2XVIA

Crystal structure of the mutant bacterial flavin containing monooxygenase (y207s)
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
445
structure length
445
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSSSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
molecule tags Oxidoreductase
source organism Methylophaga aminisulfidivorans
total genus 158
structure length 445
sequence length 445
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xviA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xviA02
1LJ1A 2GRTA 2WOWA 3RP7A 1F8WA 4YKGA 5CQFA 2VVLA 1N4UA 1D7YA 3UKKA 2QA2A 2YG6A 3GMBA 2GH5A 3VR9A 2VVLG 2XLTA 1DJQA 1E7PA 1IUXA 2CVJA 1MOKA 2TMDA 4UDPA 4B69A 2V61A 4LIIA 2WP9A 4A5LA 2V5ZA 1B5QA 4U8LA 2EQ6A 4YSZA 2A8XA 2AQJA 3AYLA 1GRTA 3VRAA 3DJDA 2PHHA 1GNDA 1NPXA 3NHOX 4B63A 5JCLA 1NAAA 3P1WA 2XLPA 4RSLA 3RHAA 5BUKA 1ZOVA 2B9WA 2GMJA 4YXDA 2R0PA 1V59A 1GPEA 3BI4A 2JB1A 3H8IA 3C4NA 1XPQA 1TDEA 2C70A 3K30A 3DJGX 1JRYA 3DGHA 1L9CA 2WDRA 3AECA 2Q0LA 2WPCA 1EBDA 3K7QX 4Z44A 4ADWA 3GSIA 1F6MA 1KDGA 4Y4LA 1GESA 2I0ZA 4WCTA 3ISHA 1NG4A 2WHDA 1TYTA 1L9DA 1NHPA 1NHQA 4RG3A 4DNAA 2YLXA 4H2RA 2R0CA 1ONFA 3F8DA 4Z26A 1COYA 1OJTA 4U2SA 4EMJA 1JOAA 4KPRA 5J7XA 3UKQA 2XFUA 3UTEA 3LZXA 4A65A 4YT0A 4AT0A 4B66A 5BRTA 1GRGA 5FS6A 4M52A 3UKFA 2XFNA 4PABA 4H4PA 4FK1C 1Y56A 3B6DA 2YAUA 1GRAA 2GF3A 4APNA 2Y6RA 1TDNA 2FJDA 3CNSA 1H7WA 2XLRA 3CTYA 5JCKA 2XFQA 3DMEA 4OVIA 2XVEA 4K2XA 3AE4A 1GXFA 2C75A 3GD4A 3B3RA 2C73A 4JY3A 2A89A 2YWLA 3QVRA 2WU5A 4H50A 1RYIA 4YKFA 5HHFA 1K0IA 4H2QA 1LV0A 2H88A 2AAQA 5M0ZA 4C77A 2WESA 3VQRA 5L46A 4KX6A 2WPEA 4UDRA 5FS8A 2QCUA 2YG4A 3QSMA 4FDCB 3NYFA 1VQWA 1TDKA 2JB3A 1NG3A 4O5QA 5CKUA 2YR4A 1M6IA 3M0OA 2YVGA 1P2EA 2GB0A 2XFOA 3NYCA 5DBJA 4B68A 1Y56B 2YQUA 3CPHG 2BCGG 4A79A 3QFAA 2IVDA 2CDUA 4U8PA 2EQ7A 2C67A 5JCMA 2XLSA 4NTEA 3K7MX 1TDFA 1CJCA 4A6NA 5M10A 5KWFA 2O9ZA 4CCQA 2X8CA 3ABVA 1D4CA 1UKVG 2A87A 2ZZCA 3CPJG 4GUVA 1JNRA 3C4AA 1XDIA 3C96A 3H4KA 4X9MA 4TLZA 3BHKA 3VRBA 2RABA 4USQA 1CJ2A 3LB8A 4GDEA 4Z2RA 2E5VA 1N1PA 3L8KA 5EOWA 1GOSA 4REKA 2X50A 4X9NA 1IUSA 2YG5A 4U8KA 4K5RA 3AE6A 4U2TA 3LADA 5BVAA 2WU2A 1FCDA 2E1MA 3QSEA 1PXAA 3I3LA 3AYJA 4EMWA 1EL8A 1PBEA 2XFPA 1B37A 1XANA 4OPGA 2QA1A 3DA1A 1LPFA 2E4GA 2GR2A 1ZP0A 3UOXA 2XDOA 1GT8A 1LTXR 4A6NB 1PXBA 3AEFA 1CJ3A 1Q9IA 3ALMA 4H4RA 3OZ2A 4MJWA 1AOGA 2X99A 2BK5A 3Q6JA 2V60A 3BNMA 4EQSA 5KOXA 4U2LA 1IUWA 3R9UA 1BKWA 3K7TA 1OJAA 1W4XA 2F5ZA 3RNMA 1ZDLA 3RP8A 1PBBA 2BABA 3S61A 2YLSA 3FIMB 2BC1A 2GAHB 3DGZA 4YTPA 4CNJA 3OC4A 5KRQA 1VDCA 4EIQA 2WQYA 2UZZA 5TR3A 4JDRA 2VZ2A 5J60A 3URHA 3Q9TA 1YQ4A 4CY8A 4OPUA 2XVHA 2BS3A 3FBSA 4OPDA 3GWFA 4NEWA 2WOIA 3UOZA 2VRLA 4BV6A 1GSNA 3NTDA 4JY2A 4H4YA 3ZYXA 1CL0A 1OJCA 4H4ZA 3ICSA 1D4EA 1REOA 3FMWA 3CGDA 4IA6A 1K0LA 1QO8A 3ALJA 1H82A 2GQWA 2IIDA 2C64A 4DSGA 2ARDA 5U63A 3UP5A 3T37A 1Q1WA 1GALA 2C76A 3ICTA 2VOUA 1P2HA 2YG3A 3SFDA 4EIPA 1S3BA 4YSYA 4H7UA 3CGBA 5C2TA 3EANA 3NN0X 2BXRA 3AEBA 1E1LA 3JSKA 4OPIA 1BZLA 1IUTA 2ACZA 1CF3A 4H4UA 4H4VA 3F8RA 1OJ9A 3NG7X 4GCMA 1H81A 3BHFA 4TM3A 2VRMA 3P4PA 4C5OA 3G5SA 3DJJA 3DK4A 4UP3A 3NKSA 3UTHA 3DK9A 4Y4NA 5FS7A 1PBDA 3UOYA 3CPIG 3AE9A 4B65A 3KA7A 1GRFA 2V3AA 3H8LA 1RP0A 3UKAA 3UOVA 3NYEA 4J36A 1K0JA 3M12A 1D5TA 2YM1A 3QJ4A 2WDVA 4H4TA 2JAEA 4BK2A 3QVPA 2WBAA 1DOBA 5KOWA 1QJDA 1H84A 1FL2A 1NENA 3LJPA 2Q7VA 1F8SA 3GRSA 2WP5A 4U8OA 1M64A 4H2NA 4Z24A 3GMCA 4IVMB 2C65A 3D1CA 4A9WA 2EQ9A 4EMIA 5IQ4A 3NH3X 1E6EA 1GREA 3DK8A 3G5QA 1KFYA 4DSHA 3IWAA 4D03A 4Z2TA 2OLOA 1IUVA 3AE8A 3FG2P 1MO9A 2BYBA 5EB5A 3ALLA 4U8JA 2Z5YA 3AWIA 2TPRA 3II4A 3P9UA 4LU6A 2YLWA 4B64A 5BULA 2NVKX 5GRTA 1IJHA 2YR6A 4AT2A 5FS9A 3NGCX 1BF3A 1S3EA 4B67A 1JRXA 2GEWA 2Q0KA 3COXA 2VQBA 2HQMA 1GRHA 4I58A 2V3BA 4J34A 3I6DA 3KLJA 1ZMDA 4GDPA 4NTCA 2GR3A 1PBCA 2GR1A 1O94A 3NT6A 4HA6A 2H89A 1NDAA 2JBVA 1DODA 4NEVA 3ICRA 2C7GA 2APGA 1QLBA 4O5UA 2B7RA 2C72A 4C74A 4OPCA 4J33A 2CFYA 2Y6QA 3NNEA 3VR8A 3EF6A 3DH9A 4FX9A 3AB1A 1H83A 5HYMA 3O0HA 4YTMA 4C3YA 4E0VA 2Z5XA 3M13A 2GVCA 1KF6A 4Y4MA 3LZWA 3PVCA 4BK3A 4YSXA 1TYPA 1K4QA 4IVOB 3REDA 3NRNA 5FMHA 3SGLA 4BJZA 1HYUA 1PN0A 2WPFA 4XWRA 4EM4A 2FJEA 5IPYA 1E1NA 2DKHA 5JCIA 2FJAA 1MXTA 3P4QA 1SEZA 4N9XA 3PO7A 4Z2UA 1CC6A 1PBFA 1CJ4A 1YKJA 4H4SA 3ATRA 4ECHA 2R9ZA 3CIRA 2WS3A 1PXCA 3SFEA 3CGEA 3QSSA 1N4WA 1CHUA 4BURA 4H2PA 4OCGA 2GR0A 2IVEA 2WETA 2YR5A 1EL9A 3AD8B 4YSHA 1L9EA 3AYIA 2B9XA 4JNAA 3GDNA 1LQTA 4IA5A 1GETA 5EB4A 2XVFA 2XVJA 2Q6UA 3AE5A 3GYIA 2GQFA 3CNDA 5HY5A 1BGNA 2WEUA 2JB2A 4PAAA 4BJYA 1ZX9A 2B76A 2X8HA 3CNTA 2CULA 2RGOA 1B4VA 4YTNA 3ADAB 4IV9A 3P4SA 1GERA 3IF9A 3NN6X 1XHCA 1O5WA 4B1BA 3F8PA 4JNQA 4NTDA 3GRTA 2BK4A 3KKJA 1PHHA 1PS9A 1VRQB 2YLZA 4ZCCA 2VQ7A 4OPTA 3AEGA 1H6VA 1JEHA 4K7ZA 4CNKA 4CY6A 4H4XA 3CN8A 2V6OA 5KVIA 2J3NA 3AE3A 1DOCA 3BI5A 4FK1A 3UKPA 2DKIA 3AD9B 3UTGA 3ZDNA 4C3XA 5C3JA 3AEEA 2AR8A 3GD3A 3AE1A 2BS4A 5HXIA 3UKHA 1KSSA 4U8IA 4K8DA 3FPZA 1L0VA 3NIXA 4EQRA 5JCNA 1F8RA 2GMHA 1GV4A 2FBWA 2XYOA 1GTEA 3EPTA 4U8NA 3KVEA 3AEDA 4NZHA 1Y0PA 4AOXA 2XCGA 4YWOA 4EQXA 1PJ5A 1TRBA 2X8GA 1DXLA 5LV9A 3KU9A 4J31A 4K22A 4U8MA 1CBOA 1Q1RA 1H86A 2ZBWA 1E1MA 1H7XA 3UTFA 4BK1A 4HB9A 3PS9A 3NK1X 2QAEA 2X3NA 5KVHA 2C3DA 1D7LA 1NEKA 4J2WA 2B9YA 1ZK7A 2BACA 2RGJA 3LOVA 4D04A 3P4RA 1N4VA 1GTHA 3SQPA 4AP1A 2GAGB 1ELIA 5EBKA 3BNUA 4GRTA 1E1KA 1NHSA 1VG0A 5U25A 4CBQA 3CNPA 1TDOA 1PJ6A 2R0GA 4RG4A 3QFBA 3UP4A 3AE7A 4K5SA 4Z25A 1VG9A 3IHMA 4Z43A 1YY5A 2PYXA 2BA9A 4ICYA 1YQZA 3NK0X 2WOVA 2XLUA 4CCRA 3CNJA 2OALA 2YVFA 2R45A 4P9SA 3UKLA 1ZKQA 1ZY8A 4I59A 3NK2X 5GSNA 1KNRA 2BK3A 1PDHA 3CGCA 3G5RA 2R4EA 4A7AA 2YVJA 3GWDA 2OAMA 4X4JA 2GV8A 1FEAA 1LVLA 2YLTA 3VRDB 1B8SA 4WX1A 1BGJA 4UDQA 2C3CA 2OA1A 2ZZ0A 2NPXA 4AP3A 5KXJA 2VVMA 1O95A 3GDPA 2YLRA 3HZLA 1BWCA 1OJDA 4XWZA 1FECA 4GF7A 1S2YA 4ZN0A 1Z6LA 3NTAA 4EM3A 2WDQA 4A99A 2BXSA 2B7SA 2WP6A 3DJEA 3AXBA 3BI2A 2R4JA 1GEUA 3GYJA 1YQ3A 1RSGA 2YM2A 4JQ9A 5ER0A 3RP6A 2EQ8A 1GRBA 1JU2A 4XXGA 2ZZBA 1JNZA 4GR1A 1IUUA 2BCPA 3D8XA 4DGKA 3AD7B 5IQ1A 5U1OA 2OLNA 2JK6A 1DNCA 1ZOYA 4J56A 1CC2A 1EL5A 4LA1A 3L1RA 4J57A 1JRZA 3V3NA 2BC0A 3UCLA 4CRTA 3V76A 2RGHA 2R46A 4H4QA 1ZMCA 3ITJA 3WE0A 1DJNA 3E1TA 1DOEA 1S2QA 3EAOA 3S5WA 4JN9A 3SM8A 2FJBA 4OPLA 3AEAA 3IC9A 1FOHA 2YG7A 1F3PA 3AE2A 1CC4A 4TM1A 3IHGA 3KPFA 1E39A 4TM0A 1LQUA 3V3OA 4ZCDA 3NLCA 2XVIA 4TLXA 1KNPA 1EL7A 1NHRA 1X31B 2BS2A 2W0HA 3ATQA 1KSUA 3LXDA 4AOSA 4EQWA 1PJ7A 3KD9A 4TM4A 1FEBA 2C66A 4USRA 2JKCA 1D4DA 4H4WA
