2XVIA

Crystal structure of the mutant bacterial flavin containing monooxygenase (y207s)
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
445
structure length
445
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSSSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 158
structure length 445
sequence length 445
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xviA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xviA02
1K0LA 3UKKA 5BULA 1XDIA 1E1KA 1CC2A 2OALA 4BK2A 1ZY8A 4Z43A 1RP0A 3ALJA 2WPFA 1YY5A 2YG5A 5EB5A 1LJ1A 4Z24A 3F8PA 1GOSA 1EL5A 2XLRA 4REKA 4J34A 1PDHA 2BS2A 5FS7A 2VOUA 2XVEA 2YWLA 1QLBA 1DOEA 1NPXA 1Z6LA 4OPCA 2WESA 4YKGA 4JY3A 4RG4A 2R0CA 3DJJA 4XWZA 1NENA 3CNTA 1PHHA 3OZ2A 4OPDA 2YG3A 4C3YA 2XVIA 4K2XA 1M64A 2Q0KA 4X9NA 4CNKA 4U8KA 4IV9A 2BC1A 3DJEA 3CTYA 3GDNA 4GDPA 4EM3A 3P1WA 3Q6JA 2V3AA 3ZDNA 1H81A 4H4TA 3V76A 2BA9A 1EBDA 4Z25A 1F3PA 4OCGA 1BWCA 1KSSA 3R9UA 1JU2A 2BS4A 2XFUA 2VZ2A 3SFDA 1S2QA 3PS9A 2WPEA 4H4PA 1Q1RA 2DKHA 5EB4A 3ISHA 2RGHA 2XFQA 4IA5A 1S3EA 4BJZA 5KVHA 2V60A 2VVLG 1D7LA 1K0IA 2A87A 4TM1A 2X3NA 3G5RA 2C7GA 3AD9B 3O0HA 2X50A 4TM3A 3GRTA 4ADWA 2XDOA 4C5OA 4AT0A 1GEUA 2QCUA 3QSMA 1YKJA 2VRMA 4ZN0A 4YXDA 1FL2A 4D03A 2ACZA 5EBKA 3EANA 2WDRA 4U2LA 4JQ9A 2BXRA 4AOSA 4B64A 3GRSA 4H50A 2WQYA 1GETA 3WE0A 1TYPA 2X8CA 3GMBA 1QO8A 4CY6A 4KX6A 5GRTA 1DJNA 3NH3X 4DGKA 2EQ9A 1GRGA 1H83A 3DJDA 4K5SA 1MO9A 2BYBA 3FPZA 4GDEA 4I58A 4A7AA 3K7MX 3IHGA 4Z2TA 3UKLA 5J60A 3AE1A 3VR9A 3ZYXA 3UKQA 4C74A 3GD4A 4A6NA 2YLTA 2EQ7A 4GRTA 2FJBA 2FJDA 2FBWA 3Q9TA 3M13A 4EMWA 2Q7VA 4CCQA 1GRFA 2X8HA 3E1TA 1CL0A 4U8LA 4CRTA 2YR6A 3GD3A 5IPYA 2WEUA 1N4UA 5HY5A 2BK4A 1RSGA 4DNAA 1MXTA 3ICTA 2GRTA 4EQXA 3BI4A 1B5QA 1LQUA 3CGDA 1L9CA 3NK0X 2JK6A 4CCRA 1TDEA 3GDPA 3K30A 4U2SA 1ZMDA 3CGCA 2YM1A 2GVCA 4RG3A 2OA1A 2BK5A 2XYOA 1H7WA 1DOBA 3QSEA 3AD8B 1ZKQA 2EQ6A 4NEWA 2VQBA 2H89A 4PAAA 3RP7A 2BS3A 1F8RA 1TYTA 2CVJA 1BKWA 1D5TA 1H84A 2BACA 3BNUA 4K22A 3PO7A 3CNDA 4E0VA 2YQUA 1JOAA 1OJ9A 3BI5A 3IHMA 2Y6RA 3HZLA 3II4A 1GT8A 4OPUA 3NYCA 4EIQA 2E4GA 1F6MA 2YR4A 4NTDA 4USRA 1DOCA 2GQFA 2A89A 3AE8A 4YKFA 5CKUA 5FS9A 5M10A 1L9EA 4GUVA 4TLZA 2JB2A 3AEAA 5GSNA 5BRTA 4H4SA 3KPFA 3G5QA 2PYXA 5U1OA 2Y6QA 1PXCA 2A8XA 3P9UA 2GAGB 3ICRA 4Y4NA 3UKPA 3URHA 1OJTA 4ZCDA 3M0OA 3ATQA 4CNJA 1ZK7A 1VQWA 4O5QA 5BVAA 4UDQA 4OVIA 3S5WA 2Q6UA 3V3NA 4YSXA 2BCGG 4LU6A 1NG4A 1VG9A 1IJHA 4M52A 1EL9A 3UP5A 1CC4A 4J33A 4BJYA 1DJQA 2RGJA 3ITJA 3AE7A 4IVMB 4AP1A 4A6NB 4BURA 1LPFA 1E39A 2XLUA 1VDCA 4BK3A 3NLCA 4U8MA 3CNSA 1Q9IA 4KPRA 2ZZ0A 2B7SA 3LZWA 3NK2X 1KSUA 2YR5A 2GAHB 3UTHA 3B3RA 1GXFA 4JDRA 2YG7A 4CY8A 1ELIA 3CIRA 1PBDA 5U25A 1LQTA 2W0HA 1XANA 1NHPA 3C96A 1CBOA 1GREA 3AB1A 3AECA 1IUWA 2RGOA 1F8SA 1B8SA 3ATRA 4H4YA 3UP4A 2WP5A 1PBFA 1YQZA 5HHFA 3UTEA 3NKSA 2ZZCA 3ABVA 3LJPA 4LA1A 1VG0A 2YLXA 1QJDA 1GTEA 2YLSA 2QA1A 3I6DA 2IIDA 3AEGA 4APNA 3FMWA 3BI2A 4B67A 1GERA 1GNDA 1CJ2A 2B76A 3AYLA 4YSZA 1TDNA 1P2EA 3LB8A 2WP9A 5KOWA 3KD9A 4H4UA 1Y56A 3EPTA 4GF7A 4J56A 5C3JA 1L9DA 3AE6A 2QA2A 3L1RA 3IF9A 3LADA 1FEBA 2GR0A 3COXA 1E6EA 2R9ZA 4UDRA 1COYA 2JKCA 2GMJA 4H4WA 1REOA 2AAQA 4OPIA 2C75A 1DNCA 2UZZA 2C70A 4Z2RA 3KVEA 4U8OA 3RP6A 4A99A 3AE3A 4BV6A 4FK1A 4D04A 2WHDA 4NTEA 4YTNA 3GSIA 2XFNA 4XWRA 3CGEA 3UCLA 1H82A 1O94A 3KU9A 1NG3A 1N4VA 1XHCA 4AOXA 1JRXA 5LV9A 1FOHA 1XPQA 1GRTA 3OC4A 4C3XA 3BHKA 1VRQB 3QFBA 2R0GA 1JNZA 1CHUA 1PN0A 2C65A 2FJAA 4AT2A 5HXIA 4JNQA 4N9XA 4ECHA 3C4AA 1CJ3A 2BCPA 2WOVA 3ALMA 3AWIA 3V3OA 4B69A 4YTMA 1NHRA 1ZMCA 3BNMA 3NN0X 4P9SA 2WU5A 3FBSA 1GTHA 1H6VA 1E7PA 5KRQA 1AOGA 1DODA 1S3BA 3DGHA 1O5WA 5KWFA 3GYIA 1P2HA 5JCLA 2B7RA 4TM4A 4U8JA 5JCIA 2V61A 2WU2A 2E1MA 4OPTA 5EOWA 1KF6A 2EQ8A 3GMCA 4H4XA 2F5ZA 2BXSA 4J2WA 1PJ6A 2OAMA 2VQ7A 4LIIA 1JEHA 1PBBA 3QFAA 3K7QX 3F8RA 4X4JA 1ZDLA 3M12A 1NHQA 2E5VA 2BC0A 1D4CA 2GR3A 3VRDB 4DSHA 4O5UA 3QSSA 5BUKA 2C64A 2GV8A 5IQ1A 1Y56B 2R45A 3DK4A 4Y4MA 5IQ4A 1ONFA 4YWOA 2BK3A 2WETA 2Z5YA 1HYUA 3P4PA 4EIPA 2C3DA 1N1PA 3S61A 1H86A 3FG2P 4IA6A 1PJ5A 1JRZA 2WP6A 3IC9A 4FK1C 1GSNA 1FCDA 2R0PA 1BF3A 4ICYA 4IVOB 3UOYA 4MJWA 4YTPA 1YQ3A 2X8GA 3CPJG 1ZP0A 2XVJA 3DGZA 1PJ7A 4C77A 4AP3A 5U63A 3NG7X 4B1BA 3D8XA 1PBCA 2GF3A 3KKJA 4PABA 5JCMA 4HB9A 1OJCA 5L46A 3AE2A 3VR8A 3H8IA 1ZX9A 3ICSA 5JCKA 2XFPA 1E1MA 1GRHA 3UKAA 1PS9A 3B6DA 2O9ZA 4USQA 4J57A 2GB0A 4B68A 4YT0A 2B9XA 1O95A 1X31B 3K7TA 4A9WA 3NRNA 1MOKA 4K7ZA 1Q1WA 3VQRA 2FJEA 3SGLA 1GRBA 1D4DA 2APGA 3SQPA 1NDAA 4H4ZA 4J31A 4EQSA 2HQMA 3AEEA 3KA7A 3QVPA 3F8DA 4B63A 3NTDA 1FEAA 3VRBA 2YM2A 2WDQA 3GWDA 4J36A 5M0ZA 3RP8A 3G5SA 1JNRA 2B9YA 3DA1A 3NGCX 4NEVA 3AYIA 2YLRA 4K8DA 2XLSA 4A79A 2VVMA 2JAEA 2CFYA 2XFOA 3UKHA 4EQWA 1TDKA 4NTCA 3UOZA 2WDVA 1FECA 1D7YA 2GH5A 5HYMA 4K5RA 1SEZA 1BZLA 3ALLA 4H7UA 3DK8A 1PBEA 2TPRA 5KVIA 1ZOVA 5CQFA 2OLNA 4Z44A 3VRAA 5TR3A 4TLXA 1E1NA 1LV0A 1RYIA 2YAUA 4EMJA 3DH9A 2AQJA 2C67A 1EL8A 2YLWA 3EAOA 2XCGA 3IWAA 2ARDA 2XLPA 3P4RA 3CPHG 2WOWA 1IUSA 4JY2A 1BGJA 4OPLA 2NPXA 1K4QA 1OJAA 2PHHA 4H4RA 4B65A 2V5ZA 2ZBWA 3DJGX 3P4SA 4U8IA 3FIMB 2AR8A 3RNMA 1EL7A 1W4XA 4H2NA 2C66A 3SM8A 4BK1A 2NVKX 2IVDA 2GEWA 4TM0A 5ER0A 4Z2UA 1LVLA 1IUVA 3P4QA 2GR1A 4JNAA 4H4VA 4I59A 3BHFA 2H88A 1KNPA 1TDOA 2C3CA 1LTXR 3CNPA 1TDFA 4H2QA 3GWFA 3NN6X 2XVFA 2TMDA 1CJCA 3C4NA 2XVHA 3NIXA 1CJ4A 1H7XA 5C2TA 4JN9A 2GR2A 4YSYA 3L8KA 3NTAA 4U8NA 3LZXA 4OPGA 1KFYA 4EM4A 4Y4LA 4U8PA 2ZZBA 2JB1A 3CN8A 4GCMA 4H2RA 1OJDA 4GR1A 4HA6A 4H4QA 1D4EA 1PXBA 1Y0PA 3H4KA 3UOVA 1IUTA 1GRAA 1BGNA 2X99A 3T37A 2C76A 2DKIA 1GPEA 2WBAA 2YVFA 1F8WA 5J7XA 3REDA 3AE4A 2XLTA 2JB3A 5FMHA 4FX9A 2OLOA 3AEFA 4H2PA 2CDUA 2WPCA 3CPIG 4A5LA 5KOXA 1B37A 1CF3A 2GQWA 2V6OA 2R4EA 1NHSA 2RABA 3UTGA 3LOVA 4YSHA 3NNEA 1GALA 2YG4A 4NZHA 4Z26A 3AEDA 3UTFA 2B9WA 2QAEA 4FDCB 4EQRA 1IUUA 3NHOX 4WX1A 1B4VA 1K0JA 2WS3A 4EMIA 3AEBA 4X9MA 3SFEA 3AE9A 1L0VA 3AXBA 2YVJA 4ZCCA 1UKVG 2R46A 5DBJA 1E1LA 5FS8A 3DK9A 4DSGA 2V3BA 2YG6A 3NYFA 4B66A 2I0ZA 4A65A 1V59A 1M6IA 3AD7B 1GV4A 3D1CA 2JBVA 3I3LA 4RSLA 1TRBA 3CNJA 4CBQA 5KXJA 2CULA 1GESA 3NT6A 2IVEA 3PVCA 2GMHA 1CC6A 3QVRA 1KNRA 1YQ4A 2Z5XA 1NAAA 3DMEA 2R4JA 3NK1X 1ZOYA 4U2TA 1KDGA 1NEKA 3NYEA 1IUXA 3LXDA 3RHAA 3JSKA 1JRYA 3H8LA 3QJ4A 2YLZA 3AYJA 2J3NA 3UKFA 4XXGA 2BABA 2C73A 3GYJA 2VVLA 2YVGA 2C72A 1S2YA 3UOXA 5JCNA 2WOIA 4UDPA 4WCTA 2VRLA 3EF6A 5FS6A 1PXAA 4UP3A 1DXLA 3CGBA 3KLJA 1N4WA 2Q0LA 3AE5A 3ADAB
