A 4J34A 3AEEA 2X50A 4ZN0A 3AE9A 3T2ZA 2AQJA 1PXCA 1N1PA 3H8IA 1BZLA 1DJQA 3UP5A 1PXBA 5KVIA 1E1KA 1YKJA 4GF7A 4U2SA 1H83A 2H89A 5KOWA 2BRYA 3K7TA 4EMIA 1NHSA 4BK2A 3T0KA 2XVHA 3Q9TA 3QSEA 3CGEA 3QFAA 3QVRA 4AT0A 4TM1A 4GAVA 1TRBA 1OJCA 5JCKA 2F5ZA 1LTXR 2OA1A 1JRXA 2C3CA 2WS3A 1F8WA 1E1LA 1VRQB 2VZ2A 3IC9A 2AR8A 1SEZA 1PBBA 1IUTA 3GWDA 2C70A 1GRGA 3AE6A 1GESA 2YG5A 4H4SA 3II4A 1CL0A 3D8XA 3UOXA 1ZY8A 3F8PA 1Y56B 2GAGB 4AOXA 4OPIA 1ZOYA 2GR3A 4ICYA 4JQ9A 2JB3A 3GYIA 2YAUA 2V5ZA 3BHKA 4UP3A 2XVIA 5GRTA 3AYLA 2VRMA 3UTHA 2I0ZA 3AE2A 3VR8A 1N4UA 2CULA 3AD8B 1D7LA 3GD4A 3R9UA 4G6GA 2OAMA 3VRBA 2EQ8A 1GPEA 2E1MA 4J57A 3DJDA 3SGLA 3T2YA 4B68A 4C3XA 1RSGA 3RNMA 2XYOA 2YG4A 1H81A 4P9SA 1DOBA 3NH3X 2IIDA 5JCMA 3SM8A 3DGZA 3UKKA 3VRAA 1N4VA 2Y6QA 3ICRA 4CY8A 1GRTA 2BK5A 3DJGX 4Z25A 1VQWA 1NHQA 5JCLA 1X31B 3ICSA 3JSKA 3UKFA 4OPTA 1NDAA 1F3PA 2FBWA 2R0PA 1JU2A 3NRNA 4II3A 4IA5A 1BGNA 4J2WA 2X8CA 4H4UA 2XFQA 1VDCA 1P2HA 1GXFA 1K0JA 4LIIA 5GSNA 4C77A 2Z5YA 3GDNA 4UDPA 1NAAA 2GR2A 1QJDA 2E5VA 2Q6UA 2V60A 2WOVA 3C96A 2JK6A 3AECA 2O9ZA 3NN0X 3URHA 4B65A 4NZHA 1H82A 4YSHA 1H6VA 2HQMA 4H4WA 2C67A 4H2RA 5DBJA 2WBAA 4USQA 3NGCX 1FOHA 2W0HA 3EAOA 4AP3A 1Y56A 3UP4A 1GRAA 1XHCA 2AAQA 3LZWA 4TLZA 1FECA 5EB4A 1NG4A 1M64A 2YM2A 2APGA 3P4RA 4XWZA 1EL8A 1NG3A 3T14A 2Z5XA 4KPRA 1UKVG 4U8JA 3LJPA 2WETA 1KFYA 2CDUA 2FJAA 3CPIG 5CQFA 4ECHA 1B37A 2WEUA 3REDA 3V76A 2YG6A 4C5OA 1KNRA 1S3EA 2NVKX 1PJ5A 2DKHA 3CIRA 1B4VA 4TM0A 5J7XA 4Z24A 2BS3A 2WP5A 4WCTA 3EANA 3G5RA 4X9NA 2C64A 2IVDA 3L1RA 1EL7A 2PYXA 1FEBA 3UKLA 4CCRA 4Z2UA 3QSMA 1HYUA 2E4GA 3AEGA 3ZDNA 3O0HA 4WX1A 1CC6A 4A6NA 4H4XA 3BI2A 2Q0KA 3AE5A 2EQ9A 2BC0A 1PBFA 3SXIA 1PJ6A 5TR3A 5U25A 3UTFA 4B64A 3UKQA 1PHHA 3GMCA 2R4JA 5BULA 2XFNA 2UZZA 3CNDA 4XWRA 5C2TA 2BA9A 2OLOA 3P4PA 2C75A 4GR1A 2WQYA 2XDOA 4EQSA 3GD3A 2V61A 4FK1A 1GEUA 4REKA 2H88A 1DOCA 2YG3A 3DH9A 3K7MX 4OVIA 1D4EA 4AP1A 5KMRA 1OJDA 2JAEA 1IUUA 4JY2A 4UDQA 1K0LA 3BNMA 4EQWA 3ITJA 1BGJA 1RP0A 3AEDA 3IHGA 4NEWA 1GV4A 3NT6A 3GSIA 3UKHA 5FS8A 1PS9A 3SFDA 1O95A 2JB2A 4H50A 4C3YA 2BCPA 4U2LA 1L9EA 4EM3A 5FS9A 1GT8A 2BS4A 2YG7A 3ABVA 4K5RA 4Z26A 1LPFA 4U8IA 1ELIA 1TYTA 2ZZCA 1BWCA 3SZCA 4IA6A 2Y6RA 5M0ZA 1IUVA 3RP7A 4A79A 1O5WA 2YM1A 3CNPA 2GV8A 4X9MA 3NTAA 2X8GA 3NTDA 3SX6A 4B63A 4CNKA 1O94A 1ZOVA 2GAHB 1XANA 4XXGA 3SY4A 4B1BA 2B7SA 4USRA 4YKFA 3DK9A 3NYCA 5CKUA 2A8XA 4J31A 4O5UA 3SQPA 4MJWA 1L9DA 3KVEA 1DOEA 3V3NA 4TM3A 4YSXA 3SFEA 4BJYA 3ALJA 5KNLA 1NEKA 2GQFA 3OZ2A 2C7GA 2WDVA 2R0GA 3E1TA 1JOAA 4LA1A 4GCMA 3SYIA 3NK2X 3RP8A 2VRLA 3WE0A 1S2YA 3IF9A 3ALMA 1ONFA 2C65A 2B9XA 1E1NA 3UKAA 1YY5A 5KMQA 4J56A 3OC4A 2QA1A 3AYJA 1DXLA 3NN6X 1GOSA 2VQBA 4APNA 2WU5A 2XFOA 3ALLA 1QLBA 1NPXA 4G9KA 4NTEA 4CBQA 4Z44A 3ATRA 2X99A 1JRZA 3F8DA 1CJCA 2EQ7A 3F8RA 3HZLA 2VVLA 3LB8A 4NTDA 4EMWA 4J36A 5KVHA 1P2EA 3CGBA 3G5QA 3GRSA 2RGHA 4G6HA 4A7AA 4EIQA 4U8KA 3Q6JA 1LQUA 3AB1A 2BCGG 2WPFA 3CGDA 3CPJG 4YTNA 2XCGA 2R45A 5LV9A 2B9YA 3BHFA 4X4JA 3S5WA 3H4KA 3BI5A 4H4PA 2XLUA 4A6NB 2GR1A 1EL9A 1IJHA 3L8KA 1KNPA 3NIXA 4AT2A 3NK0X 1OJTA 1PBCA 4IVMB 3KA7A 5JCNA 5KOXA 5IQ4A 3GWFA 3P4QA 4C74A 3QJ4A 1DODA 2WU2A 2YR5A 3COXA 3I3LA 4YTMA 1NENA 1OJAA 2YLRA 2WOWA 4TM4A 4Y4MA 4K8DA 4B69A 4D04A 4EQRA 2YLTA 1S3BA 2TPRA 4H2QA 1JRYA 1LJ1A 2GEWA 1CF3A 4ZCDA 1JEHA 2A87A 4U8OA 5KMSA 1Q1WA 2XLSA 3CPHG 3FPZA 3K30A 2XLPA 4G73A 3RP6A 1OJ9A 3UCLA 3AWIA 4JN9A 4YTPA 4Z2TA 2DKIA 1MOKA 3EF6A 2C72A 3AEBA 2YLZA 4H4TA 4FDCB 3CTYA 4KX6A 3SZFA 4YSZA 3GRTA 2BRAA 3H8LA 1ZK7A 2BC1A 4H4RA 4N9XA 1CC2A 2PHHA 3UOYA 1AOGA 2R0CA 4M52A 4Y4NA 5FMHA 5KMPA 2GMJA 2VOUA 2RGJA 2FJBA 4Y4LA 1JNRA 2ZBWA 4BK3A 3DK4A 2WDQA 4D03A 2GRTA 1E39A 4GRTA 5HHFA 3KU9A 3T37A 3V3OA 3AE1A 4I59A 5BVAA 1TDEA 3BNUA 4CY6A 3DJEA 2YVFA 3GYJA 4Z43A 1FCDA 1GRBA 1F8RA 3ISHA 4RSLA 3I6DA 1M6IA 3NG7X 3PS9A 4TLXA 2GMHA 3HYXA 2XFPA 1EL5A 4NWZA 4BV6A 4H4ZA 5J60A 2CFYA 1LQTA 2R46A 1L0VA 1NHPA 2GF3A 3GYXA 2BK4A 3D1CA 1GSNA 2GQWA 3AD9B 2JKCA 2TMDA 2ZZBA 2CVJA 3NNEA 