2XVSA

Crystal structure of human ttc5 (strap) c-terminal ob domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
166
structure length
166
Chain Sequence
SMRQREQQLLEFLDRLTSLLESKGKVKTKKLQSMLGSLRPAHLGPCSDGHYQSASGQKVTLELKPLSTLQPGVNSGAVILGKVVFSLTTEEKVPFTFGLVDSDGPCYAVMVYNIVQSWGVLIGDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The P53 Cofactor Strap Exhibits an Unexpected Tpr Motif and Oligonucleotide-Binding (Ob)-Fold Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords TETRATRICOPEPTIDE REPEAT PROTEIN 5
total genus 43
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2010-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.550 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xvsA00
4ABNA 2XVSA
chains in the Genus database with same CATH superfamily
4S3SA 2E8GA 1TS4A 4IJLA 1SNCA 5LMUL 1V1QA 2I0QA 2K32A 3MAQA 1EQVA 4JI4L 2Z8LA 1SNOA 1HFNA 5I2YA 2ZM6L 1B1ZA 4DV3Q 5C4HA 1VQ6A 3ULPA 1PDQA 4JI1L 1D1IA 3IKJA 1C9OA 1IBML 4IO9A 2E2HB 2FFKB 1U4RA 1YNNC 4IUVA 1XPRA 1EY9A 2DN8A 3KBXA 4Y7NH 3CD6A 1ILQA 3DM3A 4C3HB 5C6AA 4NMZA 3KOJA 3TP7A 3KJPA 3M7NA 3SK8A 2JEAI 4IPHA 2ICEC 2AMCB 2LKVA 5GROA 3D4DA 3N52A 2IX3A 3CCQA 1I50H 1LTBD 1VQ9A 3LGJA 5LMNL 2KA7A 1YHQA 3ND8A 3PF4A 3T16A 4M1UB 3TRZA 1GUTA 1JE5A 1SSOA 2RCFA 5EPLA 1CA6A 1KAWA 5L37A 2G9HD 4JYAQ 4JBWA 2JA7B 3CW2C 2B2YA 2B2UA 2B2YC 1LT4D 1X9NA 3S2HB 3ERSX 1ESRA 1PZID 2F0VA 5IE8A 1UEAB 3D4RA 1XX8A 1X6OA 4CDDC 4JBKA 1PTOB 1S5FD 3OMCA 1LTLA 4GKKL 2UXCL 1QILA 4DR1Q 2J0TD 3CPWA 1HNWQ 1EYGA 4MTKA 2L55A 2H1EA 4A3KH 1A3UA 3K0XA 2G5DA 4ABNA 2JA5G 4TVAB 3PUWA 1K8GA 3I7FA 2F4VL 2JA6B 1EZ8A 2CQAA 4YHHQ 2KUMA 1JJCB 4XTCS 3H09A 4B3SQ 2Y0SE 1B8AA 5E1FA 3UDGA 2A8VA 4A3JH 4ALPA 2R7FA 2JQOA 3RZDB 2NVXB 3FPUB 4K14A 4HN7A 1WTRA 2ES2A 4QF4A 2RDGA 1IBKL 4MIUA 2N3SA 1TWFB 4IZ8A 3M7GA 3WWVA 1KNAA 4MN3A 4KV6A 5CV4A 5C0XG 1CZWA 2WFWA 4DN4M 2ZTCA 1ENCA 2NVTH 3DUZA 5JOBA 2XN9C 4A93G 3GTLH 1BXTA 3Q23A 1MBYA 2O5JC 1KDBA 2XSCA 2PNHA 1EL0A 3MTSA 1GO3E 1K8MA 4X3SA 4IOCA 2A68C 4KHPL 5EKIA 2F4VQ 2EYJA 4C3IH 4UAIA 5C44B 3PUYA 4G7HC 1G6PA 3CCUA 4UY8C 4IFDG 4A3KB 2CVRA 2JK8A 4DV1L 1I6HB 4DR1L 5T1IA 3TQYA 1UUPA 1RF2D 1SYCA 2EZVA 2I5LX 4IPCA 3NSWA 3ULJA 4QGUA 3NWTA 3TS0A 2QF7A 4DV4L 4X3KA 2Z4IA 5M3FB 5C3EH 1KD1C 4H02A 2K1BA 3BS1A 1JWMD 1Y8NB 3PUVA 4RA8A 3GTKH 2JA5H 2NUCA 4TSSA 3T1HQ 4ZKBB 1QOHA 5FO9B 4ME3A 4OX9Q 1EZ6A 5LL6X 3J81c 2L5TA 3OMGA 1PA6A 5G3LF 4QUCA 5TSSA 4DK1A 3STBC 4K5WA 3HGBA 1OO9B 1S40A 3J7ZC 2K04A 1JJGA 1K83B 3OWFA 5LMNQ 2EYMA 4A3BH 2F3WA 3L2PA 5IGBA 2VXWA 3SK6A 1B3AA 1VCIA 3E5SA 2CW0C 1CSPA 2ZXOA 4J6HA 4K6DA 2XNAC 3MC0B 1N36Q 4ZAIA 4DUZL 5J3BA 4XT3B 1TY2A 3VR3A 4C3JB 1CKNB 1SAPA 3I55A 4RKLA 5M5YB 4R4TA 5I9PA 1SJED 4RAUC 1NUCA 4POFA 1VQAA 4POGA 1LABA 2K5NA 4BBRH 1S72A 1MHWC 5ELBA 4HIDA 1GJXA 2IPKD 3U4VA 5JVG3 3PO3B 1SYDA 4LFAL 1NMFA 5HURA 2Z6KC 1WD0A 3OTOQ 1YNND 1EIFA 5DAUA 2R3ZA 4DV5Q 3WOFA 3RZOH 1AN8A 4U673 5IGGA 3SGIA 1I94Q 4K6LA 4GN5A 2BE5D 4TKOB 4QCLA 4TRDA 1SNQA 1IBKQ 1PH2A 4ZK9B 3FKIG 1SLJA 1JQYD 4BS9A 4HMIA 1EEFD 1T5EA 4OXPA 3ZYYX 1HNXQ 2B63B 3HOYG 3OPOA 4B3RQ 1QB5D 2M00A 4A3IG 3G6EA 1ZYRD 2ZTDA 4A3EH 1DOKA 2K5HA 2N55A 1G291 2K5VA 3CQZB 4F87A 4FF1A 2BH8A 2JXMB 2Q2HA 3NK9A 2L12A 3QWNA 3SDZA 1EFID 4Q0FA 2VW9A 4L6TB 3KK7A 4LFBQ 4EVOA 2L0CA 1SFOH 1HZBA 4DR6L 4DV4Q 3HZXA 1X65A 1X56A 1CT1D 3I91A 4NXNL 1CQFA 3FPPA 3EN2A 3PO2B 2FINB 3GV6A 5IWAL 1W6KA 3NELA 3VYSA 2N88A 5KNCA 1WCMB 2VS1A 2E2IH 3I56A 1VQ8A 1F2YA 1FL0A 3BDCA 4XT1B 1EIGA 5E4XA 3NTIA 2KHJA 4Q5VA 4NXMQ 1NSNS 2WB1E 2YV5A 2KBNA 3HEJA 1Q3LA 2WAQB 2R61A 1PH6A 4GS3A 2VQEQ 2B2TA 2RVLA 4FXGC 4GNXA 2FHTA 3S16B 1HQMC 1K28A 2MUYA 1I3QH 3W5OA 1PTOH 2R7ZG 1C4QA 1OXSC 3S1RB 4RWSC 4A3IH 1EOTA 4O42A 1GUGA 2KHSA 1TT2A 1TWAB 2Q8TA 4CHTB 2OWOA 3S2HH 2B29A 4IFDJ 1G2TA 3G4SA 4OWTB 2EIFA 3KF6B 3HOXB 1D7QA 3E6ZX 4A93H 4IFDH 5HGQA 2PO4A 1MGSA 1SDFA 1FNUA 5EKLA 1Q90A 1CKOA 4A3JB 1SFOB 5C4XB 1W3SA 3CU7A 3SEBA 2QEXA 1E22A 1RKNA 5CR3A 5CV5A 1SMYC 3AQQA 3I3CA 4L63B 4IUPA 3KLRA 4AYBG 1UE7A 1TWHB 3M4OH 3S1NH 1STGA 2JA6H 4WJ4A 1HTLD 5KIXA 3K5MA 5FJ8H 2F52A 1E2VA 4LMQD 4N8FA 1H9RA 2EY5A 3KF8A 3SK4A 4R4CA 4X65L 1O7IA 3DEPA 2ATWA 4RG1A 3EA6A 3TP5A 4DR2L 1XYIA 4LF9L 1HRJA 3IRBA 1A0IA 3HOZH 4DKAC 4OO1H 1MJEA 2VUMH 1F9RA 3KFUA 2VQEL 1EWCA 1K0RA 3RN5A 3KUPA 5EQ0A 4BBSB 1I5FA 1EU3A 3RD4A 4K2LA 3VR4A 2HQLA 4Y52H 3NE5B 3VA7A 2B8GA 5C4ZA 3J81L 3MVVA 4JG2A 1Q86C 4N8X1 4XYQA 3URYA 5FLMH 4CKCA 1IYUA 3QOLA 2ZJQA 1DCZA 1UE5A 3SE0A 4OX9L 4JI6Q 3FP9A 1WJJA 3BG3A 4C3JH 4M8AA 4BA2I 1NE3A 4A3KG 2NN6G 5BN5A 5M5XH 3CF5A 3L0OA 2E5LQ 4LFCL 1WTVA 3HG9A 4GOPB 1FNWA 4X66Q 1YZ6A 2L1BA 3G48A 2LXKA 2V1CC 3KLWA 5CBAE 4C3HG 2F0LA 1KL9A 2QDLA 1EY6A 3BZCA 3H94A 5GQOA 3J80L 1QUQA 2YU9B 4H44C 1TWHH 3IAYA 4FF3A 1STEA 1BUVT 5AFWA 4A4IA 5I4DA 1YNXA 1FJGL 3HOZG 4DUZQ 5ELFA 4OWXB 1EOVA 4B9XA 4LF6L 2SEBD 1YJNA 1STNA 2FJ2A 3MWYW 4A3EB 4CKEA 2J7ZA 3I4NG 1KRSA 3TREA 4YY3L 1EIHA 2UXBQ 1FR3A 5ELCA 5JJZA 5JEAG 1Q81C 1SN8A 4OO1G 4OL7A 1SE4A 4DPGA 3ERQA 4IJHA 2F0MA 3K0YA 1BVSA 2EY1A 1O80A 2R93H 2IJ0A 4JV5Q 1I6HH 2A69C 1DM0B 1A63A 3GTOB 4FDBA 2NZ1D 3Q24A 4KN4C 2ZTEA 4DFAA 1FD7D 2E2DC 3M4YA 3NTHA 1V43A 3F1ZA 2F0NA 3F2DA 4FF4A 2F3VA 4GN4B 1SE3A 1TU2B 2MQHA 2YYZA 2Z0SA 3FEWX 2F0KA 2F0EA 1WTXA 4BY7H 2EQSA 1F9QA 3MXUA 4KK7A 1EY8A 3T53B 1WTPA 2E2IB 5C4JB 1GUNA 4FNFA 2Z4HA 1BCPD 4EQPA 4LFCQ 1YJWA 5J39A 3NENA 3GTLB 2OTLA 4BXXG 4R4QA 3TZUA 2ENBA 2Q8IB 1LACA 2PW5A 1I3QB 5A2QL 1HNWL 4HJ9A 2A5HA 1H95A 3I4MB 2WINB 3CCEA 1YHAA 5C5LA 1JB7A 3H15A 1Z6HA 2L11A 3GTGH 4DV6Q 2JA7G 3A5UA 3A0JA 1VQHA 2QA4A 2IX1A 5E7NA 1FJGQ 2F0WA 1SYBA 3U4ZA 3CRKC 4HSPA 2XWJB 4PG3A 3MA2B 1Y14B 4P73A 3G71A 3N6RA 1XTDA 1ZXTA 5ELEA 2KHIA 3BVMA 1Y8PB 1C48A 3F8TA 1BCPC 1VS0A 4A3LG 2R93G 3DM1A 1IXRA 4KI0A 1EQQA 3GTQH 3LX0A 1K3BC 4C1NI 3HOWG 3S17H 2Y0SB 4BY7B 3BVGA 4K8JA 4NKLA 1Q1EA 4Y7NB 1CTMA 2EJMA 5D14A 1Z7TA 2C9OA 5M3FG 3A8JE 5C0XH 4QMGA 3U9SA 4JI2L 2RDFA 4DV0Q 4RH6A 1SROA 1VQ5A 3DLLA 4QY7A 1II3A 3A56A 2WAQG 4FP5D 3FRPB 4DK0A 5GAEC 5IY0A 3ZJYC 1EYAA 4JK1C 4TQUS 1TIID 4WORA 4KKSA 1G91A 1GUOA 4LFAQ 1UNSA 5IYBG 1VQFA 3J7AF 4HJAA 1A6XA 