chains in the Genus database with same CATH superfamily
1LJ1A 2GRTA 2WOWA 3RP7A 1F8WA 4YKGA 5CQFA 2VVLA 1N4UA 1D7YA 3UKKA 2QA2A 2YG6A 3GMBA 2GH5A 3VR9A 2VVLG 2XLTA 1DJQA 1E7PA 1IUXA 2CVJA 1MOKA 2TMDA 4UDPA 4B69A 2V61A 4LIIA 2WP9A 4A5LA 2V5ZA 1B5QA 4U8LA 2EQ6A 4YSZA 2A8XA 2AQJA 3AYLA 1GRTA 3VRAA 3DJDA 2PHHA 1GNDA 1NPXA 3NHOX 4B63A 5JCLA 1NAAA 3P1WA 2XLPA 4RSLA 3RHAA 5BUKA 1ZOVA 2B9WA 2GMJA 4YXDA 2R0PA 1V59A 1GPEA 3BI4A 2JB1A 3H8IA 3C4NA 1XPQA 1TDEA 2C70A 3K30A 3DJGX 3HYVA 4G74A 1JRYA 3DGHA 1L9CA 2WDRA 3AECA 2Q0LA 2WPCA 1EBDA 3K7QX 4Z44A 4ADWA 3GSIA 1F6MA 1KDGA 4Y4LA 1GESA 2I0ZA 4WCTA 3ISHA 1NG4A 2WHDA 1TYTA 1L9DA 1NHPA 1NHQA 4RG3A 4DNAA 2YLXA 4H2RA 2R0CA 1ONFA 3F8DA 4Z26A 1COYA 1OJTA 4U2SA 4EMJA 1JOAA 4KPRA 5J7XA 3UKQA 2XFUA 3UTEA 3LZXA 4A65A 4YT0A 4AT0A 4B66A 5BRTA 1GRGA 5FS6A 4M52A 3UKFA 4G6GA 3SYIA 2XFNA 4PABA 4H4PA 4FK1C 3SX6A 1Y56A 3B6DA 2YAUA 1GRAA 2GF3A 4APNA 2Y6RA 1TDNA 2FJDA 3CNSA 1H7WA 2XLRA 3CTYA 5JCKA 2XFQA 3DMEA 4OVIA 2XVEA 3T2ZA 4K2XA 3AE4A 1GXFA 2C75A 3GD4A 3B3RA 2C73A 4JY3A 2A89A 2YWLA 3QVRA 2WU5A 4H50A 1RYIA 4YKFA 5HHFA 1K0IA 4H2QA 1LV0A 2H88A 2AAQA 5M0ZA 4C77A 2WESA 3VQRA 5L46A 4KX6A 2WPEA 4UDRA 5FS8A 2QCUA 2YG4A 3QSMA 4FDCB 3NYFA 1VQWA 1TDKA 2JB3A 1NG3A 4O5QA 5CKUA 2YR4A 1M6IA 3M0OA 2YVGA 1P2EA 2GB0A 2XFOA 3NYCA 5DBJA 4B68A 1Y56B 2YQUA 3CPHG 2BCGG 4A79A 3QFAA 2IVDA 2CDUA 4U8PA 2EQ7A 2C67A 5JCMA 2XLSA 4NTEA 3K7MX 1TDFA 1CJCA 4A6NA 5M10A 5KNLA 5KWFA 2O9ZA 4CCQA 2X8CA 3ABVA 1D4CA 1UKVG 2A87A 2ZZCA 3CPJG 4GUVA 1JNRA 3C4AA 1XDIA 3C96A 3H4KA 4X9MA 3SZ0A 4TLZA 3BHKA 3T2YA 3VRBA 2RABA 4USQA 1CJ2A 3LB8A 4GDEA 4Z2RA 2E5VA 1N1PA 3L8KA 5EOWA 1GOSA 4REKA 2X50A 4X9NA 1IUSA 2YG5A 4U8KA 4K5RA 3AE6A 4U2TA 3LADA 5BVAA 2WU2A 1FCDA 2E1MA 3QSEA 1PXAA 3I3LA 3AYJA 4EMWA 1EL8A 1PBEA 2XFPA 1B37A 1XANA 4OPGA 2QA1A 3DA1A 1LPFA 2E4GA 2GR2A 1ZP0A 3UOXA 2XDOA 1GT8A 1LTXR 4A6NB 1PXBA 3AEFA 1CJ3A 1Q9IA 3ALMA 4H4RA 3OZ2A 4MJWA 1AOGA 2X99A 2BK5A 3Q6JA 2V60A 3BNMA 4EQSA 5KOXA 4U2LA 1IUWA 3R9UA 1BKWA 3K7TA 1OJAA 1W4XA 2F5ZA 3RNMA 1ZDLA 3RP8A 1PBBA 2BABA 3S61A 2YLSA 3FIMB 2BC1A 2GAHB 3DGZA 4YTPA 4CNJA 3OC4A 5KRQA 1VDCA 4EIQA 2WQYA 2UZZA 5TR3A 4JDRA 2VZ2A 5J60A 3URHA 3Q9TA 1YQ4A 4CY8A 4OPUA 2XVHA 2BS3A 3FBSA 4OPDA 3GWFA 4NEWA 2WOIA 3UOZA 2VRLA 4BV6A 1GSNA 3NTDA 4JY2A 4H4YA 3ZYXA 1CL0A 1OJCA 4H4ZA 3ICSA 1D4EA 1REOA 3FMWA 3CGDA 4IA6A 1K0LA 1QO8A 3ALJA 1H82A 2GQWA 2IIDA 2C64A 4DSGA 2ARDA 5U63A 3UP5A 3T37A 1Q1WA 3GYXA 1GALA 3HYWA 2C76A 3ICTA 2VOUA 1P2HA 2YG3A 3SFDA 4EIPA 1S3BA 4YSYA 4H7UA 3CGBA 5C2TA 3EANA 3NN0X 2BXRA 3AEBA 1E1LA 3JSKA 4OPIA 1BZLA 1IUTA 4II2A 2ACZA 1CF3A 4H4UA 4H4VA 3F8RA 1OJ9A 3NG7X 4GCMA 1H81A 3BHFA 4TM3A 2BRYA 2VRMA 3P4PA 4C5OA 4GAVA 3G5SA 3DJJA 3DK4A 4UP3A 3NKSA 3UTHA 3DK9A 4Y4NA 3HYXA 5FS7A 1PBDA 3UOYA 3CPIG 3AE9A 4B65A 3KA7A 3SY4A 1GRFA 2V3AA 3H8LA 1RP0A 3UKAA 3UOVA 3NYEA 4J36A 1K0JA 3SZFA 3M12A 1D5TA 2YM1A 3QJ4A 2WDVA 4H4TA 2JAEA 4BK2A 3QVPA 2WBAA 1DOBA 5KOWA 1QJDA 1H84A 1FL2A 1NENA 3LJPA 2Q7VA 1F8SA 3GRSA 2WP5A 4U8OA 1M64A 4H2NA 4Z24A 3GMCA 4IVMB 2C65A 3D1CA 4A9WA 2EQ9A 4EMIA 5IQ4A 3NH3X 1E6EA 1GREA 3DK8A 3G5QA 1KFYA 4DSHA 3IWAA 4D03A 4Z2TA 2OLOA 1IUVA 3AE8A 3FG2P 3SZCA 1MO9A 2BYBA 5EB5A 3ALLA 4U8JA 2Z5YA 3AWIA 2TPRA 3II4A 3P9UA 4LU6A 2YLWA 4B64A 5BULA 2NVKX 5GRTA 1IJHA 2YR6A 4AT2A 5FS9A 3NGCX 1BF3A 1S3EA 4B67A 1JRXA 2GEWA 2Q0KA 3SXIA 3COXA 2VQBA 2HQMA 1GRHA 4I58A 2V3BA 4J34A 3I6DA 3KLJA 1ZMDA 4GDPA 4NTCA 2GR3A 1PBCA 2GR1A 1O94A 3NT6A 4HA6A 2H89A 1NDAA 2JBVA 1DODA 4NEVA 3ICRA 2C7GA 2APGA 1QLBA 4O5UA 2B7RA 2C72A 4C74A 4OPCA 4J33A 2CFYA 2Y6QA 3NNEA 3VR8A 3EF6A 3DH9A 4FX9A 3AB1A 1H83A 5HYMA 3O0HA 4YTMA 4C3YA 4E0VA 2Z5XA 3M13A 2GVCA 1KF6A 4Y4MA 3LZWA 3PVCA 4BK3A 4YSXA 3CMMA 1TYPA 4GAPA 1K4QA 4IVOB 3REDA 3NRNA 5FMHA 3SGLA 4BJZA 1HYUA 1PN0A 2WPFA 4XWRA 4EM4A 2FJEA 5IPYA 1E1NA 2DKHA 5JCIA 2FJAA 1MXTA 3P4QA 1SEZA 4N9XA 3PO7A 4Z2UA 1CC6A 1PBFA 5KMSA 1CJ4A 1YKJA 4H4SA 3ATRA 4ECHA 2R9ZA 3CIRA 2WS3A 1PXCA 3SFEA 3CGEA 3QSSA 1N4WA 1CHUA 4BURA 4H2PA 4OCGA 2GR0A 2IVEA 2WETA 2YR5A 1EL9A 3AD8B 4YSHA 1L9EA 3AYIA 2B9XA 4JNAA 3GDNA 1LQTA 4IA5A 1GETA 5EB4A 2XVFA 2XVJA 2Q6UA 3AE5A 3GYIA 2GQFA 3CNDA 5HY5A 1BGNA 2WEUA 2JB2A 4PAAA 4BJYA 1ZX9A 2B76A 2X8HA 3CNTA 2CULA 2RGOA 1B4VA 4YTNA 3ADAB 4IV9A 3P4SA 1GERA 3IF9A 3NN6X 1XHCA 1O5WA 4II3A 3F8PA 4B1BA 4JNQA 4NTDA 3GRTA 2BK4A 3KKJA 1PHHA 1PS9A 1VRQB 2YLZA 4ZCCA 2VQ7A 4OPTA 3AEGA 1H6VA 1JEHA 4K7ZA 4CNKA 4CY6A 4H4XA 3CN8A 2V6OA 5KVIA 2J3NA 3AE3A 1DOCA 3BI5A 4FK1A 3UKPA 2DKIA 3AD9B 3UTGA 3ZDNA 4C3XA 5C3JA 3AEEA 2AR8A 3GD3A 3AE1A 2BS4A 5HXIA 3UKHA 1KSSA 4U8IA 4K8DA 3FPZA 1L0VA 3NIXA 4G6HA 4EQRA 1F8RA 5JCNA 2GMHA 1GV4A 2FBWA 2XYOA 3SZWA 1GTEA 3EPTA 4U8NA 3KVEA 3AEDA 4NZHA 1Y0PA 5KMQA 4AOXA 2XCGA 4YWOA 4EQXA 2BRAA 1PJ5A 1TRBA 5KMRA 2X8GA 1DXLA 5LV9A 3KU9A 4J31A 4K22A 4U8MA 1CBOA 1Q1RA 3T2KA 1H86A 2ZBWA 1E1MA 1H7XA 3UTFA 4BK1A 4HB9A 3PS9A 3NK1X 2QAEA 2X3NA 5KVHA 2C3DA 1D7LA 1NEKA 4J2WA 2B9YA 1ZK7A 2BACA 2RGJA 3T31A 3LOVA 4D04A 3P4RA 1N4VA 1GTHA 3SQPA 4AP1A 2GAGB 1ELIA 5EBKA 3BNUA 4GRTA 1E1KA 1NHSA 1VG0A 5U25A 3KPKA 4CBQA 3CNPA 1TDOA 1PJ6A 2R0GA 4RG4A 3QFBA 3UP4A 3AE7A 4K5SA 4Z25A 1VG9A 3IHMA 4Z43A 