chains in the Genus database with same CATH superfamily
1K0LA 3UKKA 5BULA 1XDIA 1E1KA 1CC2A 2OALA 4BK2A 1ZY8A 3SZFA 1RP0A 3ALJA 2WPFA 4Z43A 1YY5A 2YG5A 4II3A 1LJ1A 5EB5A 4Z24A 3F8PA 1GOSA 1EL5A 2XLRA 4REKA 4J34A 1PDHA 2BS2A 5FS7A 2VOUA 2XVEA 2YWLA 1QLBA 1DOEA 1NPXA 1Z6LA 4OPCA 2WESA 4YKGA 4JY3A 4RG4A 2R0CA 3DJJA 4XWZA 1NENA 3CNTA 1PHHA 3OZ2A 4OPDA 2YG3A 4C3YA 3T2KA 2XVIA 4K2XA 1M64A 2Q0KA 4X9NA 4CNKA 4U8KA 4IV9A 2BC1A 3DJEA 3SX6A 3CTYA 3GDNA 4GDPA 4EM3A 3P1WA 3Q6JA 2V3AA 3ZDNA 1H81A 4H4TA 3V76A 2BA9A 1EBDA 4Z25A 1F3PA 4OCGA 1BWCA 1KSSA 3R9UA 1JU2A 2BS4A 2XFUA 2VZ2A 3SFDA 1S2QA 3PS9A 2WPEA 4H4PA 1Q1RA 2DKHA 5EB4A 3ISHA 3SZWA 2RGHA 2XFQA 4IA5A 1S3EA 4BJZA 5KVHA 2V60A 2VVLG 1D7LA 1K0IA 2A87A 4TM1A 2X3NA 3G5RA 2C7GA 3AD9B 3O0HA 2X50A 5KMPA 4TM3A 3GRTA 4ADWA 2XDOA 4C5OA 4AT0A 1GEUA 2QCUA 3QSMA 1YKJA 2VRMA 4ZN0A 4YXDA 1FL2A 4D03A 2ACZA 5EBKA 3EANA 2WDRA 4U2LA 4JQ9A 2BXRA 4AOSA 4B64A 3GRSA 4H50A 2WQYA 1GETA 3T31A 3WE0A 1TYPA 2X8CA 3GMBA 1QO8A 4CY6A 4KX6A 5GRTA 1DJNA 3NH3X 4DGKA 2EQ9A 1GRGA 1H83A 3DJDA 4K5SA 4G9KA 3T2YA 1MO9A 2BYBA 3FPZA 4GDEA 4I58A 4NWZA 4A7AA 3K7MX 3IHGA 4Z2TA 3UKLA 5J60A 3AE1A 3VR9A 3ZYXA 3UKQA 4C74A 3GD4A 4A6NA 2YLTA 2EQ7A 4GRTA 2FJBA 2FJDA 2FBWA 3Q9TA 3M13A 4EMWA 2Q7VA 4CCQA 1GRFA 2X8HA 3E1TA 1CL0A 4U8LA 4CRTA 2YR6A 3GD3A 5IPYA 2WEUA 1N4UA 5HY5A 2BK4A 1RSGA 4DNAA 1MXTA 3ICTA 2GRTA 4EQXA 3BI4A 1B5QA 1LQUA 3CGDA 1L9CA 3NK0X 2JK6A 4CCRA 1TDEA 3GDPA 3K30A 4U2SA 1ZMDA 3CGCA 2YM1A 2GVCA 4RG3A 2OA1A 2BK5A 2XYOA 1H7WA 1DOBA 3QSEA 3AD8B 1ZKQA 2EQ6A 4NEWA 2VQBA 2H89A 4G6HA 4PAAA 3RP7A 2BS3A 1F8RA 1TYTA 2CVJA 1BKWA 1D5TA 1H84A 2BACA 3BNUA 4K22A 3PO7A 3CNDA 4E0VA 2YQUA 1JOAA 1OJ9A 3BI5A 3IHMA 2Y6RA 3HZLA 3II4A 1GT8A 4OPUA 3NYCA 4EIQA 2E4GA 1F6MA 2YR4A 4NTDA 4USRA 1DOCA 2GQFA 2C4CA 2A89A 3AE8A 4YKFA 5CKUA 5FS9A 5M10A 1L9EA 4GUVA 4TLZA 2JB2A 3AEAA 5GSNA 5BRTA 4H4SA 3KPFA 3G5QA 2PYXA 5U1OA 2Y6QA 1PXCA 2A8XA 3P9UA 2GAGB 3ICRA 4Y4NA 3UKPA 3URHA 1OJTA 4ZCDA 3M0OA 3ATQA 4CNJA 1ZK7A 1VQWA 4O5QA 5BVAA 4UDQA 4OVIA 3S5WA 2Q6UA 3V3NA 4GAVA 2BCGG 4LU6A 1NG4A 1VG9A 1IJHA 4M52A 1EL9A 3UP5A 1CC4A 4J33A 4BJYA 1DJQA 2RGJA 3ITJA 3AE7A 4IVMB 4AP1A 4A6NB 4BURA 1LPFA 1E39A 2XLUA 2BRAA 1VDCA 4BK3A 3NLCA 4U8MA 3CNSA 1Q9IA 4G74A 4KPRA 2ZZ0A 2B7SA 3LZWA 3NK2X 1KSUA 2YR5A 2GAHB 3UTHA 3B3RA 1GXFA 4JDRA 2YG7A 4CY8A 1ELIA 3CIRA 1PBDA 4G73A 5U25A 1LQTA 2W0HA 3SYIA 5KMRA 1XANA 1NHPA 3C96A 1CBOA 1GREA 3AB1A 3AECA 1IUWA 2RGOA 1F8SA 1B8SA 3ATRA 5KNLA 4H4YA 3UP4A 2WP5A 1PBFA 1YQZA 5HHFA 3UTEA 3NKSA 2ZZCA 3ABVA 3LJPA 4LA1A 1VG0A 2YLXA 1QJDA 1GTEA 2YLSA 2QA1A 3I6DA 2IIDA 3AEGA 4APNA 3FMWA 3BI2A 4B67A 1GERA 1GNDA 1CJ2A 2B76A 3AYLA 4YSZA 1TDNA 1P2EA 3LB8A 2WP9A 5KOWA 3KD9A 4H4UA 1Y56A 3EPTA 4GF7A 4J56A 5C3JA 1L9DA 3AE6A 2QA2A 3L1RA 3IF9A 3LADA 1FEBA 2GR0A 3COXA 1E6EA 2R9ZA 4UDRA 1COYA 2JKCA 2GMJA 4H4WA 1REOA 2AAQA 4OPIA 2C75A 1DNCA 2UZZA 2C70A 4Z2RA 3KVEA 4U8OA 5KMSA 3RP6A 4A99A 3AE3A 4BV6A 4FK1A 4D04A 3HYXA 2WHDA 4NTEA 4YTNA 3GSIA 2XFNA 4XWRA 3CGEA 3UCLA 1H82A 1O94A 3KU9A 1NG3A 1N4VA 1XHCA 4AOXA 1JRXA 5LV9A 1FOHA 1XPQA 1GRTA 3OC4A 3T2ZA 3BHKA 4C3XA 1VRQB 3QFBA 2R0GA 1JNZA 1CHUA 1PN0A 2C65A 2FJAA 4AT2A 5HXIA 4JNQA 4N9XA 4ECHA 3C4AA 1CJ3A 2BCPA 2WOVA 3ALMA 3AWIA 3V3OA 4B69A 4YTMA 1NHRA 1ZMCA 3BNMA 3NN0X 4P9SA 2WU5A 3FBSA 1GTHA 1H6VA 1E7PA 5KRQA 1AOGA 1DODA 1S3BA 3DGHA 1O5WA 5KWFA 3GYIA 1P2HA 5JCLA 2B7RA 4TM4A 4U8JA 5JCIA 2V61A 2WU2A 2E1MA 4OPTA 5EOWA 1KF6A 2EQ8A 3GMCA 4H4XA 2F5ZA 2BXSA 4J2WA 1PJ6A 2OAMA 2VQ7A 4LIIA 1JEHA 1PBBA 3QFAA 3K7QX 3F8RA 4X4JA 1ZDLA 3M12A 1NHQA 2E5VA 2BC0A 1D4CA 2GR3A 3VRDB 4DSHA 4O5UA 3QSSA 5BUKA 2C64A 2GV8A 5IQ1A 1Y56B 2R45A 3DK4A 4Y4MA 5IQ4A 1ONFA 4YWOA 2BK3A 2WETA 2Z5YA 1HYUA 3P4PA 4EIPA 2C3DA 1N1PA 3S61A 1H86A 3FG2P 4IA6A 1PJ5A 1JRZA 2WP6A 3IC9A 4FK1C 1GSNA 1FCDA 2R0PA 3SXIA 1BF3A 4ICYA 4IVOB 3UOYA 4MJWA 4YTPA 1YQ3A 2X8GA 3CPJG 1ZP0A 2XVJA 3DGZA 1PJ7A 4C77A 4AP3A 5U63A 3NG7X 4B1BA 3D8XA 1PBCA 2GF3A 3KKJA 4PABA 5JCMA 4HB9A 1OJCA 5L46A 3AE2A 3VR8A 3H8IA 1ZX9A 3ICSA 2BRYA 5JCKA 2XFPA 1E1MA 1GRHA 3UKAA 1PS9A 3B6DA 2O9ZA 4USQA 4J57A 3CMMA 2GB0A 4B68A 4YT0A 2B9XA 1O95A 1X31B 3K7TA 4A9WA 3NRNA 1MOKA 4K7ZA 1Q1WA 3SZCA 3VQRA 2FJEA 3SGLA 1GRBA 1D4DA 2APGA 3SQPA 1NDAA 4H4ZA 4J31A 4EQSA 2HQMA 3AEEA 3KA7A 3QVPA 3F8DA 4B63A 3NTDA 1FEAA 3VRBA 2YM2A 2WDQA 3GWDA 4J36A 5M0ZA 3RP8A 3G5SA 1JNRA 2B9YA 3DA1A 3NGCX 4NEVA 3AYIA 4YSXA 2YLRA 4K8DA 2XLSA 3GYXA 4A79A 2VVMA 2JAEA 2CFYA 2XFOA 3UKHA 4EQWA 1TDKA 4NTCA 3UOZA 2WDVA 1FECA 1D7YA 2GH5A 5HYMA 4K5RA 1SEZA 1BZLA 3ALLA 3SY4A 4H7UA 3DK8A 1PBEA 2TPRA 5KVIA 1ZOVA 3HYVA 5CQFA 2OLNA 4Z44A 3VRAA 5TR3A 4TLXA 1E1NA 1LV0A 1RYIA 2YAUA 4EMJA 3DH9A 2AQJA 2C67A 1EL8A 2YLWA 3EAOA 2XCGA 3IWAA 2ARDA 2XLPA 3P4RA 3CPHG 2WOWA 1IUSA 4JY2A 1BGJA 4OPLA 2NPXA 1K4QA 1OJAA 2PHHA 4H4RA 4B65A 2V5ZA 2ZBWA 3DJGX 3P4SA 4U8IA 3FIMB 2AR8A 3RNMA 1EL7A 1W4XA 4H2NA 2C66A 3SM8A 4BK1A 2NVKX 4NNJA 2IVDA 5KMQA 2GEWA 4TM0A 5ER0A 4Z2UA 1LVLA 1IUVA 3P4QA 2GR1A 4JNAA 4H4VA 4I59A 3BHFA 2H88A 1KNPA 1TDOA 2C3CA 1LTXR 3CNPA 1TDFA 4H2QA 3GWFA 3NN6X 2XVFA 2TMDA 1CJCA 3C4NA 2XVHA 3NIXA 1CJ4A 1H7XA 5C2TA 4JN9A 2GR2A 4YSYA 3L8KA 3NTAA 4U8NA 3LZXA 4OPGA 1KFYA 4EM4A 4Y4LA 4U8PA 2ZZBA 2JB1A 3CN8A 4GCMA 4H2RA 1OJDA 