2XVIA

Crystal structure of the mutant bacterial flavin containing monooxygenase (y207s)
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
445
structure length
445
Chain Sequence
b'TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSSSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 158
structure length 445
sequence length 445
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xviA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xviA02
3L8KA 4A79A 2B9XA 1UKVG 3LJPA 3FMWA 3NTDA 3CGBA 2FBWA 1K4QA 1PBBA 4U8PA 1H84A 4A6NA 4C3XA 3M0OA 4K7ZA 3COXA 4CCQA 3BI4A 4O5UA 2YVJA 2BYBA 2UZZA 5BVAA 4B67A 3UTGA 2O9ZA 2B9WA 2HQMA 1PBEA 3H4KA 4H7UA 4B65A 2FJBA 4AP1A 4PABA 4JY3A 3RHAA 3UP5A 3LADA 2ZZ0A 3RP6A 5KWFA 3ALJA 3H8LA 3AE3A 4OPTA 1DJQA 1IUUA 3AE9A 1QLBA 4U8IA 4APNA 2GRTA 2H88A 3QJ4A 3DK9A 4BK1A 3GMCA 3QFBA 3T37A 2BC0A 3AB1A 1ONFA 4B68A 4ECHA 1OJTA 2GR3A 3AE8A 4H4PA 1X31B 4X9MA 2GEWA 4GF7A 2C7GA 3B3RA 1P2HA 1XHCA 2XVEA 3DK4A 2EQ7A 3SGLA 4U8NA 5KXJA 2BS4A 2ZBWA 4GR1A 3CIRA 4XWZA 2WDVA 1BZLA 2V60A 3DMEA 1YKJA 4OCGA 4UDRA 3I6DA 3URHA 2R0GA 3LB8A 2EQ8A 2XCGA 4GRTA 4AP3A 1MXTA 1E6EA 1OJ9A 3PS9A 2W0HA 2JKCA 1O5WA 2WOVA 4RG3A 4FK1A 3NK2X 2GMJA 2JB1A 4OPIA 2QAEA 3NG7X 3G5SA 3M12A 4NTEA 4RG4A 4U8OA 4EM4A 4OVIA 1RSGA 3AEFA 4NEVA 3CPIG 3IHMA 4NTCA 3UTEA 2ZZCA 3UKPA 1ZK7A 4C77A 1IUVA 3UTFA 1QO8A 1PHHA 4OPDA 3P1WA 1COYA 1GNDA 1KDGA 1JRYA 3AXBA 4OPGA 5LV9A 4H4WA 1CBOA 1E1KA 3Q9TA 1LPFA 2VQ7A 5JCLA 2C67A 5BRTA 1JNRA 4A6NB 4YKFA 1CF3A 1GRBA 4KX6A 4XWRA 3DJJA 1GERA 3NHOX 3KU9A 5IQ4A 1L9DA 3IF9A 1GREA 4IV9A 3C96A 4NEWA 2VVLA 2XYOA 2C75A 3DGHA 2E4GA 3AEEA 4LU6A 2AAQA 4HA6A 1E1NA 1DOCA 4YSZA 4X9NA 1GPEA 3GDNA 1YQZA 3ATRA 1FEAA 5C3JA 3H8IA 2GR0A 5DBJA 1Q1RA 3NNEA 3QSSA 2YLXA 3ITJA 4B66A 2R0PA 1BGNA 4ZCCA 3CGEA 4EMIA 1GRAA 1N4WA 1ZP0A 3BHFA 2ARDA 3IWAA 5FS7A 3OZ2A 4U8MA 2C70A 3CGCA 2PHHA 2WOIA 3JSKA 3NN6X 3NYCA 2B7RA 4A99A 4AOSA 1B4VA 1CHUA 3AEAA 1P2EA 2RGOA 4XXGA 4TM3A 2A8XA 5CQFA 1CJ4A 1S3BA 3IC9A 2YAUA 1GRFA 2EQ9A 2VQBA 4D04A 2BACA 3C4AA 3DK8A 3AEBA 3UKQA 1KNPA 3BNUA 4A9WA 1GV4A 3AE1A 3GDPA 3ADAB 4UDQA 1OJDA 2Q0LA 4JN9A 1D4EA 4GDEA 4D03A 4E0VA 1F6MA 2C66A 2JK6A 2XLUA 3EPTA 4CCRA 4OPLA 2WDQA 1KF6A 1ELIA 2V3BA 5BUKA 1N4VA 4U8KA 3QFAA 3AD7B 4IVMB 1BGJA 1PBDA 3PVCA 4Z2UA 4CBQA 1PN0A 5GRTA 2J3NA 2OLOA 2BK5A 3NLCA 4J56A 2Y6RA 3P4QA 4LIIA 1TDKA 2YM1A 3ICRA 2GMHA 4BK3A 4H4QA 3S5WA 1YQ3A 1DJNA 1ZMDA 1GTEA 2CFYA 4K5RA 4Z26A 3F8RA 2E5VA 4YTNA 2FJDA 4C5OA 5KRQA 1JU2A 1RP0A 4H4RA 1PBFA 4H4XA 4CRTA 1PS9A 2R4EA 3F8PA 3S61A 4BJYA 2Z5YA 2WS3A 2X99A 4YSYA 1ZMCA 3GSIA 3P4RA 2A87A 5EB5A 4EQSA 1CJCA 4YTPA 3EAOA 4H2PA 4H4YA 2X8HA 1W4XA 2Q0KA 4USQA 4FK1C 4YWOA 2YLZA 1FOHA 3EF6A 5L46A 1FL2A 2CVJA 3CPHG 4B64A 1PDHA 2R46A 3ZDNA 4BURA 3AD8B 1L9EA 2E1MA 2WHDA 2JB2A 1PJ7A 2BS3A 1IUXA 1D4CA 1DOBA 1O94A 2OA1A 3AE4A 4B1BA 3D1CA 3DA1A 1IUTA 1KNRA 2V6OA 4DNAA 2VVMA 1NHSA 4AT2A 2DKIA 2XFOA 2GQWA 2WU5A 3AECA 3ATQA 1REOA 4K22A 4EMWA 2ACZA 4JDRA 3LZXA 4H4TA 4EQRA 2EQ6A 3AE2A 3WE0A 1F8RA 2YG5A 4JNQA 3ISHA 1E1MA 2AR8A 3K30A 1OJCA 2WPCA 3P4SA 1EL7A 1CJ2A 2GH5A 1GT8A 5HY5A 2BXSA 3NYFA 3NTAA 1H83A 2YVFA 3GWDA 4A7AA 1CC6A 4WX1A 3PO7A 4LA1A 3NK1X 3UOXA 2XDOA 5TR3A 2H89A 1NHRA 1FECA 4PAAA 2GR2A 4I58A 1KSUA 3G5QA 1F3PA 4K8DA 4EQXA 1D4DA 3AEGA 5HXIA 2WPFA 2X50A 2YG4A 1TYTA 3ICTA 1HYUA 4K2XA 2R45A 1XDIA 4H2NA 5U25A 4AOXA 1NG4A 3G5RA 3UOZA 2XLSA 2WETA 3SQPA 3UKKA 2RABA 5C2TA 3SM8A 4Z43A 4FDCB 3AYJA 4NTDA 2VOUA 4Y4LA 4REKA 1QJDA 1E1LA 2C3CA 1GOSA 1Q9IA 2APGA 2YR6A 3GYJA 2QA2A 3QVPA 3EANA 4U8LA 2WP5A 1GXFA 2XVJA 3M13A 3CGDA 4JNAA 4U2LA 1PJ6A 2X8CA 1LTXR 4A5LA 3DGZA 4YSHA 2X3NA 3KA7A 1NEKA 3P9UA 1GETA 2XVHA 3QVRA 2BCPA 4U2SA 1N4UA 2YWLA 1LQUA 1GSNA 2V61A 1ZDLA 3GRSA 2VRLA 1VG0A 2WQYA 4UDPA 4Z44A 3QSEA 1JEHA 1NHQA 2XLPA 2WBAA 1TRBA 3LOVA 5CKUA 4CNJA 3RP7A 3I3LA 2YLTA 3Q6JA 3VR8A 1FEBA 3UP4A 1PXCA 1LJ1A 2C64A 1K0IA 4AT0A 2WESA 1LVLA 4ADWA 3ABVA 1S2QA 3NRNA 3V3OA 4YXDA 1DNCA 1JRXA 1MO9A 1PJ5A 3AYIA 3LZWA 4USRA 4Y4MA 1NG3A 2IIDA 2YR5A 4EMJA 1F8WA 1TDEA 4YT0A 1B37A 2WP6A 1EBDA 3AE7A 1IJHA 2FJEA 4CNKA 4EM3A 1EL9A 3UCLA 1CC4A 1GTHA 2YG6A 4JY2A 1ZOYA 1M6IA 3GMBA 4BK2A 1D7YA 4GUVA 2OLNA 5J7XA 1NHPA 4I59A 5KVIA 3BNMA 3SFDA 3VR9A 4OPUA 4A65A 2X8GA 3SFEA 1JNZA 3ALLA 1H82A 1GEUA 2Y6QA 3KKJA 4EQWA 3FG2P 4ICYA 3AE5A 5JCIA 1B5QA 2YQUA 2CULA 4UP3A 2OALA 3NK0X 3UKAA 4TM1A 3GWFA 2GB0A 4H50A 2C72A 3GRTA 1F8SA 2XVIA 2YLSA 1D7LA 4MJWA 2YLRA 5U1OA 4GCMA 4H4VA 1YQ4A 2WPEA 3BI2A 4NZHA 2XFNA 3L1RA 2C3DA 3VRDB 4JQ9A 5FS8A 1KSSA 5EB4A 3NT6A 1OJAA 1TDOA 2VZ2A 1ZKQA 2JAEA 2GQFA 3RP8A 1NPXA 2ZZBA 2YG7A 1IUSA 5BULA 5FS6A 2R4JA 1DXLA 1H81A 1H6VA 2GAGB 4TLZA 3HZLA 4X4JA 5IPYA 3LXDA 1AOGA 1Q1WA 1K0LA 1BWCA 5JCNA 1TDNA 4J57A 2V5ZA 3QSMA 2BCGG 4HB9A 3ZYXA 1IUWA 1B8SA 4M52A 2IVDA 4Z25A 3ALMA 4O5QA 3AE6A 3NIXA 1N1PA 1L9CA 3CNTA 3IHGA 1KFYA 4IA6A 4YSXA 2JB3A 2NVKX 2V3AA 3AYLA 3B6DA 1DOEA 2R9ZA 3CPJG 4TM0A 2GVCA 4YTMA 1CJ3A 1Y56A 2OAMA 4J2WA 2GV8A 4J33A 1PXAA 1PBCA 4H4ZA 3UTHA 3UKHA 1ZOVA 5JCKA 1H7XA 4CY6A 2RGJA 4U8JA 2QCUA 1BF3A 2JBVA 4K5SA 3REDA 2XVFA 5FMHA 1ZY8A 3GD4A 2Q6UA 3UOYA 4Z2RA 1GESA 4J31A 5HHFA 1DODA 3DH9A 2WOWA 2YM2A 3C4NA 1H7WA 3UKLA 2C65A 4C74A 1YY5A 2BXRA 4B69A 3CNDA 2B76A 4CY8A 3CNPA 3NN0X 4DGKA 4C3YA 5J60A 3II4A 1NENA 1D5TA 3K7QX 2DKHA 3O0HA 3BI5A 1L0VA 4H2QA 3FBSA 2C73A 3FPZA 2BK3A 3VRBA 4EIPA 1XPQA 2XLTA 2B7SA 5ER0A 3NYEA 2C76A 1Y0PA 3KPFA 2YLWA 2YR4A 2Z5XA 4DSHA 2QA1A 1K0JA 2XFUA 2F5ZA 1MOKA 3GYIA 3NH3X 2WDRA 1LV0A 3DJDA 3K7MX 2BS2A 5EOWA 1O95A 2GR1A 4H4UA 3OC4A 4GDPA 2Q7VA 4TM4A 2YG3A 1S2YA 3DJGX 2VRMA 5IQ1A 1FCDA 2WEUA 1M64A 1E39A 1RYIA 3BHKA 3KLJA 1E7PA 2XLRA 5U63A 4Y4NA 3NGCX 2GAHB 3KD9A 1TYPA 4IVOB 4WCTA 2PYXA 5KVHA 1VDCA 1V59A 1VG9A 1NAAA 3AWIA 3K7TA 4DSGA 3UOVA 3VQRA 2NPXA 3F8DA 2YVGA 1VRQB 4U2TA 3DJEA 5HYMA 2RGHA 1S3EA 4IA5A 3UKFA 5FS9A 5EBKA 2XFPA 3NKSA 1GALA 4J34A 1Y56B 2R0CA 3AEDA 4KPRA 2TPRA 1NDAA 1GRGA 1EL8A 1JRZA 2B9YA 2WP9A 3E1TA 1GRTA 2A89A 3CNJA 3CN8A 2BC1A 2TMDA 3FIMB 4H4SA 5M10A 4ZCDA 2BA9A 1BKWA 2FJAA 1EL5A 4OPCA 3R9UA 3VRAA 4BV6A 5JCMA 5KOXA 3V3NA 4BJZA 1JOAA 2XFQA 3CNSA 4FX9A 3RNMA 2GF3A 2WU2A 2CDUA 3ICSA 2VVLG 2BABA 1Z6LA 3P4PA 5GSNA 1H86A 1GRHA 3GD3A 4N9XA 1SEZA 4J36A 4P9SA 4Z24A 3V76A 4TLXA 2IVEA 2BK4A 3CTYA 1VQWA 4ZN0A 1TDFA 1LQTA 4H2RA 4YKGA 5KOWA 2I0ZA 2AQJA 1PXBA 1CL0A 4RSLA 1XANA 4Z2TA 4EIQA 5M0ZA 3AD9B 3D8XA 3KVEA 4B63A 1CC2A 1ZX9A