4NWZA 1YY5A 2PYXA 2BA9A 4ICYA 3T0KA 1YQZA 3NK0X 2WOVA 2XLUA 4CCRA 3CNJA 2OALA 2YVFA 2R45A 4P9SA 3UKLA 1ZKQA 1ZY8A 4I59A 3NK2X 5GSNA 1KNRA 2BK3A 1PDHA 3CGCA 3G5RA 2R4EA 4A7AA 2YVJA 3GWDA 2OAMA 4X4JA 2GV8A 1FEAA 1LVLA 2YLTA 3VRDB 1B8SA 4WX1A 1BGJA 4UDQA 2C3CA 2OA1A 2ZZ0A 2NPXA 4AP3A 5KXJA 3T14A 2VVMA 4G73A 1O95A 3GDPA 2YLRA 3HZLA 1BWCA 1OJDA 4XWZA 1FECA 4GF7A 1S2YA 4ZN0A 1Z6LA 3NTAA 4EM3A 2WDQA 4A99A 2BXSA 2B7SA 2WP6A 3DJEA 3AXBA 3BI2A 2R4JA 1GEUA 3GYJA 1YQ3A 1RSGA 2YM2A 4JQ9A 5ER0A 3RP6A 2EQ8A 5KMPA 1GRBA 1JU2A 4XXGA 2ZZBA 1JNZA 4GR1A 1IUUA 2BCPA 3D8XA 4DGKA 3AD7B 5IQ1A 5U1OA 2OLNA 2JK6A 1DNCA 1ZOYA 4J56A 1CC2A 1EL5A 4LA1A 3L1RA 4J57A 1JRZA 3V3NA 2BC0A 3UCLA 4CRTA 3V76A 2RGHA 2R46A 4H4QA 1ZMCA 3ITJA 3WE0A 1DJNA 3E1TA 1DOEA 1S2QA 3EAOA 3S5WA 4G9KA 4JN9A 2FJBA 4OPLA 3AEAA 3IC9A 3SM8A 1FOHA 2C4CA 2YG7A 1F3PA 3AE2A 1CC4A 4TM1A 3IHGA 3KPFA 1E39A 4TM0A 1LQUA 3V3OA 4ZCDA 3NLCA 2XVIA 4TLXA 1KNPA 1EL7A 1NHRA 1X31B 2BS2A 2W0HA 3ATQA 1KSUA 3LXDA 4AOSA 4EQWA 1PJ7A 3KD9A 4TM4A 1FEBA 2C66A 4USRA 4NNJA 2JKCA 1D4DA 4H4WA
chains in the Genus database with same CATH topology
1LJ1A 2GRTA 2WOWA 3RP7A 1F8WA 4YKGA 5CQFA 2VVLA 1N4UA 1D7YA 3UKKA 2QA2A 2YG6A 3GMBA 2GH5A 3VR9A 2VVLG 2XLTA 1DJQA 1E7PA 1IUXA 2CVJA 1MOKA 2TMDA 4UDPA 4B69A 2V61A 4LIIA 2WP9A 4A5LA 2V5ZA 1B5QA 4U8LA 2EQ6A 4YSZA 2A8XA 2AQJA 3AYLA 1GRTA 3VRAA 3DJDA 2PHHA 1GNDA 1NPXA 3NHOX 4B63A 5JCLA 1NAAA 3P1WA 2XLPA 4RSLA 3RHAA 5BUKA 1ZOVA 2B9WA 2GMJA 4YXDA 2R0PA 1V59A 1GPEA 3BI4A 2JB1A 3H8IA 3C4NA 1XPQA 1TDEA 2C70A 3K30A 3DJGX 3HYVA 4G74A 1JRYA 3DGHA 1L9CA 2WDRA 3AECA 2Q0LA 2WPCA 1EBDA 3K7QX 4Z44A 4ADWA 3GSIA 1F6MA 1KDGA 4Y4LA 1GESA 2I0ZA 4WCTA 3ISHA 1NG4A 2WHDA 1TYTA 1L9DA 1NHPA 1NHQA 4RG3A 4DNAA 2YLXA 4H2RA 2R0CA 1ONFA 3F8DA 4Z26A 1COYA 1OJTA 4U2SA 4EMJA 1JOAA 4KPRA 5J7XA 3UKQA 2XFUA 3UTEA 3LZXA 4A65A 4YT0A 4AT0A 4B66A 5BRTA 1GRGA 5FS6A 4M52A 3UKFA 4G6GA 3SYIA 2XFNA 4PABA 4H4PA 4FK1C 3SX6A 1Y56A 3B6DA 2YAUA 1GRAA 2GF3A 4APNA 2Y6RA 1TDNA 2FJDA 3CNSA 1H7WA 2XLRA 3CTYA 5JCKA 2XFQA 3DMEA 4OVIA 2XVEA 3T2ZA 4K2XA 3AE4A 1GXFA 2C75A 3GD4A 3B3RA 2C73A 4JY3A 2A89A 2YWLA 3QVRA 2WU5A 4H50A 1RYIA 4YKFA 5HHFA 1K0IA 4H2QA 1LV0A 2H88A 2AAQA 5M0ZA 4C77A 2WESA 3VQRA 5L46A 4KX6A 2WPEA 4UDRA 5FS8A 2QCUA 2YG4A 3QSMA 4FDCB 3NYFA 1VQWA 1TDKA 2JB3A 1NG3A 4O5QA 5CKUA 2YR4A 1M6IA 3M0OA 2YVGA 1P2EA 2GB0A 2XFOA 3NYCA 5DBJA 4B68A 1Y56B 2YQUA 3CPHG 2BCGG 4A79A 3QFAA 2IVDA 2CDUA 4U8PA 2EQ7A 2C67A 5JCMA 2XLSA 4NTEA 3K7MX 1TDFA 1CJCA 4A6NA 5M10A 5KNLA 5KWFA 2O9ZA 4CCQA 2X8CA 3ABVA 1D4CA 1UKVG 2A87A 2ZZCA 3CPJG 4GUVA 1JNRA 3C4AA 1XDIA 3C96A 3H4KA 4X9MA 3SZ0A 4TLZA 3BHKA 3T2YA 3VRBA 2RABA 4USQA 1CJ2A 3LB8A 4GDEA 4Z2RA 2E5VA 1N1PA 3L8KA 5EOWA 1GOSA 4REKA 2X50A 4X9NA 1IUSA 2YG5A 4U8KA 4K5RA 3AE6A 4U2TA 3LADA 5BVAA 2WU2A 1FCDA 2E1MA 3QSEA 1PXAA 3I3LA 3AYJA 4EMWA 1EL8A 1PBEA 2XFPA 1B37A 1XANA 4OPGA 2QA1A 3DA1A 1LPFA 2E4GA 2GR2A 1ZP0A 3UOXA 2XDOA 1GT8A 1LTXR 4A6NB 1PXBA 3AEFA 1CJ3A 1Q9IA 3ALMA 4H4RA 3OZ2A 4MJWA 1AOGA 2X99A 2BK5A 3Q6JA 2V60A 3BNMA 4EQSA 5KOXA 4U2LA 1IUWA 3R9UA 1BKWA 3K7TA 1OJAA 1W4XA 2F5ZA 3RNMA 1ZDLA 3RP8A 1PBBA 2BABA 3S61A 2YLSA 3FIMB 2BC1A 2GAHB 3DGZA 4YTPA 4CNJA 3OC4A 5KRQA 1VDCA 4EIQA 2WQYA 2UZZA 5TR3A 4JDRA 2VZ2A 5J60A 3URHA 3Q9TA 1YQ4A 4CY8A 4OPUA 2XVHA 2BS3A 3FBSA 4OPDA 3GWFA 4NEWA 2WOIA 3UOZA 2VRLA 4BV6A 1GSNA 3NTDA 4JY2A 4H4YA 3ZYXA 1CL0A 1OJCA 4H4ZA 3ICSA 1D4EA 1REOA 3FMWA 3CGDA 4IA6A 1K0LA 1QO8A 3ALJA 1H82A 2GQWA 2IIDA 2C64A 4DSGA 2ARDA 5U63A 3UP5A 3T37A 1Q1WA 3GYXA 1GALA 3HYWA 2C76A 3ICTA 2VOUA 1P2HA 2YG3A 3SFDA 4EIPA 1S3BA 4YSYA 4H7UA 3CGBA 5C2TA 3EANA 3NN0X 2BXRA 3AEBA 1E1LA 3JSKA 4OPIA 1BZLA 1IUTA 4II2A 2ACZA 1CF3A 4H4UA 4H4VA 3F8RA 1OJ9A 3NG7X 4GCMA 1H81A 3BHFA 4TM3A 2BRYA 2VRMA 3P4PA 4C5OA 4GAVA 3G5SA 3DJJA 3DK4A 4UP3A 3NKSA 3UTHA 3DK9A 4Y4NA 3HYXA 5FS7A 1PBDA 3UOYA 3CPIG 3AE9A 4B65A 3KA7A 3SY4A 1GRFA 2V3AA 3H8LA 1RP0A 3UKAA 3UOVA 3NYEA 4J36A 1K0JA 3SZFA 3M12A 1D5TA 2YM1A 3QJ4A 2WDVA 4H4TA 2JAEA 4BK2A 3QVPA 2WBAA 1DOBA 5KOWA 1QJDA 1H84A 1FL2A 1NENA 3LJPA 2Q7VA 1F8SA 3GRSA 2WP5A 4U8OA 1M64A 4H2NA 4Z24A 3GMCA 4IVMB 2C65A 3D1CA 4A9WA 2EQ9A 4EMIA 5IQ4A 3NH3X 1E6EA 1GREA 3DK8A 3G5QA 1KFYA 4DSHA 3IWAA 4D03A 4Z2TA 2OLOA 1IUVA 3AE8A 3FG2P 3SZCA 1MO9A 2BYBA 5EB5A 3ALLA 4U8JA 2Z5YA 3AWIA 2TPRA 3II4A 3P9UA 4LU6A 2YLWA 4B64A 5BULA 2NVKX 5GRTA 1IJHA 2YR6A 4AT2A 5FS9A 3NGCX 1BF3A 1S3EA 4B67A 1JRXA 2GEWA 2Q0KA 3SXIA 3COXA 2VQBA 2HQMA 1GRHA 4I58A 2V3BA 4J34A 3I6DA 3KLJA 1ZMDA 4GDPA 4NTCA 2GR3A 1PBCA 2GR1A 1O94A 3NT6A 4HA6A 2H89A 1NDAA 2JBVA 1DODA 4NEVA 3ICRA 2C7GA 2APGA 1QLBA 4O5UA 2B7RA 2C72A 4C74A 4OPCA 4J33A 2CFYA 2Y6QA 3NNEA 3VR8A 3EF6A 3DH9A 4FX9A 3AB1A 1H83A 5HYMA 3O0HA 4YTMA 4C3YA 4E0VA 2Z5XA 3M13A 2GVCA 1KF6A 4Y4MA 3LZWA 3PVCA 4BK3A 4YSXA 3CMMA 1TYPA 4GAPA 1K4QA 4IVOB 3REDA 3NRNA 5FMHA 3SGLA 4BJZA 1HYUA 1PN0A 2WPFA 4XWRA 4EM4A 2FJEA 5IPYA 1E1NA 2DKHA 5JCIA 2FJAA 1MXTA 3P4QA 1SEZA 4N9XA 3PO7A 4Z2UA 1CC6A 1PBFA 5KMSA 1CJ4A 1YKJA 4H4SA 3ATRA 4ECHA 2R9ZA 3CIRA 2WS3A 1PXCA 3SFEA 3CGEA 3QSSA 1N4WA 1CHUA 4BURA 4H2PA 4OCGA 2GR0A 2IVEA 2WETA 2YR5A 1EL9A 3AD8B 4YSHA 1L9EA 3AYIA 2B9XA 4JNAA 3GDNA 1LQTA 4IA5A 1GETA 5EB4A 2XVFA 2XVJA 2Q6UA 3AE5A 3GYIA 2GQFA 3CNDA 5HY5A 1BGNA 2WEUA 2JB2A 4PAAA 4BJYA 1ZX9A 2B76A 2X8HA 3CNTA 2CULA 2RGOA 1B4VA 4YTNA 3ADAB 4IV9A 3P4SA 1GERA 3IF9A 3NN6X 1XHCA 1O5WA 4II3A 3F8PA 4B1BA 4JNQA 4NTDA 3GRTA 2BK4A 3KKJA 1PHHA 1PS9A 1VRQB 2YLZA 4ZCCA 2VQ7A 4OPTA 3AEGA 1H6VA 1JEHA 4K7ZA 4CNKA 4CY6A 4H4XA 3CN8A 2V6OA 5KVIA 2J3NA 3AE3A 1DOCA 3BI5A 4FK1A 3UKPA 2DKIA 3AD9B 3UTGA 3ZDNA 4C3XA 5C3JA 3AEEA 2AR8A 3GD3A 3AE1A 2BS4A 5HXIA 3UKHA 1KSSA 4U8IA 4K8DA 3FPZA 1L0VA 3NIXA 4G6HA 4EQRA 1F8RA 5JCNA 2GMHA 1GV4A 2FBWA 2XYOA 3SZWA 1GTEA 3EPTA 4U8NA 3KVEA 3AEDA 4NZHA 1Y0PA 5KMQA 4AOXA 2XCGA 4YWOA 4EQXA 2BRAA 1PJ5A 