4JNQA 4U8PA 4CCQA 2VQ7A 3G5SA 2ZZ0A 2WDRA 4U8NA 3NLCA 3KD9A 1H7XA 2XLRA 3HYVA 2WHDA 2IVEA 3CN8A 4B67A 2GB0A 2QAEA 4PAAA 1ZP0A 3C4AA 1S2QA 2XLTA 2YWLA 3KKJA 1LVLA 4CNJA 3NYFA 1H86A 1EBDA 1D5TA 2FJEA 2X8HA 5FS7A 2C66A 2YLWA 2WESA 3SZ0A 3AE7A 3BI4A 4EM4A 5FS6A 4U2TA 3QVPA 5L46A 1TDFA 3AE3A 2BXSA 4BK1A 3PVCA 5EBKA 5HYMA 3RHAA 2R4EA 1GNDA 4I58A 1K4QA 1PBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HA6 A;  3QFB A;  3CGC A;  4YSY A;  1F6M A;  2B76 A;  2YLX A;  3DME A;  1PDH A;  5BUK A;  3K7Q X;  1DNC A;  1GTH A;  1XPQ A;  4PAB A;  4OCG A;  2XFU A;  4OPU A;  4EIP A;  5IQ1 A;  1D4C A;  2OLN A;  3FIM B;  4CRT A;  4Z2R A;  3LAD A;  2Q7V A;  4AOS A;  3B3R A;  1CC4 A;  3S61 A;  1GRH A;  4YXD A;  3ADA B;  2V3A A;  3KLJ A;  1F8S A;  1IUX A;  1YQ4 A;  2C76 A;  3LOV A;  3CNT A;  3IHM A;  1IUS A;  3FMW A;  1GET A;  2C73 A;  3DA1 A;  2J3N A;  1PBE A;  4E0V A;  2YLS A;  1REO A;  2R9Z A;  1COY A;  2EQ6 A;  2JB1 A;  1MXT A;  2FJD A;  3ZYX A;  2OAL A;  5KXJ A;  3P1W A;  1KF6 A;  4A99 A;  1Q9I A;  4K5S A;  4OPD A;  4U8M A;  3CNS A;  4H4V A;  4DSG A;  1KDG A;  4RG4 A;  4EMJ A;  4LU6 A;  1CJ4 A;  1L9C A;  4A5L A;  1GAL A;  1GER A;  5BRT A;  4JY3 A;  5ER0 A;  2BS2 A;  1CJ3 A;  2WPE A;  1RYI A;  5C3J A;  1XDI A;  1ZDL A;  4DSH A;  3FBS A;  2WPC A;  4B66 A;  2VVM A;  1FEA A;  2BK3 A;  1ZX9 A;  3DK8 A;  2ACZ A;  1YQ3 A;  3AEA A;  4FK1 C;  1YQZ A;  2X3N A;  4O5Q A;  3ICT A;  4GUV A;  1TDK A;  4A9W A;  1TDN A;  5KRQ A;  2C3D A;  2WP6 A;  2A89 A;  1VG0 A;  4GDE A;  2Q0L A;  2BXR A;  1IUW A;  3AEF A;  3DJJ A;  1PXA A;  1E1M A;  3FG2 P;  1K0I A;  3VR9 A;  1GTE A;  1V59 A;  1VG9 A;  3C4N A;  1NHR A;  4J33 A;  5KWF A;  2GH5 A;  2GVC A;  2V3B A;  4OPC A;  1KSU A;  1GRF A;  1W4X A;  2BAC A;  2YR4 A;  2QA2 A;  3NYE A;  2BAB A;  3UOZ A;  3AE4 A;  3AD7 B;  1MO9 A;  1D7Y A;  1E6E A;  4OPL A;  4BJZ A;  5JCI A;  3KPF A;  2YVJ A;  4GDP A;  2XVF A;  2WOI A;  1TDO A;  3NKS A;  4RG3 A;  4HB9 A;  3M12 A;  2BYB A;  3AXB A;  1Z6L A;  5IPY A;  4H4Y A;  4K7Z A;  2JBV A;  2YVG A;  4DGK A;  3VQR A;  4U8L A;  3EPT A;  1B8S A;  1LV0 A;  4UDR A;  1ZMD A;  1BKW A;  2RGO A;  2WP9 A;  4ZCC A;  2V6O A;  2B7R A;  3B6D A;  2B9W A;  4DNA A;  4FX9 A;  1BF3 A;  5U63 A;  1B5Q A;  1QO8 A;  1ZKQ A;  4NTC A;  2RAB A;  2YQU A;  3M0O A;  4BUR A;  4EQX A;  3QSS A;  5EB5 A;  3LZX A;  5M10 A;  1KSS A;  1ZMC A;  2YR6 A;  1PN0 A;  2ARD A;  3ATQ A;  1D4D A;  3M13 A;  3AE8 A;  2XVJ A;  4IV9 A;  4NEV A;  3AYI A;  4H2N A;  3UTG A;  1CJ2 A;  4H2P A;  1H7W A;  4H7U A;  2QCU A;  3P9U A;  1PJ7 A;  5HXI A;  1JNZ A;  2XVE A;  1N4W A;  5U1O A;  1H84 A;  1CHU A;  4JDR A;  1E7P A;  4K2X A;  3PO7 A;  4OPG A;  4YT0 A;  4A65 A;  3UTE A;  1TYP A;  3UOV A;  1CBO A;  4YWO A;  3CNJ A;  3VRD B;  3DGH A;  4ADW A;  4IVO B;  2VVL G;  5EOW A;  2NPX A;  4H4Q A;  1Y0P A;  5HY5 A;  3NHO X;  1DJN A;  1GRE A;  3IWA A;  1Q1R A;  3LXD A;  4JNA A;  4YKG A;  3NK1 X;  3GDP A;  3GMB A;  4K22 A;  3P4S A;  2GR0 A;  3UKP A;  1FL2 A;  4J34 A;  3AEE A;  2X50 A;  4ZN0 A;  3AE9 A;  2AQJ A;  1PXC A;  1N1P A;  3H8I A;  1BZL A;  1DJQ A;  3UP5 A;  1PXB A;  5KVI A;  1E1K A;  1YKJ A;  4GF7 A;  4U2S A;  1H83 A;  2H89 A;  5KOW A;  3K7T A;  4EMI A;  1NHS A;  4BK2 A;  2XVH A;  3Q9T A;  3QSE A;  3CGE A;  3QFA A;  3QVR A;  4AT0 A;  4TM1 A;  1TRB A;  1OJC A;  5JCK A;  2F5Z A;  1LTX R;  2OA1 A;  1JRX A;  2C3C A;  2WS3 A;  1F8W A;  1E1L A;  1VRQ B;  2VZ2 A;  3IC9 A;  2AR8 A;  1SEZ A;  1PBB A;  1IUT A;  3GWD A;  2C70 A;  1GRG A;  3AE6 A;  1GES A;  2YG5 A;  4H4S A;  3II4 A;  1CL0 A;  3D8X A;  3UOX A;  1ZY8 A;  3F8P A;  1Y56 B;  2GAG B;  4AOX A;  4OPI A;  1ZOY A;  2GR3 A;  4ICY A;  4JQ9 A;  2JB3 A;  3GYI A;  2YAU A;  2V5Z A;  3BHK A;  4UP3 A;  2XVI A;  5GRT A;  3AYL A;  2VRM A;  3UTH A;  2I0Z A;  3AE2 A;  3VR8 A;  1N4U A;  2CUL A;  3AD8 B;  1D7L A;  3GD4 A;  3R9U A;  2OAM A;  3VRB A;  2EQ8 A;  1GPE A;  2E1M A;  4J57 A;  3DJD A;  3SGL A;  4B68 A;  4C3X A;  1RSG A;  