chains in the Genus database with same CATH superfamily
3SXIA 3L8KA 4A79A 2B9XA 1UKVG 3LJPA 4G74A 3FMWA 3NTDA 2C4CA 3CGBA 2FBWA 1K4QA 1PBBA 4NNJA 1H84A 4U8PA 4A6NA 4C3XA 3M0OA 4K7ZA 3COXA 4CCQA 3BI4A 4O5UA 2YVJA 2BYBA 2UZZA 5BVAA 4B67A 3UTGA 2O9ZA 2B9WA 2HQMA 1PBEA 3H4KA 4H7UA 4B65A 2FJBA 4AP1A 4PABA 4JY3A 3RHAA 3UP5A 3LADA 2ZZ0A 3RP6A 3T14A 5KWFA 3ALJA 3H8LA 3AE3A 4OPTA 1DJQA 1IUUA 3AE9A 1QLBA 4U8IA 4APNA 2GRTA 2H88A 3QJ4A 3DK9A 4BK1A 3GMCA 3QFBA 3T37A 2BC0A 3AB1A 1ONFA 4B68A 4ECHA 3SX6A 1OJTA 2GR3A 3AE8A 4H4PA 1X31B 4X9MA 2GEWA 4GF7A 2C7GA 3SZ0A 3B3RA 1P2HA 1XHCA 2XVEA 3DK4A 2EQ7A 3SGLA 4U8NA 5KXJA 2BS4A 2ZBWA 4GR1A 3CIRA 4XWZA 2WDVA 1BZLA 2V60A 3DMEA 1YKJA 4OCGA 4UDRA 3I6DA 3URHA 2R0GA 3LB8A 2EQ8A 2XCGA 4GRTA 4AP3A 1MXTA 1E6EA 1OJ9A 3PS9A 2W0HA 2JKCA 1O5WA 2WOVA 4RG3A 4FK1A 3NK2X 2GMJA 2JB1A 4OPIA 2QAEA 3NG7X 3G5SA 3M12A 4NTEA 4RG4A 4U8OA 4EM4A 4OVIA 1RSGA 3AEFA 4NEVA 3CPIG 3IHMA 4NTCA 3UTEA 2ZZCA 3UKPA 1ZK7A 4C77A 1IUVA 3UTFA 1QO8A 1PHHA 4OPDA 3P1WA 1COYA 1GNDA 1KDGA 1JRYA 3AXBA 4OPGA 5LV9A 4H4WA 1CBOA 1E1KA 3Q9TA 1LPFA 2VQ7A 5JCLA 2C67A 5BRTA 1JNRA 4A6NB 3SYIA 4YKFA 1CF3A 1GRBA 4KX6A 4XWRA 3DJJA 1GERA 3NHOX 3KU9A 5IQ4A 1L9DA 3IF9A 1GREA 4IV9A 3C96A 4NEWA 2VVLA 2XYOA 2C75A 3DGHA 2E4GA 3AEEA 3T2KA 4LU6A 2AAQA 4HA6A 1E1NA 1DOCA 4YSZA 4X9NA 1GPEA 3GDNA 1YQZA 3ATRA 1FEAA 5C3JA 3H8IA 2GR0A 5DBJA 1Q1RA 3NNEA 3QSSA 2YLXA 3ITJA 4B66A 2R0PA 1BGNA 4ZCCA 3CGEA 4EMIA 1GRAA 1N4WA 1ZP0A 3BHFA 2ARDA 3IWAA 5FS7A 3OZ2A 4U8MA 2C70A 3CGCA 2PHHA 2WOIA 3JSKA 3NN6X 3NYCA 2B7RA 4A99A 4AOSA 1B4VA 1CHUA 3AEAA 1P2EA 2RGOA 4XXGA 4TM3A 2A8XA 5CQFA 1CJ4A 1S3BA 3IC9A 2YAUA 1GRFA 2EQ9A 2VQBA 4D04A 2BACA 3C4AA 3DK8A 3AEBA 3UKQA 1KNPA 3BNUA 4A9WA 1GV4A 3AE1A 3GDPA 3ADAB 4UDQA 1OJDA 2Q0LA 4JN9A 1D4EA 4GDEA 4D03A 4E0VA 1F6MA 2C66A 2JK6A 2XLUA 3EPTA 4CCRA 4OPLA 2WDQA 1KF6A 1ELIA 2V3BA 5BUKA 1N4VA 4U8KA 3QFAA 3AD7B 4IVMB 1BGJA 1PBDA 3PVCA 4Z2UA 4CBQA 3SZWA 1PN0A 5GRTA 2J3NA 2OLOA 2BK5A 3GYXA 3NLCA 2Y6RA 3P4QA 4J56A 4LIIA 1TDKA 2YM1A 3ICRA 2GMHA 3SZFA 4BK3A 4H4QA 3S5WA 1YQ3A 1DJNA 1ZMDA 1GTEA 2CFYA 4K5RA 4Z26A 3F8RA 2E5VA 4YTNA 2FJDA 4C5OA 5KRQA 1JU2A 1RP0A 3SZCA 4G73A 4H4RA 1PBFA 4H4XA 4CRTA 1PS9A 2R4EA 3F8PA 3S61A 4BJYA 2Z5YA 2WS3A 2X99A 4YSYA 1ZMCA 3GSIA 3P4RA 2A87A 5EB5A 4EQSA 1CJCA 4YTPA 5KMSA 3EAOA 4H2PA 4H4YA 2X8HA 1W4XA 2Q0KA 4USQA 4FK1C 4YWOA 2YLZA 1FOHA 3EF6A 5L46A 1FL2A 2CVJA 3CPHG 4B64A 1PDHA 2R46A 3ZDNA 4BURA 3AD8B 1L9EA 4II2A 2E1MA 2WHDA 2JB2A 1PJ7A 2BS3A 1IUXA 1D4CA 1DOBA 1O94A 2OA1A 3AE4A 4B1BA 3D1CA 3DA1A 1IUTA 1KNRA 2V6OA 4DNAA 2VVMA 1NHSA 4AT2A 2DKIA 2XFOA 3HYWA 2GQWA 2WU5A 3AECA 3ATQA 1REOA 4K22A 4EMWA 2ACZA 4JDRA 3LZXA 4H4TA 4EQRA 2EQ6A 3AE2A 3WE0A 1F8RA 2YG5A 4JNQA 3ISHA 1E1MA 2AR8A 3K30A 1OJCA 2WPCA 3P4SA 1EL7A 1CJ2A 2GH5A 1GT8A 5HY5A 2BXSA 3NYFA 3NTAA 1H83A 2YVFA 3GWDA 4A7AA 1CC6A 4WX1A 3PO7A 4LA1A 3NK1X 3UOXA 2XDOA 5TR3A 2H89A 1NHRA 1FECA 4PAAA 2GR2A 4I58A 1KSUA 3G5QA 1F3PA 4K8DA 4EQXA 1D4DA 3AEGA 5HXIA 4GAPA 2WPFA 2X50A 2YG4A 1TYTA 3ICTA 1HYUA 4GAVA 4K2XA 2R45A 1XDIA 4H2NA 5U25A 4AOXA 3SY4A 1NG4A 3G5RA 3UOZA 2XLSA 2WETA 3SQPA 3UKKA 2RABA 5C2TA 3SM8A 4Z43A 4FDCB 3AYJA 4NTDA 2VOUA 4Y4LA 4REKA 1QJDA 1E1LA 2C3CA 1GOSA 1Q9IA 2APGA 2YR6A 3GYJA 3T31A 2QA2A 3QVPA 3EANA 4U8LA 2WP5A 1GXFA 2XVJA 3M13A 3CGDA 4JNAA 4U2LA 1PJ6A 2X8CA 1LTXR 4A5LA 3DGZA 4YSHA 2X3NA 3KA7A 1NEKA 3P9UA 1GETA 2XVHA 3QVRA 2BCPA 4NWZA 1N4UA 2YWLA 4U2SA 1LQUA 1GSNA 2V61A 1ZDLA 3GRSA 2VRLA 1VG0A 2WQYA 4UDPA 4Z44A 3QSEA 1JEHA 1NHQA 2XLPA 2WBAA 1TRBA 3LOVA 5CKUA 4CNJA 3RP7A 3I3LA 2YLTA 3Q6JA 3VR8A 1FEBA 3UP4A 1PXCA 1LJ1A 2C64A 1K0IA 4AT0A 2WESA 1LVLA 3KPKA 4ADWA 3ABVA 1S2QA 3NRNA 3V3OA 4YXDA 1DNCA 1JRXA 1MO9A 1PJ5A 3AYIA 3LZWA 4USRA 4Y4MA 1NG3A 2IIDA 2YR5A 4EMJA 1F8WA 1TDEA 4YT0A 1B37A 2WP6A 1EBDA 3AE7A 1IJHA 2FJEA 4CNKA 4EM3A 1EL9A 3UCLA 1CC4A 1GTHA 2YG6A 4JY2A 1ZOYA 1M6IA 3GMBA 4G9KA 4BK2A 1D7YA 4GUVA 2OLNA 5J7XA 1NHPA 4I59A 5KVIA 3BNMA 3SFDA 3VR9A 4OPUA 4A65A 2X8GA 3SFEA 1JNZA 3ALLA 5KNLA 1H82A 1GEUA 2Y6QA 3KKJA 4EQWA 3FG2P 4ICYA 3AE5A 5JCIA 1B5QA 2YQUA 2CULA 4UP3A 2OALA 3NK0X 3UKAA 4TM1A 3GWFA 2GB0A 2BRYA 4H50A 2C72A 3GRTA 1F8SA 2XVIA 2YLSA 1D7LA 4G6HA 4MJWA 2YLRA 5U1OA 4GCMA 4H4VA 1YQ4A 2WPEA 3BI2A 4G6GA 4NZHA 2XFNA 3L1RA 2C3DA 3VRDB 4JQ9A 5FS8A 1KSSA 5EB4A 3NT6A 1OJAA 1TDOA 2VZ2A 1ZKQA 2JAEA 2GQFA 3RP8A 1NPXA 2ZZBA 2YG7A 1IUSA 3HYXA 5BULA 5FS6A 2R4JA 1DXLA 1H81A 1H6VA 2GAGB 4TLZA 3HZLA 4X4JA 5IPYA 3LXDA 1AOGA 1Q1WA 1K0LA 1BWCA 5JCNA 1TDNA 4J57A 2V5ZA 3QSMA 2BCGG 4HB9A 3ZYXA 1IUWA 1B8SA 4M52A 2IVDA 4Z25A 3ALMA 4O5QA 3AE6A 3NIXA 1N1PA 1L9CA 3CNTA 3IHGA 1KFYA 4IA6A 4YSXA 2JB3A 2NVKX 2V3AA 3AYLA 5KMRA 3B6DA 1DOEA 2R9ZA 3CPJG 4TM0A 2GVCA 4YTMA 1CJ3A 1Y56A 2OAMA 4J2WA 2GV8A 4J33A 1PXAA 1PBCA 4H4ZA 3UTHA 3UKHA 1ZOVA 5JCKA 1H7XA 4CY6A 2RGJA 4U8JA 2QCUA 1BF3A 2JBVA 4K5SA 3REDA 2XVFA 5FMHA 1ZY8A 3GD4A 2Q6UA 3UOYA 4Z2RA 1GESA 4J31A 5HHFA 1DODA 3DH9A 2WOWA 2YM2A 3C4NA 1H7WA 3UKLA 2C65A 4C74A 1YY5A 2BXRA 4B69A 3CNDA 2B76A 4CY8A 3CNPA 3NN0X 4DGKA 4C3YA 5J60A 3II4A 1NENA 1D5TA 3K7QX 2DKHA 3O0HA 3BI5A 1L0VA 4H2QA 3FBSA 2C73A 3FPZA 2BK3A 3VRBA 4EIPA 1XPQA 2XLTA 2B7SA 5ER0A 3NYEA 2C76A 1Y0PA 3KPFA 2YLWA 2YR4A 2Z5XA 4DSHA 2QA1A 