2UXDL 2KENA 4HCSA 3QB3A 4L8JA 1J6QA 4X62L 4ID6A 1YHBA 2RSOA 2RF4A 3L3OC 1ILPA 5C5MA 2OCEA 1KLGD 3H91A 1LT6D 4R8NA 2HQEA 3OSOA 2H5XA 1AE3A 4KHVA 1CM9A 4A3LH 1HPCA 2NN6H 4C3JG 3S1QB 3V2TA 3CCMA 1YBYA 3BU2A 2E2HH 4LUOA 2R92H 1E0BA 3R8BA 1XNQL 3UE0A 1R4QB 4LF8L 5M3FH 1QE6A 4DV7L 4KN7C 4R4IA 4RKBA 4AYBB 4KY7A 1JB3A 3ICEA 1HZAA 1CSQA 2K03A 3E0JA 2RQXA 1PHJA 4LF5Q 2EJFC 3QR8A 1WTWA 1STAA 2WV6D 5IP9H 4ZUJA 5ELNA 2VQFL 2OQKA 1N32Q 2CFMA 5D3IB 4JI7Q 1C8CA 4QQBX 2RSNA 4IUQA 1PYBA 1HJPA 5FOBB 1QNUA 4JYAL 5KYLA 1RIPA 3K5NA 2AUKA 3D8GA 1CZGA 5D65A 3S14B 2HCIA 5IGDA 2NYZD 3PUZA 2EYOA 4P74A 4IURA 4AYBE 1FVIA 1TVXA 2F0TA 1N32L 4YCWA 2HDLA 2PZTA 1I94L 2LXJA 1GM5A 2O2LD 5EKKA 4JI5L 5FK9C 2IL8A 3CMEA 5JPNC 4PQXA 2AUJD 3DEOA 4P71A 2R92G 4FO2A 3ND9A 3CHBD 4RCNA 3J7YW 3AFPA 3ULLA 3S15H 2DY7A 3QOJA 1CQVA 2F4IA 5M5YH 4JW0A 1F77A 1S5ED 1FGBD 1JCKB 1J5EL 3S1QH 4CGYB 3RLNA 1SYFA 3M9BA 3CCVA 4IUUA 1U4LA 4PMWA 2JSOA 4C1NK 2CKZB 3S1NB 4DR6Q 3J81E 2JN4A 4G57A 2A6ED 1NMGA 1WCMG 2B39A 1JJ2A 4JI4Q 2BDOA 2A19A 2GA4B 1RJTA 2C35B 3TMEA 1XJVA 2ZM6Q 3PO3G 4RHRA 3WDNA 3NXWA 1IBLL 2N78A 3KLSA 5I6WA 1DZ1A 4DXFA 5A35A 5BR8L 2BH2A 3HOXH 3O13A 3CCLA 3EQLC 4YWMA 4A75A 2CWPA 4A93B 2WB1B 4NDXA 2IX0A 4DV5L 1EUJA 4K5VA 2XGTA 2JA8H 5EPJA 1B70B 4V0BA 1AZQA 1B7YB 3NBHA 4DAVA 3HOYB 2I46A 1SMYD 5CC4A 2DJGC 2AQ3B 2CH4A 3WOEA 4A3IB 1EU4A 4PZ6A 1PH5A 3MEHA 1LTSD 4GOPA 1JOOA 4LF4L 5M9OA 1P8LA 1XNRQ 3MXNA 1KQSA 2JE6I 3S2DB 3OHXC 5CV6A 2K05A 5IYCG 2XWBB 1VQBA 1T9HA 2E2JH 3GTOH 5EAYA 3J80i 1PH3A 4HIMA 4A3GB 2VL6A 1S5BD 3KDFA 3DMUA 5C3EG 3EVQA 3ONAB 4C3IB 1YIJA 2CCZA 3HKZE 1WCMH 5H1SE 1KLUD 5LHY1 3K81C 2NBFA 1EWHA 1O78A 3K7AH 1HUNA 1A2TA 5FKAC 4KHZA 5C0XI 1JT8A 1WYDA 2DJFC 3OOCA 1HR0W 2A1AA 5DM73 3E9HA 1DONA 2UXBL 2ZXPA 1VMCA 2P5ZX 4RGMA 2XRSD 3R2IA 4DR7Q 4PZ7A 1HNXL 1JWUD 1RHPA 4XQNA 1M90C 3CC2A 3U9OA 1LUZA 3FHWA 3RMHA 3W2DA 1L1OA 2QKIC 2X69A 3I2ZA 2DNEA 1QVGA 4JOIC 3RLFA 2OXPA 1E7ZA 4DU9A 1M4VA 3GTJH 1KNEA 3MXPA 1LV9A 4QB4A 4K8IA 3LWUA 5FLXL 2EPBA 2PI2E 3S14H 1X3EA 1N34L 4KY6A 1HR0Q 2HUGA 1QJOA 3K59A 4ZCKA 2F0DA 4IPGA 5FO7B 5GAHC 3S2DH 5IODA 4GKJQ 1TS5A 5G3LD 5M5WH 4BXXH 3I70A 2E76C 3T51B 1DXMA 1QG7A 1JMCA 3HOVB 3GTMB 3D6WA 1XMOQ 1CHQD 2Z6KA 4BY7G 3JAML 1N33Q 3PO2H 2KCNA 2EY2A 2NVTB 3QJYA 1X54A 3U58A 3H0GB 3HOVH 4J15A 4DNTB 2VUMG 1GD7A 1PTOC 4G7OC 1BBUA 2F0FA 4P2CB 2MJ8A 4R4OA 3T4AC 4YY3Q 1K8AC 3HOZB 3VYTA 2EE1A 4OO1I 3I72A 1VF5C 5KNBA 4HIKA 1PXUA 2GVBA 1H9SA 3AYHB 4OHJA 3KYHC 4IPDA 4A3EG 2MO1A 1QNKA 3R93A 5KGUA 2B63G 1LTRD 2XVSA 1SE8A 1PZKD 1W2BA 4YCUA 5BR8Q 1Q8KA 3OIQA 2HHHL 3IFTA 4RGOS 2SNSA 4UP7A 4DR5Q 1N33L 4KKUA 3FKIH 4GLAC 5E3FA 1JORA 1PV4A 1D1KA 3HKSA 2EYPA 4CJ0B 3NTKA 2UU9Q 2MPMA 1RODA 4FF2A 4CJ1B 2Q2UA 3JAMi 1A15A 4E6IA 1BCPB 1LLRD 4LUZA 4LF5L 1XNRL 3PO2G 4JV5L 2JEBI 2EVBA 3CQZH 1VQ7A 2K33A 1CKNA 1NR4A 2YU9H 4PNYA 3BZKA 1J5EQ 4F88A 5T1GA 3IL8A 1ASYA 1RDPD 3H3VC 3NQIA 1NAPA 4XXEA 2MGSA 1L0YB 1IYJB 3SK5A 1PMRA 1JOQA 1GHJA 4CKBA 4DR3Q 1Y1WG 1QVFA 2RDHA 2B3GA 2F0PA 4HJ7A 4OONA 2B2VA 2JJQA 1BBWA 1VQNA 1ICFB 1VQIA 5M3MH 1WD1A 3BZDB 1DYQA 3Q6SA 2KEDA 4V190 3D3RA 3MZ5A 1SXTA 2EXZA 2F0UA 2LFNA 4JI7L 1NNXA 3EIVA 4DV6L 4B3TL 1Q8IA 1X3PA 3S24A 3D0FA 1KDCA 1WTQA 1JR0D 4O2DA 4A3BG 1GUSA 2UUCL 5IWAQ 1DOLA 1SNDA 5IIFA 1JC7A 5CMDA 2R92B 5C4XG 5EBDA 1H9KA 4NXNQ 4UHVA 2F0HA 5IP9G 1O7ZA 4A3CH 3HOUG 3F2UA 1PTOD 1MJCA 4OGQC 4EQNA 1PFSA 4BBRG 2AWOA 5C0XJ 4EQOA 4CDFC 1TWGH 2Y0SG 3TEHB 2HIVA 4ILWA 2YTYA 3GTKB 2RHSB 3UE1A 2XRQD 1ESFA 4ZKCB 5CORA 3PIPA 3RZOB 4FXKC 4JOIA 4B3RL 4HMJA 1QCBD 1U4PA 3NBHB 2UUCQ 2EYLA 5JVH3 3I4MG 1L1OC 3C1FA 2FXQA 1EYDA 2PQEA 3TP8A 4ZLTF 2K28A 1K9MC 3KDFB 4DAYB 3C46A 3PIO3 4LUVA 5IGFA 1RTNA 1R9TH 1DGSA 3GP7A 3SR1A 4IUNA 2WB1G 2SNMA 3T13A 3CCJA 2B8FA 4OEMB 1G51A 3CAMA 2KEEA 4MZ9A 2OTJA 4HSVA 3UI2A 2MFIA 4X3UA 4WFN3 1KTKA 2QILA 3DHQA 2K5WA 2A73B 2K52A 4H13C 2FMCA 4KLKA 1IW7C 3HOUH 1MKHA 2KCMA 2NZOA 2ZXRA 1Z47A 2I5HA 4DR4L 2NTTA 4ZUIA 3CKIB 4I7AA 3OYYA 4LNQA 2R93B 4XQJA 4CDEC 1PRTF 4MHEA 4GNXC 3HOWB 2M9VA 3OW7A 5A2QE 1TXYA 1J9OA 4C3IG 4HCEA 5EJWA 2D0OA 2LS01 3F2BA 3M4OB 4JI0Q 1HFGA 5HY6A 2ALYB 1ZYRC 1T5XD 1Q7YC 4HJ8A 2JA8G 1ET9A 3EBEA 1HCZA 2O5IC 2SDFA 2WIIB 4K0KL 1AEXA 2B2WC 2QCPX 2YTVA 3RZDH 1PFMA 3TSSA 1K8OA 1HNZL 4A3MB 1D5MC 1ENAA 3DWQA 1TWAH 1BOSA 4A3FH 3I4MH 1ML0D 4DR3L 3NHHA 1V1PA 3I4NB 2EOTA 1TWCH 1Q82C 4IFDI 1U5KA 5KRUA 3BDLA 2ICIA 5IGCA 1VQKA 1GOZA 4WJWA 5COYA 1VF7A 1I4PA 4DR2Q 1XMQQ 1MD2D 4DV2L 4MTNA 1U9RA 5FLXc 2R7DA 4EX5A 4RCOA 1TKWB 5KYIA 1PYWD 1EQTA 1RCVD 3HRZC 2UUBL 3D4WA 3KLSX 1A2UA 4Z9CB 2XTIA 2F0QA 1OXXK 4WRDA 5DEHA 4ZYSA 1KXLA 1KHIA 5KNDA 2D9UA 1EY7A 4LF7Q 1PH4A 4RFBA 1K0SA 3MXNB 1B4OA 2LY7A 4GLXA 3I4LA 1XMQL 2UUBQ 1BQQT 5K5PA 3F2CA 2PQAB 2DY8A 2A74C 1LTGD 1ZKOA 2BDNA 3A8IE 1CI3M 2JYOA 2VUMB 3E9IA 3V96A 4DV2Q 3M3YH 3SVMA 1ONLA 5ELOA 3JAMc 1A3VA 5M3MG 2QEJC 2K4KA 5LMNW 1TY0A 5CBEE 2KCTA 5FLXE 1IKMA 2E75C 5ISRA 3GD7A 5C4JH 4R9WA 1VQPA 4F8MA 3AEVA 1D6EC 2CHBD 4B3ML 3VYUA 5KEEA 2AWNA 3OWEB 1Y1WH 2NVQB 2BCOA 3QIAA 3KBGA 5IT9E 4K2KA 1HHVA 3P75A 4XQQA 3I8ZA 3C1EA 5M5XB 2KECA 2VB2X 3S17B 4ZRZA 5GAGC 5AJ3L 1EY4A 4GLVB 3GDEA 3PIOA 5M5WB 1F9PA 4DA2A 5C4XH 1G6ZA 1H9SB 3J81i 2R6GA 1EEID 2B2TC 2HCCA 2KVMA 4JCVE 4A3CG 1X55A 1KIXA 4HTHA 3U50C 1OXUA 4A3GG 4JC0A 1I4HA 4BY1H 5JJKA 1Y8OB 4HIOA 4NB3A 3K57A 3DXJC 2ZJRA 4BA1I 3CPFA 4JI6L 1WVLA 1KC8C 3UDXA 1IYVA 3AFQA 3PQIA 3KF8B 2ZJPA 1AZPA 5IP7H 2KOLA 1B44D 5IT9c 3S1RH 4UDUC 2K6AA 1BKBA 4DK6C 1NR2A 3M3YB 2PNRC 2L4NA 5NUCA 3OW2A 3E0EA 5I6YA 3M85A 4RMFA 2Q2TA 1HQRD 1I50B 3FDTA 1NTGA 1JE4A 5D3DA 2UXDQ 1I4QA 4B9WA 4B3MQ 2G9DA 4CJ2C 3GQBA 3Q0AA 3G7LA 2B63H 1BO0A 4RGNA 1HA5A 4C2MH 1G2SA 5GADC 1BF4A 1K3RA 1CA5A 2A6HC 2Z6BA 3CC7A 4OIKA 2K01A 1YNJD 4JI3Q 2B2VC 1K83H 1U0LA 4A3BB 1OXTA 1Y1VB 2AHOB 4H7BA 3BJUA 3HKZG 4A3GH 4OIJA 5CGKA 5IYCH 1XNQQ 4DV7Q 2KJXA 5C3EB 3VYRA 5J1ZA 4LF8Q 3K5OA 4L5QA 2NB0A 2JA5B 1V1OA 2VZAA 4DV3L 3P7JA 2A69D 2EYFA 5JAVA 1JOKA 5IP7G 5FO8B 1N9WA 3RUZA 3BVZA 2JA6G 1I4GA 4DK3C 1YITA 3H0GG 4F7XA 5IYDH 1QZGA 4CBVA 4PV1C 4A3MH 1EQRA 1XPUA 1B3QA 1YEZA 3PGZA 1W6JA 3PF5A 3VR5A 1KABA 3H3VI 2B2WA 4R8IA 