4GR1A 3T0KA 4HA6A 4H4QA 1D4EA 1PXBA 1Y0PA 3H4KA 3UOVA 1IUTA 1GRAA 1BGNA 2X99A 3T37A 2C76A 2DKIA 1GPEA 2WBAA 2YVFA 1F8WA 5J7XA 3REDA 3T14A 3AE4A 2XLTA 2JB3A 5FMHA 4FX9A 2OLOA 3AEFA 4H2PA 2CDUA 2WPCA 3CPIG 4A5LA 5KOXA 3KPKA 1B37A 1CF3A 2GQWA 2V6OA 2R4EA 1NHSA 2RABA 3UTGA 3LOVA 4YSHA 3NNEA 1GALA 2YG4A 4NZHA 4Z26A 3AEDA 3UTFA 2B9WA 2QAEA 4FDCB 4EQRA 1IUUA 3NHOX 4WX1A 1B4VA 1K0JA 2WS3A 4EMIA 3AEBA 4GAPA 4X9MA 3SFEA 3AE9A 1L0VA 3AXBA 2YVJA 4ZCCA 1UKVG 2R46A 5DBJA 1E1LA 5FS8A 3DK9A 4DSGA 2V3BA 2YG6A 3NYFA 4B66A 2I0ZA 4A65A 1V59A 1M6IA 3AD7B 1GV4A 3SZ0A 3D1CA 2JBVA 3I3LA 4RSLA 1TRBA 3CNJA 4CBQA 5KXJA 2CULA 1GESA 3NT6A 2IVEA 3PVCA 2GMHA 1CC6A 3QVRA 1KNRA 1YQ4A 2Z5XA 1NAAA 3DMEA 4II2A 2R4JA 3NK1X 1ZOYA 4U2TA 1KDGA 1NEKA 3NYEA 1IUXA 3LXDA 3RHAA 3JSKA 1JRYA 3H8LA 3QJ4A 4G6GA 2YLZA 3AYJA 2J3NA 3UKFA 4XXGA 2BABA 2C73A 3GYJA 2VVLA 2YVGA 2C72A 1S2YA 3HYWA 3UOXA 5JCNA 2WOIA 4UDPA 4WCTA 2VRLA 3EF6A 5FS6A 1PXAA 4UP3A 1DXLA 3CGBA 3KLJA 1N4WA 2Q0LA 3AE5A 3ADAB
chains in the Genus database with same CATH topology
1K0LA 3UKKA 5BULA 1XDIA 1E1KA 1CC2A 2OALA 4BK2A 1ZY8A 3SZFA 1RP0A 3ALJA 2WPFA 4Z43A 1YY5A 2YG5A 4II3A 1LJ1A 5EB5A 4Z24A 3F8PA 1GOSA 1EL5A 2XLRA 4REKA 4J34A 1PDHA 2BS2A 5FS7A 2VOUA 2XVEA 2YWLA 1QLBA 1DOEA 1NPXA 1Z6LA 4OPCA 2WESA 4YKGA 4JY3A 4RG4A 2R0CA 3DJJA 4XWZA 1NENA 3CNTA 1PHHA 3OZ2A 4OPDA 2YG3A 4C3YA 3T2KA 2XVIA 4K2XA 1M64A 2Q0KA 4X9NA 4CNKA 4U8KA 4IV9A 2BC1A 3DJEA 3SX6A 3CTYA 3GDNA 4GDPA 4EM3A 3P1WA 3Q6JA 2V3AA 3ZDNA 1H81A 4H4TA 3V76A 2BA9A 1EBDA 4Z25A 1F3PA 4OCGA 1BWCA 1KSSA 3R9UA 1JU2A 2BS4A 2XFUA 2VZ2A 3SFDA 1S2QA 3PS9A 2WPEA 4H4PA 1Q1RA 2DKHA 5EB4A 3ISHA 3SZWA 2RGHA 2XFQA 4IA5A 1S3EA 4BJZA 5KVHA 2V60A 2VVLG 1D7LA 1K0IA 2A87A 4TM1A 2X3NA 3G5RA 2C7GA 3AD9B 3O0HA 2X50A 5KMPA 4TM3A 3GRTA 4ADWA 2XDOA 4C5OA 4AT0A 1GEUA 2QCUA 3QSMA 1YKJA 2VRMA 4ZN0A 4YXDA 1FL2A 4D03A 2ACZA 5EBKA 3EANA 2WDRA 4U2LA 4JQ9A 2BXRA 4AOSA 4B64A 3GRSA 4H50A 2WQYA 1GETA 3T31A 3WE0A 1TYPA 2X8CA 3GMBA 1QO8A 4CY6A 4KX6A 5GRTA 1DJNA 3NH3X 4DGKA 2EQ9A 1GRGA 1H83A 3DJDA 4K5SA 4G9KA 3T2YA 1MO9A 2BYBA 3FPZA 4GDEA 4I58A 4NWZA 4A7AA 3K7MX 3IHGA 4Z2TA 3UKLA 5J60A 3AE1A 3VR9A 3ZYXA 3UKQA 4C74A 3GD4A 4A6NA 2YLTA 2EQ7A 4GRTA 2FJBA 2FJDA 2FBWA 3Q9TA 3M13A 4EMWA 2Q7VA 4CCQA 1GRFA 2X8HA 3E1TA 1CL0A 4U8LA 4CRTA 2YR6A 3GD3A 5IPYA 2WEUA 1N4UA 5HY5A 2BK4A 1RSGA 4DNAA 1MXTA 3ICTA 2GRTA 4EQXA 3BI4A 1B5QA 1LQUA 3CGDA 1L9CA 3NK0X 2JK6A 4CCRA 1TDEA 3GDPA 3K30A 4U2SA 1ZMDA 3CGCA 2YM1A 2GVCA 4RG3A 2OA1A 2BK5A 2XYOA 1H7WA 1DOBA 3QSEA 3AD8B 1ZKQA 2EQ6A 4NEWA 2VQBA 2H89A 4G6HA 4PAAA 3RP7A 2BS3A 1F8RA 1TYTA 2CVJA 1BKWA 1D5TA 1H84A 2BACA 3BNUA 4K22A 3PO7A 3CNDA 4E0VA 2YQUA 1JOAA 1OJ9A 3BI5A 3IHMA 2Y6RA 3HZLA 3II4A 1GT8A 4OPUA 3NYCA 4EIQA 2E4GA 1F6MA 2YR4A 4NTDA 4USRA 1DOCA 2GQFA 2C4CA 2A89A 3AE8A 4YKFA 5CKUA 5FS9A 5M10A 1L9EA 4GUVA 4TLZA 2JB2A 3AEAA 5GSNA 5BRTA 4H4SA 3KPFA 3G5QA 2PYXA 5U1OA 2Y6QA 1PXCA 2A8XA 3P9UA 2GAGB 3ICRA 4Y4NA 3UKPA 3URHA 1OJTA 4ZCDA 3M0OA 3ATQA 4CNJA 1ZK7A 1VQWA 4O5QA 5BVAA 4UDQA 4OVIA 3S5WA 2Q6UA 3V3NA 4GAVA 2BCGG 4LU6A 1NG4A 1VG9A 1IJHA 4M52A 1EL9A 3UP5A 1CC4A 4J33A 4BJYA 1DJQA 2RGJA 3ITJA 3AE7A 4IVMB 4AP1A 4A6NB 4BURA 1LPFA 1E39A 2XLUA 2BRAA 1VDCA 4BK3A 3NLCA 4U8MA 3CNSA 1Q9IA 4G74A 4KPRA 2ZZ0A 2B7SA 3LZWA 3NK2X 1KSUA 2YR5A 2GAHB 3UTHA 3B3RA 1GXFA 4JDRA 2YG7A 4CY8A 1ELIA 3CIRA 1PBDA 4G73A 5U25A 1LQTA 2W0HA 3SYIA 5KMRA 1XANA 1NHPA 3C96A 1CBOA 1GREA 3AB1A 3AECA 1IUWA 2RGOA 1F8SA 1B8SA 3ATRA 5KNLA 4H4YA 3UP4A 2WP5A 1PBFA 1YQZA 5HHFA 3UTEA 3NKSA 2ZZCA 3ABVA 3LJPA 4LA1A 1VG0A 2YLXA 1QJDA 1GTEA 2YLSA 2QA1A 3I6DA 2IIDA 3AEGA 4APNA 3FMWA 3BI2A 4B67A 1GERA 1GNDA 1CJ2A 2B76A 3AYLA 4YSZA 1TDNA 1P2EA 3LB8A 2WP9A 5KOWA 3KD9A 4H4UA 1Y56A 3EPTA 4GF7A 4J56A 5C3JA 1L9DA 3AE6A 2QA2A 3L1RA 3IF9A 3LADA 1FEBA 2GR0A 3COXA 1E6EA 2R9ZA 4UDRA 1COYA 2JKCA 2GMJA 4H4WA 1REOA 2AAQA 4OPIA 2C75A 1DNCA 2UZZA 2C70A 4Z2RA 3KVEA 4U8OA 5KMSA 3RP6A 4A99A 3AE3A 4BV6A 4FK1A 4D04A 3HYXA 2WHDA 4NTEA 4YTNA 3GSIA 2XFNA 4XWRA 3CGEA 3UCLA 1H82A 1O94A 3KU9A 1NG3A 1N4VA 1XHCA 4AOXA 1JRXA 5LV9A 1FOHA 1XPQA 1GRTA 3OC4A 3T2ZA 3BHKA 4C3XA 1VRQB 3QFBA 2R0GA 1JNZA 1CHUA 1PN0A 2C65A 2FJAA 4AT2A 5HXIA 4JNQA 4N9XA 4ECHA 3C4AA 1CJ3A 2BCPA 2WOVA 3ALMA 3AWIA 3V3OA 4B69A 4YTMA 1NHRA 1ZMCA 3BNMA 3NN0X 4P9SA 2WU5A 3FBSA 1GTHA 1H6VA 1E7PA 5KRQA 1AOGA 1DODA 1S3BA 3DGHA 1O5WA 5KWFA 3GYIA 1P2HA 5JCLA 2B7RA 4TM4A 4U8JA 5JCIA 2V61A 2WU2A 2E1MA 4OPTA 5EOWA 1KF6A 2EQ8A 3GMCA 4H4XA 2F5ZA 2BXSA 4J2WA 1PJ6A 2OAMA 2VQ7A 4LIIA 1JEHA 1PBBA 3QFAA 3K7QX 3F8RA 4X4JA 1ZDLA 3M12A 1NHQA 2E5VA 2BC0A 1D4CA 2GR3A 3VRDB 4DSHA 4O5UA 3QSSA 5BUKA 2C64A 2GV8A 5IQ1A 1Y56B 2R45A 3DK4A 4Y4MA 5IQ4A 1ONFA 4YWOA 2BK3A 2WETA 2Z5YA 1HYUA 3P4PA 4EIPA 2C3DA 1N1PA 3S61A 1H86A 3FG2P 4IA6A 1PJ5A 1JRZA 2WP6A 3IC9A 4FK1C 1GSNA 1FCDA 2R0PA 3SXIA 1BF3A 4ICYA 4IVOB 3UOYA 4MJWA 4YTPA 1YQ3A 2X8GA 3CPJG 1ZP0A 2XVJA 3DGZA 1PJ7A 4C77A 4AP3A 5U63A 3NG7X 4B1BA 3D8XA 1PBCA 2GF3A 3KKJA 4PABA 5JCMA 4HB9A 1OJCA 5L46A 3AE2A 3VR8A 3H8IA 1ZX9A 3ICSA 2BRYA 5JCKA 2XFPA 1E1MA 1GRHA 3UKAA 1PS9A 3B6DA 2O9ZA 4USQA 4J57A 3CMMA 2GB0A 4B68A 4YT0A 2B9XA 1O95A 1X31B 3K7TA 4A9WA 3NRNA 1MOKA 4K7ZA 1Q1WA 3SZCA 3VQRA 2FJEA 3SGLA 1GRBA 1D4DA 2APGA 3SQPA 1NDAA 4H4ZA 4J31A 4EQSA 2HQMA 3AEEA 3KA7A 3QVPA 3F8DA 4B63A 3NTDA 1FEAA 3VRBA 2YM2A 2WDQA 3GWDA 4J36A 5M0ZA 3RP8A 3G5SA 1JNRA 2B9YA 3DA1A 3NGCX 4NEVA 3AYIA 4YSXA 2YLRA 4K8DA 2XLSA 3GYXA 4A79A 2VVMA 2JAEA 2CFYA 2XFOA 3UKHA 4EQWA 1TDKA 4NTCA 3UOZA 2WDVA 1FECA 1D7YA 2GH5A 5HYMA 4K5RA 1SEZA 1BZLA 3ALLA 3SY4A 4H7UA 3DK8A 1PBEA 2TPRA 5KVIA 1ZOVA 3HYVA 5CQFA 2OLNA 4Z44A 3VRAA 5TR3A 4TLXA 1E1NA 1LV0A 1RYIA 2YAUA 4EMJA 3DH9A 2AQJA 2C67A 1EL8A 2YLWA 3EAOA 2XCGA 3IWAA 2ARDA 2XLPA 3P4RA 3CPHG 2WOWA 1IUSA 4JY2A 1BGJA 4OPLA 2NPXA 1K4QA 1OJAA 2PHHA 4H4RA 4B65A 2V5ZA 