3RNM A;  2XYO A;  2YG4 A;  1H81 A;  4P9S A;  1DOB A;  3NH3 X;  2IID A;  5JCM A;  3SM8 A;  3DGZ A;  3UKK A;  3VRA A;  1N4V A;  2Y6Q A;  3ICR A;  4CY8 A;  1GRT A;  2BK5 A;  3DJG X;  4Z25 A;  1VQW A;  1NHQ A;  5JCL A;  1X31 B;  3ICS A;  3JSK A;  3UKF A;  4OPT A;  1NDA A;  1F3P A;  2FBW A;  2R0P A;  1JU2 A;  3NRN A;  4IA5 A;  1BGN A;  4J2W A;  2X8C A;  4H4U A;  2XFQ A;  1VDC A;  1P2H A;  1GXF A;  1K0J A;  4LII A;  5GSN A;  4C77 A;  2Z5Y A;  3GDN A;  4UDP A;  1NAA A;  2GR2 A;  1QJD A;  2E5V A;  2Q6U A;  2V60 A;  2WOV A;  3C96 A;  2JK6 A;  3AEC A;  2O9Z A;  3NN0 X;  3URH A;  4B65 A;  4NZH A;  1H82 A;  4YSH A;  1H6V A;  2HQM A;  4H4W A;  2C67 A;  4H2R A;  5DBJ A;  2WBA A;  4USQ A;  3NGC X;  1FOH A;  2W0H A;  3EAO A;  4AP3 A;  1Y56 A;  3UP4 A;  1GRA A;  1XHC A;  2AAQ A;  3LZW A;  4TLZ A;  1FEC A;  5EB4 A;  1NG4 A;  1M64 A;  2YM2 A;  2APG A;  3P4R A;  4XWZ A;  1EL8 A;  1NG3 A;  2Z5X A;  4KPR A;  1UKV G;  4U8J A;  3LJP A;  2WET A;  1KFY A;  2CDU A;  2FJA A;  3CPI G;  5CQF A;  4ECH A;  1B37 A;  2WEU A;  3RED A;  3V76 A;  2YG6 A;  4C5O A;  1KNR A;  1S3E A;  2NVK X;  1PJ5 A;  2DKH A;  3CIR A;  1B4V A;  4TM0 A;  5J7X A;  4Z24 A;  2BS3 A;  2WP5 A;  4WCT A;  3EAN A;  3G5R A;  4X9N A;  2C64 A;  2IVD A;  3L1R A;  1EL7 A;  2PYX A;  1FEB A;  3UKL A;  4CCR A;  4Z2U A;  3QSM A;  1HYU A;  2E4G A;  3AEG A;  3ZDN A;  3O0H A;  4WX1 A;  1CC6 A;  4A6N A;  4H4X A;  3BI2 A;  2Q0K A;  3AE5 A;  2EQ9 A;  2BC0 A;  1PBF A;  1PJ6 A;  5TR3 A;  5U25 A;  3UTF A;  4B64 A;  3UKQ A;  1PHH A;  3GMC A;  2R4J A;  5BUL A;  2XFN A;  2UZZ A;  3CND A;  4XWR A;  5C2T A;  2BA9 A;  2OLO A;  3P4P A;  2C75 A;  4GR1 A;  2WQY A;  2XDO A;  4EQS A;  3GD3 A;  2V61 A;  4FK1 A;  1GEU A;  4REK A;  2H88 A;  1DOC A;  2YG3 A;  3DH9 A;  3K7M X;  4OVI A;  1D4E A;  4AP1 A;  1OJD A;  2JAE A;  1IUU A;  4JY2 A;  4UDQ A;  1K0L A;  3BNM A;  4EQW A;  3ITJ A;  1BGJ A;  1RP0 A;  3AED A;  3IHG A;  4NEW A;  1GV4 A;  3NT6 A;  3GSI A;  3UKH A;  5FS8 A;  1PS9 A;  3SFD A;  1O95 A;  2JB2 A;  4H50 A;  4C3Y A;  2BCP A;  4U2L A;  1L9E A;  4EM3 A;  5FS9 A;  1GT8 A;  2BS4 A;  2YG7 A;  3ABV A;  4K5R A;  4Z26 A;  1LPF A;  4U8I A;  1ELI A;  1TYT A;  2ZZC A;  1BWC A;  4IA6 A;  2Y6R A;  5M0Z A;  1IUV A;  3RP7 A;  4A79 A;  1O5W A;  2YM1 A;  3CNP A;  2GV8 A;  4X9M A;  3NTA A;  2X8G A;  3NTD A;  4B63 A;  4CNK A;  1O94 A;  1ZOV A;  2GAH B;  1XAN A;  4XXG A;  4B1B A;  2B7S A;  4USR A;  4YKF A;  3DK9 A;  3NYC A;  5CKU A;  2A8X A;  4J31 A;  4O5U A;  3SQP A;  4MJW A;  1L9D A;  3KVE A;  1DOE A;  3V3N A;  4TM3 A;  4YSX A;  3SFE A;  4BJY A;  3ALJ A;  1NEK A;  2GQF A;  3OZ2 A;  2C7G A;  2WDV A;  2R0G A;  3E1T A;  1JOA A;  4LA1 A;  4GCM A;  3NK2 X;  3RP8 A;  2VRL A;  3WE0 A;  1S2Y A;  3IF9 A;  3ALM A;  1ONF A;  2C65 A;  2B9X A;  1E1N A;  3UKA A;  1YY5 A;  4J56 A;  3OC4 A;  2QA1 A;  3AYJ A;  1DXL A;  3NN6 X;  1GOS A;  2VQB A;  4APN A;  2WU5 A;  2XFO A;  3ALL A;  1QLB A;  1NPX A;  4NTE A;  4CBQ A;  4Z44 A;  3ATR A;  2X99 A;  1JRZ A;  3F8D A;  1CJC A;  2EQ7 A;  3F8R A;  3HZL A;  2VVL A;  3LB8 A;  4NTD A;  4EMW A;  4J36 A;  5KVH A;  1P2E A;  3CGB A;  3G5Q A;  3GRS A;  2RGH A;  4A7A A;  4EIQ A;  4U8K A;  3Q6J A;  1LQU A;  3AB1 A;  2BCG G;  2WPF A;  3CGD A;  3CPJ G;  4YTN A;  2XCG A;  2R45 A;  5LV9 A;  2B9Y A;  3BHF A;  4X4J A;  3S5W A;  3H4K A;  3BI5 A;  4H4P A;  2XLU A;  4A6N B;  2GR1 A;  1EL9 A;  1IJH A;  3L8K A;  1KNP A;  3NIX A;  4AT2 A;  3NK0 X;  1OJT A;  1PBC A;  4IVM B;  3KA7 A;  5JCN A;  5KOX A;  5IQ4 A;  3GWF A;  3P4Q A;  4C74 A;  3QJ4 A;  1DOD A;  2WU2 A;  2YR5 A;  3COX A;  3I3L A;  4YTM A;  1NEN A;  1OJA A;  2YLR A;  2WOW A;  4TM4 A;  4Y4M A;  4K8D A;  4B69 A;  4D04 A;  4EQR A;  2YLT A;  1S3B A;  2TPR A;  4H2Q A;  1JRY A;  1LJ1 A;  2GEW A;  1CF3 A;  4ZCD A;  1JEH A;  2A87 A;  4U8O A;  1Q1W A;  2XLS A;  3CPH G;  3FPZ A;  3K30 A;  2XLP A;  3RP6 A;  1OJ9 A;  3UCL A;  3AWI A;  4JN9 A;  4YTP A;  4Z2T A;  2DKI A;  1MOK A;  3EF6 A;  2C72 