3C3LA 1TS2A 1IL8A 1SE2A 5FLMG 2OEOA 5C44H 3QG1A 1VQEA 4GNXB 2TSSA 2I07B 2NZHA 3A7AB 1HA6A 1HXYD 1EY5A 1OTCA 3BYTB 2N8NA 1WTOA 2AQ1B 1B9MA 1V9PA 3S1MB 2BA1A 5CYUA 4IN3A 2X6LA 1STBA 4K5XA 4JI2Q 3BYYB 2B2UC 1PH8A 2CWAA 1ZEQX 3T56B 3QO2A 4AQYL 4K0KQ 3HFZB 2E5LL 3ER0A 2K7VA 2EJGC 2E74C 1IW7D 2YTXA 3HOVG 5HGTA 4JVZA 2PQAA 2F0SA 3K8AA 3W3AA 4QIWE 2WKCA 2IHEA 1HZ9A 1XXGA 1YJ9A 3LNNA 1E2ZA 3IFDA 4AH6A 1F2MA 5K36G 4JI8Q 4C3HH 2I5MX 3H6MA 5JPMC 5I9OA 2N49A 4N9TA 1NCVA 2VY3A 2Q8RE 1PZJD 1MSGA 2D2CC 5JEAJ 1TWCB 5CV7A 5IGEA 2AQ2B 3NUCA 3R2TA 3DWAA 4O0AA 5BN4A 1CHPD 2F0GA 1LYLA 4XYOA 4A3MG 3J7AV 3CC4A 4A3DG 4FYDA 4DR7L 2X6GA 1VDZA 2J4XA 2OF1A 2NWGA 3TS2A 1C7YA 1X32A 1CFMA 4KD4A 1QUQB 4QJFA 1L0XB 2F3IA 4KTAA 1PTOF 1PYSB 2PYKA 4JBJA 2EY6A 2RA4A 1Z9FA 2UUAL 1VQ4A 1KDAA 1IBLQ 2WACA 3X3NA 1PLFA 4O1NA 3V05A 2UU9L 1DOMA 1X3QA 2A6EC 4DF7A 3W1BA 3VDYA 1XMOL 3NP8A 4NPSA 4JI3L 3FVQA 2PPBC 1RL2A 1SRUA 3TBIB 1MSHA 4H0LC 3GTMH 1NJIC 4DUYQ 1ICWA 4UP9A 2UUAQ 1IHZA 4J8QA 1PH1A 1ENFA 1AW7A 1QWYA 4A3FG 3TZDA 3TDQA 3EJIA 1GVPA 1VMPA 1BNZA 4G4KA 4BY1G 1YNJC 4I7ZC 4IOAA 4AQYQ 5C3WA 1UE1A 1QVCA 3RR5A 2CW0D 4YWLA 4GOPC 3HS0C 2PZWA 1LTID 1FYCA 1P16A 2CQOA 2EYHA 4KHPQ 5JJIA 2ID0A 2ASBA 5C3XA 3S9WA 2NVQH 4KY5A 1O7LA 4L5RC 1D5ZC 4X3TA 4A3DH 1GKHA 5IT9L 3EFXD 4PMBA 4RHSA 1PFBA 1K73C 4FXDA 4LF9Q 3HOYH 4DAMA 1MIUA 2K50A 3GTQB 4N9PA 4UP8A 1PH7A 1GXDC 3I4OA 1HZCA 4B08A 5CV9A 1F9SA 1HTPA 1WTHA 2V4DA 3A5ZB 1DD2A 2DUDA 2QGQA 2NVYB 4LFBL 2OT2A 2IW3A 1IKLA 3S1MH 1TR5A 4BBRB 5E4WC 4B3SL 3BDOA 1STHA 1E24A 1A62A 1H9JA 2K5DA 3GTPH 1JICA 1WOCA 2FMMA 3B6YA 4J1MA 4LF4Q 2RKSA 1NY4A 5IYBH 2JA8B 2GN5A 1AH9A 2PI2A 1PFNA 4DAPA 1TWFH 5F2DA 2R7ZH 4NP5A 4OELB 3SHLA 1EWIA 1QZHA 2H4OA 1IL2A 1DJRD 4LK1C 3NWSA 4X6AH 3J81j 4QIWB 4KJNA 4I65A 1H9MA 3MHBA 1YI2A 1HNZQ 2MHVA 1L0WA 3AB9A 3JC66 4DR5L 1IZ6A 4LW1A 2HHHQ 3H0GH 4B3TQ 3T1YL 5BN3A 4LAAA 5CV8A 2PMZB 3X3MA 1AE2A 1Q1BA 2NVXH 4ME5A 2RHQB 2AKWB 4BWGB 3K58A 4X64Q 2VQFQ 3I4NH 4BBSH 3GV3A 2A6HD 2WAQE 4PZ8A 2EXDA 5DM63 5DLQE 5C44G 1PVOA 3Q22A 2PZUA 2HD3A 1L1OB 4HEDA 1TS3A 1S3OA 2Z9HA 1X3GA 3HP3A 1Y1VG 1AFPA 2F0OA 3I90A 4KMUC 4UPAA 3HKZB 4YHHL 4JI8L 4ULLA 3CP0A 4DXGA 4AIMA 1EY0A 3A54A 2TMPA 3Q8DA 3STBD 3KJOA 3PMFA 4HAEA 3TN2A 2MO0A 1F2LA 2CH4W 5K36H 4FVMA 3D6CA 2UXCQ 2D62A 2IY5B 1SMXA 2L15A 3SXHA 1TWGB 3G6JB 2IT1A 1Y1WB 2JA7H 3S16H 4KKTA 3P20A 1ASZA 2BA0A 5LL6S 1SNMA 2QW7A 4CDCC 4JI1Q 2D0PA 2KCCA 3MXGA 1PRTC 3PCOB 3J80c 4LWCA 5IOCA 5FJ8G 3A55A 1VQCA 1CKMA 4IUTA 2HT1A 4C2MB 4IALA 4XDXA 2PMZE 4LJZC 4YIJA 2MNAA 1VQLA 3NEMA 3UDIA 3PV0A 3T1HL 4ZQ3A 1D2BA 2DNCA 4C56C 2K75A 5JJLA 3PSIA 2F1MA 5EPKA 3VR2A 3GTGB 3VA5A 3MFYA 4P75A 4DNRB 1WFQA 3OIPA 4YWKA 1VQMA 4ODGA 1PH9A 2D5DA 1EIYB 1PRTB 4XIGS 3D31A 2E2JB 3A7LA 4L5SA 3HOUB 2L9HA 3DWPA 1NBWA 2LSSA 4GKKQ 4WJ3M 3A8KE 1Y69U 1B9NA 3C2PA 1E1OA 1SJHD 3L7ZC 3MFGA 2F03A 1AP0A 2BE5C 1IBMQ 3I73A 1M8AA 2MP1A 3RN2A 2IWHA 2C5CA 1UE6A 1Q46A 1F2ZA 3A74A 1WI5A 1SYEA 1BCPF 1JWSD 3K7UC 1R4PB 1CUKA 2VB3X 4KJOA 4NW2A 1B53A 4GKJL 3AU7A 1BBXC 1FNVA 1GHKA 1N36L 1EFWA 2KQ3A 4X65Q 1UWVA 4X62Q 1SEBD 4G7ZC 5JEAH 1HUMA 2R7ZB 4APVA 3K5LA 2JP1A 1V1PB 2ZT9C 1M1KC 3FKIB 1SR3A 1B2TA 3T1YQ 3PO3H 1HH2P 4DGZA 2Q2IA 5I2XA 3FMCA 3GTJB 1RD9D 1VQGA 4DV0L 1VQDA 4GZYC 2DGYA 2A68D 3OTOL 3L9AX 1E2WA 1CK1A 3HOXG 1VQOA 1N8RC 4OWWB 2VNUD 4NXML 3P1HA 2BOSA 3NQTA 1A3TA 4YCVA 1LT3D 3S15B 2IHFA 4A3JG 1KAAA 3R3OA 4HR7B 4LF7L 2M2LA 4QL5A 1GUWA 1LO5D 4MNOA 1E1TA 1YVCA 1N34Q 2F0IA 1D8LA 1TQOA 2WKDA 4RGTA 3K6OA 1S4ZA 1LT5D 1X3FA 4A3FB 4PMCA 4DV1Q 2EDGA 3K80C 5ELDA 1EYCA 2Z1CA 4DAYA 4HJ5A 4BY1B 3VR6A 1Q12A 3RLOA 3ITPA 2JA9A 4GN3B 3EROA 5EGTA 3CXCA 4JI5Q 3CRLC 2XIWA 4LF6Q 1G8ZD 5EBCA 4A76A 1SNPA 2NN6I 1OXVA 3JAME 1S5DD 2HDMA 3M4QA 4BBSG 3J80E 3AMUA 3PUXA 5DNFA 1LTTD 4EGVA 1FGUA 2LMCB 1V8QA 2SOBA 3E3XA 2O4XA 2WP8J 1D5XC 1Y1VH 2RCNA 1I4XA 2PCFB 4IQZA 1E3PA 4R1JA 4DUYL 4JI0L 1C0AA 4JBMA 4X66L 1LTAD 4EQ5A 3W1GA 2OQ0A 3UDFA 3GO5A 1XPOA 1HR0L 1SBBB 3NPPA 3J7A5 5IYDG 1KRTA 5AJ3Q 1UEBA 3RNUA 2RBMA 1BDOA 1RTOA 3K7AB 3CMAA 4DNIA 1XTCD 1MI2A 3GTPB 3HOWH 5LMUQ 4DR4Q 3TP6A 2NVYH 2GVAA 1LM0A 4JPBW 4U68A 3M4PA 1J8IA 1VQJA 2F0JA 3PIP3 2NTSA 1R9TB 1ET6A 1S5CD 1A8VA 1SYGA 1O7YA 1I4RA 2QDBA 3MEFA 1STYA 3CCSA 5M3MB 2K5QA 2HIXA 2K14A 1I6VC 3KF6A 1UAPA 2PW7A 4KD3A 1L2FA 1B50A 1U4MA 1BR9A 1PRTD 3H3VH 4P72A 3CCRA 1XWEA 4L5TA 4A3DB 5J22A 4QUFA 3NBIA 4X64L 3LWEA
chains in the Genus database with same CATH topology
4S3SA 1TS4A 1SNCA 2K32A 3MAQA 1EQVA 2Z8LA 1SNOA 1HFNA 5I2YA 1B1ZA 5C4HA 1PDQA 1D1IA 3IKJA 2E2HB 2FFKB 1U4RA 1YNNC 4IUVA 1EY9A 2DN8A 3KBXA 1ILQA 4C3HB 5C6AA 4NMZA 3TP7A 3M7NA 3SK8A 2JEAI 2ICEC 2LKVA 3D4DA 3N52A 2IX3A 1LTBD 2KA7A 3ND8A 3T16A 4M1UB 1GUTA 1SSOA 5EPLA 1CA6A 2G9HD 2JA7B 4JBWA 2B2YA 2B2UA 2B2YC 1LT4D 3S2HB 1ESRA 1PZID 2F0VA 1UEAB 3D4RA 1XX8A 1PTOB 1S5FD 3OMCA 1QILA 2J0TD 2L55A 2H1EA 1A3UA 4ABNA 3PUWA 2JA6B 1EZ8A 2CQAA 2KUMA 4XTCS 3H09A 5E1FA 3RZDB 2NVXB 3FPUB 4K14A 4HN7A 1WTRA 4QF4A 2RDGA 4MIUA 1TWFB 4IZ8A 3M7GA 1KNAA 4KV6A 4MN3A 5CV4A 5C0XG 1CZWA 4DN4M 1ENCA 3DUZA 5JOBA 2XN9C 1BXTA 3Q23A 1MBYA 2O5JC 1KDBA 2XSCA 1EL0A 3MTSA 1K8MA 4X3SA 2A68C 5EKIA 2EYJA 4UAIA 5C44B 3PUYA 4G7HC 4IFDG 4A3KB 2CVRA 1I6HB 5T1IA 1UUPA 1RF2D 1SYCA 2EZVA 3NSWA 3NWTA 2QF7A 4X3KA 2Z4IA 5M3FB 2K1BA 3BS1A 1JWMD 1Y8NB 3PUVA 4RA8A 2NUCA 4TSSA 4ZKBB 1QOHA 5FO9B 1EZ6A 5LL6X 2L5TA 3OMGA 5G3LF 4QUCA 5TSSA 4DK1A 4K5WA 3HGBA 1OO9B 2K04A 1K83B 3OWFA 2EYMA 2F3WA 5IGBA 2VXWA 3SK6A 1B3AA 1VCIA 3E5SA 2CW0C 2ZXOA 4J6HA 4K6DA 2XNAC 3MC0B 4ZAIA 4XT3B 1TY2A 3VR3A 4C3JB 1SAPA 4RKLA 5M5YB 5I9PA 1SJED 4RAUC 1NUCA 1LABA 5ELBA 1GJXA 2IPKD 5JVG3 3PO3B 1SYDA 5HURA 1WD0A 1YNND 5DAUA 2R3ZA 3WOFA 1AN8A 4U673 5IGGA 4K6LA 4TKOB 2BE5D 4QCLA 4TRDA 1SNQA 4ZK9B 4BS9A 1JQYD 4HMIA 1EEFD 1T5EA 3ZYYX 2B63B 3OPOA 1QB5D 2M00A 1ZYRD 1DOKA 2N55A 1G291 3CQZB 4F87A 4FF1A 2JXMB 3NK9A 2L12A 3QWNA 3SDZA 1EFID 4Q0FA 4L6TB 3KK7A 4EVOA 2L0CA 3HZXA 1CT1D 3I91A 1CQFA 3FPPA 3PO2B 2FINB 3GV6A 1W6KA 3VYSA 5KNCA 2N88A 1WCMB 1F2YA 3BDCA 4XT1B 1EIGA 5E4XA 3NTIA 4Q5VA 1NSNS 3HEJA 1Q3LA 2WAQB 2R61A 2B2TA 2RVLA 4FXGC 2FHTA 3S16B 1HQMC 2MUYA 