2ZBWA 3DJGX 3P4SA 4U8IA 3FIMB 2AR8A 3RNMA 1EL7A 1W4XA 4H2NA 2C66A 3SM8A 4BK1A 2NVKX 4NNJA 2IVDA 5KMQA 2GEWA 4TM0A 5ER0A 4Z2UA 1LVLA 1IUVA 3P4QA 2GR1A 4JNAA 4H4VA 4I59A 3BHFA 2H88A 1KNPA 1TDOA 2C3CA 1LTXR 3CNPA 1TDFA 4H2QA 3GWFA 3NN6X 2XVFA 2TMDA 1CJCA 3C4NA 2XVHA 3NIXA 1CJ4A 1H7XA 5C2TA 4JN9A 2GR2A 4YSYA 3L8KA 3NTAA 4U8NA 3LZXA 4OPGA 1KFYA 4EM4A 4Y4LA 4U8PA 2ZZBA 2JB1A 3CN8A 4GCMA 4H2RA 1OJDA 4GR1A 3T0KA 4HA6A 4H4QA 1D4EA 1PXBA 1Y0PA 3H4KA 3UOVA 1IUTA 1GRAA 1BGNA 2X99A 3T37A 2C76A 2DKIA 1GPEA 2WBAA 2YVFA 1F8WA 5J7XA 3REDA 3T14A 3AE4A 2XLTA 2JB3A 5FMHA 4FX9A 2OLOA 3AEFA 4H2PA 2CDUA 2WPCA 3CPIG 4A5LA 5KOXA 3KPKA 1B37A 1CF3A 2GQWA 2V6OA 2R4EA 1NHSA 2RABA 3UTGA 3LOVA 4YSHA 3NNEA 1GALA 2YG4A 4NZHA 4Z26A 3AEDA 3UTFA 2B9WA 2QAEA 4FDCB 4EQRA 1IUUA 3NHOX 4WX1A 1B4VA 1K0JA 2WS3A 4EMIA 3AEBA 4GAPA 4X9MA 3SFEA 3AE9A 1L0VA 3AXBA 2YVJA 4ZCCA 1UKVG 2R46A 5DBJA 1E1LA 5FS8A 3DK9A 4DSGA 2V3BA 2YG6A 3NYFA 4B66A 2I0ZA 4A65A 1V59A 1M6IA 3AD7B 1GV4A 3SZ0A 3D1CA 2JBVA 3I3LA 4RSLA 1TRBA 3CNJA 4CBQA 5KXJA 2CULA 1GESA 3NT6A 2IVEA 3PVCA 2GMHA 1CC6A 3QVRA 1KNRA 1YQ4A 2Z5XA 1NAAA 3DMEA 4II2A 2R4JA 3NK1X 1ZOYA 4U2TA 1KDGA 1NEKA 3NYEA 1IUXA 3LXDA 3RHAA 3JSKA 1JRYA 3H8LA 3QJ4A 4G6GA 2YLZA 3AYJA 2J3NA 3UKFA 4XXGA 2BABA 2C73A 3GYJA 2VVLA 2YVGA 2C72A 1S2YA 3HYWA 3UOXA 5JCNA 2WOIA 4UDPA 4WCTA 2VRLA 3EF6A 5FS6A 1PXAA 4UP3A 1DXLA 3CGBA 3KLJA 1N4WA 2Q0LA 3AE5A 3ADAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0L A;  3UKK A;  5BUL A;  1XDI A;  1E1K A;  1CC2 A;  2OAL A;  4BK2 A;  1ZY8 A;  4Z43 A;  1RP0 A;  3ALJ A;  2WPF A;  1YY5 A;  2YG5 A;  5EB5 A;  1LJ1 A;  4Z24 A;  3F8P A;  1GOS A;  1EL5 A;  2XLR A;  4REK A;  4J34 A;  1PDH A;  2BS2 A;  5FS7 A;  2VOU A;  2XVE A;  2YWL A;  1QLB A;  1DOE A;  1NPX A;  1Z6L A;  4OPC A;  2WES A;  4YKG A;  4JY3 A;  4RG4 A;  2R0C A;  3DJJ A;  4XWZ A;  1NEN A;  3CNT A;  1PHH A;  3OZ2 A;  4OPD A;  2YG3 A;  4C3Y A;  2XVI A;  4K2X A;  1M64 A;  2Q0K A;  4X9N A;  4CNK A;  4U8K A;  4IV9 A;  2BC1 A;  3DJE A;  3CTY A;  3GDN A;  4GDP A;  4EM3 A;  3P1W A;  3Q6J A;  2V3A A;  3ZDN A;  1H81 A;  4H4T A;  3V76 A;  2BA9 A;  1EBD A;  4Z25 A;  1F3P A;  4OCG A;  1BWC A;  1KSS A;  3R9U A;  1JU2 A;  2BS4 A;  2XFU A;  2VZ2 A;  3SFD A;  1S2Q A;  3PS9 A;  2WPE A;  4H4P A;  1Q1R A;  2DKH A;  5EB4 A;  3ISH A;  2RGH A;  2XFQ A;  4IA5 A;  1S3E A;  4BJZ A;  5KVH A;  2V60 A;  2VVL G;  1D7L A;  1K0I A;  2A87 A;  4TM1 A;  2X3N A;  3G5R A;  2C7G A;  3AD9 B;  3O0H A;  2X50 A;  4TM3 A;  3GRT A;  4ADW A;  2XDO A;  4C5O A;  4AT0 A;  1GEU A;  2QCU A;  3QSM A;  1YKJ A;  2VRM A;  4ZN0 A;  4YXD A;  1FL2 A;  4D03 A;  2ACZ A;  5EBK A;  3EAN A;  2WDR A;  4U2L A;  4JQ9 A;  2BXR A;  4AOS A;  4B64 A;  3GRS A;  4H50 A;  2WQY A;  1GET A;  3WE0 A;  1TYP A;  2X8C A;  3GMB A;  1QO8 A;  4CY6 A;  4KX6 A;  5GRT A;  1DJN A;  3NH3 X;  4DGK A;  2EQ9 A;  1GRG A;  1H83 A;  3DJD A;  4K5S A;  1MO9 A;  2BYB A;  3FPZ A;  4GDE A;  4I58 A;  4A7A A;  3K7M X;  3IHG A;  4Z2T A;  3UKL A;  5J60 A;  3AE1 A;  3VR9 A;  3ZYX A;  3UKQ A;  4C74 A;  3GD4 A;  4A6N A;  2YLT A;  2EQ7 A;  4GRT A;  2FJB A;  2FJD A;  2FBW A;  3Q9T A;  3M13 A;  4EMW A;  2Q7V A;  4CCQ A;  1GRF A;  2X8H A;  3E1T A;  1CL0 A;  4U8L A;  4CRT A;  2YR6 A;  3GD3 A;  5IPY A;  2WEU A;  1N4U A;  5HY5 A;  2BK4 A;  1RSG A;  4DNA A;  1MXT A;  3ICT A;  2GRT A;  4EQX A;  3BI4 A;  1B5Q A;  1LQU A;  3CGD A;  1L9C A;  3NK0 X;  2JK6 A;  4CCR A;  1TDE A;  3GDP A;  3K30 A;  4U2S A;  1ZMD A;  3CGC A;  2YM1 A;  2GVC A;  4RG3 A;  2OA1 A;  2BK5 A;  2XYO A;  1H7W A;  1DOB A;  3QSE A;  3AD8 B;  1ZKQ A;  2EQ6 A;  4NEW A;  2VQB A;  2H89 A;  4PAA A;  3RP7 A;  2BS3 A;  1F8R A;  1TYT A;  2CVJ A;  1BKW A;  1D5T A;  1H84 A;  2BAC A;  3BNU A;  4K22 A;  3PO7 A;  3CND A;  4E0V A;  2YQU A;  1JOA A;  1OJ9 A;  3BI5 A;  3IHM A;  2Y6R A;  3HZL A;  3II4 A;  1GT8 A;  4OPU A;  3NYC A;  4EIQ A;  2E4G A;  1F6M A;  2YR4 A;  4NTD A;  4USR A;  1DOC A;  2GQF A;  2A89 A;  3AE8 A;  4YKF A;  5CKU A;  5FS9 A;  5M10 A;  1L9E A;  4GUV A;  4TLZ A;  2JB2 A;  3AEA A;  5GSN A;  5BRT A;  4H4S A;  3KPF A;  3G5Q A;  2PYX A;  5U1O A;  2Y6Q A;  1PXC A;  2A8X A;  3P9U A;  2GAG B;  3ICR A;  4Y4N A;  3UKP A;  3URH A;  1OJT A;  4ZCD A;  3M0O A;  3ATQ A;  4CNJ A;  1ZK7 A;  1VQW A;  4O5Q A;  5BVA A;  4UDQ A;  4OVI A;  3S5W A;  2Q6U A;  3V3N A;  4YSX A;  2BCG G;  4LU6 A;  1NG4 A;  1VG9 A;  1IJH A;  4M52 A;  1EL9 A;  3UP5 A;  1CC4 A;  4J33 A;  4BJY A;  1DJQ A;  2RGJ A;  3ITJ A;  3AE7 A;  4IVM B;  4AP1 A;  4A6N B;  4BUR A;  1LPF A;  1E39 A;  2XLU A;  1VDC A;  4BK3 A;  3NLC A;  4U8M A;  3CNS A;  1Q9I A;  4KPR A;  2ZZ0 A;  2B7S A;  3LZW A;  3NK2 X;  1KSU A;  2YR5 A;  2GAH B;  3UTH A;  3B3R A;  1GXF A;  4JDR A;  2YG7 A;  4CY8 A;  1ELI A;  3CIR A;  1PBD A;  5U25 A;  1LQT A;  2W0H A;  1XAN A;  1NHP A;  3C96 A;  1CBO A;  1GRE A;  3AB1 A;  3AEC A;  1IUW A;  2RGO A;  1F8S A;  1B8S A;  3ATR A;  4H4Y A;  3UP4 A;  2WP5 A;  1PBF A;  1YQZ A;  5HHF A;  3UTE A;  3NKS A;  2ZZC A;  3ABV A;  3LJP A;  4LA1 A;  1VG0 A;  2YLX A;  1QJD A;  1GTE A;  2YLS A;  2QA1 A;  3I6D A;  2IID A;  3AEG A;  4APN A;  3FMW A;  3BI2 A;  4B67 A;  1GER A;  1GND A;  1CJ2 A;  2B76 A;  3AYL A;  4YSZ A;  1TDN A;  1P2E A;  3LB8 A;  2WP9 A;  5KOW A;  3KD9 A;  4H4U A;  1Y56 A;  3EPT A;  4GF7 A;  4J56 A;  5C3J A;  1L9D A;  3AE6 A;  2QA2 A;  3L1R A;  3IF9 A;  3LAD A;  1FEB A;  2GR0 A;  3COX A;  1E6E A;  2R9Z A;  4UDR A;  1COY A;  2JKC A;  2GMJ A;  4H4W A;  1REO A;  2AAQ A;  4OPI A;  2C75 A;  1DNC A;  2UZZ A;  2C70 A;  4Z2R A;  3KVE A;  4U8O A;  3RP6 A;  4A99 A;  3AE3 A;  4BV6 A;  4FK1 A;  4D04 A;  2WHD A;  4NTE A;  4YTN A;  3GSI A;  2XFN A;  4XWR A;  3CGE A;  3UCL A;  1H82 A;  1O94 A;  3KU9 A;  1NG3 A;  1N4V A;  1XHC A;  4AOX A;  1JRX A;  5LV9 A;  