1K0JA 2XFUA 2F5ZA 1MOKA 3GYIA 3NH3X 5KMPA 2WDRA 1LV0A 3DJDA 3HYVA 3K7MX 2BS2A 5EOWA 1O95A 2GR1A 4H4UA 3OC4A 4GDPA 2Q7VA 4TM4A 2YG3A 1S2YA 3DJGX 2VRMA 5IQ1A 1FCDA 2WEUA 1M64A 1E39A 1RYIA 3BHKA 3KLJA 1E7PA 2XLRA 5U63A 4Y4NA 3NGCX 2GAHB 3KD9A 1TYPA 4IVOB 4WCTA 2PYXA 5KVHA 1VDCA 1V59A 1VG9A 1NAAA 3AWIA 3K7TA 4DSGA 3UOVA 3VQRA 2NPXA 3F8DA 2YVGA 1VRQB 4U2TA 3DJEA 5HYMA 2RGHA 1S3EA 4IA5A 3T0KA 5FS9A 3UKFA 5EBKA 2XFPA 4II3A 3NKSA 1GALA 4J34A 1Y56B 2R0CA 3AEDA 4KPRA 2TPRA 1NDAA 3CMMA 1GRGA 3T2ZA 1EL8A 1JRZA 2B9YA 2WP9A 3E1TA 1GRTA 2A89A 3CNJA 3CN8A 2BC1A 2TMDA 3FIMB 4H4SA 5M10A 4ZCDA 2BA9A 1BKWA 2FJAA 1EL5A 4OPCA 3R9UA 3VRAA 4BV6A 5JCMA 5KOXA 3V3NA 4BJZA 1JOAA 2XFQA 3CNSA 4FX9A 3T2YA 3RNMA 2GF3A 2WU2A 5KMQA 2BRAA 2CDUA 3ICSA 2VVLG 2BABA 1Z6LA 3P4PA 5GSNA 1H86A 1GRHA 3GD3A 4N9XA 1SEZA 4J36A 4P9SA 4Z24A 3V76A 4TLXA 2IVEA 2BK4A 3CTYA 1VQWA 4ZN0A 1TDFA 1LQTA 4H2RA 4YKGA 5KOWA 2I0ZA 2AQJA 1PXBA 1CL0A 4RSLA 1XANA 4Z2TA 4EIQA 5M0ZA 3AD9B 3D8XA 3KVEA 4B63A 1CC2A 1ZX9A
chains in the Genus database with same CATH topology
3SXIA 3L8KA 4A79A 2B9XA 1UKVG 3LJPA 4G74A 3FMWA 3NTDA 2C4CA 3CGBA 2FBWA 1K4QA 1PBBA 4NNJA 1H84A 4U8PA 4A6NA 4C3XA 3M0OA 4K7ZA 3COXA 4CCQA 3BI4A 4O5UA 2YVJA 2BYBA 2UZZA 5BVAA 4B67A 3UTGA 2O9ZA 2B9WA 2HQMA 1PBEA 3H4KA 4H7UA 4B65A 2FJBA 4AP1A 4PABA 4JY3A 3RHAA 3UP5A 3LADA 2ZZ0A 3RP6A 3T14A 5KWFA 3ALJA 3H8LA 3AE3A 4OPTA 1DJQA 1IUUA 3AE9A 1QLBA 4U8IA 4APNA 2GRTA 2H88A 3QJ4A 3DK9A 4BK1A 3GMCA 3QFBA 3T37A 2BC0A 3AB1A 1ONFA 4B68A 4ECHA 3SX6A 1OJTA 2GR3A 3AE8A 4H4PA 1X31B 4X9MA 2GEWA 4GF7A 2C7GA 3SZ0A 3B3RA 1P2HA 1XHCA 2XVEA 3DK4A 2EQ7A 3SGLA 4U8NA 5KXJA 2BS4A 2ZBWA 4GR1A 3CIRA 4XWZA 2WDVA 1BZLA 2V60A 3DMEA 1YKJA 4OCGA 4UDRA 3I6DA 3URHA 2R0GA 3LB8A 2EQ8A 2XCGA 4GRTA 4AP3A 1MXTA 1E6EA 1OJ9A 3PS9A 2W0HA 2JKCA 1O5WA 2WOVA 4RG3A 4FK1A 3NK2X 2GMJA 2JB1A 4OPIA 2QAEA 3NG7X 3G5SA 3M12A 4NTEA 4RG4A 4U8OA 4EM4A 4OVIA 1RSGA 3AEFA 4NEVA 3CPIG 3IHMA 4NTCA 3UTEA 2ZZCA 3UKPA 1ZK7A 4C77A 1IUVA 3UTFA 1QO8A 1PHHA 4OPDA 3P1WA 1COYA 1GNDA 1KDGA 1JRYA 3AXBA 4OPGA 5LV9A 4H4WA 1CBOA 1E1KA 3Q9TA 1LPFA 2VQ7A 5JCLA 2C67A 5BRTA 1JNRA 4A6NB 3SYIA 4YKFA 1CF3A 1GRBA 4KX6A 4XWRA 3DJJA 1GERA 3NHOX 3KU9A 5IQ4A 1L9DA 3IF9A 1GREA 4IV9A 3C96A 4NEWA 2VVLA 2XYOA 2C75A 3DGHA 2E4GA 3AEEA 3T2KA 4LU6A 2AAQA 4HA6A 1E1NA 1DOCA 4YSZA 4X9NA 1GPEA 3GDNA 1YQZA 3ATRA 1FEAA 5C3JA 3H8IA 2GR0A 5DBJA 1Q1RA 3NNEA 3QSSA 2YLXA 3ITJA 4B66A 2R0PA 1BGNA 4ZCCA 3CGEA 4EMIA 1GRAA 1N4WA 1ZP0A 3BHFA 2ARDA 3IWAA 5FS7A 3OZ2A 4U8MA 2C70A 3CGCA 2PHHA 2WOIA 3JSKA 3NN6X 3NYCA 2B7RA 4A99A 4AOSA 1B4VA 1CHUA 3AEAA 1P2EA 2RGOA 4XXGA 4TM3A 2A8XA 5CQFA 1CJ4A 1S3BA 3IC9A 2YAUA 1GRFA 2EQ9A 2VQBA 4D04A 2BACA 3C4AA 3DK8A 3AEBA 3UKQA 1KNPA 3BNUA 4A9WA 1GV4A 3AE1A 3GDPA 3ADAB 4UDQA 1OJDA 2Q0LA 4JN9A 1D4EA 4GDEA 4D03A 4E0VA 1F6MA 2C66A 2JK6A 2XLUA 3EPTA 4CCRA 4OPLA 2WDQA 1KF6A 1ELIA 2V3BA 5BUKA 1N4VA 4U8KA 3QFAA 3AD7B 4IVMB 1BGJA 1PBDA 3PVCA 4Z2UA 4CBQA 3SZWA 1PN0A 5GRTA 2J3NA 2OLOA 2BK5A 3GYXA 3NLCA 2Y6RA 3P4QA 4J56A 4LIIA 1TDKA 2YM1A 3ICRA 2GMHA 3SZFA 4BK3A 4H4QA 3S5WA 1YQ3A 1DJNA 1ZMDA 1GTEA 2CFYA 4K5RA 4Z26A 3F8RA 2E5VA 4YTNA 2FJDA 4C5OA 5KRQA 1JU2A 1RP0A 3SZCA 4G73A 4H4RA 1PBFA 4H4XA 4CRTA 1PS9A 2R4EA 3F8PA 3S61A 4BJYA 2Z5YA 2WS3A 2X99A 4YSYA 1ZMCA 3GSIA 3P4RA 2A87A 5EB5A 4EQSA 1CJCA 4YTPA 5KMSA 3EAOA 4H2PA 4H4YA 2X8HA 1W4XA 2Q0KA 4USQA 4FK1C 4YWOA 2YLZA 1FOHA 3EF6A 5L46A 1FL2A 2CVJA 3CPHG 4B64A 1PDHA 2R46A 3ZDNA 4BURA 3AD8B 1L9EA 4II2A 2E1MA 2WHDA 2JB2A 1PJ7A 2BS3A 1IUXA 1D4CA 1DOBA 1O94A 2OA1A 3AE4A 4B1BA 3D1CA 3DA1A 1IUTA 1KNRA 2V6OA 4DNAA 2VVMA 1NHSA 4AT2A 2DKIA 2XFOA 3HYWA 2GQWA 2WU5A 3AECA 3ATQA 1REOA 4K22A 4EMWA 2ACZA 4JDRA 3LZXA 4H4TA 4EQRA 2EQ6A 3AE2A 3WE0A 1F8RA 2YG5A 4JNQA 3ISHA 1E1MA 2AR8A 3K30A 1OJCA 2WPCA 3P4SA 1EL7A 1CJ2A 2GH5A 1GT8A 5HY5A 2BXSA 3NYFA 3NTAA 1H83A 2YVFA 3GWDA 4A7AA 1CC6A 4WX1A 3PO7A 4LA1A 3NK1X 3UOXA 2XDOA 5TR3A 2H89A 1NHRA 1FECA 4PAAA 2GR2A 4I58A 1KSUA 3G5QA 1F3PA 4K8DA 4EQXA 1D4DA 3AEGA 5HXIA 4GAPA 2WPFA 2X50A 2YG4A 1TYTA 3ICTA 1HYUA 4GAVA 4K2XA 2R45A 1XDIA 4H2NA 5U25A 4AOXA 3SY4A 1NG4A 3G5RA 3UOZA 2XLSA 2WETA 3SQPA 3UKKA 2RABA 5C2TA 3SM8A 4Z43A 4FDCB 3AYJA 4NTDA 2VOUA 4Y4LA 4REKA 1QJDA 1E1LA 2C3CA 1GOSA 1Q9IA 2APGA 2YR6A 3GYJA 3T31A 2QA2A 3QVPA 3EANA 4U8LA 2WP5A 1GXFA 2XVJA 3M13A 3CGDA 4JNAA 4U2LA 1PJ6A 2X8CA 1LTXR 4A5LA 3DGZA 4YSHA 2X3NA 3KA7A 1NEKA 3P9UA 1GETA 2XVHA 3QVRA 2BCPA 4NWZA 1N4UA 2YWLA 4U2SA 1LQUA 1GSNA 2V61A 1ZDLA 3GRSA 2VRLA 1VG0A 2WQYA 4UDPA 4Z44A 3QSEA 1JEHA 1NHQA 2XLPA 2WBAA 1TRBA 3LOVA 5CKUA 4CNJA 3RP7A 3I3LA 2YLTA 3Q6JA 3VR8A 1FEBA 3UP4A 1PXCA 1LJ1A 2C64A 1K0IA 4AT0A 2WESA 1LVLA 3KPKA 4ADWA 3ABVA 1S2QA 3NRNA 3V3OA 4YXDA 1DNCA 1JRXA 1MO9A 1PJ5A 3AYIA 3LZWA 4USRA 4Y4MA 1NG3A 2IIDA 2YR5A 4EMJA 1F8WA 1TDEA 4YT0A 1B37A 2WP6A 1EBDA 3AE7A 1IJHA 2FJEA 4CNKA 4EM3A 1EL9A 3UCLA 1CC4A 1GTHA 2YG6A 4JY2A 1ZOYA 1M6IA 3GMBA 4G9KA 4BK2A 1D7YA 4GUVA 2OLNA 5J7XA 1NHPA 4I59A 5KVIA 3BNMA 3SFDA 3VR9A 4OPUA 4A65A 2X8GA 3SFEA 1JNZA 3ALLA 5KNLA 1H82A 1GEUA 2Y6QA 3KKJA 4EQWA 3FG2P 4ICYA 3AE5A 5JCIA 1B5QA 2YQUA 2CULA 4UP3A 2OALA 3NK0X 3UKAA 4TM1A 3GWFA 2GB0A 2BRYA 4H50A 2C72A 3GRTA 1F8SA 2XVIA 2YLSA 1D7LA 4G6HA 4MJWA 2YLRA 5U1OA 4GCMA 4H4VA 1YQ4A 2WPEA 3BI2A 4G6GA 4NZHA 2XFNA 3L1RA 2C3DA 3VRDB 4JQ9A 5FS8A 1KSSA 5EB4A 3NT6A 1OJAA 1TDOA 2VZ2A 1ZKQA 2JAEA 2GQFA 3RP8A 1NPXA 2ZZBA 2YG7A 1IUSA 3HYXA 5BULA 5FS6A 2R4JA 1DXLA 1H81A 1H6VA 2GAGB 4TLZA 3HZLA 4X4JA 5IPYA 3LXDA 1AOGA 1Q1WA 1K0LA 1BWCA 5JCNA 1TDNA 4J57A 2V5ZA 3QSMA 2BCGG 4HB9A 3ZYXA 1IUWA 1B8SA 4M52A 2IVDA 4Z25A 3ALMA 4O5QA 3AE6A 3NIXA 1N1PA 1L9CA 3CNTA 3IHGA 1KFYA 4IA6A 4YSXA 2JB3A 2NVKX 2V3AA 3AYLA 5KMRA 3B6DA 1DOEA 2R9ZA 3CPJG 4TM0A 2GVCA 4YTMA 1CJ3A 1Y56A 2OAMA 4J2WA 2GV8A 4J33A 1PXAA 1PBCA 4H4ZA 3UTHA 3UKHA 1ZOVA 5JCKA 1H7XA 