1PTOH 1C4QA 1OXSC 3S1RB 4RWSC 1EOTA 4O42A 1GUGA 2KHSA 1TT2A 1TWAB 2Q8TA 4CHTB 4IFDJ 1G2TA 3HOXB 3E6ZX 4IFDH 2PO4A 1MGSA 1SDFA 1FNUA 5EKLA 1Q90A 4A3JB 1SFOB 5C4XB 3CU7A 3SEBA 1RKNA 5CR3A 5CV5A 1SMYC 3I3CA 4L63B 4IUPA 3KLRA 1TWHB 1STGA 1HTLD 5KIXA 3K5MA 1E2VA 4LMQD 1H9RA 2EY5A 3KF8A 3SK4A 3DEPA 3TP5A 3EA6A 1HRJA 1XYIA 4OO1H 1F9RA 1EWCA 3KUPA 5EQ0A 4BBSB 1EU3A 3RD4A 4K2LA 3VR4A 3NE5B 3VA7A 2B8GA 5C4ZA 3J81L 3MVVA 4XYQA 3URYA 4CKCA 1IYUA 3QOLA 1DCZA 3SE0A 3BG3A 4BA2I 4M8AA 2NN6G 5BN5A 1WTVA 3HG9A 1FNWA 2L1BA 5CBAE 4C3HG 2F0LA 1EY6A 3H94A 2YU9B 3J80L 4H44C 3IAYA 4FF3A 1STEA 1BUVT 5AFWA 5I4DA 5ELFA 4B9XA 2SEBD 1STNA 2FJ2A 3MWYW 4A3EB 4CKEA 2J7ZA 1EIHA 1FR3A 5ELCA 5JJZA 5JEAG 4OO1G 4OL7A 1SE4A 3ERQA 2F0MA 3K0YA 2EY1A 1O80A 2IJ0A 2A69C 1DM0B 3GTOB 2NZ1D 3Q24A 4KN4C 4DFAA 1FD7D 2E2DC 3M4YA 3NTHA 1V43A 2F0NA 4FF4A 2F3VA 1SE3A 1TU2B 2YYZA 3FEWX 2F0KA 2F0EA 1WTXA 1F9QA 3MXUA 4KK7A 1EY8A 3T53B 1WTPA 2E2IB 5C4JB 1GUNA 4FNFA 2Z4HA 1BCPD 4EQPA 3GTLB 5J39A 3TZUA 2ENBA 2Q8IB 1LACA 2PW5A 1I3QB 5A2QL 2A5HA 3I4MB 2WINB 5C5LA 1Z6HA 2L11A 2IX1A 2F0WA 1SYBA 3CRKC 4HSPA 2XWJB 3MA2B 3N6RA 1ZXTA 5ELEA 3BVMA 1Y8PB 1C48A 1BCPC 3DM1A 4KI0A 3LX0A 4C1NI 2Y0SB 4BY7B 3BVGA 4K8JA 4NKLA 1Q1EA 4Y7NB 1CTMA 2EJMA 5D14A 1Z7TA 2C9OA 3A8JE 5C0XH 4QMGA 3U9SA 2RDFA 4RH6A 1II3A 3A56A 4FP5D 3FRPB 4DK0A 1EYAA 4JK1C 4TQUS 1TIID 4WORA 4KKSA 1G91A 1GUOA 1UNSA 3J7AF 1A6XA 4HCSA 4L8JA 3QB3A 4ID6A 2RSOA 3L3OC 1ILPA 5C5MA 1KLGD 3H91A 1LT6D 4R8NA 2HQEA 3OSOA 4KHVA 1CM9A 1HPCA 2NN6H 4C3JG 3S1QB 3V2TA 1E0BA 3R8BA 1R4QB 1QE6A 4KN7C 4RKBA 4AYBB 4KY7A 1JB3A 2K03A 3E0JA 2RQXA 2EJFC 1WTWA 1STAA 2WV6D 4ZUJA 5D3IB 1C8CA 2RSNA 4IUQA 5FOBB 1QNUA 5KYLA 3K5NA 2AUKA 3D8GA 1CZGA 5D65A 3S14B 2HCIA 5IGDA 2NYZD 3PUZA 2EYOA 4IURA 1TVXA 2F0TA 2HDLA 2PZTA 2O2LD 5EKKA 5FK9C 2IL8A 5JPNC 4PQXA 2AUJD 3DEOA 4FO2A 3ND9A 3CHBD 4RCNA 3J7YW 2DY7A 3QOJA 1CQVA 2F4IA 1F77A 1S5ED 1FGBD 1JCKB 4CGYB 1SYFA 4IUUA 1U4LA 4PMWA 2JSOA 4C1NK 3S1NB 3J81E 4G57A 2A6ED 2B39A 2BDOA 2GA4B 1RJTA 3TMEA 4RHRA 3WDNA 3NXWA 3KLSA 5I6WA 1DZ1A 4DXFA 5A35A 3O13A 3EQLC 4A93B 2WB1B 4NDXA 2IX0A 4K5VA 5EPJA 4V0BA 1AZQA 3NBHA 4DAVA 3HOYB 2I46A 1SMYD 5CC4A 2AQ3B 3WOEA 4A3IB 1EU4A 3MEHA 1LTSD 1JOOA 5M9OA 3MXNA 2JE6I 3S2DB 3OHXC 5CV6A 2K05A 2XWBB 4A3GB 1S5BD 3DMUA 3EVQA 3ONAB 4C3IB 1KLUD 5LHY1 2NBFA 1EWHA 1O78A 1HUNA 1A2TA 5FKAC 4KHZA 5C0XI 3OOCA 5DM73 1DONA 2ZXPA 1VMCA 4RGMA 2XRSD 3R2IA 1JWUD 1RHPA 4XQNA 3U9OA 3RMHA 3W2DA 2QKIC 2X69A 2DNEA 3RLFA 2OXPA 4DU9A 1M4VA 1KNEA 3MXPA 1LV9A 4QB4A 4K8IA 3LWUA 5FLXL 2EPBA 4KY6A 2HUGA 1QJOA 3K59A 2F0DA 5FO7B 5IODA 1TS5A 5G3LD 3I70A 2E76C 3T51B 1DXMA 1QG7A 3HOVB 3GTMB 3D6WA 1CHQD 3JAML 2KCNA 2EY2A 2NVTB 3QJYA 3H0GB 4DNTB 1PTOC 4G7OC 2F0FA 4P2CB 2MJ8A 3T4AC 3HOZB 3VYTA 2EE1A 4OO1I 3I72A 1VF5C 5KNBA 1PXUA 1H9SA 4OHJA 1QNKA 3R93A 5KGUA 1LTRD 2XVSA 1PZKD 3OIQA 3IFTA 4RGOS 2SNSA 4KKUA 5E3FA 1JORA 1D1KA 2EYPA 4CJ0B 3NTKA 2MPMA 1RODA 4FF2A 4CJ1B 1A15A 4E6IA 1BCPB 1LLRD 2JEBI 2EVBA 2K33A 1NR4A 4PNYA 4F88A 5T1GA 3IL8A 1RDPD 3H3VC 3NQIA 1NAPA 4XXEA 2MGSA 1L0YB 3SK5A 1PMRA 1JOQA 1GHJA 4CKBA 2RDHA 2F0PA 2B2VA 1WD1A 3BZDB 1DYQA 3Q6SA 2KEDA 4V190 3D3RA 3MZ5A 1SXTA 2EXZA 2F0UA 2LFNA 1Q8IA 1X3PA 1WTQA 1KDCA 1JR0D 1GUSA 1DOLA 1SNDA 5IIFA 1JC7A 5CMDA 2R92B 5EBDA 1H9KA 2F0HA 1O7ZA 3F2UA 1PTOD 4OGQC 4EQNA 2AWOA 5C0XJ 4EQOA 4ILWA 3GTKB 2XRQD 1ESFA 4ZKCB 5CORA 3RZOB 4FXKC 4HMJA 1QCBD 1U4PA 2EYLA 5JVH3 3C1FA 1EYDA 2PQEA 3TP8A 4ZLTF 2K28A 3C46A 3PIO3 5IGFA 1RTNA 3GP7A 3SR1A 4IUNA 2SNMA 3T13A 2B8FA 2KEEA 4HSVA 3UI2A 4X3UA 4WFN3 1KTKA 2QILA 3DHQA 2K5WA 2A73B 4H13C 2FMCA 1IW7C 2ZXRA 1Z47A 2NTTA 4ZUIA 3CKIB 2R93B 4XQJA 1PRTF 4MHEA 3HOWB 2M9VA 3OW7A 5A2QE 1J9OA 4C3IG 4HCEA 5EJWA 2LS01 3M4OB 1HFGA 1ZYRC 1T5XD 1ET9A 1HCZA 2O5IC 2SDFA 2WIIB 1AEXA 2B2WC 2QCPX 1PFMA 3TSSA 1K8OA 4A3MB 1D5MC 1ENAA 3DWQA 1BOSA 1ML0D 3NHHA 1V1PA 3I4NB 2EOTA 4IFDI 5KRUA 3BDLA 2ICIA 5IGCA 1GOZA 4WJWA 5COYA 1VF7A 1I4PA 1MD2D 1U9RA 4RCOA 1TKWB 5KYIA 1PYWD 1EQTA 1RCVD 3HRZC 3D4WA 3KLSX 1A2UA 4Z9CB 2F0QA 1OXXK 4WRDA 5DEHA 4ZYSA 5KNDA 2D9UA 1EY7A 4RFBA 1B4OA 2LY7A 3I4LA 1BQQT 5K5PA 2DY8A 2A74C 1LTGD 1ZKOA 2BDNA 3A8IE 1CI3M 2JYOA 2VUMB 3V96A 3SVMA 1ONLA 1A3VA 2QEJC 1TY0A 5CBEE 5FLXE 1IKMA 2E75C 5ISRA 3GD7A 4R9WA 4F8MA 1D6EC 2CHBD 3VYUA 5KEEA 2AWNA 3OWEB 2NVQB 2BCOA 3QIAA 3KBGA 5IT9E 4K2KA 1HHVA 3P75A 4XQQA 3I8ZA 3C1EA 5M5XB 2KECA 2VB2X 3S17B 4ZRZA 1EY4A 5M5WB 1F9PA 4DA2A 1G6ZA 1H9SB 2R6GA 1EEID 2B2TC 2HCCA 2KVMA 4HTHA 1OXUA 1I4HA 1Y8OB 3K57A 3DXJC 4BA1I 1WVLA 1IYVA 1AZPA 2KOLA 1B44D 4UDUC 2K6AA 1NR2A 3M3YB 2PNRC 2L4NA 5NUCA 5I6YA 3M85A 1HQRD 1I50B 3FDTA 1JE4A 5D3DA 1I4QA 4B9WA 2G9DA 4CJ2C 3GQBA 3Q0AA 3G7LA 1BO0A 4RGNA 1HA5A 1G2SA 1BF4A 1CA5A 2A6HC 4OIKA 2K01A 1YNJD 2B2VC 4A3BB 1OXTA 1Y1VB 4H7BA 4OIJA 5CGKA 2KJXA 5C3EB 3VYRA 5J1ZA 3K5OA 2NB0A 2JA5B 1V1OA 3P7JA 2A69D 2EYFA 5JAVA 1JOKA 5FO8B 3RUZA 3BVZA 1I4GA 4F7XA 4CBVA 4PV1C 1W6JA 3VR5A 1KABA 2B2WA 4R8IA 3C3LA 1TS2A 1IL8A 1SE2A 2OEOA 3QG1A 2TSSA 2I07B 3A7AB 1HA6A 1HXYD 1EY5A 3BYTB 1WTOA 2AQ1B 1B9MA 3S1MB 2BA1A 5CYUA 4IN3A 2X6LA 1STBA 4K5XA 3BYYB 2B2UC 1ZEQX 3T56B 3QO2A 2K7VA 2EJGC 2E74C 1IW7D 5HGTA 2F0SA 3W3AA 2WKCA 1XXGA 3LNNA 1E2ZA 3IFDA 1F2MA 5K36G 3H6MA 5JPMC 5I9OA 4N9TA 1NCVA 2Q8RE 1PZJD 1MSGA 2D2CC 5JEAJ 1TWCB 5CV7A 5IGEA 2AQ2B 3NUCA 3R2TA 3DWAA 5BN4A 1CHPD 2F0GA 4XYOA 3J7AV 4FYDA 2X6GA 1VDZA 2J4XA 2OF1A 2NWGA 1X32A 1CFMA 4KD4A 1L0XB 4KTAA 1PTOF 2PYKA 2EY6A 2RA4A 1KDAA 2WACA 3X3NA 1PLFA 4O1NA 3V05A 1DOMA 1X3QA 2A6EC 4DF7A 3NP8A 3FVQA 2PPBC 3TBIB 1MSHA 4H0LC 1ICWA 1IHZA 4J8QA 1ENFA 1AW7A 1QWYA 3TZDA 3TDQA 3EJIA 1VMPA 1BNZA 4G4KA 1YNJC 4I7ZC 5C3WA 2CW0D 3HS0C 2PZWA 1LTID 1FYCA 2EYHA 2ID0A 5C3XA 3S9WA 4KY5A 1O7LA 1D5ZC 4X3TA 5IT9L 3EFXD 4PMBA 4RHSA 1PFBA 4FXDA 3GTQB 4N9PA 1GXDC 4B08A 5CV9A 1F9SA 1HTPA 2V4DA 1DD2A 2NVYB 2OT2A 2IW3A 1IKLA 1TR5A 4BBRB 5E4WC 3BDOA 1STHA 1H9JA 2K5DA 1JICA 2FMMA 4J1MA 2RKSA 2JA8B 1PFNA 4DAPA 5F2DA 4NP5A 3SHLA 2H4OA 1DJRD 4LK1C 3NWSA 4QIWB 4KJNA 4I65A 1H9MA 3MHBA 2MHVA 3AB9A 5BN3A 4LAAA 5CV8A 2PMZB 3X3MA 1Q1BA 4ME5A 3K58A 4BWGB 3GV3A 2A6HD 5DM63 3Q22A 2PZUA 4HEDA 