1FOH A;  1XPQ A;  1GRT A;  3OC4 A;  4C3X A;  3BHK A;  1VRQ B;  3QFB A;  2R0G A;  1JNZ A;  1CHU A;  1PN0 A;  2C65 A;  2FJA A;  4AT2 A;  5HXI A;  4JNQ A;  4N9X A;  4ECH A;  3C4A A;  1CJ3 A;  2BCP A;  2WOV A;  3ALM A;  3AWI A;  3V3O A;  4B69 A;  4YTM A;  1NHR A;  1ZMC A;  3BNM A;  3NN0 X;  4P9S A;  2WU5 A;  3FBS A;  1GTH A;  1H6V A;  1E7P A;  5KRQ A;  1AOG A;  1DOD A;  1S3B A;  3DGH A;  1O5W A;  5KWF A;  3GYI A;  1P2H A;  5JCL A;  2B7R A;  4TM4 A;  4U8J A;  5JCI A;  2V61 A;  2WU2 A;  2E1M A;  4OPT A;  5EOW A;  1KF6 A;  2EQ8 A;  3GMC A;  4H4X A;  2F5Z A;  2BXS A;  4J2W A;  1PJ6 A;  2OAM A;  2VQ7 A;  4LII A;  1JEH A;  1PBB A;  3QFA A;  3K7Q X;  3F8R A;  4X4J A;  1ZDL A;  3M12 A;  1NHQ A;  2E5V A;  2BC0 A;  1D4C A;  2GR3 A;  3VRD B;  4DSH A;  4O5U A;  3QSS A;  5BUK A;  2C64 A;  2GV8 A;  5IQ1 A;  1Y56 B;  2R45 A;  3DK4 A;  4Y4M A;  5IQ4 A;  1ONF A;  4YWO A;  2BK3 A;  2WET A;  2Z5Y A;  1HYU A;  3P4P A;  4EIP A;  2C3D A;  1N1P A;  3S61 A;  1H86 A;  3FG2 P;  4IA6 A;  1PJ5 A;  1JRZ A;  2WP6 A;  3IC9 A;  4FK1 C;  1GSN A;  1FCD A;  2R0P A;  1BF3 A;  4ICY A;  4IVO B;  3UOY A;  4MJW A;  4YTP A;  1YQ3 A;  2X8G A;  3CPJ G;  1ZP0 A;  2XVJ A;  3DGZ A;  1PJ7 A;  4C77 A;  4AP3 A;  5U63 A;  3NG7 X;  4B1B A;  3D8X A;  1PBC A;  2GF3 A;  3KKJ A;  4PAB A;  5JCM A;  4HB9 A;  1OJC A;  5L46 A;  3AE2 A;  3VR8 A;  3H8I A;  1ZX9 A;  3ICS A;  5JCK A;  2XFP A;  1E1M A;  1GRH A;  3UKA A;  1PS9 A;  3B6D A;  2O9Z A;  4USQ A;  4J57 A;  2GB0 A;  4B68 A;  4YT0 A;  2B9X A;  1O95 A;  1X31 B;  3K7T A;  4A9W A;  3NRN A;  1MOK A;  4K7Z A;  1Q1W A;  3VQR A;  2FJE A;  3SGL A;  1GRB A;  1D4D A;  2APG A;  3SQP A;  1NDA A;  4H4Z A;  4J31 A;  4EQS A;  2HQM A;  3AEE A;  3KA7 A;  3QVP A;  3F8D A;  4B63 A;  3NTD A;  1FEA A;  3VRB A;  2YM2 A;  2WDQ A;  3GWD A;  4J36 A;  5M0Z A;  3RP8 A;  3G5S A;  1JNR A;  2B9Y A;  3DA1 A;  3NGC X;  4NEV A;  3AYI A;  2YLR A;  4K8D A;  2XLS A;  4A79 A;  2VVM A;  2JAE A;  2CFY A;  2XFO A;  3UKH A;  4EQW A;  1TDK A;  4NTC A;  3UOZ A;  2WDV A;  1FEC A;  1D7Y A;  2GH5 A;  5HYM A;  4K5R A;  1SEZ A;  1BZL A;  3ALL A;  4H7U A;  3DK8 A;  1PBE A;  2TPR A;  5KVI A;  1ZOV A;  5CQF A;  2OLN A;  4Z44 A;  3VRA A;  5TR3 A;  4TLX A;  1E1N A;  1LV0 A;  1RYI A;  2YAU A;  4EMJ A;  3DH9 A;  2AQJ A;  2C67 A;  1EL8 A;  2YLW A;  3EAO A;  2XCG A;  3IWA A;  2ARD A;  2XLP A;  3P4R A;  3CPH G;  2WOW A;  1IUS A;  4JY2 A;  1BGJ A;  4OPL A;  2NPX A;  1K4Q A;  1OJA A;  2PHH A;  4H4R A;  4B65 A;  2V5Z A;  2ZBW A;  3DJG X;  3P4S A;  4U8I A;  3FIM B;  2AR8 A;  3RNM A;  1EL7 A;  1W4X A;  4H2N A;  2C66 A;  3SM8 A;  4BK1 A;  2NVK X;  2IVD A;  2GEW A;  4TM0 A;  5ER0 A;  4Z2U A;  1LVL A;  1IUV A;  3P4Q A;  2GR1 A;  4JNA A;  4H4V A;  4I59 A;  3BHF A;  2H88 A;  1KNP A;  1TDO A;  2C3C A;  1LTX R;  3CNP A;  1TDF A;  4H2Q A;  3GWF A;  3NN6 X;  2XVF A;  2TMD A;  1CJC A;  3C4N A;  2XVH A;  3NIX A;  1CJ4 A;  1H7X A;  5C2T A;  4JN9 A;  2GR2 A;  4YSY A;  3L8K A;  3NTA A;  4U8N A;  3LZX A;  4OPG A;  1KFY A;  4EM4 A;  4Y4L A;  4U8P A;  2ZZB A;  2JB1 A;  3CN8 A;  4GCM A;  4H2R A;  1OJD A;  4GR1 A;  4HA6 A;  4H4Q A;  1D4E A;  1PXB A;  1Y0P A;  3H4K A;  3UOV A;  1IUT A;  1GRA A;  1BGN A;  2X99 A;  3T37 A;  2C76 A;  2DKI A;  1GPE A;  2WBA A;  2YVF A;  1F8W A;  5J7X A;  3RED A;  3AE4 A;  2XLT A;  2JB3 A;  5FMH A;  4FX9 A;  2OLO A;  3AEF A;  4H2P A;  2CDU A;  2WPC A;  3CPI G;  4A5L A;  5KOX A;  1B37 A;  1CF3 A;  2GQW A;  2V6O A;  2R4E A;  1NHS A;  2RAB A;  3UTG A;  3LOV A;  4YSH A;  3NNE A;  1GAL A;  2YG4 A;  4NZH A;  4Z26 A;  3AED A;  3UTF A;  2B9W A;  2QAE A;  4FDC B;  4EQR A;  1IUU A;  3NHO X;  4WX1 A;  1B4V A;  1K0J A;  2WS3 A;  4EMI A;  3AEB A;  4X9M A;  3SFE A;  3AE9 A;  1L0V A;  3AXB A;  2YVJ A;  4ZCC A;  1UKV G;  2R46 A;  5DBJ A;  1E1L A;  5FS8 A;  3DK9 A;  4DSG A;  2V3B A;  2YG6 A;  3NYF A;  4B66 A;  2I0Z A;  4A65 A;  1V59 A;  1M6I A;  3AD7 B;  1GV4 A;  3D1C A;  2JBV A;  3I3L A;  4RSL A;  1TRB A;  3CNJ A;  4CBQ A;  5KXJ A;  2CUL A;  1GES A;  3NT6 A;  2IVE A;  3PVC A;  2GMH A;  1CC6 A;  3QVR A;  1KNR A;  1YQ4 A;  2Z5X A;  1NAA A;  3DME A;  2R4J A;  3NK1 X;  1ZOY A;  4U2T A;  1KDG A;  1NEK A;  3NYE A;  1IUX A;  3LXD A;  3RHA A;  3JSK A;  1JRY A;  3H8L A;  3QJ4 A;  2YLZ A;  3AYJ A;  2J3N A;  3UKF A;  4XXG A;  2BAB A;  2C73 A;  3GYJ A;  2VVL A;  2YVG A;  2C72 A;  1S2Y A;  3UOX A;  5JCN A;  2WOI A;  4UDP A;  4WCT A;  2VRL A;  3EF6 A;  5FS6 A;  1PXA A;  4UP3 A;  1DXL A;  3CGB A;  3KLJ A;  1N4W A;  2Q0L A;  3AE5 A;  3ADA B; 
#chains in the Genus database with same CATH topology
 1K0L A;  3UKK A;  5BUL A;  1XDI A;  1E1K A;  1CC2 A;  2OAL A;  4BK2 A;  1ZY8 A;  3SZF A;  1RP0 A;  3ALJ A;  2WPF A;  4Z43 A;  1YY5 A;  2YG5 A;  4II3 A;  1LJ1 A;  5EB5 A;  4Z24 A;  3F8P A;  1GOS A;  1EL5 A;  2XLR A;  4REK A;  4J34 A;  1PDH A;  2BS2 A;  5FS7 A;  2VOU A;  2XVE A;  2YWL A;  1QLB A;  1DOE A;  1NPX A;  1Z6L A;  4OPC A;  2WES A;  4YKG A;  4JY3 A;  4RG4 A;  2R0C A;  3DJJ A;  4XWZ A;  1NEN A;  3CNT A;  1PHH A;  3OZ2 A;  4OPD A;  2YG3 A;  4C3Y A;  3T2K A;  2XVI A;  4K2X A;  1M64 A;  2Q0K A;  4X9N A;  4CNK A;  4U8K A;  4IV9 A;  2BC1 A;  3DJE A;  3SX6 A;  3CTY A;  3GDN A;  4GDP A;  4EM3 A;  3P1W A;  3Q6J A;  2V3A A;  3ZDN A;  1H81 A;  4H4T A;  3V76 A;  2BA9 A;  1EBD A;  4Z25 A;  1F3P A;  4OCG A;  1BWC A;  1KSS A;  3R9U A;  1JU2 A;  2BS4 A;  2XFU A;  2VZ2 A;  3SFD A;  1S2Q A;  3PS9 A;  2WPE A;  4H4P A;  1Q1R A;  2DKH A;  5EB4 A;  3ISH A;  3SZW A;  2RGH A;  2XFQ A;  4IA5 A;  1S3E A;  4BJZ A;  5KVH A;  2V60 A;  2VVL G;  1D7L A;  1K0I A;  2A87 A;  4TM1 A;  2X3N A;  3G5R A;  2C7G A;  3AD9 B;  3O0H A;  2X50 A;  5KMP A;  4TM3 A;  3GRT A;  4ADW A;  2XDO A;  4C5O A;  4AT0 A;  1GEU A;  2QCU A;  3QSM A;  1YKJ A;  2VRM A;  4ZN0 