A;  3AEB A;  2YLZ A;  4H4T A;  4FDC B;  3CTY A;  4KX6 A;  4YSZ A;  3GRT A;  3H8L A;  1ZK7 A;  2BC1 A;  4H4R A;  4N9X A;  1CC2 A;  2PHH A;  3UOY A;  1AOG A;  2R0C A;  4M52 A;  4Y4N A;  5FMH A;  2GMJ A;  2VOU A;  2RGJ A;  2FJB A;  4Y4L A;  1JNR A;  2ZBW A;  4BK3 A;  3DK4 A;  2WDQ A;  4D03 A;  2GRT A;  1E39 A;  4GRT A;  5HHF A;  3KU9 A;  3T37 A;  3V3O A;  3AE1 A;  4I59 A;  5BVA A;  1TDE A;  3BNU A;  4CY6 A;  3DJE A;  2YVF A;  3GYJ A;  4Z43 A;  1FCD A;  1GRB A;  1F8R A;  3ISH A;  4RSL A;  3I6D A;  1M6I A;  3NG7 X;  3PS9 A;  4TLX A;  2GMH A;  2XFP A;  1EL5 A;  4BV6 A;  5J60 A;  4H4Z A;  2CFY A;  1LQT A;  2R46 A;  1L0V A;  1NHP A;  2GF3 A;  2BK4 A;  3D1C A;  1GSN A;  2GQW A;  3AD9 B;  2JKC A;  2TMD A;  2ZZB A;  2CVJ A;  3NNE A;  4JNQ A;  4U8P A;  4CCQ A;  2VQ7 A;  3G5S A;  2ZZ0 A;  2WDR A;  4U8N A;  3NLC A;  3KD9 A;  1H7X A;  2XLR A;  2WHD A;  2IVE A;  3CN8 A;  4B67 A;  2GB0 A;  2QAE A;  4PAA A;  1ZP0 A;  3C4A A;  1S2Q A;  2XLT A;  2YWL A;  3KKJ A;  1LVL A;  4CNJ A;  3NYF A;  1H86 A;  1EBD A;  1D5T A;  2FJE A;  2X8H A;  5FS7 A;  2C66 A;  2YLW A;  2WES A;  3AE7 A;  3BI4 A;  4EM4 A;  5FS6 A;  4U2T A;  3QVP A;  5L46 A;  1TDF A;  3AE3 A;  2BXS A;  4BK1 A;  3PVC A;  5EBK A;  5HYM A;  3RHA A;  2R4E A;  1GND A;  4I58 A;  1K4Q A;  1PBD A; 
#chains in the Genus database with same CATH topology
 4HA6 A;  3QFB A;  3CGC A;  4YSY A;  3T31 A;  1F6M A;  2B76 A;  2YLX A;  3DME A;  1PDH A;  5BUK A;  3K7Q X;  1DNC A;  1GTH A;  1XPQ A;  4PAB A;  4OCG A;  2XFU A;  4OPU A;  4EIP A;  5IQ1 A;  1D4C A;  2OLN A;  3FIM B;  4CRT A;  4Z2R A;  3LAD A;  2Q7V A;  4AOS A;  3B3R A;  1CC4 A;  3S61 A;  1GRH A;  4YXD A;  3ADA B;  2V3A A;  3KLJ A;  1F8S A;  1IUX A;  1YQ4 A;  2C76 A;  3LOV A;  3CNT A;  3IHM A;  1IUS A;  3FMW A;  1GET A;  2C73 A;  3DA1 A;  2J3N A;  1PBE A;  4E0V A;  2YLS A;  1REO A;  2R9Z A;  1COY A;  2EQ6 A;  2JB1 A;  1MXT A;  2FJD A;  3ZYX A;  2OAL A;  5KXJ A;  3P1W A;  1KF6 A;  4A99 A;  1Q9I A;  4K5S A;  4OPD A;  4U8M A;  3CNS A;  4H4V A;  4DSG A;  1KDG A;  4RG4 A;  4EMJ A;  4LU6 A;  1CJ4 A;  1L9C A;  4A5L A;  1GAL A;  1GER A;  5BRT A;  4JY3 A;  5ER0 A;  2BS2 A;  1CJ3 A;  2WPE A;  1RYI A;  5C3J A;  1XDI A;  1ZDL A;  4DSH A;  4G74 A;  3FBS A;  2WPC A;  4B66 A;  2VVM A;  1FEA A;  4NNJ A;  2BK3 A;  1ZX9 A;  3DK8 A;  2ACZ A;  1YQ3 A;  3AEA A;  4FK1 C;  3T2K A;  1YQZ A;  2X3N A;  4O5Q A;  3ICT A;  4GUV A;  1TDK A;  3HYW A;  4A9W A;  1TDN A;  5KRQ A;  3SZW A;  2C3D A;  2WP6 A;  2A89 A;  1VG0 A;  4GDE A;  2Q0L A;  2BXR A;  1IUW A;  3AEF A;  3DJJ A;  1PXA A;  1E1M A;  3FG2 P;  1K0I A;  3VR9 A;  1GTE A;  1V59 A;  1VG9 A;  3C4N A;  1NHR A;  4J33 A;  3CMM A;  5KWF A;  2GH5 A;  2GVC A;  2V3B A;  4OPC A;  1KSU A;  1GRF A;  1W4X A;  2BAC A;  2YR4 A;  2QA2 A;  3KPK A;  3NYE A;  2BAB A;  3UOZ A;  3AE4 A;  3AD7 B;  1MO9 A;  1D7Y A;  1E6E A;  4OPL A;  4BJZ A;  5JCI A;  3KPF A;  2YVJ A;  4GDP A;  2XVF A;  2WOI A;  1TDO A;  3NKS A;  4RG3 A;  4HB9 A;  2C4C A;  4II2 A;  3M12 A;  2BYB A;  3AXB A;  1Z6L A;  5IPY A;  4H4Y A;  4K7Z A;  2JBV A;  2YVG A;  4DGK A;  3VQR A;  4U8L A;  3EPT A;  1B8S A;  1LV0 A;  4UDR A;  1ZMD A;  1BKW A;  2RGO A;  2WP9 A;  4ZCC A;  2V6O A;  2B7R A;  3B6D A;  2B9W A;  4DNA A;  4FX9 A;  1BF3 A;  4GAP A;  5U63 A;  1B5Q A;  1QO8 A;  1ZKQ A;  4NTC A;  2RAB A;  2YQU A;  3M0O A;  4BUR A;  4EQX A;  3QSS A;  5EB5 A;  3LZX A;  5M10 A;  1KSS A;  1ZMC A;  2YR6 A;  1PN0 A;  2ARD A;  3ATQ A;  1D4D A;  3M13 A;  3AE8 A;  2XVJ A;  4IV9 A;  4NEV A;  3AYI A;  4H2N A;  3UTG A;  1CJ2 A;  4H2P A;  1H7W A;  4H7U A;  2QCU A;  3P9U A;  1PJ7 A;  5HXI A;  1JNZ A;  2XVE A;  1N4W A;  5U1O A;  1H84 A;  1CHU A;  4JDR A;  1E7P A;  4K2X A;  3PO7 A;  4OPG A;  4YT0 A;  4A65 A;  3UTE A;  1TYP A;  3UOV A;  1CBO A;  4YWO A;  3CNJ A;  3VRD B;  3DGH A;  4ADW A;  4IVO B;  2VVL G;  5EOW A;  2NPX A;  4H4Q A;  1Y0P A;  5HY5 A;  3NHO X;  1DJN A;  1GRE A;  3IWA A;  1Q1R A;  3LXD A;  4JNA A;  4YKG