4CY6A 2RGJA 4U8JA 2QCUA 1BF3A 2JBVA 4K5SA 3REDA 2XVFA 5FMHA 1ZY8A 3GD4A 2Q6UA 3UOYA 4Z2RA 1GESA 4J31A 5HHFA 1DODA 3DH9A 2WOWA 2YM2A 3C4NA 1H7WA 3UKLA 2C65A 4C74A 1YY5A 2BXRA 4B69A 3CNDA 2B76A 4CY8A 3CNPA 3NN0X 4DGKA 4C3YA 5J60A 3II4A 1NENA 1D5TA 3K7QX 2DKHA 3O0HA 3BI5A 1L0VA 4H2QA 3FBSA 2C73A 3FPZA 2BK3A 3VRBA 4EIPA 1XPQA 2XLTA 2B7SA 5ER0A 3NYEA 2C76A 1Y0PA 3KPFA 2YLWA 2YR4A 2Z5XA 4DSHA 2QA1A 1K0JA 2XFUA 2F5ZA 1MOKA 3GYIA 3NH3X 5KMPA 2WDRA 1LV0A 3DJDA 3HYVA 3K7MX 2BS2A 5EOWA 1O95A 2GR1A 4H4UA 3OC4A 4GDPA 2Q7VA 4TM4A 2YG3A 1S2YA 3DJGX 2VRMA 5IQ1A 1FCDA 2WEUA 1M64A 1E39A 1RYIA 3BHKA 3KLJA 1E7PA 2XLRA 5U63A 4Y4NA 3NGCX 2GAHB 3KD9A 1TYPA 4IVOB 4WCTA 2PYXA 5KVHA 1VDCA 1V59A 1VG9A 1NAAA 3AWIA 3K7TA 4DSGA 3UOVA 3VQRA 2NPXA 3F8DA 2YVGA 1VRQB 4U2TA 3DJEA 5HYMA 2RGHA 1S3EA 4IA5A 3T0KA 5FS9A 3UKFA 5EBKA 2XFPA 4II3A 3NKSA 1GALA 4J34A 1Y56B 2R0CA 3AEDA 4KPRA 2TPRA 1NDAA 3CMMA 1GRGA 3T2ZA 1EL8A 1JRZA 2B9YA 2WP9A 3E1TA 1GRTA 2A89A 3CNJA 3CN8A 2BC1A 2TMDA 3FIMB 4H4SA 5M10A 4ZCDA 2BA9A 1BKWA 2FJAA 1EL5A 4OPCA 3R9UA 3VRAA 4BV6A 5JCMA 5KOXA 3V3NA 4BJZA 1JOAA 2XFQA 3CNSA 4FX9A 3T2YA 3RNMA 2GF3A 2WU2A 5KMQA 2BRAA 2CDUA 3ICSA 2VVLG 2BABA 1Z6LA 3P4PA 5GSNA 1H86A 1GRHA 3GD3A 4N9XA 1SEZA 4J36A 4P9SA 4Z24A 3V76A 4TLXA 2IVEA 2BK4A 3CTYA 1VQWA 4ZN0A 1TDFA 1LQTA 4H2RA 4YKGA 5KOWA 2I0ZA 2AQJA 1PXBA 1CL0A 4RSLA 1XANA 4Z2TA 4EIQA 5M0ZA 3AD9B 3D8XA 3KVEA 4B63A 1CC2A 1ZX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L8K A;  4A79 A;  2B9X A;  1UKV G;  3LJP A;  3FMW A;  3NTD A;  3CGB A;  2FBW A;  1K4Q A;  1PBB A;  4U8P A;  1H84 A;  4A6N A;  4C3X A;  3M0O A;  4K7Z A;  3COX A;  4CCQ A;  3BI4 A;  4O5U A;  2YVJ A;  2BYB A;  2UZZ A;  5BVA A;  4B67 A;  3UTG A;  2O9Z A;  2B9W A;  2HQM A;  1PBE A;  3H4K A;  4H7U A;  4B65 A;  2FJB A;  4AP1 A;  4PAB A;  4JY3 A;  3RHA A;  3UP5 A;  3LAD A;  2ZZ0 A;  3RP6 A;  5KWF A;  3ALJ A;  3H8L A;  3AE3 A;  4OPT A;  1DJQ A;  1IUU A;  3AE9 A;  1QLB A;  4U8I A;  4APN A;  2GRT A;  2H88 A;  3QJ4 A;  3DK9 A;  4BK1 A;  3GMC A;  3QFB A;  3T37 A;  2BC0 A;  3AB1 A;  1ONF A;  4B68 A;  4ECH A;  1OJT A;  2GR3 A;  3AE8 A;  4H4P A;  1X31 B;  4X9M A;  2GEW A;  4GF7 A;  2C7G A;  3B3R A;  1P2H A;  1XHC A;  2XVE A;  3DK4 A;  2EQ7 A;  3SGL A;  4U8N A;  5KXJ A;  2BS4 A;  2ZBW A;  4GR1 A;  3CIR A;  4XWZ A;  2WDV A;  1BZL A;  2V60 A;  3DME A;  1YKJ A;  4OCG A;  4UDR A;  3I6D A;  3URH A;  2R0G A;  3LB8 A;  2EQ8 A;  2XCG A;  4GRT A;  4AP3 A;  1MXT A;  1E6E A;  1OJ9 A;  3PS9 A;  2W0H A;  2JKC A;  1O5W A;  2WOV A;  4RG3 A;  4FK1 A;  3NK2 X;  2GMJ A;  2JB1 A;  4OPI A;  2QAE A;  3NG7 X;  3G5S A;  3M12 A;  4NTE A;  4RG4 A;  4U8O A;  4EM4 A;  4OVI A;  1RSG A;  3AEF A;  4NEV A;  3CPI G;  3IHM A;  4NTC A;  3UTE A;  2ZZC A;  3UKP A;  1ZK7 A;  4C77 A;  1IUV A;  3UTF A;  1QO8 A;  1PHH A;  4OPD A;  3P1W A;  1COY A;  1GND A;  1KDG A;  1JRY A;  3AXB A;  4OPG A;  5LV9 A;  4H4W A;  1CBO A;  1E1K A;  3Q9T A;  1LPF A;  2VQ7 A;  5JCL A;  2C67 A;  5BRT A;  1JNR A;  4A6N B;  4YKF A;  1CF3 A;  1GRB A;  4KX6 A;  4XWR A;  3DJJ A;  1GER A;  3NHO X;  3KU9 A;  5IQ4 A;  1L9D A;  3IF9 A;  1GRE A;  4IV9 A;  3C96 A;  4NEW A;  2VVL A;  2XYO A;  2C75 A;  3DGH A;  2E4G A;  3AEE A;  4LU6 A;  2AAQ A;  4HA6 A;  1E1N A;  1DOC A;  4YSZ A;  4X9N A;  1GPE A;  3GDN A;  1YQZ A;  3ATR A;  1FEA A;  5C3J A;  3H8I A;  2GR0 A;  5DBJ A;  1Q1R A;  3NNE A;  3QSS A;  2YLX A;  3ITJ A;  4B66 A;  2R0P A;  1BGN A;  4ZCC A;  3CGE A;  4EMI A;  1GRA A;  1N4W A;  1ZP0 A;  3BHF A;  2ARD A;  3IWA A;  5FS7 A;  3OZ2 A;  4U8M A;  2C70 A;  3CGC A;  2PHH A;  2WOI A;  3JSK A;  3NN6 X;  3NYC A;  2B7R A;  4A99 A;  4AOS A;  1B4V A;  1CHU A;  3AEA A;  1P2E A;  2RGO A;  4XXG A;  4TM3 A;  2A8X A;  5CQF A;  1CJ4 A;  1S3B A;  3IC9 A;  2YAU A;  1GRF A;  2EQ9 A;  2VQB A;  4D04 A;  2BAC A;  3C4A A;  3DK8 A;  3AEB A;  3UKQ A;  1KNP A;  3BNU A;  4A9W A;  1GV4 A;  3AE1 A;  3GDP A;  3ADA B;  4UDQ A;  1OJD A;  2Q0L A;  4JN9 A;  1D4E A;  4GDE A;  4D03 A;  4E0V A;  1F6M A;  2C66 A;  2JK6 A;  2XLU A;  3EPT A;  4CCR A;  4OPL A;  2WDQ A;  1KF6 A;  1ELI A;  2V3B A;  5BUK A;  1N4V A;  4U8K A;  3QFA A;  3AD7 B;  4IVM B;  1BGJ A;  1PBD A;  3PVC A;  4Z2U A;  4CBQ A;  1PN0 A;  5GRT A;  2J3N A;  2OLO A;  2BK5 A;  3NLC A;  4J56 A;  2Y6R A;  3P4Q A;  4LII A;  1TDK A;  2YM1 A;  3ICR A;  2GMH A;  4BK3 A;  4H4Q A;  3S5W A;  1YQ3 A;  1DJN A;  1ZMD A;  1GTE A;  2CFY A;  4K5R A;  4Z26 A;  3F8R A;  2E5V A;  4YTN A;  2FJD A;  4C5O A;  5KRQ A;  1JU2 A;  1RP0 A;  4H4R A;  1PBF A;  4H4X A;  4CRT A;  1PS9 A;  2R4E A;  3F8P A;  3S61 A;  4BJY A;  2Z5Y A;  2WS3 A;  2X99 A;  4YSY A;  1ZMC A;  3GSI A;  3P4R A;  2A87 A;  5EB5 A;  4EQS A;  1CJC A;  4YTP A;  3EAO A;  4H2P A;  4H4Y A;  2X8H A;  1W4X A;  2Q0K A;  4USQ A;  4FK1 C;  4YWO A;  2YLZ A;  1FOH A;  3EF6 A;  5L46 A;  1FL2 A;  2CVJ A;  3CPH G;  4B64 A;  1PDH A;  2R46 A;  3ZDN A;  4BUR A;  3AD8 B;  1L9E A;  2E1M A;  2WHD A;  2JB2 A;  1PJ7 A;  2BS3 A;  1IUX A;  1D4C A;  1DOB A;  1O94 A;  2OA1 A;  3AE4 A;  4B1B A;  3D1C A;  3DA1 A;  1IUT A;  1KNR A;  2V6O A;  4DNA A;  2VVM A;  1NHS A;  4AT2 A;  2DKI A;  2XFO A;  2GQW A;  2WU5 A;  3AEC A;  3ATQ A;  1REO A;  4K22 A;  4EMW A;  2ACZ A;  4JDR A;  3LZX A;  4H4T A;  4EQR A;  2EQ6 A;  3AE2 A;  3WE0 A;  1F8R A;  2YG5 A;  4JNQ A;  3ISH A;  1E1M A;  2AR8 A;  3K30 A;  1OJC A;  2WPC A;  3P4S A;  1EL7 A;  1CJ2 A;  2GH5 A;  1GT8 A;  5HY5 A;  2BXS A;  3NYF A;  3NTA A;  1H83 A;  2YVF A;  3GWD A;  4A7A A;  1CC6 A;  4WX1 A;  3PO7 A;  4LA1 A;  3NK1 X;  3UOX A;  2XDO A;  5TR3 A;  2H89 A;  1NHR A;  1FEC A;  4PAA A;  2GR2 A;  4I58 A;  1KSU A;  3G5Q A;  1F3P A;  4K8D A;  4EQX A;  1D4D A;  3AEG A;  5HXI A;  2WPF A;  2X50 A;  2YG4 A;  1TYT A;  3ICT A;  1HYU A;  4K2X A;  2R45 A;  1XDI A;  