A;  4YXD A;  1FL2 A;  4D03 A;  2ACZ A;  5EBK A;  3EAN A;  2WDR A;  4U2L A;  4JQ9 A;  2BXR A;  4AOS A;  4B64 A;  3GRS A;  4H50 A;  2WQY A;  1GET A;  3T31 A;  3WE0 A;  1TYP A;  2X8C A;  3GMB A;  1QO8 A;  4CY6 A;  4KX6 A;  5GRT A;  1DJN A;  3NH3 X;  4DGK A;  2EQ9 A;  1GRG A;  1H83 A;  3DJD A;  4K5S A;  4G9K A;  3T2Y A;  1MO9 A;  2BYB A;  3FPZ A;  4GDE A;  4I58 A;  4NWZ A;  4A7A A;  3K7M X;  3IHG A;  4Z2T A;  3UKL A;  5J60 A;  3AE1 A;  3VR9 A;  3ZYX A;  3UKQ A;  4C74 A;  3GD4 A;  4A6N A;  2YLT A;  2EQ7 A;  4GRT A;  2FJB A;  2FJD A;  2FBW A;  3Q9T A;  3M13 A;  4EMW A;  2Q7V A;  4CCQ A;  1GRF A;  2X8H A;  3E1T A;  1CL0 A;  4U8L A;  4CRT A;  2YR6 A;  3GD3 A;  5IPY A;  2WEU A;  1N4U A;  5HY5 A;  2BK4 A;  1RSG A;  4DNA A;  1MXT A;  3ICT A;  2GRT A;  4EQX A;  3BI4 A;  1B5Q A;  1LQU A;  3CGD A;  1L9C A;  3NK0 X;  2JK6 A;  4CCR A;  1TDE A;  3GDP A;  3K30 A;  4U2S A;  1ZMD A;  3CGC A;  2YM1 A;  2GVC A;  4RG3 A;  2OA1 A;  2BK5 A;  2XYO A;  1H7W A;  1DOB A;  3QSE A;  3AD8 B;  1ZKQ A;  2EQ6 A;  4NEW A;  2VQB A;  2H89 A;  4G6H A;  4PAA A;  3RP7 A;  2BS3 A;  1F8R A;  1TYT A;  2CVJ A;  1BKW A;  1D5T A;  1H84 A;  2BAC A;  3BNU A;  4K22 A;  3PO7 A;  3CND A;  4E0V A;  2YQU A;  1JOA A;  1OJ9 A;  3BI5 A;  3IHM A;  2Y6R A;  3HZL A;  3II4 A;  1GT8 A;  4OPU A;  3NYC A;  4EIQ A;  2E4G A;  1F6M A;  2YR4 A;  4NTD A;  4USR A;  1DOC A;  2GQF A;  2C4C A;  2A89 A;  3AE8 A;  4YKF A;  5CKU A;  5FS9 A;  5M10 A;  1L9E A;  4GUV A;  4TLZ A;  2JB2 A;  3AEA A;  5GSN A;  5BRT A;  4H4S A;  3KPF A;  3G5Q A;  2PYX A;  5U1O A;  2Y6Q A;  1PXC A;  2A8X A;  3P9U A;  2GAG B;  3ICR A;  4Y4N A;  3UKP A;  3URH A;  1OJT A;  4ZCD A;  3M0O A;  3ATQ A;  4CNJ A;  1ZK7 A;  1VQW A;  4O5Q A;  5BVA A;  4UDQ A;  4OVI A;  3S5W A;  2Q6U A;  3V3N A;  4GAV A;  2BCG G;  4LU6 A;  1NG4 A;  1VG9 A;  1IJH A;  4M52 A;  1EL9 A;  3UP5 A;  1CC4 A;  4J33 A;  4BJY A;  1DJQ A;  2RGJ A;  3ITJ A;  3AE7 A;  4IVM B;  4AP1 A;  4A6N B;  4BUR A;  1LPF A;  1E39 A;  2XLU A;  2BRA A;  1VDC A;  4BK3 A;  3NLC A;  4U8M A;  3CNS A;  1Q9I A;  4G74 A;  4KPR A;  2ZZ0 A;  2B7S A;  3LZW A;  3NK2 X;  1KSU A;  2YR5 A;  2GAH B;  3UTH A;  3B3R A;  1GXF A;  4JDR A;  2YG7 A;  4CY8 A;  1ELI A;  3CIR A;  1PBD A;  4G73 A;  5U25 A;  1LQT A;  2W0H A;  3SYI A;  5KMR A;  1XAN A;  1NHP A;  3C96 A;  1CBO A;  1GRE A;  3AB1 A;  3AEC A;  1IUW A;  2RGO A;  1F8S A;  1B8S A;  3ATR A;  5KNL A;  4H4Y A;  3UP4 A;  2WP5 A;  1PBF A;  1YQZ A;  5HHF A;  3UTE A;  3NKS A;  2ZZC A;  3ABV A;  3LJP A;  4LA1 A;  1VG0 A;  2YLX A;  1QJD A;  1GTE A;  2YLS A;  2QA1 A;  3I6D A;  2IID A;  3AEG A;  4APN A;  3FMW A;  3BI2 A;  4B67 A;  1GER A;  1GND A;  1CJ2 A;  2B76 A;  3AYL A;  4YSZ A;  1TDN A;  1P2E A;  3LB8 A;  2WP9 A;  5KOW A;  3KD9 A;  4H4U A;  1Y56 A;  3EPT A;  4GF7 A;  4J56 A;  5C3J A;  1L9D A;  3AE6 A;  2QA2 A;  3L1R A;  3IF9 A;  3LAD A;  1FEB A;  2GR0 A;  3COX A;  1E6E A;  2R9Z A;  4UDR A;  1COY A;  2JKC A;  2GMJ A;  4H4W A;  1REO A;  2AAQ A;  4OPI A;  2C75 A;  1DNC A;  2UZZ A;  2C70 A;  4Z2R A;  3KVE A;  4U8O A;  5KMS A;  3RP6 A;  4A99 A;  3AE3 A;  4BV6 A;  4FK1 A;  4D04 A;  3HYX A;  2WHD A;  4NTE A;  4YTN A;  3GSI A;  2XFN A;  4XWR A;  3CGE A;  3UCL A;  1H82 A;  1O94 A;  3KU9 A;  1NG3 A;  1N4V A;  1XHC A;  4AOX A;  1JRX A;  5LV9 A;  1FOH A;  1XPQ A;  1GRT A;  3OC4 A;  3T2Z A;  3BHK A;  4C3X A;  1VRQ B;  3QFB A;  2R0G A;  1JNZ A;  1CHU A;  1PN0 A;  2C65 A;  2FJA A;  4AT2 A;  5HXI A;  4JNQ A;  4N9X A;  4ECH A;  3C4A A;  1CJ3 A;  2BCP A;  2WOV A;  3ALM A;  3AWI A;  3V3O A;  4B69 A;  4YTM A;  1NHR A;  1ZMC A;  3BNM A;  3NN0 X;  4P9S A;  2WU5 A;  3FBS A;  1GTH A;  1H6V A;  1E7P A;  5KRQ A;  1AOG A;  1DOD A;  1S3B A;  3DGH A;  1O5W A;  5KWF A;  3GYI A;  1P2H A;  5JCL A;  2B7R A;  4TM4 A;  4U8J A;  5JCI A;  2V61 A;  2WU2 A;  2E1M A;  4OPT A;  5EOW A;  1KF6 A;  2EQ8 A;  3GMC A;  4H4X A;  2F5Z A;  2BXS A;  4J2W A;  1PJ6 A;  2OAM A;  2VQ7 A;  4LII A;  1JEH A;  1PBB A;  3QFA A;  3K7Q X;  3F8R A;  4X4J A;  1ZDL A;  3M12 A;  1NHQ A;  2E5V A;  2BC0 A;  1D4C A;  2GR3 A;  3VRD B;  4DSH A;  4O5U A;  3QSS A;  5BUK A;  2C64 A;  2GV8 A;  5IQ1 A;  1Y56 B;  2R45 A;  3DK4 A;  4Y4M A;  5IQ4 A;  1ONF A;  4YWO A;  2BK3 A;  2WET A;  2Z5Y A;  1HYU A;  3P4P A;  4EIP A;  2C3D A;  1N1P A;  3S61 A;  1H86 A;  3FG2 P;  4IA6 A;  1PJ5 A;  1JRZ A;  2WP6 A;  3IC9 A;  4FK1 C;  1GSN A;  1FCD A;  2R0P A;  3SXI A;  1BF3 A;  4ICY A;  4IVO B;  3UOY A;  4MJW A;  4YTP A;  1YQ3 A;  2X8G A;  3CPJ G;  1ZP0 A;  2XVJ A;  3DGZ A;  1PJ7 A;  4C77 A;  4AP3 A;  5U63 A;  3NG7 X;  4B1B A;  3D8X A;  1PBC A;  2GF3 A;  3KKJ A;  4PAB A;  5JCM A;  4HB9 A;  1OJC A;  5L46 A;  3AE2 A;  3VR8 A;  3H8I A;  1ZX9 A;  3ICS A;  2BRY A;  5JCK A;  2XFP A;  1E1M A;  1GRH A;  3UKA A;  1PS9 A;  3B6D A;  2O9Z A;  4USQ A;  4J57 A;  3CMM A;  2GB0 A;  4B68 A;  4YT0 A;  2B9X A;  1O95 A;  1X31 B;  3K7T A;  4A9W A;  3NRN A;  1MOK A;  4K7Z A;  1Q1W A;  3SZC A;  3VQR A;  2FJE A;  3SGL A;  1GRB A;  1D4D A;  2APG A;  3SQP A;  1NDA A;  4H4Z A;  4J31 A;  4EQS A;  2HQM A;  3AEE A;  3KA7 A;  3QVP A;  3F8D A;  4B63 A;  3NTD A;  1FEA A;  3VRB A;  2YM2 A;  2WDQ A;  3GWD A;  4J36 A;  5M0Z A;  3RP8 A;  3G5S A;  1JNR A;  2B9Y A;  3DA1 A;  3NGC X;  4NEV A;  3AYI A;  4YSX A;  2YLR A;  4K8D A;  2XLS A;  3GYX A;  4A79 A;  2VVM A;  2JAE A;  2CFY A;  2XFO A;  3UKH A;  4EQW A;  1TDK A;  4NTC A;  3UOZ A;  2WDV A;  1FEC A;  1D7Y A;  2GH5 A;  5HYM A;  4K5R A;  1SEZ A;  1BZL A;  3ALL A;  3SY4 A;  4H7U A;  3DK8 A;  1PBE A;  2TPR A;  5KVI A;  1ZOV A;  3HYV A;  5CQF A;  2OLN A;  4Z44 A;  3VRA A;  5TR3 A;  4TLX A;  1E1N A;  1LV0 A;  1RYI A;  2YAU A;  4EMJ A;  3DH9 A;  2AQJ A;  2C67 A;  1EL8 A;  2YLW A;  3EAO A;  2XCG A;  3IWA A;  2ARD A;  2XLP A;  3P4R A;  3CPH