A;  3NK1 X;  3GDP A;  3GMB A;  4K22 A;  3P4S A;  2GR0 A;  3UKP A;  1FL2 A;  4J34 A;  3AEE A;  2X50 A;  4ZN0 A;  3AE9 A;  3T2Z A;  2AQJ A;  1PXC A;  1N1P A;  3H8I A;  1BZL A;  1DJQ A;  3UP5 A;  1PXB A;  5KVI A;  1E1K A;  1YKJ A;  4GF7 A;  4U2S A;  1H83 A;  2H89 A;  5KOW A;  2BRY A;  3K7T A;  4EMI A;  1NHS A;  4BK2 A;  3T0K A;  2XVH A;  3Q9T A;  3QSE A;  3CGE A;  3QFA A;  3QVR A;  4AT0 A;  4TM1 A;  4GAV A;  1TRB A;  1OJC A;  5JCK A;  2F5Z A;  1LTX R;  2OA1 A;  1JRX A;  2C3C A;  2WS3 A;  1F8W A;  1E1L A;  1VRQ B;  2VZ2 A;  3IC9 A;  2AR8 A;  1SEZ A;  1PBB A;  1IUT A;  3GWD A;  2C70 A;  1GRG A;  3AE6 A;  1GES A;  2YG5 A;  4H4S A;  3II4 A;  1CL0 A;  3D8X A;  3UOX A;  1ZY8 A;  3F8P A;  1Y56 B;  2GAG B;  4AOX A;  4OPI A;  1ZOY A;  2GR3 A;  4ICY A;  4JQ9 A;  2JB3 A;  3GYI A;  2YAU A;  2V5Z A;  3BHK A;  4UP3 A;  2XVI A;  5GRT A;  3AYL A;  2VRM A;  3UTH A;  2I0Z A;  3AE2 A;  3VR8 A;  1N4U A;  2CUL A;  3AD8 B;  1D7L A;  3GD4 A;  3R9U A;  4G6G A;  2OAM A;  3VRB A;  2EQ8 A;  1GPE A;  2E1M A;  4J57 A;  3DJD A;  3SGL A;  3T2Y A;  4B68 A;  4C3X A;  1RSG A;  3RNM A;  2XYO A;  2YG4 A;  1H81 A;  4P9S A;  1DOB A;  3NH3 X;  2IID A;  5JCM A;  3SM8 A;  3DGZ A;  3UKK A;  3VRA A;  1N4V A;  2Y6Q A;  3ICR A;  4CY8 A;  1GRT A;  2BK5 A;  3DJG X;  4Z25 A;  1VQW A;  1NHQ A;  5JCL A;  1X31 B;  3ICS A;  3JSK A;  3UKF A;  4OPT A;  1NDA A;  1F3P A;  2FBW A;  2R0P A;  1JU2 A;  3NRN A;  4II3 A;  4IA5 A;  1BGN A;  4J2W A;  2X8C A;  4H4U A;  2XFQ A;  1VDC A;  1P2H A;  1GXF A;  1K0J A;  4LII A;  5GSN A;  4C77 A;  2Z5Y A;  3GDN A;  4UDP A;  1NAA A;  2GR2 A;  1QJD A;  2E5V A;  2Q6U A;  2V60 A;  2WOV A;  3C96 A;  2JK6 A;  3AEC A;  2O9Z A;  3NN0 X;  3URH A;  4B65 A;  4NZH A;  1H82 A;  4YSH A;  1H6V A;  2HQM A;  4H4W A;  2C67 A;  4H2R A;  5DBJ A;  2WBA A;  4USQ A;  3NGC X;  1FOH A;  2W0H A;  3EAO A;  4AP3 A;  1Y56 A;  3UP4 A;  1GRA A;  1XHC A;  2AAQ A;  3LZW A;  4TLZ A;  1FEC A;  5EB4 A;  1NG4 A;  1M64 A;  2YM2 A;  2APG A;  3P4R A;  4XWZ A;  1EL8 A;  1NG3 A;  3T14 A;  2Z5X A;  4KPR A;  1UKV G;  4U8J A;  3LJP A;  2WET A;  1KFY A;  2CDU A;  2FJA A;  3CPI G;  5CQF A;  4ECH A;  1B37 A;  2WEU A;  3RED A;  3V76 A;  2YG6 A;  4C5O A;  1KNR A;  1S3E A;  2NVK X;  1PJ5 A;  2DKH A;  3CIR A;  1B4V A;  4TM0 A;  5J7X A;  4Z24 A;  2BS3 A;  2WP5 A;  4WCT A;  3EAN A;  3G5R A;  4X9N A;  2C64 A;  2IVD A;  3L1R A;  1EL7 A;  2PYX A;  1FEB A;  3UKL A;  4CCR A;  4Z2U A;  3QSM A;  1HYU A;  2E4G A;  3AEG A;  3ZDN A;  3O0H A;  4WX1 A;  1CC6 A;  4A6N A;  4H4X A;  3BI2 A;  2Q0K A;  3AE5 A;  2EQ9 A;  2BC0 A;  1PBF A;  3SXI A;  1PJ6 A;  5TR3 A;  5U25 A;  3UTF A;  4B64 A;  3UKQ A;  1PHH A;  3GMC A;  2R4J A;  5BUL A;  2XFN A;  2UZZ A;  3CND A;  4XWR A;  5C2T A;  2BA9 A;  2OLO A;  3P4P A;  2C75 A;  4GR1 A;  2WQY A;  2XDO A;  4EQS A;  3GD3 A;  2V61 A;  4FK1 A;  1GEU A;  4REK A;  2H88 A;  1DOC A;  2YG3 A;  3DH9 A;  3K7M X;  4OVI A;  1D4E A;  4AP1 A;  5KMR A;  1OJD A;  2JAE A;  1IUU A;  4JY2 A;  4UDQ A;  1K0L A;  3BNM A;  4EQW A;  3ITJ A;  1BGJ A;  1RP0 A;  3AED A;  3IHG A;  4NEW A;  1GV4 A;  3NT6 A;  3GSI A;  3UKH A;  5FS8 A;  1PS9 A;  3SFD A;  1O95 A;  2JB2 A;  4H50 A;  4C3Y A;  2BCP A;  4U2L A;  1L9E A;  4EM3 A;  5FS9 A;  1GT8 A;  2BS4 A;  2YG7 A;  3ABV A;  4K5R A;  4Z26 A;  1LPF A;  4U8I A;  1ELI A;  1TYT A;  2ZZC A;  1BWC A;  3SZC A;  4IA6 A;  2Y6R A;  5M0Z A;  1IUV A;  3RP7 A;  4A79 A;  1O5W A;  2YM1 A;  3CNP A;  2GV8 A;  4X9M A;  3NTA A;  2X8G A;  3NTD A;  3SX6 A;  4B63 A;  4CNK A;  1O94 A;  1ZOV A;  2GAH B;  1XAN A;  4XXG A;  3SY4 A;  4B1B A;  2B7S A;  4USR A;  4YKF A;  3DK9 A;  3NYC A;  5CKU A;  2A8X A;  4J31 A;  4O5U A;  3SQP A;  4MJW A;  1L9D A;  3KVE A;  1DOE A;  3V3N A;  4TM3 A;  4YSX A;  3SFE A;  4BJY A;  3ALJ A;  5KNL A;  1NEK A;  2GQF A;  3OZ2 A;  2C7G A;  2WDV A;  2R0G A;  3E1T A;  1JOA A;  4LA1 A;  4GCM A;  3SYI A;  3NK2 X;  3RP8 A;  2VRL A;  3WE0 A;  1S2Y A;  3IF9 A;  3ALM A;  1ONF A;  2C65 A;  