1TRBA 5KMRA 2X8GA 1DXLA 5LV9A 3KU9A 4J31A 4K22A 4U8MA 1CBOA 1Q1RA 3T2KA 1H86A 2ZBWA 1E1MA 1H7XA 3UTFA 4BK1A 4HB9A 3PS9A 3NK1X 2QAEA 2X3NA 5KVHA 2C3DA 1D7LA 1NEKA 4J2WA 2B9YA 1ZK7A 2BACA 2RGJA 3T31A 3LOVA 4D04A 3P4RA 1N4VA 1GTHA 3SQPA 4AP1A 2GAGB 1ELIA 5EBKA 3BNUA 4GRTA 1E1KA 1NHSA 1VG0A 5U25A 3KPKA 4CBQA 3CNPA 1TDOA 1PJ6A 2R0GA 4RG4A 3QFBA 3UP4A 3AE7A 4K5SA 4Z25A 1VG9A 3IHMA 4Z43A 4NWZA 1YY5A 2PYXA 2BA9A 4ICYA 3T0KA 1YQZA 3NK0X 2WOVA 2XLUA 4CCRA 3CNJA 2OALA 2YVFA 2R45A 4P9SA 3UKLA 1ZKQA 1ZY8A 4I59A 3NK2X 5GSNA 1KNRA 2BK3A 1PDHA 3CGCA 3G5RA 2R4EA 4A7AA 2YVJA 3GWDA 2OAMA 4X4JA 2GV8A 1FEAA 1LVLA 2YLTA 3VRDB 1B8SA 4WX1A 1BGJA 4UDQA 2C3CA 2OA1A 2ZZ0A 2NPXA 4AP3A 5KXJA 3T14A 2VVMA 4G73A 1O95A 3GDPA 2YLRA 3HZLA 1BWCA 1OJDA 4XWZA 1FECA 4GF7A 1S2YA 4ZN0A 1Z6LA 3NTAA 4EM3A 2WDQA 4A99A 2BXSA 2B7SA 2WP6A 3DJEA 3AXBA 3BI2A 2R4JA 1GEUA 3GYJA 1YQ3A 1RSGA 2YM2A 4JQ9A 5ER0A 3RP6A 2EQ8A 5KMPA 1GRBA 1JU2A 4XXGA 2ZZBA 1JNZA 4GR1A 1IUUA 2BCPA 3D8XA 4DGKA 3AD7B 5IQ1A 5U1OA 2OLNA 2JK6A 1DNCA 1ZOYA 4J56A 1CC2A 1EL5A 4LA1A 3L1RA 4J57A 1JRZA 3V3NA 2BC0A 3UCLA 4CRTA 3V76A 2RGHA 2R46A 4H4QA 1ZMCA 3ITJA 3WE0A 1DJNA 3E1TA 1DOEA 1S2QA 3EAOA 3S5WA 4G9KA 4JN9A 2FJBA 4OPLA 3AEAA 3IC9A 3SM8A 1FOHA 2C4CA 2YG7A 1F3PA 3AE2A 1CC4A 4TM1A 3IHGA 3KPFA 1E39A 4TM0A 1LQUA 3V3OA 4ZCDA 3NLCA 2XVIA 4TLXA 1KNPA 1EL7A 1NHRA 1X31B 2BS2A 2W0HA 3ATQA 1KSUA 3LXDA 4AOSA 4EQWA 1PJ7A 3KD9A 4TM4A 1FEBA 2C66A 4USRA 4NNJA 2JKCA 1D4DA 4H4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LJ1 A;  2GRT A;  2WOW A;  3RP7 A;  1F8W A;  4YKG A;  5CQF A;  2VVL A;  1N4U A;  1D7Y A;  3UKK A;  2QA2 A;  2YG6 A;  3GMB A;  2GH5 A;  3VR9 A;  2VVL G;  2XLT A;  1DJQ A;  1E7P A;  1IUX A;  2CVJ A;  1MOK A;  2TMD A;  4UDP A;  4B69 A;  2V61 A;  4LII A;  2WP9 A;  4A5L A;  2V5Z A;  1B5Q A;  4U8L A;  2EQ6 A;  4YSZ A;  2A8X A;  2AQJ A;  3AYL A;  1GRT A;  3VRA A;  3DJD A;  2PHH A;  1GND A;  1NPX A;  3NHO X;  4B63 A;  5JCL A;  1NAA A;  3P1W A;  2XLP A;  4RSL A;  3RHA A;  5BUK A;  1ZOV A;  2B9W A;  2GMJ A;  4YXD A;  2R0P A;  1V59 A;  1GPE A;  3BI4 A;  2JB1 A;  3H8I A;  3C4N A;  1XPQ A;  1TDE A;  2C70 A;  3K30 A;  3DJG X;  1JRY A;  3DGH A;  1L9C A;  2WDR A;  3AEC A;  2Q0L A;  2WPC A;  1EBD A;  3K7Q X;  4Z44 A;  4ADW A;  3GSI A;  1F6M A;  1KDG A;  4Y4L A;  1GES A;  2I0Z A;  4WCT A;  3ISH A;  1NG4 A;  2WHD A;  1TYT A;  1L9D A;  1NHP A;  1NHQ A;  4RG3 A;  4DNA A;  2YLX A;  4H2R A;  2R0C A;  1ONF A;  3F8D A;  4Z26 A;  1COY A;  1OJT A;  4U2S A;  4EMJ A;  1JOA A;  4KPR A;  5J7X A;  3UKQ A;  2XFU A;  3UTE A;  3LZX A;  4A65 A;  4YT0 A;  4AT0 A;  4B66 A;  5BRT A;  1GRG A;  5FS6 A;  4M52 A;  3UKF A;  2XFN A;  4PAB A;  4H4P A;  4FK1 C;  1Y56 A;  3B6D A;  2YAU A;  1GRA A;  2GF3 A;  4APN A;  2Y6R A;  1TDN A;  2FJD A;  3CNS A;  1H7W A;  2XLR A;  3CTY A;  5JCK A;  2XFQ A;  3DME A;  4OVI A;  2XVE A;  4K2X A;  3AE4 A;  1GXF A;  2C75 A;  3GD4 A;  3B3R A;  2C73 A;  4JY3 A;  2A89 A;  2YWL A;  3QVR A;  2WU5 A;  4H50 A;  1RYI A;  4YKF A;  5HHF A;  1K0I A;  4H2Q A;  1LV0 A;  2H88 A;  2AAQ A;  5M0Z A;  4C77 A;  2WES A;  3VQR A;  5L46 A;  4KX6 A;  2WPE A;  4UDR A;  5FS8 A;  2QCU A;  2YG4 A;  3QSM A;  4FDC B;  3NYF A;  1VQW A;  1TDK A;  2JB3 A;  1NG3 A;  4O5Q A;  5CKU A;  2YR4 A;  1M6I A;  3M0O A;  2YVG A;  1P2E A;  2GB0 A;  2XFO A;  3NYC A;  5DBJ A;  4B68 A;  1Y56 B;  2YQU A;  3CPH G;  2BCG G;  4A79 A;  3QFA A;  2IVD A;  2CDU A;  4U8P A;  2EQ7 A;  2C67 A;  5JCM A;  2XLS A;  4NTE A;  3K7M X;  1TDF A;  1CJC A;  4A6N A;  5M10 A;  5KWF A;  2O9Z A;  4CCQ A;  2X8C A;  3ABV A;  1D4C A;  1UKV G;  2A87 A;  2ZZC A;  3CPJ G;  4GUV A;  1JNR A;  3C4A A;  1XDI A;  3C96 A;  3H4K A;  4X9M A;  4TLZ A;  3BHK A;  3VRB A;  2RAB A;  4USQ A;  1CJ2 A;  3LB8 A;  4GDE A;  4Z2R A;  2E5V A;  1N1P A;  3L8K A;  5EOW A;  1GOS A;  4REK A;  2X50 A;  4X9N A;  1IUS A;  2YG5 A;  4U8K A;  4K5R A;  3AE6 A;  4U2T A;  3LAD A;  5BVA A;  2WU2 A;  1FCD A;  2E1M A;  3QSE A;  1PXA A;  3I3L A;  3AYJ A;  4EMW A;  1EL8 A;  1PBE A;  2XFP A;  1B37 A;  1XAN A;  4OPG A;  2QA1 A;  3DA1 A;  1LPF A;  2E4G A;  2GR2 A;  1ZP0 A;  3UOX A;  2XDO A;  1GT8 A;  1LTX R;  4A6N B;  1PXB A;  3AEF A;  1CJ3 A;  1Q9I A;  3ALM A;  4H4R A;  3OZ2 A;  4MJW A;  1AOG A;  2X99 A;  2BK5 A;  3Q6J A;  2V60 A;  3BNM A;  4EQS A;  5KOX A;  4U2L A;  1IUW A;  3R9U A;  1BKW A;  3K7T A;  1OJA A;  1W4X A;  2F5Z A;  3RNM A;  1ZDL A;  3RP8 A;  1PBB A;  2BAB A;  3S61 A;  2YLS A;  3FIM B;  2BC1 A;  2GAH B;  3DGZ A;  4YTP A;  4CNJ A;  3OC4 A;  5KRQ A;  1VDC A;  4EIQ A;  2WQY A;  2UZZ A;  5TR3 A;  4JDR A;  2VZ2 A;  5J60 A;  3URH A;  3Q9T A;  1YQ4 A;  4CY8 A;  4OPU A;  2XVH A;  2BS3 A;  3FBS A;  4OPD A;  3GWF A;  4NEW A;  2WOI A;  3UOZ A;  2VRL A;  4BV6 A;  1GSN A;  3NTD A;  4JY2 A;  4H4Y A;  3ZYX A;  1CL0 A;  1OJC A;  4H4Z A;  3ICS A;  1D4E A;  1REO A;  3FMW A;  3CGD A;  4IA6 A;  1K0L A;  1QO8 A;  3ALJ A;  1H82 A;  2GQW A;  2IID A;  2C64 A;  4DSG A;  2ARD A;  5U63 A;  3UP5 A;  3T37 A;  1Q1W A;  1GAL A;  2C76 A;  3ICT A;  2VOU A;  1P2H A;  2YG3 A;  3SFD A;  4EIP A;  1S3B A;  4YSY A;  4H7U A;  3CGB A;  5C2T A;  3EAN A;  3NN0 X;  2BXR A;  3AEB A;  1E1L A;  3JSK A;  4OPI A;  1BZL A;  1IUT A;  2ACZ A;  1CF3 A;  4H4U A;  4H4V A;  3F8R A;  1OJ9 A;  3NG7 X;  4GCM A;  1H81 A;  3BHF A;  4TM3 A;  2VRM A;  3P4P A;  4C5O A;  3G5S A;  3DJJ A;  3DK4 A;  4UP3 A;  3NKS A;  3UTH A;  3DK9 A;  4Y4N A;  5FS7 A;  1PBD A;  3UOY A;  3CPI G;  3AE9 A;  4B65 A;  3KA7 A;  1GRF A;  2V3A A;  3H8L A;  1RP0 A;  3UKA A;  3UOV A;  3NYE A;  4J36 A;  1K0J A;  3M12 A;  1D5T A;  2YM1 A;  3QJ4 A;  2WDV A;  4H4T A;  2JAE A;  4BK2 A;  3QVP A;  2WBA A;  1DOB A;  5KOW A;  1QJD A;  1H84 A;  1FL2 A;  1NEN A;  3LJP A;  2Q7V A;  1F8S A;  3GRS A;  2WP5 A;  4U8O A;  1M64 A;  