1TS3A 3HP3A 1AFPA 2F0OA 3I90A 4KMUC 3HKZB 4ULLA 4DXGA 1EY0A 3A54A 2TMPA 3PMFA 4HAEA 3TN2A 1F2LA 5K36H 4FVMA 3D6CA 2D62A 3SXHA 1TWGB 3G6JB 2IT1A 1Y1WB 4KKTA 3P20A 2BA0A 5LL6S 1SNMA 2KCCA 3MXGA 1PRTC 5IOCA 3A55A 4IUTA 4C2MB 4IALA 4XDXA 4LJZC 4YIJA 3PV0A 4ZQ3A 1D2BA 2DNCA 4C56C 2F1MA 5EPKA 3VR2A 3GTGB 3VA5A 3MFYA 4DNRB 3OIPA 4ODGA 2D5DA 1PRTB 4XIGS 3D31A 2E2JB 3A7LA 3HOUB 2L9HA 3DWPA 3A8KE 1Y69U 1B9NA 3C2PA 3L7ZC 1SJHD 3MFGA 1AP0A 2F03A 2BE5C 3I73A 1M8AA 2MP1A 2IWHA 2C5CA 1F2ZA 1SYEA 1BCPF 1JWSD 1R4PB 2VB3X 4KJOA 1B53A 4NW2A 3AU7A 1BBXC 1FNVA 1GHKA 2KQ3A 1SEBD 4G7ZC 5JEAH 1HUMA 2R7ZB 3K5LA 2JP1A 1V1PB 2ZT9C 3FKIB 1B2TA 4DGZA 5I2XA 3FMCA 3GTJB 1RD9D 4GZYC 2A68D 3L9AX 1E2WA 1CK1A 2VNUD 3P1HA 2BOSA 3NQTA 1A3TA 1LT3D 3S15B 1KAAA 3R3OA 4HR7B 2M2LA 1GUWA 1LO5D 2F0IA 1TQOA 2WKDA 4RGTA 3K6OA 1S4ZA 1LT5D 4A3FB 4PMCA 2EDGA 5ELDA 1EYCA 2Z1CA 4DAYA 4BY1B 3VR6A 1Q12A 3ITPA 3EROA 5EGTA 3CRLC 2XIWA 1G8ZD 5EBCA 1SNPA 2NN6I 1OXVA 3JAME 1S5DD 2HDMA 3J80E 3AMUA 3PUXA 5DNFA 1LTTD 4EGVA 2LMCB 1V8QA 2SOBA 2O4XA 2WP8J 1D5XC 1I4XA 2PCFB 4IQZA 1LTAD 3GO5A 1SBBB 3NPPA 2RBMA 1BDOA 1RTOA 3K7AB 1XTCD 1MI2A 3GTPB 3TP6A 1J8IA 4U68A 2F0JA 3PIP3 2NTSA 1R9TB 1ET6A 1S5CD 1SYGA 1O7YA 1I4RA 2QDBA 1STYA 5M3MB 2K5QA 1I6VC 1UAPA 2PW7A 4KD3A 1B50A 1U4MA 1BR9A 1PRTD 4A3DB 1XWEA 5J22A 4QUFA 3NBIA 3LWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ABN A;  2XVS A; 
#chains in the Genus database with same CATH topology
 4S3S A;  2E8G A;  1TS4 A;  4IJL A;  1SNC A;  5LMU L;  1V1Q A;  2I0Q A;  2K32 A;  3MAQ A;  1EQV A;  4JI4 L;  2Z8L A;  1SNO A;  1HFN A;  5I2Y A;  2ZM6 L;  1B1Z A;  4DV3 Q;  5C4H A;  1VQ6 A;  3ULP A;  1PDQ A;  4JI1 L;  1D1I A;  3IKJ A;  1C9O A;  1IBM L;  4IO9 A;  2E2H B;  2FFK B;  1U4R A;  1YNN C;  4IUV A;  1XPR A;  1EY9 A;  2DN8 A;  3KBX A;  4Y7N H;  3CD6 A;  1ILQ A;  3DM3 A;  4C3H B;  5C6A A;  4NMZ A;  3KOJ A;  3TP7 A;  3KJP A;  3M7N A;  3SK8 A;  2JEA I;  4IPH A;  2ICE C;  2AMC B;  2LKV A;  5GRO A;  3D4D A;  3N52 A;  2IX3 A;  3CCQ A;  1I50 H;  1LTB D;  1VQ9 A;  3LGJ A;  5LMN L;  2KA7 A;  1YHQ A;  3ND8 A;  3PF4 A;  3T16 A;  4M1U B;  3TRZ A;  1GUT A;  1JE5 A;  1SSO A;  2RCF A;  5EPL A;  1CA6 A;  1KAW A;  5L37 A;  2G9H D;  4JYA Q;  4JBW A;  2JA7 B;  3CW2 C;  2B2Y A;  2B2U A;  2B2Y C;  1LT4 D;  1X9N A;  3S2H B;  3ERS X;  1ESR A;  1PZI D;  2F0V A;  5IE8 A;  1UEA B;  3D4R A;  1XX8 A;  1X6O A;  4CDD C;  4JBK A;  1PTO B;  1S5F D;  3OMC A;  1LTL A;  4GKK L;  2UXC L;  1QIL A;  4DR1 Q;  2J0T D;  3CPW A;  1HNW Q;  1EYG A;  4MTK A;  2L55 A;  2H1E A;  4A3K H;  1A3U A;  3K0X A;  2G5D A;  4ABN A;  2JA5 G;  4TVA B;  3PUW A;  1K8G A;  3I7F A;  2F4V L;  2JA6 B;  1EZ8 A;  2CQA A;  4YHH Q;  2KUM A;  1JJC B;  4XTC S;  3H09 A;  4B3S Q;  2Y0S E;  1B8A A;  5E1F A;  3UDG A;  2A8V A;  4A3J H;  4ALP A;  2R7F A;  2JQO A;  3RZD B;  2NVX B;  3FPU B;  4K14 A;  4HN7 A;  1WTR A;  2ES2 A;  4QF4 A;  2RDG A;  1IBK L;  4MIU A;  2N3S A;  1TWF B;  4IZ8 A;  3M7G A;  3WWV A;  1KNA A;  4MN3 A;  4KV6 A;  5CV4 A;  5C0X G;  1CZW A;  2WFW A;  4DN4 M;  2ZTC A;  1ENC A;  2NVT H;  3DUZ A;  5JOB A;  2XN9 C;  4A93 G;  3GTL H;  1BXT A;  3Q23 A;  1MBY A;  2O5J C;  1KDB A;  2XSC A;  2PNH A;  1EL0 A;  3MTS A;  1GO3 E;  1K8M A;  4X3S A;  4IOC A;  2A68 C;  4KHP L;  5EKI A;  2F4V Q;  2EYJ A;  4C3I H;  4UAI A;  5C44 B;  3PUY A;  4G7H C;  1G6P A;  3CCU A;  4UY8 C;  4IFD G;  4A3K B;  2CVR A;  2JK8 A;  4DV1 L;  1I6H B;  4DR1 L;  5T1I A;  3TQY A;  1UUP A;  1RF2 D;  1SYC A;  2EZV A;  2I5L X;  4IPC A;  3NSW A;  3ULJ A;  4QGU A;  3NWT A;  3TS0 A;  2QF7 A;  4DV4 L;  4X3K A;  2Z4I A;  5M3F B;  5C3E H;  1KD1 C;  4H02 A;  2K1B A;  3BS1 A;  1JWM D;  1Y8N B;  3PUV A;  4RA8 A;  3GTK H;  2JA5 H;  2NUC A;  4TSS A;  3T1H Q;  4ZKB B;  1QOH A;  5FO9 B;  4ME3 A;  4OX9 Q;  1EZ6 A;  5LL6 X;  3J81 c;  2L5T A;  3OMG A;  1PA6 A;  5G3L F;  4QUC A;  5TSS A;  4DK1 A;  3STB C;  4K5W A;  3HGB A;  1OO9 B;  1S40 A;  3J7Z C;  2K04 A;  1JJG A;  1K83 B;  3OWF A;  5LMN Q;  2EYM A;  4A3B H;  2F3W A;  3L2P A;  5IGB A;  2VXW A;  3SK6 A;  1B3A A;  1VCI A;  3E5S A;  2CW0 C;  1CSP A;  2ZXO A;  4J6H A;  4K6D A;  2XNA C;  3MC0 B;  1N36 Q;  4ZAI A;  4DUZ L;  5J3B A;  4XT3 B;  1TY2 A;  3VR3 A;  4C3J B;  1CKN B;  1SAP A;  3I55 A;  4RKL A;  5M5Y B;  4R4T A;  5I9P A;  1SJE D;  4RAU C;  1NUC A;  4POF A;  1VQA A;  4POG A;  1LAB A;  2K5N A;  4BBR H;  1S72 A;  1MHW C;  5ELB A;  4HID A;  1GJX A;  2IPK D;  3U4V A;  5JVG 3;  3PO3 B;  1SYD A;  4LFA L;  1NMF A;  5HUR A;  2Z6K C;  1WD0 A;  3OTO Q;  1YNN D;  1EIF A;  5DAU A;  2R3Z A;  4DV5 Q;  3WOF A;  3RZO H;  1AN8 A;  4U67 3;  5IGG A;  3SGI A;  1I94 Q;  4K6L A;  4GN5 A;  2BE5 D;  4TKO B;  4QCL A;  4TRD A;  1SNQ A;  1IBK Q;  1PH2 A;  4ZK9 B;  3FKI G;  1SLJ A;  1JQY D;  4BS9 A;  4HMI A;  1EEF D;  1T5E A;  4OXP A;  3ZYY X;  1HNX Q;  2B63 B;  3HOY G;  3OPO A;  4B3R Q;  1QB5 D;  2M00 A;  4A3I G;  3G6E A;  1ZYR D;  2ZTD A;  4A3E H;  1DOK A;  2K5H A;  2N55 A;  1G29 1;  2K5V A;  3CQZ B;  4F87 A;  4FF1 A;  2BH8 A;  2JXM B;  2Q2H A;  3NK9 A;  2L12 A;  3QWN A;  3SDZ A;  1EFI D;  4Q0F A;  2VW9 A;  4L6T B;  3KK7 A;  4LFB Q;  4EVO A;  2L0C A;  1SFO H;  1HZB A;  4DR6 L;  4DV4 Q;  3HZX A;  1X65 A;  1X56 A;  1CT1 D;  3I91 A;  4NXN L;  1CQF A;  3FPP A;  3EN2 A;  3PO2 B;  2FIN B;  3GV6 A;  5IWA L;  1W6K A;  3NEL A;  3VYS A;  2N88 A;  5KNC A;  1WCM B;  2VS1 A;  2E2I H;  3I56 A;  1VQ8 A;  1F2Y A;  1FL0 A;  3BDC A;  4XT1 B;  1EIG A;  5E4X A;  3NTI A;  2KHJ A;  4Q5V A;  4NXM Q;  1NSN S;  2WB1 E;  2YV5 A;  2KBN A;  3HEJ A;  1Q3L A;  2WAQ B;  2R61 A;  1PH6 A;  4GS3 A;  2VQE Q;  2B2T A;  2RVL A;  4FXG C;  4GNX A;  2FHT A;  3S16 B;  1HQM C;  1K28 A;  2MUY A;  1I3Q H;  3W5O A;  1PTO H;  2R7Z G;  1C4Q A;  1OXS C;  3S1R B;  4RWS C;  4A3I H;  1EOT A;  4O42 A;  1GUG A;  2KHS A;  1TT2 A;  1TWA B;  2Q8T A;  4CHT B;  2OWO A;  3S2H H;  2B29 A;  4IFD J;  1G2T A;  3G4S A;  4OWT B;  2EIF A;  3KF6 B;  3HOX B;  1D7Q A;  3E6Z X;  4A93 H;  4IFD H;  5HGQ A;  2PO4 A;  1MGS A;  1SDF A;  1FNU A;  5EKL A;  1Q90 A;  1CKO A;  4A3J B;  1SFO B;  