4H2N A;  5U25 A;  4AOX A;  1NG4 A;  3G5R A;  3UOZ A;  2XLS A;  2WET A;  3SQP A;  3UKK A;  2RAB A;  5C2T A;  3SM8 A;  4Z43 A;  4FDC B;  3AYJ A;  4NTD A;  2VOU A;  4Y4L A;  4REK A;  1QJD A;  1E1L A;  2C3C A;  1GOS A;  1Q9I A;  2APG A;  2YR6 A;  3GYJ A;  2QA2 A;  3QVP A;  3EAN A;  4U8L A;  2WP5 A;  1GXF A;  2XVJ A;  3M13 A;  3CGD A;  4JNA A;  4U2L A;  1PJ6 A;  2X8C A;  1LTX R;  4A5L A;  3DGZ A;  4YSH A;  2X3N A;  3KA7 A;  1NEK A;  3P9U A;  1GET A;  2XVH A;  3QVR A;  2BCP A;  4U2S A;  1N4U A;  2YWL A;  1LQU A;  1GSN A;  2V61 A;  1ZDL A;  3GRS A;  2VRL A;  1VG0 A;  2WQY A;  4UDP A;  4Z44 A;  3QSE A;  1JEH A;  1NHQ A;  2XLP A;  2WBA A;  1TRB A;  3LOV A;  5CKU A;  4CNJ A;  3RP7 A;  3I3L A;  2YLT A;  3Q6J A;  3VR8 A;  1FEB A;  3UP4 A;  1PXC A;  1LJ1 A;  2C64 A;  1K0I A;  4AT0 A;  2WES A;  1LVL A;  4ADW A;  3ABV A;  1S2Q A;  3NRN A;  3V3O A;  4YXD A;  1DNC A;  1JRX A;  1MO9 A;  1PJ5 A;  3AYI A;  3LZW A;  4USR A;  4Y4M A;  1NG3 A;  2IID A;  2YR5 A;  4EMJ A;  1F8W A;  1TDE A;  4YT0 A;  1B37 A;  2WP6 A;  1EBD A;  3AE7 A;  1IJH A;  2FJE A;  4CNK A;  4EM3 A;  1EL9 A;  3UCL A;  1CC4 A;  1GTH A;  2YG6 A;  4JY2 A;  1ZOY A;  1M6I A;  3GMB A;  4BK2 A;  1D7Y A;  4GUV A;  2OLN A;  5J7X A;  1NHP A;  4I59 A;  5KVI A;  3BNM A;  3SFD A;  3VR9 A;  4OPU A;  4A65 A;  2X8G A;  3SFE A;  1JNZ A;  3ALL A;  1H82 A;  1GEU A;  2Y6Q A;  3KKJ A;  4EQW A;  3FG2 P;  4ICY A;  3AE5 A;  5JCI A;  1B5Q A;  2YQU A;  2CUL A;  4UP3 A;  2OAL A;  3NK0 X;  3UKA A;  4TM1 A;  3GWF A;  2GB0 A;  4H50 A;  2C72 A;  3GRT A;  1F8S A;  2XVI A;  2YLS A;  1D7L A;  4MJW A;  2YLR A;  5U1O A;  4GCM A;  4H4V A;  1YQ4 A;  2WPE A;  3BI2 A;  4NZH A;  2XFN A;  3L1R A;  2C3D A;  3VRD B;  4JQ9 A;  5FS8 A;  1KSS A;  5EB4 A;  3NT6 A;  1OJA A;  1TDO A;  2VZ2 A;  1ZKQ A;  2JAE A;  2GQF A;  3RP8 A;  1NPX A;  2ZZB A;  2YG7 A;  1IUS A;  5BUL A;  5FS6 A;  2R4J A;  1DXL A;  1H81 A;  1H6V A;  2GAG B;  4TLZ A;  3HZL A;  4X4J A;  5IPY A;  3LXD A;  1AOG A;  1Q1W A;  1K0L A;  1BWC A;  5JCN A;  1TDN A;  4J57 A;  2V5Z A;  3QSM A;  2BCG G;  4HB9 A;  3ZYX A;  1IUW A;  1B8S A;  4M52 A;  2IVD A;  4Z25 A;  3ALM A;  4O5Q A;  3AE6 A;  3NIX A;  1N1P A;  1L9C A;  3CNT A;  3IHG A;  1KFY A;  4IA6 A;  4YSX A;  2JB3 A;  2NVK X;  2V3A A;  3AYL A;  3B6D A;  1DOE A;  2R9Z A;  3CPJ G;  4TM0 A;  2GVC A;  4YTM A;  1CJ3 A;  1Y56 A;  2OAM A;  4J2W A;  2GV8 A;  4J33 A;  1PXA A;  1PBC A;  4H4Z A;  3UTH A;  3UKH A;  1ZOV A;  5JCK A;  1H7X A;  4CY6 A;  2RGJ A;  4U8J A;  2QCU A;  1BF3 A;  2JBV A;  4K5S A;  3RED A;  2XVF A;  5FMH A;  1ZY8 A;  3GD4 A;  2Q6U A;  3UOY A;  4Z2R A;  1GES A;  4J31 A;  5HHF A;  1DOD A;  3DH9 A;  2WOW A;  2YM2 A;  3C4N A;  1H7W A;  3UKL A;  2C65 A;  4C74 A;  1YY5 A;  2BXR A;  4B69 A;  3CND A;  2B76 A;  4CY8 A;  3CNP A;  3NN0 X;  4DGK A;  4C3Y A;  5J60 A;  3II4 A;  1NEN A;  1D5T A;  3K7Q X;  2DKH A;  3O0H A;  3BI5 A;  1L0V A;  4H2Q A;  3FBS A;  2C73 A;  3FPZ A;  2BK3 A;  3VRB A;  4EIP A;  1XPQ A;  2XLT A;  2B7S A;  5ER0 A;  3NYE A;  2C76 A;  1Y0P A;  3KPF A;  2YLW A;  2YR4 A;  2Z5X A;  4DSH A;  2QA1 A;  1K0J A;  2XFU A;  2F5Z A;  1MOK A;  3GYI A;  3NH3 X;  2WDR A;  1LV0 A;  3DJD A;  3K7M X;  2BS2 A;  5EOW A;  1O95 A;  2GR1 A;  4H4U A;  3OC4 A;  4GDP A;  2Q7V A;  4TM4 A;  2YG3 A;  1S2Y A;  3DJG X;  2VRM A;  5IQ1 A;  1FCD A;  2WEU A;  1M64 A;  1E39 A;  1RYI A;  3BHK A;  3KLJ A;  1E7P A;  2XLR A;  5U63 A;  4Y4N A;  3NGC X;  2GAH B;  3KD9 A;  1TYP A;  4IVO B;  4WCT A;  2PYX A;  5KVH A;  1VDC A;  1V59 A;  1VG9 A;  1NAA A;  3AWI A;  3K7T A;  4DSG A;  3UOV A;  3VQR A;  2NPX A;  3F8D A;  2YVG A;  1VRQ B;  4U2T A;  3DJE A;  5HYM A;  2RGH A;  1S3E A;  4IA5 A;  3UKF A;  5FS9 A;  5EBK A;  2XFP A;  3NKS A;  1GAL A;  4J34 A;  1Y56 B;  2R0C A;  3AED A;  4KPR A;  2TPR A;  1NDA A;  1GRG A;  1EL8 A;  1JRZ A;  2B9Y A;  2WP9 A;  3E1T A;  1GRT A;  2A89 A;  3CNJ A;  3CN8 A;  2BC1 A;  2TMD A;  3FIM B;  4H4S A;  5M10 A;  4ZCD A;  2BA9 A;  1BKW A;  2FJA A;  1EL5 A;  4OPC A;  3R9U A;  3VRA A;  4BV6 A;  5JCM A;  5KOX A;  3V3N A;  4BJZ A;  1JOA A;  2XFQ A;  3CNS A;  4FX9 A;  3RNM A;  2GF3 A;  2WU2 A;  2CDU A;  3ICS A;  2VVL G;  2BAB A;  1Z6L A;  3P4P A;  5GSN A;  1H86 A;  1GRH A;  3GD3 A;  4N9X A;  1SEZ A;  4J36 A;  4P9S A;  4Z24 A;  3V76 A;  4TLX A;  2IVE A;  2BK4 A;  3CTY A;  1VQW A;  4ZN0 A;  1TDF A;  1LQT A;  4H2R A;  4YKG A;  5KOW A;  2I0Z A;  2AQJ A;  1PXB A;  1CL0 A;  4RSL A;  1XAN A;  4Z2T A;  4EIQ A;  5M0Z A;  3AD9 B;  3D8X A;  3KVE A;  4B63 A;  1CC2 A;  1ZX9 A; 
#chains in the Genus database with same CATH topology
 3SXI A;  3L8K A;  4A79 A;  2B9X A;  1UKV G;  3LJP A;  4G74 A;  3FMW A;  3NTD A;  2C4C A;  3CGB A;  2FBW A;  1K4Q A;  1PBB A;  4NNJ A;  1H84 A;  4U8P A;  4A6N A;  4C3X A;  3M0O A;  4K7Z A;  3COX A;  4CCQ A;  3BI4 A;  4O5U A;  2YVJ A;  2BYB A;  2UZZ A;  5BVA A;  4B67 A;  3UTG A;  2O9Z A;  2B9W A;  2HQM A;  1PBE A;  3H4K A;  4H7U A;  4B65 A;  2FJB A;  4AP1 A;  4PAB A;  4JY3 A;  3RHA A;  3UP5 A;  3LAD A;  2ZZ0 A;  3RP6 A;  3T14 A;  5KWF A;  3ALJ A;  3H8L A;  3AE3 A;  4OPT A;  1DJQ A;  1IUU A;  3AE9 A;  1QLB A;  4U8I A;  4APN A;  2GRT A;  2H88 A;  3QJ4 A;  3DK9 A;  4BK1 A;  3GMC A;  3QFB A;  3T37 A;  2BC0 A;  3AB1 A;  1ONF A;  4B68 A;  4ECH A;  3SX6 A;  1OJT A;  2GR3 A;  3AE8 A;  4H4P A;  1X31 B;  4X9M A;  2GEW A;  4GF7 A;  2C7G A;  3SZ0 A;  3B3R A;  1P2H A;  1XHC A;  2XVE A;  3DK4 A;  2EQ7 A;  3SGL A;  4U8N A;  5KXJ A;  2BS4 A;  2ZBW A;  4GR1 A;  3CIR A;  4XWZ A;  2WDV A;  1BZL A;  2V60 A;  3DME A;  1YKJ A;  4OCG A;  4UDR A;  3I6D A;  3URH A;  2R0G A;  3LB8 A;  2EQ8 A;  2XCG A;  4GRT A;  4AP3 A;  1MXT A;  1E6E A;  1OJ9 A;  3PS9 A;  2W0H A;  2JKC A;  1O5W A;  2WOV A;  4RG3 A;  4FK1 A;  3NK2 X;  2GMJ A;  2JB1 A;  4OPI A;  