4H2N A;  4Z24 A;  3GMC A;  4IVM B;  2C65 A;  3D1C A;  4A9W A;  2EQ9 A;  4EMI A;  5IQ4 A;  3NH3 X;  1E6E A;  1GRE A;  3DK8 A;  3G5Q A;  1KFY A;  4DSH A;  3IWA A;  4D03 A;  4Z2T A;  2OLO A;  1IUV A;  3AE8 A;  3FG2 P;  1MO9 A;  2BYB A;  5EB5 A;  3ALL A;  4U8J A;  2Z5Y A;  3AWI A;  2TPR A;  3II4 A;  3P9U A;  4LU6 A;  2YLW A;  4B64 A;  5BUL A;  2NVK X;  5GRT A;  1IJH A;  2YR6 A;  4AT2 A;  5FS9 A;  3NGC X;  1BF3 A;  1S3E A;  4B67 A;  1JRX A;  2GEW A;  2Q0K A;  3COX A;  2VQB A;  2HQM A;  1GRH A;  4I58 A;  2V3B A;  4J34 A;  3I6D A;  3KLJ A;  1ZMD A;  4GDP A;  4NTC A;  2GR3 A;  1PBC A;  2GR1 A;  1O94 A;  3NT6 A;  4HA6 A;  2H89 A;  1NDA A;  2JBV A;  1DOD A;  4NEV A;  3ICR A;  2C7G A;  2APG A;  1QLB A;  4O5U A;  2B7R A;  2C72 A;  4C74 A;  4OPC A;  4J33 A;  2CFY A;  2Y6Q A;  3NNE A;  3VR8 A;  3EF6 A;  3DH9 A;  4FX9 A;  3AB1 A;  1H83 A;  5HYM A;  3O0H A;  4YTM A;  4C3Y A;  4E0V A;  2Z5X A;  3M13 A;  2GVC A;  1KF6 A;  4Y4M A;  3LZW A;  3PVC A;  4BK3 A;  4YSX A;  1TYP A;  1K4Q A;  4IVO B;  3RED A;  3NRN A;  5FMH A;  3SGL A;  4BJZ A;  1HYU A;  1PN0 A;  2WPF A;  4XWR A;  4EM4 A;  2FJE A;  5IPY A;  1E1N A;  2DKH A;  5JCI A;  2FJA A;  1MXT A;  3P4Q A;  1SEZ A;  4N9X A;  3PO7 A;  4Z2U A;  1CC6 A;  1PBF A;  1CJ4 A;  1YKJ A;  4H4S A;  3ATR A;  4ECH A;  2R9Z A;  3CIR A;  2WS3 A;  1PXC A;  3SFE A;  3CGE A;  3QSS A;  1N4W A;  1CHU A;  4BUR A;  4H2P A;  4OCG A;  2GR0 A;  2IVE A;  2WET A;  2YR5 A;  1EL9 A;  3AD8 B;  4YSH A;  1L9E A;  3AYI A;  2B9X A;  4JNA A;  3GDN A;  1LQT A;  4IA5 A;  1GET A;  5EB4 A;  2XVF A;  2XVJ A;  2Q6U A;  3AE5 A;  3GYI A;  2GQF A;  3CND A;  5HY5 A;  1BGN A;  2WEU A;  2JB2 A;  4PAA A;  4BJY A;  1ZX9 A;  2B76 A;  2X8H A;  3CNT A;  2CUL A;  2RGO A;  1B4V A;  4YTN A;  3ADA B;  4IV9 A;  3P4S A;  1GER A;  3IF9 A;  3NN6 X;  1XHC A;  1O5W A;  4B1B A;  3F8P A;  4JNQ A;  4NTD A;  3GRT A;  2BK4 A;  3KKJ A;  1PHH A;  1PS9 A;  1VRQ B;  2YLZ A;  4ZCC A;  2VQ7 A;  4OPT A;  3AEG A;  1H6V A;  1JEH A;  4K7Z A;  4CNK A;  4CY6 A;  4H4X A;  3CN8 A;  2V6O A;  5KVI A;  2J3N A;  3AE3 A;  1DOC A;  3BI5 A;  4FK1 A;  3UKP A;  2DKI A;  3AD9 B;  3UTG A;  3ZDN A;  4C3X A;  5C3J A;  3AEE A;  2AR8 A;  3GD3 A;  3AE1 A;  2BS4 A;  5HXI A;  3UKH A;  1KSS A;  4U8I A;  4K8D A;  3FPZ A;  1L0V A;  3NIX A;  4EQR A;  5JCN A;  1F8R A;  2GMH A;  1GV4 A;  2FBW A;  2XYO A;  1GTE A;  3EPT A;  4U8N A;  3KVE A;  3AED A;  4NZH A;  1Y0P A;  4AOX A;  2XCG A;  4YWO A;  4EQX A;  1PJ5 A;  1TRB A;  2X8G A;  1DXL A;  5LV9 A;  3KU9 A;  4J31 A;  4K22 A;  4U8M A;  1CBO A;  1Q1R A;  1H86 A;  2ZBW A;  1E1M A;  1H7X A;  3UTF A;  4BK1 A;  4HB9 A;  3PS9 A;  3NK1 X;  2QAE A;  2X3N A;  5KVH A;  2C3D A;  1D7L A;  1NEK A;  4J2W A;  2B9Y A;  1ZK7 A;  2BAC A;  2RGJ A;  3LOV A;  4D04 A;  3P4R A;  1N4V A;  1GTH A;  3SQP A;  4AP1 A;  2GAG B;  1ELI A;  5EBK A;  3BNU A;  4GRT A;  1E1K A;  1NHS A;  1VG0 A;  5U25 A;  4CBQ A;  3CNP A;  1TDO A;  1PJ6 A;  2R0G A;  4RG4 A;  3QFB A;  3UP4 A;  3AE7 A;  4K5S A;  4Z25 A;  1VG9 A;  3IHM A;  4Z43 A;  1YY5 A;  2PYX A;  2BA9 A;  4ICY A;  1YQZ A;  3NK0 X;  2WOV A;  2XLU A;  4CCR A;  3CNJ A;  2OAL A;  2YVF A;  2R45 A;  4P9S A;  3UKL A;  1ZKQ A;  1ZY8 A;  4I59 A;  3NK2 X;  5GSN A;  1KNR A;  2BK3 A;  1PDH A;  3CGC A;  3G5R A;  2R4E A;  4A7A A;  2YVJ A;  3GWD A;  2OAM A;  4X4J A;  2GV8 A;  1FEA A;  1LVL A;  2YLT A;  3VRD B;  1B8S A;  4WX1 A;  1BGJ A;  4UDQ A;  2C3C A;  2OA1 A;  2ZZ0 A;  2NPX A;  4AP3 A;  5KXJ A;  2VVM A;  1O95 A;  3GDP A;  2YLR A;  3HZL A;  1BWC A;  1OJD A;  4XWZ A;  1FEC A;  4GF7 A;  1S2Y A;  4ZN0 A;  1Z6L A;  3NTA A;  4EM3 A;  2WDQ A;  4A99 A;  2BXS A;  2B7S A;  2WP6 A;  3DJE A;  3AXB A;  3BI2 A;  2R4J A;  1GEU A;  3GYJ A;  1YQ3 A;  1RSG A;  2YM2 A;  4JQ9 A;  5ER0 A;  3RP6 A;  2EQ8 A;  1GRB A;  1JU2 A;  4XXG A;  2ZZB A;  1JNZ A;  4GR1 A;  1IUU A;  2BCP A;  3D8X A;  4DGK A;  3AD7 B;  5IQ1 A;  5U1O A;  2OLN A;  2JK6 A;  1DNC A;  1ZOY A;  4J56 A;  1CC2 A;  1EL5 A;  4LA1 A;  3L1R A;  4J57 A;  1JRZ A;  3V3N A;  2BC0 A;  3UCL A;  4CRT A;  3V76 A;  2RGH A;  2R46 A;  4H4Q A;  1ZMC A;  3ITJ A;  3WE0 A;  1DJN A;  3E1T A;  1DOE A;  1S2Q A;  3EAO A;  3S5W A;  4JN9 A;  3SM8 A;  2FJB A;  4OPL A;  3AEA A;  3IC9 A;  1FOH A;  2YG7 A;  1F3P A;  3AE2 A;  1CC4 A;  4TM1 A;  3IHG A;  3KPF A;  1E39 A;  4TM0 A;  1LQU A;  3V3O A;  4ZCD A;  3NLC A;  2XVI A;  4TLX A;  1KNP A;  1EL7 A;  1NHR A;  1X31 B;  2BS2 A;  2W0H A;  3ATQ A;  1KSU A;  3LXD A;  4AOS A;  4EQW A;  1PJ7 A;  3KD9 A;  4TM4 A;  1FEB A;  2C66 A;  4USR A;  2JKC A;  1D4D A;  4H4W A; 
#chains in the Genus database with same CATH topology
 1LJ1 A;  2GRT A;  2WOW A;  3RP7 A;  1F8W A;  4YKG A;  5CQF A;  2VVL A;  1N4U A;  1D7Y A;  3UKK A;  2QA2 A;  2YG6 A;  3GMB A;  2GH5 A;  3VR9 A;  2VVL G;  2XLT A;  1DJQ A;  1E7P A;  1IUX A;  2CVJ A;  1MOK A;  2TMD A;  4UDP A;  4B69 A;  2V61 A;  4LII A;  2WP9 A;  4A5L A;  2V5Z A;  1B5Q A;  4U8L A;  2EQ6 A;  4YSZ A;  2A8X A;  2AQJ A;  3AYL A;  1GRT A;  3VRA A;  3DJD A;  2PHH A;  1GND A;  1NPX A;  3NHO X;  4B63 A;  5JCL A;  1NAA A;  3P1W A;  2XLP A;  4RSL A;  3RHA A;  5BUK A;  1ZOV A;  2B9W A;  2GMJ A;  4YXD A;  2R0P A;  1V59 A;  1GPE A;  3BI4 A;  2JB1 A;  3H8I A;  3C4N A;  1XPQ A;  1TDE A;  2C70 A;  3K30 A;  3DJG X;  3HYV A;  4G74 A;  1JRY A;  3DGH A;  1L9C A;  2WDR A;  3AEC A;  2Q0L A;  2WPC A;  1EBD A;  3K7Q X;  4Z44 A;  4ADW A;  3GSI A;  1F6M A;  1KDG A;  4Y4L A;  1GES A;  2I0Z A;  4WCT A;  3ISH A;  1NG4 A;  2WHD A;  1TYT A;  1L9D A;  1NHP A;  1NHQ A;  4RG3 A;  4DNA A;  2YLX A;  4H2R A;  2R0C A;  1ONF A;  3F8D A;  4Z26 A;  1COY A;  1OJT A;  4U2S A;  4EMJ A;  1JOA A;  4KPR A;  5J7X A;  3UKQ A;  2XFU A;  3UTE A;  3LZX A;  4A65 A;  4YT0 A;  4AT0 A;  4B66 A;  5BRT A;  1GRG A;  5FS6 A;  4M52 A;  