2B9X A;  1E1N A;  3UKA A;  1YY5 A;  5KMQ A;  4J56 A;  3OC4 A;  2QA1 A;  3AYJ A;  1DXL A;  3NN6 X;  1GOS A;  2VQB A;  4APN A;  2WU5 A;  2XFO A;  3ALL A;  1QLB A;  1NPX A;  4G9K A;  4NTE A;  4CBQ A;  4Z44 A;  3ATR A;  2X99 A;  1JRZ A;  3F8D A;  1CJC A;  2EQ7 A;  3F8R A;  3HZL A;  2VVL A;  3LB8 A;  4NTD A;  4EMW A;  4J36 A;  5KVH A;  1P2E A;  3CGB A;  3G5Q A;  3GRS A;  2RGH A;  4G6H A;  4A7A A;  4EIQ A;  4U8K A;  3Q6J A;  1LQU A;  3AB1 A;  2BCG G;  2WPF A;  3CGD A;  3CPJ G;  4YTN A;  2XCG A;  2R45 A;  5LV9 A;  2B9Y A;  3BHF A;  4X4J A;  3S5W A;  3H4K A;  3BI5 A;  4H4P A;  2XLU A;  4A6N B;  2GR1 A;  1EL9 A;  1IJH A;  3L8K A;  1KNP A;  3NIX A;  4AT2 A;  3NK0 X;  1OJT A;  1PBC A;  4IVM B;  3KA7 A;  5JCN A;  5KOX A;  5IQ4 A;  3GWF A;  3P4Q A;  4C74 A;  3QJ4 A;  1DOD A;  2WU2 A;  2YR5 A;  3COX A;  3I3L A;  4YTM A;  1NEN A;  1OJA A;  2YLR A;  2WOW A;  4TM4 A;  4Y4M A;  4K8D A;  4B69 A;  4D04 A;  4EQR A;  2YLT A;  1S3B A;  2TPR A;  4H2Q A;  1JRY A;  1LJ1 A;  2GEW A;  1CF3 A;  4ZCD A;  1JEH A;  2A87 A;  4U8O A;  5KMS A;  1Q1W A;  2XLS A;  3CPH G;  3FPZ A;  3K30 A;  2XLP A;  4G73 A;  3RP6 A;  1OJ9 A;  3UCL A;  3AWI A;  4JN9 A;  4YTP A;  4Z2T A;  2DKI A;  1MOK A;  3EF6 A;  2C72 A;  3AEB A;  2YLZ A;  4H4T A;  4FDC B;  3CTY A;  4KX6 A;  3SZF A;  4YSZ A;  3GRT A;  2BRA A;  3H8L A;  1ZK7 A;  2BC1 A;  4H4R A;  4N9X A;  1CC2 A;  2PHH A;  3UOY A;  1AOG A;  2R0C A;  4M52 A;  4Y4N A;  5FMH A;  5KMP A;  2GMJ A;  2VOU A;  2RGJ A;  2FJB A;  4Y4L A;  1JNR A;  2ZBW A;  4BK3 A;  3DK4 A;  2WDQ A;  4D03 A;  2GRT A;  1E39 A;  4GRT A;  5HHF A;  3KU9 A;  3T37 A;  3V3O A;  3AE1 A;  4I59 A;  5BVA A;  1TDE A;  3BNU A;  4CY6 A;  3DJE A;  2YVF A;  3GYJ A;  4Z43 A;  1FCD A;  1GRB A;  1F8R A;  3ISH A;  4RSL A;  3I6D A;  1M6I A;  3NG7 X;  3PS9 A;  4TLX A;  2GMH A;  3HYX A;  2XFP A;  1EL5 A;  4NWZ A;  4BV6 A;  4H4Z A;  5J60 A;  2CFY A;  1LQT A;  2R46 A;  1L0V A;  1NHP A;  2GF3 A;  3GYX A;  2BK4 A;  3D1C A;  1GSN A;  2GQW A;  3AD9 B;  2JKC A;  2TMD A;  2ZZB A;  2CVJ A;  3NNE A;  4JNQ A;  4U8P A;  4CCQ A;  2VQ7 A;  3G5S A;  2ZZ0 A;  2WDR A;  4U8N A;  3NLC A;  3KD9 A;  1H7X A;  2XLR A;  3HYV A;  2WHD A;  2IVE A;  3CN8 A;  4B67 A;  2GB0 A;  2QAE A;  4PAA A;  1ZP0 A;  3C4A A;  1S2Q A;  2XLT A;  2YWL A;  3KKJ A;  1LVL A;  4CNJ A;  3NYF A;  1H86 A;  1EBD A;  1D5T A;  2FJE A;  2X8H A;  5FS7 A;  2C66 A;  2YLW A;  2WES A;  3SZ0 A;  3AE7 A;  3BI4 A;  4EM4 A;  5FS6 A;  4U2T A;  3QVP A;  5L46 A;  1TDF A;  3AE3 A;  2BXS A;  4BK1 A;  3PVC A;  5EBK A;  5HYM A;  3RHA A;  2R4E A;  1GND A;  4I58 A;  1K4Q A;  1PBD A; 
#chains in the Genus database with same CATH homology
 4HA6 A;  3QFB A;  3CGC A;  4YSY A;  3T31 A;  1F6M A;  2B76 A;  2YLX A;  3DME A;  1PDH A;  5BUK A;  3K7Q X;  1DNC A;  1GTH A;  1XPQ A;  4PAB A;  4OCG A;  2XFU A;  4OPU A;  4EIP A;  5IQ1 A;  1D4C A;  2OLN A;  3FIM B;  4CRT A;  4Z2R A;  3LAD A;  2Q7V A;  4AOS A;  3B3R A;  1CC4 A;  3S61 A;  1GRH A;  4YXD A;  3ADA B;  2V3A A;  3KLJ A;  1F8S A;  1IUX A;  1YQ4 A;  2C76 A;  3LOV A;  3CNT A;  3IHM A;  1IUS A;  3FMW A;  1GET A;  2C73 A;  3DA1 A;  2J3N A;  1PBE A;  4E0V A;  2YLS A;  1REO A;  2R9Z A;  1COY A;  2EQ6 A;  2JB1 A;  1MXT A;  2FJD A;  3ZYX A;  2OAL A;  5KXJ A;  3P1W A;  1KF6 A;  4A99 A;  1Q9I A;  4K5S A;  4OPD A;  4U8M A;  3CNS A;  4H4V A;  4DSG A;  1KDG A;  4RG4 A;  4EMJ A;  4LU6 A;  1CJ4 A;  1L9C A;  4A5L A;  1GAL A;  1GER A;  5BRT A;  4JY3 A;  5ER0 A;  2BS2 A;  1CJ3 A;  2WPE A;  1RYI A;  5C3J A;  1XDI A;  1ZDL A;  4DSH A;  4G74 A;  3FBS A;  2WPC A;  4B66 A;  2VVM A;  1FEA A;  4NNJ A;  2BK3 A;  1ZX9 A;  3DK8 A;  2ACZ A;  1YQ3 A;  3AEA A;  4FK1 C;  3T2K A;  1YQZ A;  2X3N A;  4O5Q A;  3ICT A;  4GUV A;  1TDK A;  3HYW A;  4A9W A;  1TDN A;  5KRQ A;  3SZW A;  2C3D A;  2WP6 A;  2A89 A;  1VG0 A;  4GDE A;  2Q0L A;  2BXR A;  1IUW A;  3AEF A;  3DJJ A;  1PXA A;  1E1M A;  3FG2 P;  1K0I A;  3VR9 A;  1GTE A;  1V59 A;  1VG9 A;  3C4N A;  1NHR