2QAE A;  3NG7 X;  3G5S A;  3M12 A;  4NTE A;  4RG4 A;  4U8O A;  4EM4 A;  4OVI A;  1RSG A;  3AEF A;  4NEV A;  3CPI G;  3IHM A;  4NTC A;  3UTE A;  2ZZC A;  3UKP A;  1ZK7 A;  4C77 A;  1IUV A;  3UTF A;  1QO8 A;  1PHH A;  4OPD A;  3P1W A;  1COY A;  1GND A;  1KDG A;  1JRY A;  3AXB A;  4OPG A;  5LV9 A;  4H4W A;  1CBO A;  1E1K A;  3Q9T A;  1LPF A;  2VQ7 A;  5JCL A;  2C67 A;  5BRT A;  1JNR A;  4A6N B;  3SYI A;  4YKF A;  1CF3 A;  1GRB A;  4KX6 A;  4XWR A;  3DJJ A;  1GER A;  3NHO X;  3KU9 A;  5IQ4 A;  1L9D A;  3IF9 A;  1GRE A;  4IV9 A;  3C96 A;  4NEW A;  2VVL A;  2XYO A;  2C75 A;  3DGH A;  2E4G A;  3AEE A;  3T2K A;  4LU6 A;  2AAQ A;  4HA6 A;  1E1N A;  1DOC A;  4YSZ A;  4X9N A;  1GPE A;  3GDN A;  1YQZ A;  3ATR A;  1FEA A;  5C3J A;  3H8I A;  2GR0 A;  5DBJ A;  1Q1R A;  3NNE A;  3QSS A;  2YLX A;  3ITJ A;  4B66 A;  2R0P A;  1BGN A;  4ZCC A;  3CGE A;  4EMI A;  1GRA A;  1N4W A;  1ZP0 A;  3BHF A;  2ARD A;  3IWA A;  5FS7 A;  3OZ2 A;  4U8M A;  2C70 A;  3CGC A;  2PHH A;  2WOI A;  3JSK A;  3NN6 X;  3NYC A;  2B7R A;  4A99 A;  4AOS A;  1B4V A;  1CHU A;  3AEA A;  1P2E A;  2RGO A;  4XXG A;  4TM3 A;  2A8X A;  5CQF A;  1CJ4 A;  1S3B A;  3IC9 A;  2YAU A;  1GRF A;  2EQ9 A;  2VQB A;  4D04 A;  2BAC A;  3C4A A;  3DK8 A;  3AEB A;  3UKQ A;  1KNP A;  3BNU A;  4A9W A;  1GV4 A;  3AE1 A;  3GDP A;  3ADA B;  4UDQ A;  1OJD A;  2Q0L A;  4JN9 A;  1D4E A;  4GDE A;  4D03 A;  4E0V A;  1F6M A;  2C66 A;  2JK6 A;  2XLU A;  3EPT A;  4CCR A;  4OPL A;  2WDQ A;  1KF6 A;  1ELI A;  2V3B A;  5BUK A;  1N4V A;  4U8K A;  3QFA A;  3AD7 B;  4IVM B;  1BGJ A;  1PBD A;  3PVC A;  4Z2U A;  4CBQ A;  3SZW A;  1PN0 A;  5GRT A;  2J3N A;  2OLO A;  2BK5 A;  3GYX A;  3NLC A;  2Y6R A;  3P4Q A;  4J56 A;  4LII A;  1TDK A;  2YM1 A;  3ICR A;  2GMH A;  3SZF A;  4BK3 A;  4H4Q A;  3S5W A;  1YQ3 A;  1DJN A;  1ZMD A;  1GTE A;  2CFY A;  4K5R A;  4Z26 A;  3F8R A;  2E5V A;  4YTN A;  2FJD A;  4C5O A;  5KRQ A;  1JU2 A;  1RP0 A;  3SZC A;  4G73 A;  4H4R A;  1PBF A;  4H4X A;  4CRT A;  1PS9 A;  2R4E A;  3F8P A;  3S61 A;  4BJY A;  2Z5Y A;  2WS3 A;  2X99 A;  4YSY A;  1ZMC A;  3GSI A;  3P4R A;  2A87 A;  5EB5 A;  4EQS A;  1CJC A;  4YTP A;  5KMS A;  3EAO A;  4H2P A;  4H4Y A;  2X8H A;  1W4X A;  2Q0K A;  4USQ A;  4FK1 C;  4YWO A;  2YLZ A;  1FOH A;  3EF6 A;  5L46 A;  1FL2 A;  2CVJ A;  3CPH G;  4B64 A;  1PDH A;  2R46 A;  3ZDN A;  4BUR A;  3AD8 B;  1L9E A;  4II2 A;  2E1M A;  2WHD A;  2JB2 A;  1PJ7 A;  2BS3 A;  1IUX A;  1D4C A;  1DOB A;  1O94 A;  2OA1 A;  3AE4 A;  4B1B A;  3D1C A;  3DA1 A;  1IUT A;  1KNR A;  2V6O A;  4DNA A;  2VVM A;  1NHS A;  4AT2 A;  2DKI A;  2XFO A;  3HYW A;  2GQW A;  2WU5 A;  3AEC A;  3ATQ A;  1REO A;  4K22 A;  4EMW A;  2ACZ A;  4JDR A;  3LZX A;  4H4T A;  4EQR A;  2EQ6 A;  3AE2 A;  3WE0 A;  1F8R A;  2YG5 A;  4JNQ A;  3ISH A;  1E1M A;  2AR8 A;  3K30 A;  1OJC A;  2WPC A;  3P4S A;  1EL7 A;  1CJ2 A;  2GH5 A;  1GT8 A;  5HY5 A;  2BXS A;  3NYF A;  3NTA A;  1H83 A;  2YVF A;  3GWD A;  4A7A A;  1CC6 A;  4WX1 A;  3PO7 A;  4LA1 A;  3NK1 X;  3UOX A;  2XDO A;  5TR3 A;  2H89 A;  1NHR A;  1FEC A;  4PAA A;  2GR2 A;  4I58 A;  1KSU A;  3G5Q A;  1F3P A;  4K8D A;  4EQX A;  1D4D A;  3AEG A;  5HXI A;  4GAP A;  2WPF A;  2X50 A;  2YG4 A;  1TYT A;  3ICT A;  1HYU A;  4GAV A;  4K2X A;  2R45 A;  1XDI A;  4H2N A;  5U25 A;  4AOX A;  3SY4 A;  1NG4 A;  3G5R A;  3UOZ A;  2XLS A;  2WET A;  3SQP A;  3UKK A;  2RAB A;  5C2T A;  3SM8 A;  4Z43 A;  4FDC B;  3AYJ A;  4NTD A;  2VOU A;  4Y4L A;  4REK A;  1QJD A;  1E1L A;  2C3C A;  1GOS A;  1Q9I A;  2APG A;  2YR6 A;  3GYJ A;  3T31 A;  2QA2 A;  3QVP A;  3EAN A;  4U8L A;  2WP5 A;  1GXF A;  2XVJ A;  3M13 A;  3CGD A;  4JNA A;  4U2L A;  1PJ6 A;  2X8C A;  1LTX R;  4A5L A;  3DGZ A;  4YSH A;  2X3N A;  3KA7 A;  1NEK A;  3P9U A;  1GET A;  2XVH A;  3QVR A;  2BCP A;  4NWZ A;  1N4U A;  2YWL A;  4U2S A;  1LQU A;  1GSN A;  2V61 A;  1ZDL A;  3GRS A;  2VRL A;  1VG0 A;  2WQY A;  4UDP A;  4Z44 A;  3QSE A;  1JEH A;  1NHQ A;  2XLP A;  2WBA A;  1TRB A;  3LOV A;  5CKU A;  4CNJ A;  3RP7 A;  3I3L A;  2YLT A;  3Q6J A;  3VR8 A;  1FEB A;  3UP4 A;  1PXC A;  1LJ1 A;  2C64 A;  1K0I A;  4AT0 A;  2WES A;  1LVL A;  3KPK A;  4ADW A;  3ABV A;  1S2Q A;  3NRN A;  3V3O A;  4YXD A;  1DNC A;  1JRX A;  1MO9 A;  1PJ5 A;  3AYI A;  3LZW A;  4USR A;  4Y4M A;  1NG3 A;  2IID A;  2YR5 A;  4EMJ A;  1F8W A;  1TDE A;  4YT0 A;  1B37 A;  2WP6 A;  1EBD A;  3AE7 A;  1IJH A;  2FJE A;  4CNK A;  4EM3 A;  1EL9 A;  3UCL A;  1CC4 A;  1GTH A;  2YG6 A;  4JY2 A;  1ZOY A;  1M6I A;  3GMB A;  4G9K A;  4BK2 A;  1D7Y A;  4GUV A;  2OLN A;  5J7X A;  1NHP A;  4I59 A;  5KVI A;  3BNM A;  3SFD A;  3VR9 A;  4OPU A;  4A65 A;  2X8G A;  3SFE A;  1JNZ A;  3ALL A;  5KNL A;  1H82 A;  1GEU A;  2Y6Q A;  3KKJ A;  4EQW A;  3FG2 P;  4ICY A;  3AE5 A;  5JCI A;  1B5Q A;  2YQU A;  2CUL A;  4UP3 A;  2OAL A;  3NK0 X;  3UKA A;  4TM1 A;  3GWF A;  2GB0 A;  2BRY A;  4H50 A;  2C72 A;  3GRT A;  1F8S A;  2XVI A;  2YLS A;  1D7L A;  4G6H A;  4MJW A;  2YLR A;  5U1O A;  4GCM A;  4H4V A;  1YQ4 A;  2WPE A;  3BI2 A;  4G6G A;  4NZH A;  2XFN A;  3L1R A;  2C3D A;  3VRD B;  4JQ9 A;  5FS8 A;  1KSS A;  5EB4 A;  3NT6 A;  1OJA A;  1TDO A;  2VZ2 A;  1ZKQ A;  2JAE A;  2GQF A;  3RP8 A;  1NPX A;  2ZZB A;  2YG7 A;  1IUS A;  3HYX A;  5BUL A;  5FS6 A;  2R4J A;  1DXL A;  1H81 A;  1H6V A;  2GAG B;  4TLZ A;  3HZL A;  4X4J A;  5IPY A;  3LXD A;  1AOG A;  1Q1W A;  1K0L A;  1BWC A;  5JCN A;  1TDN A;  4J57 A;  2V5Z A;  3QSM A;  2BCG G;  4HB9 A;  3ZYX A;  1IUW A;  1B8S A;  4M52 A;  2IVD A;  4Z25 A;  3ALM A;  4O5Q A;  3AE6 A;  3NIX A;  1N1P A;  1L9C A;  3CNT A;  3IHG A;  1KFY A;  4IA6 A;  4YSX A;  2JB3 A;  2NVK X;  2V3A A;  3AYL A;  5KMR A;  3B6D A;  1DOE A;  2R9Z A;  3CPJ G;  4TM0 A;  2GVC A;  4YTM A;  1CJ3 A;  1Y56 A;  2OAM A;  