G;  2WOW A;  1IUS A;  4JY2 A;  1BGJ A;  4OPL A;  2NPX A;  1K4Q A;  1OJA A;  2PHH A;  4H4R A;  4B65 A;  2V5Z A;  2ZBW A;  3DJG X;  3P4S A;  4U8I A;  3FIM B;  2AR8 A;  3RNM A;  1EL7 A;  1W4X A;  4H2N A;  2C66 A;  3SM8 A;  4BK1 A;  2NVK X;  4NNJ A;  2IVD A;  5KMQ A;  2GEW A;  4TM0 A;  5ER0 A;  4Z2U A;  1LVL A;  1IUV A;  3P4Q A;  2GR1 A;  4JNA A;  4H4V A;  4I59 A;  3BHF A;  2H88 A;  1KNP A;  1TDO A;  2C3C A;  1LTX R;  3CNP A;  1TDF A;  4H2Q A;  3GWF A;  3NN6 X;  2XVF A;  2TMD A;  1CJC A;  3C4N A;  2XVH A;  3NIX A;  1CJ4 A;  1H7X A;  5C2T A;  4JN9 A;  2GR2 A;  4YSY A;  3L8K A;  3NTA A;  4U8N A;  3LZX A;  4OPG A;  1KFY A;  4EM4 A;  4Y4L A;  4U8P A;  2ZZB A;  2JB1 A;  3CN8 A;  4GCM A;  4H2R A;  1OJD A;  4GR1 A;  3T0K A;  4HA6 A;  4H4Q A;  1D4E A;  1PXB A;  1Y0P A;  3H4K A;  3UOV A;  1IUT A;  1GRA A;  1BGN A;  2X99 A;  3T37 A;  2C76 A;  2DKI A;  1GPE A;  2WBA A;  2YVF A;  1F8W A;  5J7X A;  3RED A;  3T14 A;  3AE4 A;  2XLT A;  2JB3 A;  5FMH A;  4FX9 A;  2OLO A;  3AEF A;  4H2P A;  2CDU A;  2WPC A;  3CPI G;  4A5L A;  5KOX A;  3KPK A;  1B37 A;  1CF3 A;  2GQW A;  2V6O A;  2R4E A;  1NHS A;  2RAB A;  3UTG A;  3LOV A;  4YSH A;  3NNE A;  1GAL A;  2YG4 A;  4NZH A;  4Z26 A;  3AED A;  3UTF A;  2B9W A;  2QAE A;  4FDC B;  4EQR A;  1IUU A;  3NHO X;  4WX1 A;  1B4V A;  1K0J A;  2WS3 A;  4EMI A;  3AEB A;  4GAP A;  4X9M A;  3SFE A;  3AE9 A;  1L0V A;  3AXB A;  2YVJ A;  4ZCC A;  1UKV G;  2R46 A;  5DBJ A;  1E1L A;  5FS8 A;  3DK9 A;  4DSG A;  2V3B A;  2YG6 A;  3NYF A;  4B66 A;  2I0Z A;  4A65 A;  1V59 A;  1M6I A;  3AD7 B;  1GV4 A;  3SZ0 A;  3D1C A;  2JBV A;  3I3L A;  4RSL A;  1TRB A;  3CNJ A;  4CBQ A;  5KXJ A;  2CUL A;  1GES A;  3NT6 A;  2IVE A;  3PVC A;  2GMH A;  1CC6 A;  3QVR A;  1KNR A;  1YQ4 A;  2Z5X A;  1NAA A;  3DME A;  4II2 A;  2R4J A;  3NK1 X;  1ZOY A;  4U2T A;  1KDG A;  1NEK A;  3NYE A;  1IUX A;  3LXD A;  3RHA A;  3JSK A;  1JRY A;  3H8L A;  3QJ4 A;  4G6G A;  2YLZ A;  3AYJ A;  2J3N A;  3UKF A;  4XXG A;  2BAB A;  2C73 A;  3GYJ A;  2VVL A;  2YVG A;  2C72 A;  1S2Y A;  3HYW A;  3UOX A;  5JCN A;  2WOI A;  4UDP A;  4WCT A;  2VRL A;  3EF6 A;  5FS6 A;  1PXA A;  4UP3 A;  1DXL A;  3CGB A;  3KLJ A;  1N4W A;  2Q0L A;  3AE5 A;  3ADA B; 
#chains in the Genus database with same CATH homology
 1K0L A;  3UKK A;  5BUL A;  1XDI A;  1E1K A;  1CC2 A;  2OAL A;  4BK2 A;  1ZY8 A;  3SZF A;  1RP0 A;  3ALJ A;  2WPF A;  4Z43 A;  1YY5 A;  2YG5 A;  4II3 A;  1LJ1 A;  5EB5 A;  4Z24 A;  3F8P A;  1GOS A;  1EL5 A;  2XLR A;  4REK A;  4J34 A;  1PDH A;  2BS2 A;  5FS7 A;  2VOU A;  2XVE A;  2YWL A;  1QLB A;  1DOE A;  1NPX A;  1Z6L A;  4OPC A;  2WES A;  4YKG A;  4JY3 A;  4RG4 A;  2R0C A;  3DJJ A;  4XWZ A;  1NEN A;  3CNT A;  1PHH A;  3OZ2 A;  4OPD A;  2YG3 A;  4C3Y A;  3T2K A;  2XVI A;  4K2X A;  1M64 A;  2Q0K A;  4X9N A;  4CNK A;  4U8K A;  4IV9 A;  2BC1 A;  3DJE A;  3SX6 A;  3CTY A;  3GDN A;  4GDP A;  4EM3 A;  3P1W A;  3Q6J A;  2V3A A;  3ZDN A;  1H81 A;  4H4T A;  3V76 A;  2BA9 A;  1EBD A;  4Z25 A;  1F3P A;  4OCG A;  1BWC A;  1KSS A;  3R9U A;  1JU2 A;  2BS4 A;  2XFU A;  2VZ2 A;  3SFD A;  1S2Q A;  3PS9 A;  2WPE A;  4H4P A;  1Q1R A;  2DKH A;  5EB4 A;  3ISH A;  3SZW A;  2RGH A;  2XFQ A;  4IA5 A;  1S3E A;  4BJZ A;  5KVH A;  2V60 A;  2VVL G;  1D7L A;  1K0I A;  2A87 A;  4TM1 A;  2X3N A;  3G5R A;  2C7G A;  3AD9 B;  3O0H A;  2X50 A;  5KMP A;  4TM3 A;  3GRT A;  4ADW A;  2XDO A;  4C5O A;  4AT0 A;  1GEU A;  2QCU A;  3QSM A;  1YKJ A;  2VRM A;  4ZN0 A;  4YXD A;  1FL2 A;  4D03 A;  2ACZ A;  5EBK A;  3EAN A;  2WDR A;  4U2L A;  4JQ9 A;  2BXR A;  4AOS A;  4B64 A;  3GRS A;  4H50 A;  2WQY A;  1GET A;  3T31 A;  3WE0 A;  1TYP A;  2X8C A;  3GMB A;  1QO8 A;  4CY6 A;  4KX6 A;  5GRT A;  1DJN A;  3NH3 X;  4DGK A;  2EQ9 A;  1GRG A;  1H83 A;  3DJD A;  4K5S A;  4G9K A;  3T2Y A;  1MO9 A;  2BYB A;  3FPZ A;  4GDE A;  4I58 A;  4NWZ A;  4A7A A;  3K7M X;  3IHG A;  4Z2T A;  3UKL A;  5J60 A;  3AE1 A;  3VR9 A;  3ZYX A;  3UKQ A;  4C74 A;  3GD4 A;  4A6N A;  2YLT A;  2EQ7 A;  4GRT A;  2FJB A;  2FJD A;  2FBW A;  3Q9T A;  3M13 A;  4EMW A;  2Q7V A;  4CCQ A;  1GRF A;  2X8H A;  3E1T A;  1CL0 A;  4U8L A;  4CRT A;  2YR6 A;  3GD3 A;  5IPY A;  2WEU A;  1N4U A;  5HY5 A;  2BK4 A;  1RSG A;  4DNA A;  1MXT A;  3ICT A;  2GRT A;  4EQX A;  3BI4 A;  1B5Q A;  1LQU A;  3CGD A;  1L9C A;  3NK0 X;  2JK6 A;  4CCR A;  1TDE A;  3GDP A;  3K30 A;  4U2S A;  1ZMD A;  3CGC A;  2YM1 A;  2GVC A;  4RG3 A;  2OA1 A;  2BK5 A;  2XYO A;  1H7W A;  1DOB A;  3QSE A;  3AD8 B;  1ZKQ A;  2EQ6 A;  4NEW A;  2VQB A;  2H89 A;  4G6H A;  4PAA A;  3RP7 A;  2BS3 A;  1F8R A;  1TYT A;  2CVJ A;  1BKW A;  1D5T A;  1H84 A;  2BAC A;  3BNU A;  4K22 A;  3PO7 A;  3CND A;  4E0V A;  2YQU A;  1JOA A;  1OJ9 A;  3BI5 A;  3IHM A;  2Y6R A;  3HZL A;  3II4 A;  1GT8 A;  4OPU A;  3NYC A;  4EIQ A;  2E4G A;  1F6M A;  2YR4 A;  4NTD A;  4USR A;  1DOC A;  2GQF A;  2C4C A;  2A89 A;  3AE8 A;  4YKF A;  5CKU A;  5FS9 A;  5M10 A;  1L9E A;  4GUV A;  4TLZ A;  2JB2 A;  3AEA A;  5GSN A;  5BRT A;  4H4S A;  3KPF A;  3G5Q A;  2PYX A;  5U1O A;  2Y6Q A;  1PXC A;  2A8X A;  3P9U A;  2GAG B;  3ICR A;  4Y4N A;  3UKP A;  3URH A;  1OJT A;  4ZCD A;  3M0O A;  3ATQ A;  4CNJ A;  1ZK7 A;  1VQW A;  4O5Q A;  5BVA A;  4UDQ A;  4OVI A;  3S5W A;  2Q6U A;  3V3N A;  4GAV A;  2BCG G;  4LU6 A;  1NG4 A;  1VG9 A;  1IJH A;  4M52 A;  1EL9 A;  3UP5 A;  1CC4 A;  4J33 A;  4BJY A;  1DJQ A;  2RGJ A;  3ITJ A;  3AE7 A;  4IVM B;  4AP1 A;  4A6N B;  4BUR A;  1LPF A;  1E39 A;  2XLU A;  2BRA A;  1VDC A;  4BK3 A;  3NLC A;  4U8M A;  3CNS A;  1Q9I A;  4G74 A;  4KPR A;  2ZZ0 A;  2B7S A;  3LZW A;  3NK2 X;  1KSU A;  2YR5 A;  2GAH B;  3UTH A;  3B3R A;  1GXF A;  4JDR A;  2YG7 A;  4CY8 A;  1ELI A;  3CIR A;  1PBD A;  4G73 A;  5U25 A;  1LQT A;  2W0H A;  3SYI A;  