3UKF A;  4G6G A;  3SYI A;  2XFN A;  4PAB A;  4H4P A;  4FK1 C;  3SX6 A;  1Y56 A;  3B6D A;  2YAU A;  1GRA A;  2GF3 A;  4APN A;  2Y6R A;  1TDN A;  2FJD A;  3CNS A;  1H7W A;  2XLR A;  3CTY A;  5JCK A;  2XFQ A;  3DME A;  4OVI A;  2XVE A;  3T2Z A;  4K2X A;  3AE4 A;  1GXF A;  2C75 A;  3GD4 A;  3B3R A;  2C73 A;  4JY3 A;  2A89 A;  2YWL A;  3QVR A;  2WU5 A;  4H50 A;  1RYI A;  4YKF A;  5HHF A;  1K0I A;  4H2Q A;  1LV0 A;  2H88 A;  2AAQ A;  5M0Z A;  4C77 A;  2WES A;  3VQR A;  5L46 A;  4KX6 A;  2WPE A;  4UDR A;  5FS8 A;  2QCU A;  2YG4 A;  3QSM A;  4FDC B;  3NYF A;  1VQW A;  1TDK A;  2JB3 A;  1NG3 A;  4O5Q A;  5CKU A;  2YR4 A;  1M6I A;  3M0O A;  2YVG A;  1P2E A;  2GB0 A;  2XFO A;  3NYC A;  5DBJ A;  4B68 A;  1Y56 B;  2YQU A;  3CPH G;  2BCG G;  4A79 A;  3QFA A;  2IVD A;  2CDU A;  4U8P A;  2EQ7 A;  2C67 A;  5JCM A;  2XLS A;  4NTE A;  3K7M X;  1TDF A;  1CJC A;  4A6N A;  5M10 A;  5KNL A;  5KWF A;  2O9Z A;  4CCQ A;  2X8C A;  3ABV A;  1D4C A;  1UKV G;  2A87 A;  2ZZC A;  3CPJ G;  4GUV A;  1JNR A;  3C4A A;  1XDI A;  3C96 A;  3H4K A;  4X9M A;  3SZ0 A;  4TLZ A;  3BHK A;  3T2Y A;  3VRB A;  2RAB A;  4USQ A;  1CJ2 A;  3LB8 A;  4GDE A;  4Z2R A;  2E5V A;  1N1P A;  3L8K A;  5EOW A;  1GOS A;  4REK A;  2X50 A;  4X9N A;  1IUS A;  2YG5 A;  4U8K A;  4K5R A;  3AE6 A;  4U2T A;  3LAD A;  5BVA A;  2WU2 A;  1FCD A;  2E1M A;  3QSE A;  1PXA A;  3I3L A;  3AYJ A;  4EMW A;  1EL8 A;  1PBE A;  2XFP A;  1B37 A;  1XAN A;  4OPG A;  2QA1 A;  3DA1 A;  1LPF A;  2E4G A;  2GR2 A;  1ZP0 A;  3UOX A;  2XDO A;  1GT8 A;  1LTX R;  4A6N B;  1PXB A;  3AEF A;  1CJ3 A;  1Q9I A;  3ALM A;  4H4R A;  3OZ2 A;  4MJW A;  1AOG A;  2X99 A;  2BK5 A;  3Q6J A;  2V60 A;  3BNM A;  4EQS A;  5KOX A;  4U2L A;  1IUW A;  3R9U A;  1BKW A;  3K7T A;  1OJA A;  1W4X A;  2F5Z A;  3RNM A;  1ZDL A;  3RP8 A;  1PBB A;  2BAB A;  3S61 A;  2YLS A;  3FIM B;  2BC1 A;  2GAH B;  3DGZ A;  4YTP A;  4CNJ A;  3OC4 A;  5KRQ A;  1VDC A;  4EIQ A;  2WQY A;  2UZZ A;  5TR3 A;  4JDR A;  2VZ2 A;  5J60 A;  3URH A;  3Q9T A;  1YQ4 A;  4CY8 A;  4OPU A;  2XVH A;  2BS3 A;  3FBS A;  4OPD A;  3GWF A;  4NEW A;  2WOI A;  3UOZ A;  2VRL A;  4BV6 A;  1GSN A;  3NTD A;  4JY2 A;  4H4Y A;  3ZYX A;  1CL0 A;  1OJC A;  4H4Z A;  3ICS A;  1D4E A;  1REO A;  3FMW A;  3CGD A;  4IA6 A;  1K0L A;  1QO8 A;  3ALJ A;  1H82 A;  2GQW A;  2IID A;  2C64 A;  4DSG A;  2ARD A;  5U63 A;  3UP5 A;  3T37 A;  1Q1W A;  3GYX A;  1GAL A;  3HYW A;  2C76 A;  3ICT A;  2VOU A;  1P2H A;  2YG3 A;  3SFD A;  4EIP A;  1S3B A;  4YSY A;  4H7U A;  3CGB A;  5C2T A;  3EAN A;  3NN0 X;  2BXR A;  3AEB A;  1E1L A;  3JSK A;  4OPI A;  1BZL A;  1IUT A;  4II2 A;  2ACZ A;  1CF3 A;  4H4U A;  4H4V A;  3F8R A;  1OJ9 A;  3NG7 X;  4GCM A;  1H81 A;  3BHF A;  4TM3 A;  2BRY A;  2VRM A;  3P4P A;  4C5O A;  4GAV A;  3G5S A;  3DJJ A;  3DK4 A;  4UP3 A;  3NKS A;  3UTH A;  3DK9 A;  4Y4N A;  3HYX A;  5FS7 A;  1PBD A;  3UOY A;  3CPI G;  3AE9 A;  4B65 A;  3KA7 A;  3SY4 A;  1GRF A;  2V3A A;  3H8L A;  1RP0 A;  3UKA A;  3UOV A;  3NYE A;  4J36 A;  1K0J A;  3SZF A;  3M12 A;  1D5T A;  2YM1 A;  3QJ4 A;  2WDV A;  4H4T A;  2JAE A;  4BK2 A;  3QVP A;  2WBA A;  1DOB A;  5KOW A;  1QJD A;  1H84 A;  1FL2 A;  1NEN A;  3LJP A;  2Q7V A;  1F8S A;  3GRS A;  2WP5 A;  4U8O A;  1M64 A;  4H2N A;  4Z24 A;  3GMC A;  4IVM B;  2C65 A;  3D1C A;  4A9W A;  2EQ9 A;  4EMI A;  5IQ4 A;  3NH3 X;  1E6E A;  1GRE A;  3DK8 A;  3G5Q A;  1KFY A;  4DSH A;  3IWA A;  4D03 A;  4Z2T A;  2OLO A;  1IUV A;  3AE8 A;  3FG2 P;  3SZC A;  1MO9 A;  2BYB A;  5EB5 A;  3ALL A;  4U8J A;  2Z5Y A;  3AWI A;  2TPR A;  3II4 A;  3P9U A;  4LU6 A;  2YLW A;  4B64 A;  5BUL A;  2NVK X;  5GRT A;  1IJH A;  2YR6 A;  4AT2 A;  5FS9 A;  3NGC X;  1BF3 A;  1S3E A;  4B67 A;  1JRX A;  2GEW A;  2Q0K A;  3SXI A;  3COX A;  2VQB A;  2HQM A;  1GRH A;  4I58 A;  2V3B A;  4J34 A;  3I6D A;  3KLJ A;  1ZMD A;  4GDP A;  4NTC A;  2GR3 A;  1PBC A;  2GR1 A;  1O94 A;  3NT6 A;  4HA6 A;  2H89 A;  1NDA A;  2JBV A;  1DOD A;  4NEV A;  3ICR A;  2C7G A;  2APG A;  1QLB A;  4O5U A;  2B7R A;  2C72 A;  4C74 A;  4OPC A;  4J33 A;  2CFY A;  2Y6Q A;  3NNE A;  3VR8 A;  3EF6 A;  3DH9 A;  4FX9 A;  3AB1 A;  1H83 A;  5HYM A;  3O0H A;  4YTM A;  4C3Y A;  4E0V A;  2Z5X A;  3M13 A;  2GVC A;  1KF6 A;  4Y4M A;  3LZW A;  3PVC A;  4BK3 A;  4YSX A;  3CMM A;  1TYP A;  4GAP A;  1K4Q A;  4IVO B;  3RED A;  3NRN A;  5FMH A;  3SGL A;  4BJZ A;  1HYU A;  1PN0 A;  2WPF A;  4XWR A;  4EM4 A;  2FJE A;  5IPY A;  1E1N A;  2DKH A;  5JCI A;  2FJA A;  1MXT A;  3P4Q A;  1SEZ A;  4N9X A;  3PO7 A;  4Z2U A;  1CC6 A;  1PBF A;  5KMS A;  1CJ4 A;  1YKJ A;  4H4S A;  3ATR A;  4ECH A;  2R9Z A;  3CIR A;  2WS3 A;  1PXC A;  3SFE A;  3CGE A;  3QSS A;  1N4W A;  1CHU A;  4BUR A;  4H2P A;  4OCG A;  2GR0 A;  2IVE A;  2WET A;  2YR5 A;  1EL9 A;  3AD8 B;  4YSH A;  1L9E A;  3AYI A;  2B9X A;  4JNA A;  3GDN A;  1LQT A;  4IA5 A;  1GET A;  5EB4 A;  2XVF A;  2XVJ A;  2Q6U A;  3AE5 A;  3GYI A;  2GQF A;  3CND A;  5HY5 A;  1BGN A;  2WEU A;  2JB2 A;  4PAA A;  4BJY A;  1ZX9 A;  2B76 A;  2X8H A;  3CNT A;  2CUL A;  2RGO A;  1B4V A;  4YTN A;  3ADA B;  4IV9 A;  3P4S A;  1GER A;  3IF9 A;  3NN6 X;  1XHC A;  1O5W A;  4II3 A;  3F8P A;  4B1B A;  4JNQ A;  4NTD A;  3GRT A;  2BK4 A;  3KKJ A;  1PHH A;  1PS9 A;  1VRQ B;  2YLZ A;  4ZCC A;  2VQ7 A;  4OPT A;  3AEG A;  1H6V A;  1JEH A;  4K7Z A;  4CNK A;  4CY6 A;  4H4X A;  3CN8 A;  2V6O A;  5KVI A;  2J3N A;  3AE3 A;  1DOC A;  3BI5 A;  4FK1 A;  3UKP A;  2DKI A;  3AD9 B;  3UTG A;  3ZDN A;  4C3X A;  5C3J A;  3AEE A;  2AR8 A;  3GD3 A;  3AE1 A;  2BS4 A;  5HXI A;  3UKH A;  1KSS A;  4U8I A;  4K8D A;  3FPZ A;  1L0V A;  3NIX A;  4G6H A;  4EQR A;  1F8R A;  5JCN A;  2GMH A;  1GV4 A;  2FBW A;  2XYO A;  3SZW A;  1GTE A;  3EPT A;  4U8N A;  3KVE A;  3AED A;  4NZH A;  1Y0P A;  5KMQ A;  