4J2W A;  2GV8 A;  4J33 A;  1PXA A;  1PBC A;  4H4Z A;  3UTH A;  3UKH A;  1ZOV A;  5JCK A;  1H7X A;  4CY6 A;  2RGJ A;  4U8J A;  2QCU A;  1BF3 A;  2JBV A;  4K5S A;  3RED A;  2XVF A;  5FMH A;  1ZY8 A;  3GD4 A;  2Q6U A;  3UOY A;  4Z2R A;  1GES A;  4J31 A;  5HHF A;  1DOD A;  3DH9 A;  2WOW A;  2YM2 A;  3C4N A;  1H7W A;  3UKL A;  2C65 A;  4C74 A;  1YY5 A;  2BXR A;  4B69 A;  3CND A;  2B76 A;  4CY8 A;  3CNP A;  3NN0 X;  4DGK A;  4C3Y A;  5J60 A;  3II4 A;  1NEN A;  1D5T A;  3K7Q X;  2DKH A;  3O0H A;  3BI5 A;  1L0V A;  4H2Q A;  3FBS A;  2C73 A;  3FPZ A;  2BK3 A;  3VRB A;  4EIP A;  1XPQ A;  2XLT A;  2B7S A;  5ER0 A;  3NYE A;  2C76 A;  1Y0P A;  3KPF A;  2YLW A;  2YR4 A;  2Z5X A;  4DSH A;  2QA1 A;  1K0J A;  2XFU A;  2F5Z A;  1MOK A;  3GYI A;  3NH3 X;  5KMP A;  2WDR A;  1LV0 A;  3DJD A;  3HYV A;  3K7M X;  2BS2 A;  5EOW A;  1O95 A;  2GR1 A;  4H4U A;  3OC4 A;  4GDP A;  2Q7V A;  4TM4 A;  2YG3 A;  1S2Y A;  3DJG X;  2VRM A;  5IQ1 A;  1FCD A;  2WEU A;  1M64 A;  1E39 A;  1RYI A;  3BHK A;  3KLJ A;  1E7P A;  2XLR A;  5U63 A;  4Y4N A;  3NGC X;  2GAH B;  3KD9 A;  1TYP A;  4IVO B;  4WCT A;  2PYX A;  5KVH A;  1VDC A;  1V59 A;  1VG9 A;  1NAA A;  3AWI A;  3K7T A;  4DSG A;  3UOV A;  3VQR A;  2NPX A;  3F8D A;  2YVG A;  1VRQ B;  4U2T A;  3DJE A;  5HYM A;  2RGH A;  1S3E A;  4IA5 A;  3T0K A;  5FS9 A;  3UKF A;  5EBK A;  2XFP A;  4II3 A;  3NKS A;  1GAL A;  4J34 A;  1Y56 B;  2R0C A;  3AED A;  4KPR A;  2TPR A;  1NDA A;  3CMM A;  1GRG A;  3T2Z A;  1EL8 A;  1JRZ A;  2B9Y A;  2WP9 A;  3E1T A;  1GRT A;  2A89 A;  3CNJ A;  3CN8 A;  2BC1 A;  2TMD A;  3FIM B;  4H4S A;  5M10 A;  4ZCD A;  2BA9 A;  1BKW A;  2FJA A;  1EL5 A;  4OPC A;  3R9U A;  3VRA A;  4BV6 A;  5JCM A;  5KOX A;  3V3N A;  4BJZ A;  1JOA A;  2XFQ A;  3CNS A;  4FX9 A;  3T2Y A;  3RNM A;  2GF3 A;  2WU2 A;  5KMQ A;  2BRA A;  2CDU A;  3ICS A;  2VVL G;  2BAB A;  1Z6L A;  3P4P A;  5GSN A;  1H86 A;  1GRH A;  3GD3 A;  4N9X A;  1SEZ A;  4J36 A;  4P9S A;  4Z24 A;  3V76 A;  4TLX A;  2IVE A;  2BK4 A;  3CTY A;  1VQW A;  4ZN0 A;  1TDF A;  1LQT A;  4H2R A;  4YKG A;  5KOW A;  2I0Z A;  2AQJ A;  1PXB A;  1CL0 A;  4RSL A;  1XAN A;  4Z2T A;  4EIQ A;  5M0Z A;  3AD9 B;  3D8X A;  3KVE A;  4B63 A;  1CC2 A;  1ZX9 A; 
#chains in the Genus database with same CATH homology
 3SXI A;  3L8K A;  4A79 A;  2B9X A;  1UKV G;  3LJP A;  4G74 A;  3FMW A;  3NTD A;  2C4C A;  3CGB A;  2FBW A;  1K4Q A;  1PBB A;  4NNJ A;  1H84 A;  4U8P A;  4A6N A;  4C3X A;  3M0O A;  4K7Z A;  3COX A;  4CCQ A;  3BI4 A;  4O5U A;  2YVJ A;  2BYB A;  2UZZ A;  5BVA A;  4B67 A;  3UTG A;  2O9Z A;  2B9W A;  2HQM A;  1PBE A;  3H4K A;  4H7U A;  4B65 A;  2FJB A;  4AP1 A;  4PAB A;  4JY3 A;  3RHA A;  3UP5 A;  3LAD A;  2ZZ0 A;  3RP6 A;  3T14 A;  5KWF A;  3ALJ A;  3H8L A;  3AE3 A;  4OPT A;  1DJQ A;  1IUU A;  3AE9 A;  1QLB A;  4U8I A;  4APN A;  2GRT A;  2H88 A;  3QJ4 A;  3DK9 A;  4BK1 A;  3GMC A;  3QFB A;  3T37 A;  2BC0 A;  3AB1 A;  1ONF A;  4B68 A;  4ECH A;  3SX6 A;  1OJT A;  2GR3 A;  3AE8 A;  4H4P A;  1X31 B;  4X9M A;  2GEW A;  4GF7 A;  2C7G A;  3SZ0 A;  3B3R A;  1P2H A;  1XHC A;  2XVE A;  3DK4 A;  2EQ7 A;  3SGL A;  4U8N A;  5KXJ A;  2BS4 A;  2ZBW A;  4GR1 A;  3CIR A;  4XWZ A;  2WDV A;  1BZL A;  2V60 A;  3DME A;  1YKJ A;  4OCG A;  4UDR A;  3I6D A;  3URH A;  2R0G A;  3LB8 A;  2EQ8 A;  2XCG A;  4GRT A;  4AP3 A;  1MXT A;  1E6E A;  1OJ9 A;  3PS9 A;  2W0H A;  2JKC A;  1O5W A;  2WOV A;  4RG3 A;  4FK1 A;  3NK2 X;  2GMJ A;  2JB1 A;  4OPI A;  2QAE A;  3NG7 X;  3G5S A;  3M12 A;  4NTE A;  4RG4 A;  4U8O A;  4EM4 A;  4OVI A;  1RSG A;  3AEF A;  4NEV A;  3CPI G;  3IHM A;  4NTC A;  3UTE A;  2ZZC A;  3UKP A;  1ZK7 A;  4C77 A;  1IUV A;  3UTF A;  1QO8 A;  1PHH A;  4OPD A;  3P1W A;  1COY A;  1GND A;  1KDG A;  1JRY A;  3AXB A;  4OPG A;  5LV9 A;  4H4W A;  1CBO A;  1E1K A;  3Q9T A;  1LPF A;  2VQ7 A;  5JCL A;  2C67 A;  5BRT A;  1JNR A;  4A6N B;  3SYI A;  4YKF A;  1CF3 A;  1GRB A;  4KX6 A;  4XWR A;  3DJJ A;  1GER A;  3NHO X;  3KU9 A;  5IQ4 A;  1L9D A;  3IF9 A;  1GRE A;  4IV9 A;  3C96 A;  4NEW A;  2VVL A;  2XYO A;  2C75 A;  3DGH A;  2E4G A;  3AEE A;  3T2K A;  4LU6 A;  2AAQ A;  4HA6 A;  1E1N A;  1DOC A;  4YSZ A;  4X9N A;  1GPE A;  3GDN A;  1YQZ A;  3ATR A;  1FEA A;  5C3J A;  3H8I A;  2GR0 A;  5DBJ A;  1Q1R A;  3NNE A;  3QSS A;  2YLX A;  3ITJ A;  4B66 A;  2R0P A;  1BGN A;  4ZCC A;  3CGE A;  4EMI A;  1GRA A;  1N4W A;  1ZP0 A;  3BHF A;  2ARD A;  3IWA A;  5FS7 A;  3OZ2 A;  4U8M A;  2C70 A;  3CGC A;  2PHH A;  2WOI A;  3JSK A;  3NN6 X;  3NYC A;  2B7R A;  4A99 A;  4AOS A;  1B4V A;  1CHU A;  3AEA A;  1P2E A;  2RGO A;  4XXG A;  4TM3 A;  2A8X A;  5CQF A;  1CJ4 A;  1S3B A;  3IC9 A;  2YAU A;  1GRF A;  2EQ9 A;  2VQB A;  4D04 A;  2BAC A;  3C4A A;  3DK8 A;  3AEB A;  3UKQ A;  1KNP A;  3BNU A;  4A9W A;  1GV4 A;  3AE1 A;  3GDP A;  3ADA B;  4UDQ A;  1OJD A;  2Q0L A;  4JN9 A;  1D4E A;  4GDE A;  4D03 A;  4E0V A;  1F6M A;  2C66 A;  2JK6 A;  2XLU A;  3EPT A;  4CCR A;  4OPL A;  2WDQ A;  1KF6 A;  1ELI A;  2V3B A;  5BUK A;  1N4V A;  4U8K A;  3QFA A;  3AD7 B;  4IVM B;  1BGJ A;  1PBD A;  3PVC A;  4Z2U A;  4CBQ A;  3SZW A;  1PN0 A;  5GRT A;  2J3N A;  2OLO A;  2BK5 A;  3GYX A;  3NLC A;  2Y6R A;  3P4Q A;  4J56 A;  4LII A;  1TDK A;  2YM1 A;  3ICR A;  2GMH A;  3SZF A;  4BK3 A;  4H4Q A;  3S5W A;  1YQ3 A;  1DJN A;  1ZMD A;  1GTE A;  2CFY A;  4K5R A;  4Z26 A;  3F8R A;  2E5V A;  4YTN A;  2FJD A;  4C5O A;  5KRQ A;  1JU2 A;  1RP0 A;  3SZC A;  4G73 A;  4H4R A;  1PBF A;  4H4X A;  4CRT A;  1PS9 A;  2R4E A;  3F8P A;  3S61 A;  4BJY A;  2Z5Y A;  2WS3 A;  2X99 A;  4YSY A;  1ZMC A;  3GSI A;  3P4R A;  2A87 A;  5EB5 A;  4EQS A;  1CJC A;  4YTP A;  5KMS A;  3EAO A;  4H2P A;  4H4Y A;  2X8H A;  1W4X A;  2Q0K A;  4USQ A;  4FK1 C;  4YWO A;  2YLZ A;  1FOH A;  3EF6 