5KMR A;  1XAN A;  1NHP A;  3C96 A;  1CBO A;  1GRE A;  3AB1 A;  3AEC A;  1IUW A;  2RGO A;  1F8S A;  1B8S A;  3ATR A;  5KNL A;  4H4Y A;  3UP4 A;  2WP5 A;  1PBF A;  1YQZ A;  5HHF A;  3UTE A;  3NKS A;  2ZZC A;  3ABV A;  3LJP A;  4LA1 A;  1VG0 A;  2YLX A;  1QJD A;  1GTE A;  2YLS A;  2QA1 A;  3I6D A;  2IID A;  3AEG A;  4APN A;  3FMW A;  3BI2 A;  4B67 A;  1GER A;  1GND A;  1CJ2 A;  2B76 A;  3AYL A;  4YSZ A;  1TDN A;  1P2E A;  3LB8 A;  2WP9 A;  5KOW A;  3KD9 A;  4H4U A;  1Y56 A;  3EPT A;  4GF7 A;  4J56 A;  5C3J A;  1L9D A;  3AE6 A;  2QA2 A;  3L1R A;  3IF9 A;  3LAD A;  1FEB A;  2GR0 A;  3COX A;  1E6E A;  2R9Z A;  4UDR A;  1COY A;  2JKC A;  2GMJ A;  4H4W A;  1REO A;  2AAQ A;  4OPI A;  2C75 A;  1DNC A;  2UZZ A;  2C70 A;  4Z2R A;  3KVE A;  4U8O A;  5KMS A;  3RP6 A;  4A99 A;  3AE3 A;  4BV6 A;  4FK1 A;  4D04 A;  3HYX A;  2WHD A;  4NTE A;  4YTN A;  3GSI A;  2XFN A;  4XWR A;  3CGE A;  3UCL A;  1H82 A;  1O94 A;  3KU9 A;  1NG3 A;  1N4V A;  1XHC A;  4AOX A;  1JRX A;  5LV9 A;  1FOH A;  1XPQ A;  1GRT A;  3OC4 A;  3T2Z A;  3BHK A;  4C3X A;  1VRQ B;  3QFB A;  2R0G A;  1JNZ A;  1CHU A;  1PN0 A;  2C65 A;  2FJA A;  4AT2 A;  5HXI A;  4JNQ A;  4N9X A;  4ECH A;  3C4A A;  1CJ3 A;  2BCP A;  2WOV A;  3ALM A;  3AWI A;  3V3O A;  4B69 A;  4YTM A;  1NHR A;  1ZMC A;  3BNM A;  3NN0 X;  4P9S A;  2WU5 A;  3FBS A;  1GTH A;  1H6V A;  1E7P A;  5KRQ A;  1AOG A;  1DOD A;  1S3B A;  3DGH A;  1O5W A;  5KWF A;  3GYI A;  1P2H A;  5JCL A;  2B7R A;  4TM4 A;  4U8J A;  5JCI A;  2V61 A;  2WU2 A;  2E1M A;  4OPT A;  5EOW A;  1KF6 A;  2EQ8 A;  3GMC A;  4H4X A;  2F5Z A;  2BXS A;  4J2W A;  1PJ6 A;  2OAM A;  2VQ7 A;  4LII A;  1JEH A;  1PBB A;  3QFA A;  3K7Q X;  3F8R A;  4X4J A;  1ZDL A;  3M12 A;  1NHQ A;  2E5V A;  2BC0 A;  1D4C A;  2GR3 A;  3VRD B;  4DSH A;  4O5U A;  3QSS A;  5BUK A;  2C64 A;  2GV8 A;  5IQ1 A;  1Y56 B;  2R45 A;  3DK4 A;  4Y4M A;  5IQ4 A;  1ONF A;  4YWO A;  2BK3 A;  2WET A;  2Z5Y A;  1HYU A;  3P4P A;  4EIP A;  2C3D A;  1N1P A;  3S61 A;  1H86 A;  3FG2 P;  4IA6 A;  1PJ5 A;  1JRZ A;  2WP6 A;  3IC9 A;  4FK1 C;  1GSN A;  1FCD A;  2R0P A;  3SXI A;  1BF3 A;  4ICY A;  4IVO B;  3UOY A;  4MJW A;  4YTP A;  1YQ3 A;  2X8G A;  3CPJ G;  1ZP0 A;  2XVJ A;  3DGZ A;  1PJ7 A;  4C77 A;  4AP3 A;  5U63 A;  3NG7 X;  4B1B A;  3D8X A;  1PBC A;  2GF3 A;  3KKJ A;  4PAB A;  5JCM A;  4HB9 A;  1OJC A;  5L46 A;  3AE2 A;  3VR8 A;  3H8I A;  1ZX9 A;  3ICS A;  2BRY A;  5JCK A;  2XFP A;  1E1M A;  1GRH A;  3UKA A;  1PS9 A;  3B6D A;  2O9Z A;  4USQ A;  4J57 A;  3CMM A;  2GB0 A;  4B68 A;  4YT0 A;  2B9X A;  1O95 A;  1X31 B;  3K7T A;  4A9W A;  3NRN A;  1MOK A;  4K7Z A;  1Q1W A;  3SZC A;  3VQR A;  2FJE A;  3SGL A;  1GRB A;  1D4D A;  2APG A;  3SQP A;  1NDA A;  4H4Z A;  4J31 A;  4EQS A;  2HQM A;  3AEE A;  3KA7 A;  3QVP A;  3F8D A;  4B63 A;  3NTD A;  1FEA A;  3VRB A;  2YM2 A;  2WDQ A;  3GWD A;  4J36 A;  5M0Z A;  3RP8 A;  3G5S A;  1JNR A;  2B9Y A;  3DA1 A;  3NGC X;  4NEV A;  3AYI A;  4YSX A;  2YLR A;  4K8D A;  2XLS A;  3GYX A;  4A79 A;  2VVM A;  2JAE A;  2CFY A;  2XFO A;  3UKH A;  4EQW A;  1TDK A;  4NTC A;  3UOZ A;  2WDV A;  1FEC A;  1D7Y A;  2GH5 A;  5HYM A;  4K5R A;  1SEZ A;  1BZL A;  3ALL A;  3SY4 A;  4H7U A;  3DK8 A;  1PBE A;  2TPR A;  5KVI A;  1ZOV A;  3HYV A;  5CQF A;  2OLN A;  4Z44 A;  3VRA A;  5TR3 A;  4TLX A;  1E1N A;  1LV0 A;  1RYI A;  2YAU A;  4EMJ A;  3DH9 A;  2AQJ A;  2C67 A;  1EL8 A;  2YLW A;  3EAO A;  2XCG A;  3IWA A;  2ARD A;  2XLP A;  3P4R A;  3CPH G;  2WOW A;  1IUS A;  4JY2 A;  1BGJ A;  4OPL A;  2NPX A;  1K4Q A;  1OJA A;  2PHH A;  4H4R A;  4B65 A;  2V5Z A;  2ZBW A;  3DJG X;  3P4S A;  4U8I A;  3FIM B;  2AR8 A;  3RNM A;  1EL7 A;  1W4X A;  4H2N A;  2C66 A;  3SM8 A;  4BK1 A;  2NVK X;  4NNJ A;  2IVD A;  5KMQ A;  2GEW A;  4TM0 A;  5ER0 A;  4Z2U A;  1LVL A;  1IUV A;  3P4Q A;  2GR1 A;  4JNA A;  4H4V A;  4I59 A;  3BHF A;  2H88 A;  1KNP A;  1TDO A;  2C3C A;  1LTX R;  3CNP A;  1TDF A;  4H2Q A;  3GWF A;  3NN6 X;  2XVF A;  2TMD A;  1CJC A;  3C4N A;  2XVH A;  3NIX A;  1CJ4 A;  1H7X A;  5C2T A;  4JN9 A;  2GR2 A;  4YSY A;  3L8K A;  3NTA A;  4U8N A;  3LZX A;  4OPG A;  1KFY A;  4EM4 A;  4Y4L A;  4U8P A;  2ZZB A;  2JB1 A;  3CN8 A;  4GCM A;  4H2R A;  1OJD A;  4GR1 A;  3T0K A;  4HA6 A;  4H4Q A;  1D4E A;  1PXB A;  1Y0P A;  3H4K A;  3UOV A;  1IUT A;  1GRA A;  1BGN A;  2X99 A;  3T37 A;  2C76 A;  2DKI A;  1GPE A;  2WBA A;  2YVF A;  1F8W A;  5J7X A;  3RED A;  3T14 A;  3AE4 A;  2XLT A;  2JB3 A;  5FMH A;  4FX9 A;  2OLO A;  3AEF A;  4H2P A;  2CDU A;  2WPC A;  3CPI G;  4A5L A;  5KOX A;  3KPK A;  1B37 A;  1CF3 A;  2GQW A;  2V6O A;  2R4E A;  1NHS A;  2RAB A;  3UTG A;  3LOV A;  4YSH A;  3NNE A;  1GAL A;  2YG4 A;  4NZH A;  4Z26 A;  3AED A;  3UTF A;  2B9W A;  2QAE A;  4FDC B;  4EQR A;  1IUU A;  3NHO X;  4WX1 A;  1B4V A;  1K0J A;  2WS3 A;  4EMI A;  3AEB A;  4GAP A;  4X9M A;  3SFE A;  3AE9 A;  1L0V A;  3AXB A;  2YVJ A;  4ZCC A;  1UKV G;  2R46 A;  5DBJ A;  1E1L A;  5FS8 A;  3DK9 A;  4DSG A;  2V3B A;  2YG6 A;  3NYF A;  4B66 A;  2I0Z A;  4A65 A;  1V59 A;  1M6I A;  3AD7 B;  1GV4 A;  3SZ0 A;  3D1C A;  2JBV A;  3I3L A;  4RSL A;  1TRB A;  3CNJ A;  4CBQ A;  5KXJ A;  2CUL A;  1GES A;  3NT6 A;  2IVE A;  3PVC A;  2GMH A;  1CC6 A;  3QVR A;  1KNR A;  1YQ4 A;  2Z5X A;  1NAA A;  3DME A;  4II2 A;  2R4J A;  3NK1 X;  1ZOY A;  4U2T A;  1KDG A;  1NEK A;  3NYE A;  1IUX A;  3LXD A;  3RHA A;  3JSK A;  1JRY A;  3H8L A;  3QJ4 A;  4G6G A;  2YLZ A;  3AYJ A;  2J3N A;  3UKF A;  4XXG A;  2BAB A;  2C73 A;  3GYJ A;  2VVL A;  2YVG A;  2C72 A;  1S2Y A;  3HYW A;  3UOX A;  5JCN A;  2WOI A;  4UDP A;  4WCT A;  2VRL A;  3EF6 A;  5FS6 A;  1PXA A;  4UP3 A;  1DXL A;  3CGB A;  3KLJ A;  1N4W A;  2Q0L A;  3AE5 A;  3ADA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...