5C4X B;  1W3S A;  3CU7 A;  3SEB A;  2QEX A;  1E22 A;  1RKN A;  5CR3 A;  5CV5 A;  1SMY C;  3AQQ A;  3I3C A;  4L63 B;  4IUP A;  3KLR A;  4AYB G;  1UE7 A;  1TWH B;  3M4O H;  3S1N H;  1STG A;  2JA6 H;  4WJ4 A;  1HTL D;  5KIX A;  3K5M A;  5FJ8 H;  2F52 A;  1E2V A;  4LMQ D;  4N8F A;  1H9R A;  2EY5 A;  3KF8 A;  3SK4 A;  4R4C A;  4X65 L;  1O7I A;  3DEP A;  2ATW A;  4RG1 A;  3EA6 A;  3TP5 A;  4DR2 L;  1XYI A;  4LF9 L;  1HRJ A;  3IRB A;  1A0I A;  3HOZ H;  4DKA C;  4OO1 H;  1MJE A;  2VUM H;  1F9R A;  3KFU A;  2VQE L;  1EWC A;  1K0R A;  3RN5 A;  3KUP A;  5EQ0 A;  4BBS B;  1I5F A;  1EU3 A;  3RD4 A;  4K2L A;  3VR4 A;  2HQL A;  4Y52 H;  3NE5 B;  3VA7 A;  2B8G A;  5C4Z A;  3J81 L;  3MVV A;  4JG2 A;  1Q86 C;  4N8X 1;  4XYQ A;  3URY A;  5FLM H;  4CKC A;  1IYU A;  3QOL A;  2ZJQ A;  1DCZ A;  1UE5 A;  3SE0 A;  4OX9 L;  4JI6 Q;  3FP9 A;  1WJJ A;  3BG3 A;  4C3J H;  4M8A A;  4BA2 I;  1NE3 A;  4A3K G;  2NN6 G;  5BN5 A;  5M5X H;  3CF5 A;  3L0O A;  2E5L Q;  4LFC L;  1WTV A;  3HG9 A;  4GOP B;  1FNW A;  4X66 Q;  1YZ6 A;  2L1B A;  3G48 A;  2LXK A;  2V1C C;  3KLW A;  5CBA E;  4C3H G;  2F0L A;  1KL9 A;  2QDL A;  1EY6 A;  3BZC A;  3H94 A;  5GQO A;  3J80 L;  1QUQ A;  2YU9 B;  4H44 C;  1TWH H;  3IAY A;  4FF3 A;  1STE A;  1BUV T;  5AFW A;  4A4I A;  5I4D A;  1YNX A;  1FJG L;  3HOZ G;  4DUZ Q;  5ELF A;  4OWX B;  1EOV A;  4B9X A;  4LF6 L;  2SEB D;  1YJN A;  1STN A;  2FJ2 A;  3MWY W;  4A3E B;  4CKE A;  2J7Z A;  3I4N G;  1KRS A;  3TRE A;  4YY3 L;  1EIH A;  2UXB Q;  1FR3 A;  5ELC A;  5JJZ A;  5JEA G;  1Q81 C;  1SN8 A;  4OO1 G;  4OL7 A;  1SE4 A;  4DPG A;  3ERQ A;  4IJH A;  2F0M A;  3K0Y A;  1BVS A;  2EY1 A;  1O80 A;  2R93 H;  2IJ0 A;  4JV5 Q;  1I6H H;  2A69 C;  1DM0 B;  1A63 A;  3GTO B;  4FDB A;  2NZ1 D;  3Q24 A;  4KN4 C;  2ZTE A;  4DFA A;  1FD7 D;  2E2D C;  3M4Y A;  3NTH A;  1V43 A;  3F1Z A;  2F0N A;  3F2D A;  4FF4 A;  2F3V A;  4GN4 B;  1SE3 A;  1TU2 B;  2MQH A;  2YYZ A;  2Z0S A;  3FEW X;  2F0K A;  2F0E A;  1WTX A;  4BY7 H;  2EQS A;  1F9Q A;  3MXU A;  4KK7 A;  1EY8 A;  3T53 B;  1WTP A;  2E2I B;  5C4J B;  1GUN A;  4FNF A;  2Z4H A;  1BCP D;  4EQP A;  4LFC Q;  1YJW A;  5J39 A;  3NEN A;  3GTL B;  2OTL A;  4BXX G;  4R4Q A;  3TZU A;  2ENB A;  2Q8I B;  1LAC A;  2PW5 A;  1I3Q B;  5A2Q L;  1HNW L;  4HJ9 A;  2A5H A;  1H95 A;  3I4M B;  2WIN B;  3CCE A;  1YHA A;  5C5L A;  1JB7 A;  3H15 A;  1Z6H A;  2L11 A;  3GTG H;  4DV6 Q;  2JA7 G;  3A5U A;  3A0J A;  1VQH A;  2QA4 A;  2IX1 A;  5E7N A;  1FJG Q;  2F0W A;  1SYB A;  3U4Z A;  3CRK C;  4HSP A;  2XWJ B;  4PG3 A;  3MA2 B;  1Y14 B;  4P73 A;  3G71 A;  3N6R A;  1XTD A;  1ZXT A;  5ELE A;  2KHI A;  3BVM A;  1Y8P B;  1C48 A;  3F8T A;  1BCP C;  1VS0 A;  4A3L G;  2R93 G;  3DM1 A;  1IXR A;  4KI0 A;  1EQQ A;  3GTQ H;  3LX0 A;  1K3B C;  4C1N I;  3HOW G;  3S17 H;  2Y0S B;  4BY7 B;  3BVG A;  4K8J A;  4NKL A;  1Q1E A;  4Y7N B;  1CTM A;  2EJM A;  5D14 A;  1Z7T A;  2C9O A;  5M3F G;  3A8J E;  5C0X H;  4QMG A;  3U9S A;  4JI2 L;  2RDF A;  4DV0 Q;  4RH6 A;  1SRO A;  1VQ5 A;  3DLL A;  4QY7 A;  1II3 A;  3A56 A;  2WAQ G;  4FP5 D;  3FRP B;  4DK0 A;  5GAE C;  5IY0 A;  3ZJY C;  1EYA A;  4JK1 C;  4TQU S;  1TII D;  4WOR A;  4KKS A;  1G91 A;  1GUO A;  4LFA Q;  1UNS A;  5IYB G;  1VQF A;  3J7A F;  4HJA A;  1A6X A;  2UXD L;  2KEN A;  4HCS A;  3QB3 A;  4L8J A;  1J6Q A;  4X62 L;  4ID6 A;  1YHB A;  2RSO A;  2RF4 A;  3L3O C;  1ILP A;  5C5M A;  2OCE A;  1KLG D;  3H91 A;  1LT6 D;  4R8N A;  2HQE A;  3OSO A;  2H5X A;  1AE3 A;  4KHV A;  1CM9 A;  4A3L H;  1HPC A;  2NN6 H;  4C3J G;  3S1Q B;  3V2T A;  3CCM A;  1YBY A;  3BU2 A;  2E2H H;  4LUO A;  2R92 H;  1E0B A;  3R8B A;  1XNQ L;  3UE0 A;  1R4Q B;  4LF8 L;  5M3F H;  1QE6 A;  4DV7 L;  4KN7 C;  4R4I A;  4RKB A;  4AYB B;  4KY7 A;  1JB3 A;  3ICE A;  1HZA A;  1CSQ A;  2K03 A;  3E0J A;  2RQX A;  1PHJ A;  4LF5 Q;  2EJF C;  3QR8 A;  1WTW A;  1STA A;  2WV6 D;  5IP9 H;  4ZUJ A;  5ELN A;  2VQF L;  2OQK A;  1N32 Q;  2CFM A;  5D3I B;  4JI7 Q;  1C8C A;  4QQB X;  2RSN A;  4IUQ A;  1PYB A;  1HJP A;  5FOB B;  1QNU A;  4JYA L;  5KYL A;  1RIP A;  3K5N A;  2AUK A;  3D8G A;  1CZG A;  5D65 A;  3S14 B;  2HCI A;  5IGD A;  2NYZ D;  3PUZ A;  2EYO A;  4P74 A;  4IUR A;  4AYB E;  1FVI A;  1TVX A;  2F0T A;  1N32 L;  4YCW A;  2HDL A;  2PZT A;  1I94 L;  2LXJ A;  1GM5 A;  2O2L D;  5EKK A;  4JI5 L;  5FK9 C;  2IL8 A;  3CME A;  5JPN C;  4PQX A;  2AUJ D;  3DEO A;  4P71 A;  2R92 G;  4FO2 A;  3ND9 A;  3CHB D;  4RCN A;  3J7Y W;  3AFP A;  3ULL A;  3S15 H;  2DY7 A;  3QOJ A;  1CQV A;  2F4I A;  5M5Y H;  4JW0 A;  1F77 A;  1S5E D;  1FGB D;  1JCK B;  1J5E L;  3S1Q H;  4CGY B;  3RLN A;  1SYF A;  3M9B A;  3CCV A;  4IUU A;  1U4L A;  4PMW A;  2JSO A;  4C1N K;  2CKZ B;  3S1N B;  4DR6 Q;  3J81 E;  2JN4 A;  4G57 A;  2A6E D;  1NMG A;  1WCM G;  2B39 A;  1JJ2 A;  4JI4 Q;  2BDO A;  2A19 A;  2GA4 B;  1RJT A;  2C35 B;  3TME A;  1XJV A;  2ZM6 Q;  3PO3 G;  4RHR A;  3WDN A;  3NXW A;  1IBL L;  2N78 A;  3KLS A;  5I6W A;  1DZ1 A;  4DXF A;  5A35 A;  5BR8 L;  2BH2 A;  3HOX H;  3O13 A;  3CCL A;  3EQL C;  4YWM A;  4A75 A;  2CWP A;  4A93 B;  2WB1 B;  4NDX A;  2IX0 A;  4DV5 L;  1EUJ A;  4K5V A;  2XGT A;  2JA8 H;  5EPJ A;  1B70 B;  4V0B A;  1AZQ A;  1B7Y B;  3NBH A;  4DAV A;  3HOY B;  2I46 A;  1SMY D;  5CC4 A;  2DJG C;  2AQ3 B;  2CH4 A;  3WOE A;  4A3I B;  1EU4 A;  4PZ6 A;  1PH5 A;  3MEH A;  1LTS D;  4GOP A;  1JOO A;  4LF4 L;  5M9O A;  1P8L A;  1XNR Q;  3MXN A;  1KQS A;  2JE6 I;  3S2D B;  3OHX C;  5CV6 A;  2K05 A;  5IYC G;  2XWB B;  1VQB A;  1T9H A;  2E2J H;  3GTO H;  5EAY A;  3J80 i;  1PH3 A;  4HIM A;  4A3G B;  2VL6 A;  1S5B D;  3KDF A;  3DMU A;  5C3E G;  3EVQ A;  3ONA B;  4C3I B;  1YIJ A;  2CCZ A;  3HKZ E;  1WCM H;  5H1S E;  1KLU D;  5LHY 1;  3K81 C;  2NBF A;  1EWH A;  1O78 A;  3K7A H;  1HUN A;  1A2T A;  5FKA C;  4KHZ A;  5C0X I;  1JT8 A;  1WYD A;  2DJF C;  3OOC A;  1HR0 W;  2A1A A;  5DM7 3;  3E9H A;  1DON A;  2UXB L;  2ZXP A;  1VMC A;  2P5Z X;  4RGM A;  2XRS D;  3R2I A;  4DR7 Q;  4PZ7 A;  1HNX L;  1JWU D;  1RHP A;  4XQN A;  1M90 C;  3CC2 A;  3U9O A;  1LUZ A;  3FHW A;  3RMH A;  3W2D A;  1L1O A;  2QKI C;  2X69 A;  3I2Z A;  2DNE A;  1QVG A;  4JOI C;  3RLF A;  2OXP A;  1E7Z A;  4DU9 A;  1M4V A;  3GTJ H;  1KNE A;  3MXP A;  1LV9 A;  4QB4 A;  4K8I A;  3LWU A;  5FLX L;  2EPB A;  2PI2 E;  3S14 H;  1X3E A;  1N34 L;  4KY6 A;  1HR0 Q;  2HUG A;  1QJO A;  3K59 A;  4ZCK A;  2F0D A;  4IPG A;  5FO7 B;  5GAH C;  3S2D H;  5IOD A;  4GKJ Q;  1TS5 A;  5G3L D;  5M5W H;  4BXX H;  3I70 A;  2E76 C;  3T51 B;  1DXM A;  1QG7 A;  1JMC A;  3HOV B;  3GTM B;  3D6W A;  1XMO Q;  1CHQ D;  2Z6K A;  4BY7 G;  3JAM L;  1N33 Q;  3PO2 H;  2KCN A;  2EY2 A;  2NVT B;  3QJY A;  1X54 A;  3U58 A;  3H0G B;  3HOV H;  4J15 A;  4DNT B;  2VUM G;  1GD7 A;  1PTO C;  4G7O C;  1BBU A;  2F0F A;  4P2C B;  2MJ8 A;  4R4O A;  3T4A C;  4YY3 Q;  1K8A C;  3HOZ B;  3VYT A;  2EE1 A;  4OO1 I;  3I72 A;  1VF5 C;  5KNB A;  4HIK A;  1PXU A;  2GVB A;  1H9S A;  3AYH B;  4OHJ A;  3KYH C;  4IPD A;  4A3E G;  2MO1 A;  1QNK A;  3R93 A;  5KGU A;  2B63 G;  1LTR D;  2XVS A;  1SE8 A;  1PZK D;  1W2B A;  4YCU A;  5BR8 Q;  1Q8K A;  3OIQ A;  2HHH L;  3IFT A;  4RGO S;  2SNS A;  4UP7 A;  4DR5 Q;  1N33 L;  4KKU A;  3FKI H;  4GLA C;  5E3F A;  1JOR A;  1PV4 A;  1D1K A;  3HKS A;  2EYP A;  4CJ0 B;  3NTK A;  2UU9 Q;  2MPM A;  1ROD A;  4FF2 A;  4CJ1 B;  2Q2U A;  3JAM i;  1A15 A;  4E6I A;  1BCP B;  1LLR D;  4LUZ A;  4LF5 L;  1XNR L;  3PO2 G;  4JV5 L;  2JEB I;  2EVB A;  3CQZ H;  1VQ7 A;  2K33 A;  1CKN A;  1NR4 A;  2YU9 H;  4PNY A;  3BZK A;  1J5E Q;  4F88 A;  5T1G A;  3IL8 A;  1ASY A;  1RDP D;  3H3V C;  3NQI A;  1NAP A;  4XXE A;  2MGS A;  1L0Y B;  1IYJ B;  3SK5 A;  1PMR A;  1JOQ A;  1GHJ A;  4CKB A;  4DR3 Q;  1Y1W G;  1QVF A;  2RDH A;  2B3G A;  2F0P A;  4HJ7 A;  4OON A;  2B2V A;  2JJQ A;  1BBW A;  1VQN A;  1ICF B;  1VQI A;  5M3M H;  1WD1 A;  3BZD B;  1DYQ A;  3Q6S A;  2KED A;  4V19 0;  3D3R A;  3MZ5 A;  1SXT A;  2EXZ A;  2F0U A;  2LFN A;  4JI7 L;  1NNX A;  3EIV A;  4DV6 L;  4B3T L;  1Q8I A;  1X3P A;  3S24 A;  3D0F A;  1KDC A;  1WTQ A;  1JR0 D;  4O2D A;  4A3B G;  1GUS A;  2UUC L;  5IWA Q;  1DOL A;  1SND A;  5IIF A;  1JC7 A;  5CMD A;  2R92 B;  5C4X G;  5EBD A;  1H9K A;  4NXN Q;  4UHV A;  2F0H A;  5IP9 G;  1O7Z A;  4A3C H;  3HOU G;  3F2U A;  1PTO D;  1MJC A;  4OGQ C;  4EQN A;  1PFS A;  4BBR G;  2AWO A;  5C0X J;  4EQO A;  4CDF C;  1TWG H;  2Y0S G;  3TEH B;  2HIV A;  4ILW A;  2YTY A;  3GTK B;  2RHS B;  3UE1 A;  2XRQ D;  1ESF A;  4ZKC B;  5COR A;  3PIP A;  3RZO B;  4FXK C;  4JOI A;  4B3R L;  4HMJ A;  1QCB D;  1U4P A;  3NBH B;  2UUC Q;  2EYL A;  5JVH 3;  3I4M G;  1L1O C;  3C1F A;  2FXQ A;  1EYD A;  2PQE A;  3TP8 A;  4ZLT F;  2K28 A;  1K9M C;  3KDF B;  4DAY B;  3C46 A;  3PIO 3;  4LUV A;  5IGF A;  1RTN A;  1R9T H;  1DGS A;  3GP7 A;  3SR1 A;  4IUN A;  2WB1 G;  2SNM A;  3T13 A;  3CCJ A;  2B8F A;  4OEM B;  1G51 A;  3CAM A;  2KEE A;  4MZ9 A;  2OTJ A;  4HSV A;  3UI2 A;  2MFI A;  4X3U A;  4WFN 3;  1KTK A;  2QIL A;  3DHQ A;  2K5W A;  2A73 B;  2K52 A;  4H13 C;  2FMC A;  4KLK A;  1IW7 C;  3HOU H;  1MKH A;  2KCM A;  2NZO A;  2ZXR A;  1Z47 A;  2I5H A;  4DR4 L;  2NTT A;  4ZUI A;  3CKI B;  4I7A A;  3OYY A;  4LNQ A;  2R93 B;  4XQJ A;  4CDE C;  1PRT F;  4MHE A;  4GNX C;  3HOW B;  2M9V A;  3OW7 A;  5A2Q E;  1TXY A;  1J9O A;  4C3I G;  4HCE A;  5EJW A;  2D0O A;  2LS0 1;  3F2B A;  3M4O B;  4JI0 Q;  1HFG A;  5HY6 A;  2ALY B;  1ZYR C;  1T5X D;  1Q7Y C;  4HJ8 A;  2JA8 G;  1ET9 A;  3EBE A;  1HCZ A;  2O5I C;  2SDF A;  2WII B;  4K0K L;  1AEX A;  2B2W C;  2QCP X;  2YTV A;  3RZD H;  1PFM A;  3TSS A;  1K8O A;  1HNZ L;  4A3M B;  1D5M C;  1ENA A;  3DWQ A;  1TWA H;  1BOS A;  4A3F H;  3I4M H;  1ML0 D;  4DR3 L;  3NHH A;  1V1P A;  3I4N B;  2EOT A;  1TWC H;  1Q82 C;  4IFD I;  1U5K A;  5KRU A;  3BDL A;  2ICI A;  5IGC A;  1VQK A;  1GOZ A;  4WJW A;  5COY A;  1VF7 A;  1I4P A;  4DR2 Q;  1XMQ Q;  1MD2 D;  4DV2 L;  4MTN A;  1U9R A;  5FLX c;  2R7D A;  4EX5 A;  4RCO A;  1TKW B;  5KYI A;  1PYW D;  1EQT A;  1RCV D;  3HRZ C;  2UUB L;  3D4W A;  3KLS X;  1A2U A;  4Z9C B;  2XTI A;  2F0Q A;  1OXX K;  4WRD A;  5DEH A;  4ZYS A;  1KXL A;  1KHI A;  5KND A;  2D9U A;  1EY7 A;  4LF7 Q;  1PH4 A;  4RFB A;  1K0S A;  3MXN B;  1B4O A;  2LY7 A;  4GLX A;  3I4L A;  1XMQ L;  2UUB Q;  1BQQ T;  5K5P A;  3F2C A;  2PQA B;  2DY8 A;  2A74 C;  1LTG D;  1ZKO A;  2BDN A;  3A8I E;  1CI3 M;  2JYO A;  2VUM B;  3E9I A;  3V96 A;  4DV2 Q;  3M3Y H;  3SVM A;  1ONL A;  5ELO A;  3JAM c;  1A3V A;  5M3M G;  2QEJ C;  2K4K A;  5LMN W;  1TY0 A;  5CBE E;  2KCT A;  5FLX E;  1IKM A;  2E75 C;  5ISR A;  3GD7 A;  5C4J H;  4R9W A;  1VQP A;  4F8M A;  3AEV A;  1D6E C;  2CHB D;  4B3M L;  3VYU A;  5KEE A;  2AWN A;  3OWE B;  1Y1W H;  2NVQ B;  2BCO A;  3QIA A;  3KBG A;  5IT9 E;  4K2K A;  1HHV A;  3P75 A;  4XQQ A;  3I8Z A;  3C1E A;  5M5X B;  2KEC A;  2VB2 X;  3S17 B;  4ZRZ A;  5GAG C;  5AJ3 L;  1EY4 A;  4GLV B;  3GDE A;  3PIO A;  5M5W B;  1F9P A;  4DA2 A;  5C4X H;  1G6Z A;  1H9S B;  3J81 i;  2R6G A;  1EEI D;  2B2T C;  2HCC A;  2KVM A;  4JCV E;  4A3C G;  1X55 A;  1KIX A;  4HTH A;  3U50 C;  1OXU A;  4A3G G;  4JC0 A;  1I4H A;  4BY1 H;  5JJK A;  1Y8O B;  4HIO A;  4NB3 A;  3K57 A;  3DXJ C;  2ZJR A;  4BA1 I;  3CPF A;  4JI6 L;  1WVL A;  1KC8 C;  3UDX A;  1IYV A;  3AFQ A;  3PQI A;  3KF8 B;  2ZJP A;  1AZP A;  5IP7 H;  2KOL A;  1B44 D;  5IT9 c;  3S1R H;  4UDU C;  2K6A A;  1BKB A;  4DK6 C;  1NR2 A;  3M3Y B;  2PNR C;  2L4N A;  5NUC A;  3OW2 A;  3E0E A;  5I6Y A;  3M85 A;  4RMF A;  2Q2T A;  1HQR D;  1I50 B;  3FDT A;  1NTG A;  1JE4 A;  5D3D A;  2UXD Q;  1I4Q A;  4B9W A;  4B3M Q;  2G9D A;  4CJ2 C;  3GQB A;  3Q0A A;  3G7L A;  2B63 H;  1BO0 A;  4RGN A;  1HA5 A;  4C2M H;  1G2S A;  5GAD C;  1BF4 A;  1K3R A;  1CA5 A;  2A6H C;  2Z6B A;  3CC7 A;  4OIK A;  2K01 A;  1YNJ D;  4JI3 Q;  2B2V C;  1K83 H;  1U0L A;  4A3B B;  1OXT A;  1Y1V B;  2AHO B;  4H7B A;  3BJU A;  3HKZ G;  4A3G H;  4OIJ A;  5CGK A;  5IYC H;  1XNQ Q;  4DV7 Q;  2KJX A;  5C3E B;  3VYR A;  5J1Z A;  4LF8 Q;  3K5O A;  4L5Q A;  2NB0 A;  2JA5 B;  1V1O A;  2VZA A;  4DV3 L;  3P7J A;  2A69 D;  2EYF A;  5JAV A;  1JOK A;  5IP7 G;  5FO8 B;  1N9W A;  