A;  5L46 A;  1FL2 A;  2CVJ A;  3CPH G;  4B64 A;  1PDH A;  2R46 A;  3ZDN A;  4BUR A;  3AD8 B;  1L9E A;  4II2 A;  2E1M A;  2WHD A;  2JB2 A;  1PJ7 A;  2BS3 A;  1IUX A;  1D4C A;  1DOB A;  1O94 A;  2OA1 A;  3AE4 A;  4B1B A;  3D1C A;  3DA1 A;  1IUT A;  1KNR A;  2V6O A;  4DNA A;  2VVM A;  1NHS A;  4AT2 A;  2DKI A;  2XFO A;  3HYW A;  2GQW A;  2WU5 A;  3AEC A;  3ATQ A;  1REO A;  4K22 A;  4EMW A;  2ACZ A;  4JDR A;  3LZX A;  4H4T A;  4EQR A;  2EQ6 A;  3AE2 A;  3WE0 A;  1F8R A;  2YG5 A;  4JNQ A;  3ISH A;  1E1M A;  2AR8 A;  3K30 A;  1OJC A;  2WPC A;  3P4S A;  1EL7 A;  1CJ2 A;  2GH5 A;  1GT8 A;  5HY5 A;  2BXS A;  3NYF A;  3NTA A;  1H83 A;  2YVF A;  3GWD A;  4A7A A;  1CC6 A;  4WX1 A;  3PO7 A;  4LA1 A;  3NK1 X;  3UOX A;  2XDO A;  5TR3 A;  2H89 A;  1NHR A;  1FEC A;  4PAA A;  2GR2 A;  4I58 A;  1KSU A;  3G5Q A;  1F3P A;  4K8D A;  4EQX A;  1D4D A;  3AEG A;  5HXI A;  4GAP A;  2WPF A;  2X50 A;  2YG4 A;  1TYT A;  3ICT A;  1HYU A;  4GAV A;  4K2X A;  2R45 A;  1XDI A;  4H2N A;  5U25 A;  4AOX A;  3SY4 A;  1NG4 A;  3G5R A;  3UOZ A;  2XLS A;  2WET A;  3SQP A;  3UKK A;  2RAB A;  5C2T A;  3SM8 A;  4Z43 A;  4FDC B;  3AYJ A;  4NTD A;  2VOU A;  4Y4L A;  4REK A;  1QJD A;  1E1L A;  2C3C A;  1GOS A;  1Q9I A;  2APG A;  2YR6 A;  3GYJ A;  3T31 A;  2QA2 A;  3QVP A;  3EAN A;  4U8L A;  2WP5 A;  1GXF A;  2XVJ A;  3M13 A;  3CGD A;  4JNA A;  4U2L A;  1PJ6 A;  2X8C A;  1LTX R;  4A5L A;  3DGZ A;  4YSH A;  2X3N A;  3KA7 A;  1NEK A;  3P9U A;  1GET A;  2XVH A;  3QVR A;  2BCP A;  4NWZ A;  1N4U A;  2YWL A;  4U2S A;  1LQU A;  1GSN A;  2V61 A;  1ZDL A;  3GRS A;  2VRL A;  1VG0 A;  2WQY A;  4UDP A;  4Z44 A;  3QSE A;  1JEH A;  1NHQ A;  2XLP A;  2WBA A;  1TRB A;  3LOV A;  5CKU A;  4CNJ A;  3RP7 A;  3I3L A;  2YLT A;  3Q6J A;  3VR8 A;  1FEB A;  3UP4 A;  1PXC A;  1LJ1 A;  2C64 A;  1K0I A;  4AT0 A;  2WES A;  1LVL A;  3KPK A;  4ADW A;  3ABV A;  1S2Q A;  3NRN A;  3V3O A;  4YXD A;  1DNC A;  1JRX A;  1MO9 A;  1PJ5 A;  3AYI A;  3LZW A;  4USR A;  4Y4M A;  1NG3 A;  2IID A;  2YR5 A;  4EMJ A;  1F8W A;  1TDE A;  4YT0 A;  1B37 A;  2WP6 A;  1EBD A;  3AE7 A;  1IJH A;  2FJE A;  4CNK A;  4EM3 A;  1EL9 A;  3UCL A;  1CC4 A;  1GTH A;  2YG6 A;  4JY2 A;  1ZOY A;  1M6I A;  3GMB A;  4G9K A;  4BK2 A;  1D7Y A;  4GUV A;  2OLN A;  5J7X A;  1NHP A;  4I59 A;  5KVI A;  3BNM A;  3SFD A;  3VR9 A;  4OPU A;  4A65 A;  2X8G A;  3SFE A;  1JNZ A;  3ALL A;  5KNL A;  1H82 A;  1GEU A;  2Y6Q A;  3KKJ A;  4EQW A;  3FG2 P;  4ICY A;  3AE5 A;  5JCI A;  1B5Q A;  2YQU A;  2CUL A;  4UP3 A;  2OAL A;  3NK0 X;  3UKA A;  4TM1 A;  3GWF A;  2GB0 A;  2BRY A;  4H50 A;  2C72 A;  3GRT A;  1F8S A;  2XVI A;  2YLS A;  1D7L A;  4G6H A;  4MJW A;  2YLR A;  5U1O A;  4GCM A;  4H4V A;  1YQ4 A;  2WPE A;  3BI2 A;  4G6G A;  4NZH A;  2XFN A;  3L1R A;  2C3D A;  3VRD B;  4JQ9 A;  5FS8 A;  1KSS A;  5EB4 A;  3NT6 A;  1OJA A;  1TDO A;  2VZ2 A;  1ZKQ A;  2JAE A;  2GQF A;  3RP8 A;  1NPX A;  2ZZB A;  2YG7 A;  1IUS A;  3HYX A;  5BUL A;  5FS6 A;  2R4J A;  1DXL A;  1H81 A;  1H6V A;  2GAG B;  4TLZ A;  3HZL A;  4X4J A;  5IPY A;  3LXD A;  1AOG A;  1Q1W A;  1K0L A;  1BWC A;  5JCN A;  1TDN A;  4J57 A;  2V5Z A;  3QSM A;  2BCG G;  4HB9 A;  3ZYX A;  1IUW A;  1B8S A;  4M52 A;  2IVD A;  4Z25 A;  3ALM A;  4O5Q A;  3AE6 A;  3NIX A;  1N1P A;  1L9C A;  3CNT A;  3IHG A;  1KFY A;  4IA6 A;  4YSX A;  2JB3 A;  2NVK X;  2V3A A;  3AYL A;  5KMR A;  3B6D A;  1DOE A;  2R9Z A;  3CPJ G;  4TM0 A;  2GVC A;  4YTM A;  1CJ3 A;  1Y56 A;  2OAM A;  4J2W A;  2GV8 A;  4J33 A;  1PXA A;  1PBC A;  4H4Z A;  3UTH A;  3UKH A;  1ZOV A;  5JCK A;  1H7X A;  4CY6 A;  2RGJ A;  4U8J A;  2QCU A;  1BF3 A;  2JBV A;  4K5S A;  3RED A;  2XVF A;  5FMH A;  1ZY8 A;  3GD4 A;  2Q6U A;  3UOY A;  4Z2R A;  1GES A;  4J31 A;  5HHF A;  1DOD A;  3DH9 A;  2WOW A;  2YM2 A;  3C4N A;  1H7W A;  3UKL A;  2C65 A;  4C74 A;  1YY5 A;  2BXR A;  4B69 A;  3CND A;  2B76 A;  4CY8 A;  3CNP A;  3NN0 X;  4DGK A;  4C3Y A;  5J60 A;  3II4 A;  1NEN A;  1D5T A;  3K7Q X;  2DKH A;  3O0H A;  3BI5 A;  1L0V A;  4H2Q A;  3FBS A;  2C73 A;  3FPZ A;  2BK3 A;  3VRB A;  4EIP A;  1XPQ A;  2XLT A;  2B7S A;  5ER0 A;  3NYE A;  2C76 A;  1Y0P A;  3KPF A;  2YLW A;  2YR4 A;  2Z5X A;  4DSH A;  2QA1 A;  1K0J A;  2XFU A;  2F5Z A;  1MOK A;  3GYI A;  3NH3 X;  5KMP A;  2WDR A;  1LV0 A;  3DJD A;  3HYV A;  3K7M X;  2BS2 A;  5EOW A;  1O95 A;  2GR1 A;  4H4U A;  3OC4 A;  4GDP A;  2Q7V A;  4TM4 A;  2YG3 A;  1S2Y A;  3DJG X;  2VRM A;  5IQ1 A;  1FCD A;  2WEU A;  1M64 A;  1E39 A;  1RYI A;  3BHK A;  3KLJ A;  1E7P A;  2XLR A;  5U63 A;  4Y4N A;  3NGC X;  2GAH B;  3KD9 A;  1TYP A;  4IVO B;  4WCT A;  2PYX A;  5KVH A;  1VDC A;  1V59 A;  1VG9 A;  1NAA A;  3AWI A;  3K7T A;  4DSG A;  3UOV A;  3VQR A;  2NPX A;  3F8D A;  2YVG A;  1VRQ B;  4U2T A;  3DJE A;  5HYM A;  2RGH A;  1S3E A;  4IA5 A;  3T0K A;  5FS9 A;  3UKF A;  5EBK A;  2XFP A;  4II3 A;  3NKS A;  1GAL A;  4J34 A;  1Y56 B;  2R0C A;  3AED A;  4KPR A;  2TPR A;  1NDA A;  3CMM A;  1GRG A;  3T2Z A;  1EL8 A;  1JRZ A;  2B9Y A;  2WP9 A;  3E1T A;  1GRT A;  2A89 A;  3CNJ A;  3CN8 A;  2BC1 A;  2TMD A;  3FIM B;  4H4S A;  5M10 A;  4ZCD A;  2BA9 A;  1BKW A;  2FJA A;  1EL5 A;  4OPC A;  3R9U A;  3VRA A;  4BV6 A;  5JCM A;  5KOX A;  3V3N A;  4BJZ A;  1JOA A;  2XFQ A;  3CNS A;  4FX9 A;  3T2Y A;  3RNM A;  2GF3 A;  2WU2 A;  5KMQ A;  2BRA A;  2CDU A;  3ICS A;  2VVL G;  2BAB A;  1Z6L A;  3P4P A;  5GSN A;  1H86 A;  1GRH A;  3GD3 A;  4N9X A;  1SEZ A;  4J36 A;  4P9S A;  4Z24 A;  3V76 A;  4TLX A;  2IVE A;  2BK4 A;  3CTY A;  1VQW A;  4ZN0 A;  1TDF A;  1LQT A;  4H2R A;  4YKG A;  5KOW A;  2I0Z A;  2AQJ A;  1PXB A;  1CL0 A;  4RSL A;  1XAN A;  4Z2T A;  4EIQ A;  5M0Z A;  3AD9 B;  3D8X A;  3KVE A;  4B63 A;  1CC2 A;  1ZX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...