4AOX A;  2XCG A;  4YWO A;  4EQX A;  2BRA A;  1PJ5 A;  1TRB A;  5KMR A;  2X8G A;  1DXL A;  5LV9 A;  3KU9 A;  4J31 A;  4K22 A;  4U8M A;  1CBO A;  1Q1R A;  3T2K A;  1H86 A;  2ZBW A;  1E1M A;  1H7X A;  3UTF A;  4BK1 A;  4HB9 A;  3PS9 A;  3NK1 X;  2QAE A;  2X3N A;  5KVH A;  2C3D A;  1D7L A;  1NEK A;  4J2W A;  2B9Y A;  1ZK7 A;  2BAC A;  2RGJ A;  3T31 A;  3LOV A;  4D04 A;  3P4R A;  1N4V A;  1GTH A;  3SQP A;  4AP1 A;  2GAG B;  1ELI A;  5EBK A;  3BNU A;  4GRT A;  1E1K A;  1NHS A;  1VG0 A;  5U25 A;  3KPK A;  4CBQ A;  3CNP A;  1TDO A;  1PJ6 A;  2R0G A;  4RG4 A;  3QFB A;  3UP4 A;  3AE7 A;  4K5S A;  4Z25 A;  1VG9 A;  3IHM A;  4Z43 A;  4NWZ A;  1YY5 A;  2PYX A;  2BA9 A;  4ICY A;  3T0K A;  1YQZ A;  3NK0 X;  2WOV A;  2XLU A;  4CCR A;  3CNJ A;  2OAL A;  2YVF A;  2R45 A;  4P9S A;  3UKL A;  1ZKQ A;  1ZY8 A;  4I59 A;  3NK2 X;  5GSN A;  1KNR A;  2BK3 A;  1PDH A;  3CGC A;  3G5R A;  2R4E A;  4A7A A;  2YVJ A;  3GWD A;  2OAM A;  4X4J A;  2GV8 A;  1FEA A;  1LVL A;  2YLT A;  3VRD B;  1B8S A;  4WX1 A;  1BGJ A;  4UDQ A;  2C3C A;  2OA1 A;  2ZZ0 A;  2NPX A;  4AP3 A;  5KXJ A;  3T14 A;  2VVM A;  4G73 A;  1O95 A;  3GDP A;  2YLR A;  3HZL A;  1BWC A;  1OJD A;  4XWZ A;  1FEC A;  4GF7 A;  1S2Y A;  4ZN0 A;  1Z6L A;  3NTA A;  4EM3 A;  2WDQ A;  4A99 A;  2BXS A;  2B7S A;  2WP6 A;  3DJE A;  3AXB A;  3BI2 A;  2R4J A;  1GEU A;  3GYJ A;  1YQ3 A;  1RSG A;  2YM2 A;  4JQ9 A;  5ER0 A;  3RP6 A;  2EQ8 A;  5KMP A;  1GRB A;  1JU2 A;  4XXG A;  2ZZB A;  1JNZ A;  4GR1 A;  1IUU A;  2BCP A;  3D8X A;  4DGK A;  3AD7 B;  5IQ1 A;  5U1O A;  2OLN A;  2JK6 A;  1DNC A;  1ZOY A;  4J56 A;  1CC2 A;  1EL5 A;  4LA1 A;  3L1R A;  4J57 A;  1JRZ A;  3V3N A;  2BC0 A;  3UCL A;  4CRT A;  3V76 A;  2RGH A;  2R46 A;  4H4Q A;  1ZMC A;  3ITJ A;  3WE0 A;  1DJN A;  3E1T A;  1DOE A;  1S2Q A;  3EAO A;  3S5W A;  4G9K A;  4JN9 A;  2FJB A;  4OPL A;  3AEA A;  3IC9 A;  3SM8 A;  1FOH A;  2C4C A;  2YG7 A;  1F3P A;  3AE2 A;  1CC4 A;  4TM1 A;  3IHG A;  3KPF A;  1E39 A;  4TM0 A;  1LQU A;  3V3O A;  4ZCD A;  3NLC A;  2XVI A;  4TLX A;  1KNP A;  1EL7 A;  1NHR A;  1X31 B;  2BS2 A;  2W0H A;  3ATQ A;  1KSU A;  3LXD A;  4AOS A;  4EQW A;  1PJ7 A;  3KD9 A;  4TM4 A;  1FEB A;  2C66 A;  4USR A;  4NNJ A;  2JKC A;  1D4D A;  4H4W A; 
#chains in the Genus database with same CATH homology
 1LJ1 A;  2GRT A;  2WOW A;  3RP7 A;  1F8W A;  4YKG A;  5CQF A;  2VVL A;  1N4U A;  1D7Y A;  3UKK A;  2QA2 A;  2YG6 A;  3GMB A;  2GH5 A;  3VR9 A;  2VVL G;  2XLT A;  1DJQ A;  1E7P A;  1IUX A;  2CVJ A;  1MOK A;  2TMD A;  4UDP A;  4B69 A;  2V61 A;  4LII A;  2WP9 A;  4A5L A;  2V5Z A;  1B5Q A;  4U8L A;  2EQ6 A;  4YSZ A;  2A8X A;  2AQJ A;  3AYL A;  1GRT A;  3VRA A;  3DJD A;  2PHH A;  1GND A;  1NPX A;  3NHO X;  4B63 A;  5JCL A;  1NAA A;  3P1W A;  2XLP A;  4RSL A;  3RHA A;  5BUK A;  1ZOV A;  2B9W A;  2GMJ A;  4YXD A;  2R0P A;  1V59 A;  1GPE A;  3BI4 A;  2JB1 A;  3H8I A;  3C4N A;  1XPQ A;  1TDE A;  2C70 A;  3K30 A;  3DJG X;  3HYV A;  4G74 A;  1JRY A;  3DGH A;  1L9C A;  2WDR A;  3AEC A;  2Q0L A;  2WPC A;  1EBD A;  3K7Q X;  4Z44 A;  4ADW A;  3GSI A;  1F6M A;  1KDG A;  4Y4L A;  1GES A;  2I0Z A;  4WCT A;  3ISH A;  1NG4 A;  2WHD A;  1TYT A;  1L9D A;  1NHP A;  1NHQ A;  4RG3 A;  4DNA A;  2YLX A;  4H2R A;  2R0C A;  1ONF A;  3F8D A;  4Z26 A;  1COY A;  1OJT A;  4U2S A;  4EMJ A;  1JOA A;  4KPR A;  5J7X A;  3UKQ A;  2XFU A;  3UTE A;  3LZX A;  4A65 A;  4YT0 A;  4AT0 A;  4B66 A;  5BRT A;  1GRG A;  5FS6 A;  4M52 A;  3UKF A;  4G6G A;  3SYI A;  2XFN A;  4PAB A;  4H4P A;  4FK1 C;  3SX6 A;  1Y56 A;  3B6D A;  2YAU A;  1GRA A;  2GF3 A;  4APN A;  2Y6R A;  1TDN A;  2FJD A;  3CNS A;  1H7W A;  2XLR A;  3CTY A;  5JCK A;  2XFQ A;  3DME A;  4OVI A;  2XVE A;  3T2Z A;  4K2X A;  3AE4 A;  1GXF A;  2C75 A;  3GD4 A;  3B3R A;  2C73 A;  4JY3 A;  2A89 A;  2YWL A;  3QVR A;  2WU5 A;  4H50 A;  1RYI A;  4YKF A;  5HHF A;  1K0I A;  4H2Q A;  1LV0 A;  2H88 A;  2AAQ A;  5M0Z A;  4C77 A;  2WES A;  3VQR A;  5L46 A;  4KX6 A;  2WPE A;  4UDR A;  5FS8 A;  2QCU A;  2YG4 A;  3QSM A;  4FDC B;  3NYF A;  1VQW A;  1TDK A;  2JB3 A;  1NG3 A;  4O5Q A;  5CKU A;  2YR4 A;  1M6I A;  3M0O A;  2YVG A;  1P2E A;  2GB0 A;  2XFO A;  3NYC A;  5DBJ A;  4B68 A;  1Y56 B;  2YQU A;  3CPH G;  2BCG G;  4A79 A;  3QFA A;  2IVD A;  2CDU A;  4U8P A;  2EQ7 A;  2C67 A;  5JCM A;  2XLS A;  4NTE A;  3K7M X;  1TDF A;  1CJC A;  4A6N A;  5M10 A;  5KNL A;  5KWF A;  2O9Z A;  4CCQ A;  2X8C A;  3ABV A;  1D4C A;  1UKV G;  2A87 A;  2ZZC A;  3CPJ G;  4GUV A;  1JNR A;  3C4A A;  1XDI A;  3C96 A;  3H4K A;  4X9M A;  3SZ0 A;  4TLZ A;  3BHK A;  3T2Y A;  3VRB A;  2RAB A;  4USQ A;  1CJ2 A;  3LB8 A;  4GDE A;  4Z2R A;  2E5V A;  1N1P A;  3L8K A;  5EOW A;  1GOS A;  4REK A;  2X50 A;  4X9N A;  1IUS A;  2YG5 A;  4U8K A;  4K5R A;  3AE6 A;  4U2T A;  3LAD A;  5BVA A;  2WU2 A;  1FCD A;  2E1M A;  3QSE A;  1PXA A;  3I3L A;  3AYJ A;  4EMW A;  1EL8 A;  1PBE A;  2XFP A;  1B37 A;  1XAN A;  4OPG A;  2QA1 A;  3DA1 A;  1LPF A;  2E4G A;  2GR2 A;  1ZP0 A;  3UOX A;  2XDO A;  1GT8 A;  1LTX R;  4A6N B;  1PXB A;  3AEF A;  1CJ3 A;  1Q9I A;  3ALM A;  4H4R A;  3OZ2 A;  4MJW A;  1AOG A;  2X99 A;  2BK5 A;  3Q6J A;  2V60 A;  3BNM A;  4EQS A;  5KOX A;  4U2L A;  1IUW A;  3R9U A;  1BKW A;  3K7T A;  1OJA A;  1W4X A;  2F5Z A;  3RNM A;  1ZDL A;  3RP8 A;  1PBB A;  2BAB A;  3S61 A;  2YLS A;  3FIM B;  2BC1 A;  2GAH B;  3DGZ A;  4YTP A;  4CNJ A;  3OC4 A;  5KRQ A;  1VDC A;  4EIQ A;  2WQY A;  2UZZ A;  5TR3 A;  4JDR A;  2VZ2 A;  5J60 A;  3URH A;  3Q9T A;  1YQ4 A;  4CY8 A;  4OPU A;  2XVH A;  2BS3 A;  3FBS A;  4OPD A;  3GWF A;  4NEW A;  2WOI A;  3UOZ A;  2VRL A;  4BV6 A;  1GSN A;  3NTD A;  4JY2 A;  4H4Y A;  3ZYX A;  1CL0 A;  1OJC A;  4H4Z A;  3ICS A;  1D4E A;  1REO A;  3FMW A;  3CGD A;  4IA6 A;  1K0L A;  1QO8 A;  3ALJ A;  1H82 A;  2GQW A;  2IID A;  2C64 A;  4DSG A;  2ARD A;  5U63 A;  3UP5 A;  3T37 A;  1Q1W A;  3GYX A;  1GAL A;  3HYW A;  2C76 A;  3ICT A;  2VOU A;  1P2H A;  2YG3 A;  3SFD A;  4EIP A;  1S3B A;  4YSY A;  4H7U A;  3CGB A;  5C2T A;  3EAN A;  3NN0 X;  2BXR A;  3AEB A;  1E1L A;  3JSK A;  4OPI A;  1BZL A;  1IUT A;  4II2 A;  2ACZ A;  1CF3 A;  4H4U A;  4H4V A;  3F8R A;  1OJ9 A;  3NG7 X;  4GCM A;  1H81 A;  3BHF A;  4TM3 A;  2BRY A;  2VRM A;  3P4P A;  4C5O A;  4GAV A;  3G5S A;  3DJJ A;  3DK4 A;  4UP3 A;  3NKS A;  3UTH A;  3DK9 A;  4Y4N A;  3HYX A;  5FS7 A;  1PBD A;  3UOY A;  3CPI G;  3AE9 A;  4B65 A;  3KA7 A;  3SY4 A;  1GRF A;  2V3A A;  3H8L A;  1RP0 A;  3UKA A;  3UOV A;  3NYE A;  4J36 A;  1K0J A;  3SZF A;  3M12 A;  1D5T A;  2YM1 A;  3QJ4 A;  2WDV A;  4H4T A;  2JAE A;  4BK2 A;  3QVP A;  2WBA A;  1DOB A;  5KOW A;  1QJD A;  1H84 A;  1FL2 A;  1NEN A;  3LJP A;  2Q7V A;  1F8S A;  3GRS A;  2WP5 A;  4U8O A;  1M64 A;  4H2N A;  4Z24 A;  3GMC A;  4IVM B;  2C65 A;  3D1C A;  4A9W A;  2EQ9 A;  4EMI A;  5IQ4 A;  3NH3 X;  1E6E A;  1GRE A;  3DK8 A;  3G5Q A;  1KFY A;  4DSH A;  3IWA A;  4D03 A;  4Z2T A;  2OLO A;  1IUV A;  3AE8 A;  3FG2 P;  3SZC A;  1MO9 A;  2BYB A;  5EB5 A;  3ALL A;  4U8J A;  2Z5Y A;  3AWI A;  2TPR A;  3II4 A;  3P9U A;  4LU6 A;  2YLW A;  4B64 A;  5BUL A;  2NVK X;  5GRT A;  1IJH A;  2YR6 A;  4AT2 A;  5FS9 A;  3NGC X;  1BF3 A;  1S3E A;  4B67 A;  1JRX A;  2GEW A;  2Q0K A;  3SXI A;  3COX A;  2VQB A;  2HQM A;  1GRH A;  4I58 A;  2V3B A;  4J34 A;  3I6D A;  3KLJ A;  1ZMD A;  4GDP A;  4NTC A;  2GR3 A;  1PBC A;  2GR1 A;  1O94 A;  3NT6 A;  4HA6 A;  2H89 A;  1NDA A;  2JBV A;  1DOD A;  4NEV A;  3ICR A;  2C7G A;  2APG A;  1QLB A;  4O5U A;  2B7R A;  2C72 A;  4C74 A;  4OPC A;  4J33 A;  2CFY A;  2Y6Q A;  3NNE A;  3VR8 A;  3EF6 A;  3DH9 A;  4FX9 A;  3AB1 A;  1H83 A;  5HYM A;  3O0H A;  4YTM A;  4C3Y A;  4E0V A;  2Z5X A;  3M13 A;  2GVC A;  1KF6 A;  4Y4M A;  3LZW A;  3PVC A;  4BK3 A;  4YSX A;  3CMM A;  1TYP A;  4GAP A;  1K4Q A;  4IVO B;  3RED A;  3NRN A;  5FMH A;  3SGL A;  4BJZ A;  1HYU A;  1PN0 A;  2WPF A;  4XWR A;  4EM4 A;  2FJE A;  5IPY A;  1E1N A;  2DKH A;  5JCI A;  2FJA A;  1MXT A;  3P4Q A;  1SEZ A;  4N9X A;  3PO7 A;  4Z2U A;  1CC6 A;  1PBF A;  5KMS A;  1CJ4 A;  1YKJ A;  4H4S A;  3ATR A;  4ECH A;  2R9Z A;  3CIR A;  2WS3 A;  1PXC A;  3SFE A;  3CGE A;  3QSS A;  1N4W A;  1CHU A;  4BUR A;  4H2P A;  4OCG A;  2GR0 A;  2IVE A;  2WET A;  2YR5 A;  1EL9 A;  3AD8 B;  4YSH A;  1L9E A;  3AYI A;  2B9X A;  4JNA A;  3GDN A;  1LQT A;  4IA5 A;  1GET A;  5EB4 A;  2XVF A;  2XVJ A;  2Q6U A;  3AE5 A;  3GYI A;  2GQF A;  3CND A;  5HY5 A;  1BGN A;  2WEU A;  2JB2 A;  4PAA A;  4BJY A;  1ZX9 A;  2B76 A;  2X8H A;  3CNT A;  2CUL A;  2RGO A;  1B4V A;  4YTN A;  3ADA B;  4IV9 A;  3P4S A;  1GER A;  3IF9 A;  3NN6 X;  1XHC A;  1O5W A;  4II3 A;  3F8P A;  4B1B A;  4JNQ A;  4NTD A;  3GRT A;  2BK4 A;  3KKJ A;  1PHH A;  1PS9 A;  1VRQ B;  2YLZ A;  4ZCC A;  2VQ7 A;  4OPT A;  3AEG A;  1H6V A;  1JEH A;  4K7Z A;  4CNK A;  4CY6 A;  4H4X A;  3CN8 A;  2V6O A;  5KVI A;  2J3N A;  3AE3 A;  1DOC A;  3BI5 A;  4FK1 A;  3UKP A;  2DKI A;  3AD9 B;  3UTG A;  3ZDN A;  4C3X A;  5C3J A;  3AEE A;  2AR8 A;  3GD3 A;  3AE1 A;  2BS4 A;  5HXI A;  3UKH A;  1KSS A;  4U8I A;  4K8D A;  3FPZ A;  1L0V A;  3NIX A;  4G6H A;  4EQR A;  1F8R A;  5JCN A;  2GMH A;  1GV4 A;  2FBW A;  2XYO A;  3SZW A;  1GTE A;  3EPT A;  4U8N A;  3KVE A;  3AED A;  4NZH A;  1Y0P A;  5KMQ A;  4AOX A;  2XCG A;  4YWO A;  4EQX A;  2BRA A;  1PJ5 A;  1TRB A;  5KMR A;  2X8G A;  1DXL A;  5LV9 A;  3KU9 A;  4J31 A;  4K22 A;  4U8M A;  1CBO A;  1Q1R A;  3T2K A;  1H86 A;  2ZBW A;  1E1M A;  1H7X A;  3UTF A;  4BK1 A;  4HB9 A;  3PS9 A;  3NK1 X;  2QAE A;  2X3N A;  5KVH A;  2C3D A;  1D7L A;  1NEK A;  4J2W A;  2B9Y A;  1ZK7 A;  2BAC A;  2RGJ A;  3T31 A;  3LOV A;  4D04 A;  3P4R A;  1N4V A;  1GTH A;  3SQP A;  4AP1 A;  2GAG B;  1ELI A;  5EBK A;  3BNU A;  4GRT A;  1E1K A;  1NHS A;  1VG0 A;  5U25 A;  3KPK A;  4CBQ A;  3CNP A;  1TDO A;  1PJ6 A;  2R0G A;  4RG4 A;  3QFB A;  3UP4 A;  3AE7 A;  4K5S A;  4Z25 A;  1VG9 A;  3IHM A;  4Z43 A;  4NWZ A;  1YY5 A;  2PYX A;  2BA9 A;  4ICY A;  3T0K A;  1YQZ A;  3NK0 X;  2WOV A;  2XLU A;  4CCR A;  3CNJ A;  2OAL A;  2YVF A;  2R45 A;  4P9S A;  3UKL A;  1ZKQ A;  1ZY8 A;  4I59 A;  3NK2 X;  5GSN A;  1KNR A;  2BK3 A;  1PDH A;  3CGC A;  3G5R A;  2R4E A;  4A7A A;  2YVJ A;  3GWD A;  2OAM A;  4X4J A;  2GV8 A;  1FEA A;  1LVL A;  2YLT A;  3VRD B;  1B8S A;  4WX1 A;  1BGJ A;  4UDQ A;  2C3C A;  2OA1 A;  2ZZ0 A;  2NPX A;  4AP3 A;  5KXJ A;  3T14 A;  2VVM A;  4G73 A;  1O95 A;  3GDP A;  2YLR A;  3HZL A;  1BWC A;  1OJD A;  4XWZ A;  1FEC A;  4GF7 A;  1S2Y A;  4ZN0 A;  1Z6L A;  3NTA A;  4EM3 A;  2WDQ A;  4A99 A;  2BXS A;  2B7S A;  2WP6 A;  3DJE A;  3AXB A;  3BI2 A;  2R4J A;  1GEU A;  3GYJ A;  1YQ3 A;  1RSG A;  2YM2 A;  4JQ9 A;  5ER0 A;  3RP6 A;  2EQ8 A;  5KMP A;  1GRB A;  1JU2 A;  4XXG A;  2ZZB A;  1JNZ A;  4GR1 A;  1IUU A;  2BCP A;  3D8X A;  4DGK A;  3AD7 B;  5IQ1 A;  5U1O A;  2OLN A;  2JK6 A;  1DNC A;  1ZOY A;  4J56 A;  1CC2 A;  1EL5 A;  4LA1 A;  3L1R A;  4J57 A;  1JRZ A;  3V3N A;  2BC0 A;  3UCL A;  4CRT A;  3V76 A;  2RGH A;  2R46 A;  4H4Q A;  1ZMC A;  3ITJ A;  3WE0 A;  1DJN A;  3E1T A;  1DOE A;  1S2Q A;  3EAO A;  3S5W A;  4G9K A;  4JN9 A;  2FJB A;  4OPL A;  3AEA A;  3IC9 A;  3SM8 A;  1FOH A;  2C4C A;  2YG7 A;  1F3P A;  3AE2 A;  1CC4 A;  4TM1 A;  3IHG A;  3KPF A;  1E39 A;  4TM0 A;  1LQU A;  3V3O A;  4ZCD A;  3NLC A;  2XVI A;  4TLX A;  1KNP A;  1EL7 A;  1NHR A;  1X31 B;  2BS2 A;  2W0H A;  3ATQ A;  1KSU A;  3LXD A;  4AOS A;  4EQW A;  1PJ7 A;  3KD9 A;  4TM4 A;  1FEB A;  2C66 A;  4USR A;  4NNJ A;  2JKC A;  1D4D A;  4H4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...