A;  4J33 A;  3CMM A;  5KWF A;  2GH5 A;  2GVC A;  2V3B A;  4OPC A;  1KSU A;  1GRF A;  1W4X A;  2BAC A;  2YR4 A;  2QA2 A;  3KPK A;  3NYE A;  2BAB A;  3UOZ A;  3AE4 A;  3AD7 B;  1MO9 A;  1D7Y A;  1E6E A;  4OPL A;  4BJZ A;  5JCI A;  3KPF A;  2YVJ A;  4GDP A;  2XVF A;  2WOI A;  1TDO A;  3NKS A;  4RG3 A;  4HB9 A;  2C4C A;  4II2 A;  3M12 A;  2BYB A;  3AXB A;  1Z6L A;  5IPY A;  4H4Y A;  4K7Z A;  2JBV A;  2YVG A;  4DGK A;  3VQR A;  4U8L A;  3EPT A;  1B8S A;  1LV0 A;  4UDR A;  1ZMD A;  1BKW A;  2RGO A;  2WP9 A;  4ZCC A;  2V6O A;  2B7R A;  3B6D A;  2B9W A;  4DNA A;  4FX9 A;  1BF3 A;  4GAP A;  5U63 A;  1B5Q A;  1QO8 A;  1ZKQ A;  4NTC A;  2RAB A;  2YQU A;  3M0O A;  4BUR A;  4EQX A;  3QSS A;  5EB5 A;  3LZX A;  5M10 A;  1KSS A;  1ZMC A;  2YR6 A;  1PN0 A;  2ARD A;  3ATQ A;  1D4D A;  3M13 A;  3AE8 A;  2XVJ A;  4IV9 A;  4NEV A;  3AYI A;  4H2N A;  3UTG A;  1CJ2 A;  4H2P A;  1H7W A;  4H7U A;  2QCU A;  3P9U A;  1PJ7 A;  5HXI A;  1JNZ A;  2XVE A;  1N4W A;  5U1O A;  1H84 A;  1CHU A;  4JDR A;  1E7P A;  4K2X A;  3PO7 A;  4OPG A;  4YT0 A;  4A65 A;  3UTE A;  1TYP A;  3UOV A;  1CBO A;  4YWO A;  3CNJ A;  3VRD B;  3DGH A;  4ADW A;  4IVO B;  2VVL G;  5EOW A;  2NPX A;  4H4Q A;  1Y0P A;  5HY5 A;  3NHO X;  1DJN A;  1GRE A;  3IWA A;  1Q1R A;  3LXD A;  4JNA A;  4YKG A;  3NK1 X;  3GDP A;  3GMB A;  4K22 A;  3P4S A;  2GR0 A;  3UKP A;  1FL2 A;  4J34 A;  3AEE A;  2X50 A;  4ZN0 A;  3AE9 A;  3T2Z A;  2AQJ A;  1PXC A;  1N1P A;  3H8I A;  1BZL A;  1DJQ A;  3UP5 A;  1PXB A;  5KVI A;  1E1K A;  1YKJ A;  4GF7 A;  4U2S A;  1H83 A;  2H89 A;  5KOW A;  2BRY A;  3K7T A;  4EMI A;  1NHS A;  4BK2 A;  3T0K A;  2XVH A;  3Q9T A;  3QSE A;  3CGE A;  3QFA A;  3QVR A;  4AT0 A;  4TM1 A;  4GAV A;  1TRB A;  1OJC A;  5JCK A;  2F5Z A;  1LTX R;  2OA1 A;  1JRX A;  2C3C A;  2WS3 A;  1F8W A;  1E1L A;  1VRQ B;  2VZ2 A;  3IC9 A;  2AR8 A;  1SEZ A;  1PBB A;  1IUT A;  3GWD A;  2C70 A;  1GRG A;  3AE6 A;  1GES A;  2YG5 A;  4H4S A;  3II4 A;  1CL0 A;  3D8X A;  3UOX A;  1ZY8 A;  3F8P A;  1Y56 B;  2GAG B;  4AOX A;  4OPI A;  1ZOY A;  2GR3 A;  4ICY A;  4JQ9 A;  2JB3 A;  3GYI A;  2YAU A;  2V5Z A;  3BHK A;  4UP3 A;  2XVI A;  5GRT A;  3AYL A;  2VRM A;  3UTH A;  2I0Z A;  3AE2 A;  3VR8 A;  1N4U A;  2CUL A;  3AD8 B;  1D7L A;  3GD4 A;  3R9U A;  4G6G A;  2OAM A;  3VRB A;  2EQ8 A;  1GPE A;  2E1M A;  4J57 A;  3DJD A;  3SGL A;  3T2Y A;  4B68 A;  4C3X A;  1RSG A;  3RNM A;  2XYO A;  2YG4 A;  1H81 A;  4P9S A;  1DOB A;  3NH3 X;  2IID A;  5JCM A;  3SM8 A;  3DGZ A;  3UKK A;  3VRA A;  1N4V A;  2Y6Q A;  3ICR A;  4CY8 A;  1GRT A;  2BK5 A;  3DJG X;  4Z25 A;  1VQW A;  1NHQ A;  5JCL A;  1X31 B;  3ICS A;  3JSK A;  3UKF A;  4OPT A;  1NDA A;  1F3P A;  2FBW A;  2R0P A;  1JU2 A;  3NRN A;  4II3 A;  4IA5 A;  1BGN A;  4J2W A;  2X8C A;  4H4U A;  2XFQ A;  1VDC A;  1P2H A;  1GXF A;  1K0J A;  4LII A;  5GSN A;  4C77 A;  2Z5Y A;  3GDN A;  4UDP A;  1NAA A;  2GR2 A;  1QJD A;  2E5V A;  2Q6U A;  2V60 A;  2WOV A;  3C96 A;  2JK6 A;  3AEC A;  2O9Z A;  3NN0 X;  3URH A;  4B65 A;  4NZH A;  1H82 A;  4YSH A;  1H6V A;  2HQM A;  4H4W A;  2C67 A;  4H2R A;  5DBJ A;  2WBA A;  4USQ A;  3NGC X;  1FOH A;  2W0H A;  3EAO A;  4AP3 A;  1Y56 A;  3UP4 A;  1GRA A;  1XHC A;  2AAQ A;  3LZW A;  4TLZ A;  1FEC A;  5EB4 A;  1NG4 A;  1M64 A;  2YM2 A;  2APG A;  3P4R A;  4XWZ A;  1EL8 A;  1NG3 A;  3T14 A;  2Z5X A;  4KPR A;  1UKV G;  4U8J A;  3LJP A;  2WET A;  1KFY A;  2CDU A;  2FJA A;  3CPI G;  5CQF A;  4ECH A;  1B37 A;  2WEU A;  3RED A;  3V76 A;  2YG6 A;  4C5O A;  1KNR A;  1S3E A;  2NVK X;  1PJ5 A;  2DKH A;  3CIR A;  1B4V A;  4TM0 A;  5J7X A;  4Z24 A;  2BS3 A;  2WP5 A;  4WCT A;  3EAN A;  3G5R A;  4X9N A;  2C64 A;  2IVD A;  3L1R A;  1EL7 A;  2PYX A;  1FEB A;  3UKL A;  4CCR A;  4Z2U A;  3QSM A;  1HYU A;  2E4G A;  3AEG A;  3ZDN A;  3O0H A;  4WX1 A;  1CC6 A;  4A6N A;  4H4X A;  3BI2 A;  2Q0K A;  3AE5 A;  2EQ9 A;  2BC0 A;  1PBF A;  3SXI A;  1PJ6 A;  5TR3 A;  5U25 A;  3UTF A;  4B64 A;  3UKQ A;  1PHH A;  3GMC A;  2R4J A;  5BUL A;  2XFN A;  2UZZ A;  3CND A;  4XWR A;  5C2T A;  2BA9 A;  2OLO A;  3P4P A;  2C75 A;  4GR1 A;  2WQY A;  2XDO A;  4EQS A;  3GD3 A;  2V61 A;  4FK1 A;  1GEU A;  4REK A;  2H88 A;  1DOC A;  2YG3 A;  3DH9 A;  3K7M X;  4OVI A;  1D4E A;  4AP1 A;  5KMR A;  1OJD A;  2JAE A;  1IUU A;  4JY2 A;  4UDQ A;  1K0L A;  3BNM A;  4EQW A;  3ITJ A;  1BGJ A;  1RP0 A;  3AED A;  3IHG A;  4NEW A;  1GV4 A;  3NT6 A;  3GSI A;  3UKH A;  5FS8 A;  1PS9 A;  3SFD A;  1O95 A;  2JB2 A;  4H50 A;  4C3Y A;  2BCP A;  4U2L A;  1L9E A;  4EM3 A;  5FS9 A;  1GT8 A;  2BS4 A;  2YG7 A;  3ABV A;  4K5R A;  4Z26 A;  1LPF A;  4U8I A;  1ELI A;  1TYT A;  2ZZC A;  1BWC A;  3SZC A;  4IA6 A;  2Y6R A;  5M0Z A;  1IUV A;  3RP7 A;  4A79 A;  1O5W A;  2YM1 A;  3CNP A;  2GV8 A;  4X9M A;  3NTA A;  2X8G A;  3NTD A;  3SX6 A;  4B63 A;  4CNK A;  1O94 A;  1ZOV A;  2GAH B;  1XAN A;  4XXG A;  3SY4 A;  4B1B A;  2B7S A;  4USR A;  4YKF A;  3DK9 A;  3NYC A;  5CKU A;  2A8X A;  4J31 A;  4O5U A;  3SQP A;  4MJW A;  1L9D A;  3KVE A;  1DOE A;  3V3N A;  4TM3 A;  4YSX A;  3SFE A;  4BJY A;  3ALJ A;  5KNL A;  1NEK A;  2GQF A;  3OZ2 A;  2C7G A;  2WDV A;  2R0G A;  3E1T A;  1JOA A;  4LA1 A;  4GCM A;  3SYI A;  3NK2 X;  3RP8 A;  2VRL A;  3WE0 A;  1S2Y A;  3IF9 A;  3ALM A;  1ONF A;  2C65 A;  2B9X A;  1E1N A;  3UKA A;  1YY5 A;  5KMQ A;  4J56 A;  3OC4 A;  2QA1 A;  3AYJ A;  1DXL A;  3NN6 X;  1GOS A;  2VQB A;  4APN A;  2WU5 A;  2XFO A;  3ALL A;  1QLB A;  1NPX A;  4G9K A;  4NTE A;  4CBQ A;  4Z44 A;  3ATR A;  2X99 A;  1JRZ A;  3F8D A;  1CJC A;  2EQ7 A;  3F8R A;  3HZL A;  2VVL A;  3LB8 A;  4NTD A;  4EMW A;  4J36 A;  5KVH A;  1P2E A;  3CGB A;  3G5Q A;  3GRS A;  2RGH A;  4G6H A;  4A7A A;  4EIQ A;  4U8K A;  3Q6J A;  1LQU A;  3AB1 A;  2BCG G;  2WPF A;  3CGD A;  3CPJ G;  4YTN A;  2XCG A;  2R45 A;  5LV9 A;  2B9Y A;  3BHF A;  4X4J A;  3S5W A;  3H4K A;  3BI5 A;  4H4P A;  2XLU A;  4A6N B;  2GR1 A;  1EL9 A;  1IJH A;  3L8K A;  1KNP A;  3NIX A;  4AT2 A;  3NK0 X;  1OJT A;  1PBC A;  4IVM B;  3KA7 A;  5JCN A;  5KOX A;  5IQ4 A;  3GWF A;  3P4Q A;  4C74 A;  3QJ4 A;  1DOD A;  2WU2 A;  2YR5 A;  3COX A;  3I3L A;  4YTM A;  1NEN A;  1OJA A;  2YLR A;  2WOW A;  4TM4 A;  4Y4M A;  4K8D A;  4B69 A;  4D04 A;  4EQR A;  2YLT A;  1S3B A;  2TPR A;  4H2Q A;  1JRY A;  1LJ1 A;  2GEW A;  1CF3 A;  4ZCD A;  1JEH A;  2A87 A;  4U8O A;  5KMS A;  1Q1W A;  2XLS A;  3CPH G;  3FPZ A;  3K30 A;  2XLP A;  4G73 A;  3RP6 A;  1OJ9 A;  3UCL A;  3AWI A;  4JN9 A;  4YTP A;  4Z2T A;  2DKI A;  1MOK A;  3EF6 A;  2C72 A;  3AEB A;  2YLZ A;  4H4T A;  4FDC B;  3CTY A;  4KX6 A;  3SZF A;  4YSZ A;  3GRT A;  2BRA A;  3H8L A;  1ZK7 A;  2BC1 A;  4H4R A;  4N9X A;  1CC2 A;  2PHH A;  3UOY A;  1AOG A;  2R0C A;  4M52 A;  4Y4N A;  5FMH A;  5KMP A;  2GMJ A;  2VOU A;  2RGJ A;  2FJB A;  4Y4L A;  1JNR A;  2ZBW A;  4BK3 A;  3DK4 A;  2WDQ A;  4D03 A;  2GRT A;  1E39 A;  4GRT A;  5HHF A;  3KU9 A;  3T37 A;  3V3O A;  3AE1 A;  4I59 A;  5BVA A;  1TDE A;  3BNU A;  4CY6 A;  3DJE A;  2YVF A;  3GYJ A;  4Z43 A;  1FCD A;  1GRB A;  1F8R A;  3ISH A;  4RSL A;  3I6D A;  1M6I A;  3NG7 X;  3PS9 A;  4TLX A;  2GMH A;  3HYX A;  2XFP A;  1EL5 A;  4NWZ A;  4BV6 A;  4H4Z A;  5J60 A;  2CFY A;  1LQT A;  2R46 A;  1L0V A;  1NHP A;  2GF3 A;  3GYX A;  2BK4 A;  3D1C A;  1GSN A;  2GQW A;  3AD9 B;  2JKC A;  2TMD A;  2ZZB A;  2CVJ A;  3NNE A;  4JNQ A;  4U8P A;  4CCQ A;  2VQ7 A;  3G5S A;  2ZZ0 A;  2WDR A;  4U8N A;  3NLC A;  3KD9 A;  1H7X A;  2XLR A;  3HYV A;  2WHD A;  2IVE A;  3CN8 A;  4B67 A;  2GB0 A;  2QAE A;  4PAA A;  1ZP0 A;  3C4A A;  1S2Q A;  2XLT A;  2YWL A;  3KKJ A;  1LVL A;  4CNJ A;  3NYF A;  1H86 A;  1EBD A;  1D5T A;  2FJE A;  2X8H A;  5FS7 A;  2C66 A;  2YLW A;  2WES A;  3SZ0 A;  3AE7 A;  3BI4 A;  4EM4 A;  5FS6 A;  4U2T A;  3QVP A;  5L46 A;  1TDF A;  3AE3 A;  2BXS A;  4BK1 A;  3PVC A;  5EBK A;  5HYM A;  3RHA A;  2R4E A;  1GND A;  4I58 A;  1K4Q A;  1PBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...