3RUZ A;  3BVZ A;  2JA6 G;  1I4G A;  4DK3 C;  1YIT A;  3H0G G;  4F7X A;  5IYD H;  1QZG A;  4CBV A;  4PV1 C;  4A3M H;  1EQR A;  1XPU A;  1B3Q A;  1YEZ A;  3PGZ A;  1W6J A;  3PF5 A;  3VR5 A;  1KAB A;  3H3V I;  2B2W A;  4R8I A;  3C3L A;  1TS2 A;  1IL8 A;  1SE2 A;  5FLM G;  2OEO A;  5C44 H;  3QG1 A;  1VQE A;  4GNX B;  2TSS A;  2I07 B;  2NZH A;  3A7A B;  1HA6 A;  1HXY D;  1EY5 A;  1OTC A;  3BYT B;  2N8N A;  1WTO A;  2AQ1 B;  1B9M A;  1V9P A;  3S1M B;  2BA1 A;  5CYU A;  4IN3 A;  2X6L A;  1STB A;  4K5X A;  4JI2 Q;  3BYY B;  2B2U C;  1PH8 A;  2CWA A;  1ZEQ X;  3T56 B;  3QO2 A;  4AQY L;  4K0K Q;  3HFZ B;  2E5L L;  3ER0 A;  2K7V A;  2EJG C;  2E74 C;  1IW7 D;  2YTX A;  3HOV G;  5HGT A;  4JVZ A;  2PQA A;  2F0S A;  3K8A A;  3W3A A;  4QIW E;  2WKC A;  2IHE A;  1HZ9 A;  1XXG A;  1YJ9 A;  3LNN A;  1E2Z A;  3IFD A;  4AH6 A;  1F2M A;  5K36 G;  4JI8 Q;  4C3H H;  2I5M X;  3H6M A;  5JPM C;  5I9O A;  2N49 A;  4N9T A;  1NCV A;  2VY3 A;  2Q8R E;  1PZJ D;  1MSG A;  2D2C C;  5JEA J;  1TWC B;  5CV7 A;  5IGE A;  2AQ2 B;  3NUC A;  3R2T A;  3DWA A;  4O0A A;  5BN4 A;  1CHP D;  2F0G A;  1LYL A;  4XYO A;  4A3M G;  3J7A V;  3CC4 A;  4A3D G;  4FYD A;  4DR7 L;  2X6G A;  1VDZ A;  2J4X A;  2OF1 A;  2NWG A;  3TS2 A;  1C7Y A;  1X32 A;  1CFM A;  4KD4 A;  1QUQ B;  4QJF A;  1L0X B;  2F3I A;  4KTA A;  1PTO F;  1PYS B;  2PYK A;  4JBJ A;  2EY6 A;  2RA4 A;  1Z9F A;  2UUA L;  1VQ4 A;  1KDA A;  1IBL Q;  2WAC A;  3X3N A;  1PLF A;  4O1N A;  3V05 A;  2UU9 L;  1DOM A;  1X3Q A;  2A6E C;  4DF7 A;  3W1B A;  3VDY A;  1XMO L;  3NP8 A;  4NPS A;  4JI3 L;  3FVQ A;  2PPB C;  1RL2 A;  1SRU A;  3TBI B;  1MSH A;  4H0L C;  3GTM H;  1NJI C;  4DUY Q;  1ICW A;  4UP9 A;  2UUA Q;  1IHZ A;  4J8Q A;  1PH1 A;  1ENF A;  1AW7 A;  1QWY A;  4A3F G;  3TZD A;  3TDQ A;  3EJI A;  1GVP A;  1VMP A;  1BNZ A;  4G4K A;  4BY1 G;  1YNJ C;  4I7Z C;  4IOA A;  4AQY Q;  5C3W A;  1UE1 A;  1QVC A;  3RR5 A;  2CW0 D;  4YWL A;  4GOP C;  3HS0 C;  2PZW A;  1LTI D;  1FYC A;  1P16 A;  2CQO A;  2EYH A;  4KHP Q;  5JJI A;  2ID0 A;  2ASB A;  5C3X A;  3S9W A;  2NVQ H;  4KY5 A;  1O7L A;  4L5R C;  1D5Z C;  4X3T A;  4A3D H;  1GKH A;  5IT9 L;  3EFX D;  4PMB A;  4RHS A;  1PFB A;  1K73 C;  4FXD A;  4LF9 Q;  3HOY H;  4DAM A;  1MIU A;  2K50 A;  3GTQ B;  4N9P A;  4UP8 A;  1PH7 A;  1GXD C;  3I4O A;  1HZC A;  4B08 A;  5CV9 A;  1F9S A;  1HTP A;  1WTH A;  2V4D A;  3A5Z B;  1DD2 A;  2DUD A;  2QGQ A;  2NVY B;  4LFB L;  2OT2 A;  2IW3 A;  1IKL A;  3S1M H;  1TR5 A;  4BBR B;  5E4W C;  4B3S L;  3BDO A;  1STH A;  1E24 A;  1A62 A;  1H9J A;  2K5D A;  3GTP H;  1JIC A;  1WOC A;  2FMM A;  3B6Y A;  4J1M A;  4LF4 Q;  2RKS A;  1NY4 A;  5IYB H;  2JA8 B;  2GN5 A;  1AH9 A;  2PI2 A;  1PFN A;  4DAP A;  1TWF H;  5F2D A;  2R7Z H;  4NP5 A;  4OEL B;  3SHL A;  1EWI A;  1QZH A;  2H4O A;  1IL2 A;  1DJR D;  4LK1 C;  3NWS A;  4X6A H;  3J81 j;  4QIW B;  4KJN A;  4I65 A;  1H9M A;  3MHB A;  1YI2 A;  1HNZ Q;  2MHV A;  1L0W A;  3AB9 A;  3JC6 6;  4DR5 L;  1IZ6 A;  4LW1 A;  2HHH Q;  3H0G H;  4B3T Q;  3T1Y L;  5BN3 A;  4LAA A;  5CV8 A;  2PMZ B;  3X3M A;  1AE2 A;  1Q1B A;  2NVX H;  4ME5 A;  2RHQ B;  2AKW B;  4BWG B;  3K58 A;  4X64 Q;  2VQF Q;  3I4N H;  4BBS H;  3GV3 A;  2A6H D;  2WAQ E;  4PZ8 A;  2EXD A;  5DM6 3;  5DLQ E;  5C44 G;  1PVO A;  3Q22 A;  2PZU A;  2HD3 A;  1L1O B;  4HED A;  1TS3 A;  1S3O A;  2Z9H A;  1X3G A;  3HP3 A;  1Y1V G;  1AFP A;  2F0O A;  3I90 A;  4KMU C;  4UPA A;  3HKZ B;  4YHH L;  4JI8 L;  4ULL A;  3CP0 A;  4DXG A;  4AIM A;  1EY0 A;  3A54 A;  2TMP A;  3Q8D A;  3STB D;  3KJO A;  3PMF A;  4HAE A;  3TN2 A;  2MO0 A;  1F2L A;  2CH4 W;  5K36 H;  4FVM A;  3D6C A;  2UXC Q;  2D62 A;  2IY5 B;  1SMX A;  2L15 A;  3SXH A;  1TWG B;  3G6J B;  2IT1 A;  1Y1W B;  2JA7 H;  3S16 H;  4KKT A;  3P20 A;  1ASZ A;  2BA0 A;  5LL6 S;  1SNM A;  2QW7 A;  4CDC C;  4JI1 Q;  2D0P A;  2KCC A;  3MXG A;  1PRT C;  3PCO B;  3J80 c;  4LWC A;  5IOC A;  5FJ8 G;  3A55 A;  1VQC A;  1CKM A;  4IUT A;  2HT1 A;  4C2M B;  4IAL A;  4XDX A;  2PMZ E;  4LJZ C;  4YIJ A;  2MNA A;  1VQL A;  3NEM A;  3UDI A;  3PV0 A;  3T1H L;  4ZQ3 A;  1D2B A;  2DNC A;  4C56 C;  2K75 A;  5JJL A;  3PSI A;  2F1M A;  5EPK A;  3VR2 A;  3GTG B;  3VA5 A;  3MFY A;  4P75 A;  4DNR B;  1WFQ A;  3OIP A;  4YWK A;  1VQM A;  4ODG A;  1PH9 A;  2D5D A;  1EIY B;  1PRT B;  4XIG S;  3D31 A;  2E2J B;  3A7L A;  4L5S A;  3HOU B;  2L9H A;  3DWP A;  1NBW A;  2LSS A;  4GKK Q;  4WJ3 M;  3A8K E;  1Y69 U;  1B9N A;  3C2P A;  1E1O A;  1SJH D;  3L7Z C;  3MFG A;  2F03 A;  1AP0 A;  2BE5 C;  1IBM Q;  3I73 A;  1M8A A;  2MP1 A;  3RN2 A;  2IWH A;  2C5C A;  1UE6 A;  1Q46 A;  1F2Z A;  3A74 A;  1WI5 A;  1SYE A;  1BCP F;  1JWS D;  3K7U C;  1R4P B;  1CUK A;  2VB3 X;  4KJO A;  4NW2 A;  1B53 A;  4GKJ L;  3AU7 A;  1BBX C;  1FNV A;  1GHK A;  1N36 L;  1EFW A;  2KQ3 A;  4X65 Q;  1UWV A;  4X62 Q;  1SEB D;  4G7Z C;  5JEA H;  1HUM A;  2R7Z B;  4APV A;  3K5L A;  2JP1 A;  1V1P B;  2ZT9 C;  1M1K C;  3FKI B;  1SR3 A;  1B2T A;  3T1Y Q;  3PO3 H;  1HH2 P;  4DGZ A;  2Q2I A;  5I2X A;  3FMC A;  3GTJ B;  1RD9 D;  1VQG A;  4DV0 L;  1VQD A;  4GZY C;  2DGY A;  2A68 D;  3OTO L;  3L9A X;  1E2W A;  1CK1 A;  3HOX G;  1VQO A;  1N8R C;  4OWW B;  2VNU D;  4NXM L;  3P1H A;  2BOS A;  3NQT A;  1A3T A;  4YCV A;  1LT3 D;  3S15 B;  2IHF A;  4A3J G;  1KAA A;  3R3O A;  4HR7 B;  4LF7 L;  2M2L A;  4QL5 A;  1GUW A;  1LO5 D;  4MNO A;  1E1T A;  1YVC A;  1N34 Q;  2F0I A;  1D8L A;  1TQO A;  2WKD A;  4RGT A;  3K6O A;  1S4Z A;  1LT5 D;  1X3F A;  4A3F B;  4PMC A;  4DV1 Q;  2EDG A;  3K80 C;  5ELD A;  1EYC A;  2Z1C A;  4DAY A;  4HJ5 A;  4BY1 B;  3VR6 A;  1Q12 A;  3RLO A;  3ITP A;  2JA9 A;  4GN3 B;  3ERO A;  5EGT A;  3CXC A;  4JI5 Q;  3CRL C;  2XIW A;  4LF6 Q;  1G8Z D;  5EBC A;  4A76 A;  1SNP A;  2NN6 I;  1OXV A;  3JAM E;  1S5D D;  2HDM A;  3M4Q A;  4BBS G;  3J80 E;  3AMU A;  3PUX A;  5DNF A;  1LTT D;  4EGV A;  1FGU A;  2LMC B;  1V8Q A;  2SOB A;  3E3X A;  2O4X A;  2WP8 J;  1D5X C;  1Y1V H;  2RCN A;  1I4X A;  2PCF B;  4IQZ A;  1E3P A;  4R1J A;  4DUY L;  4JI0 L;  1C0A A;  4JBM A;  4X66 L;  1LTA D;  4EQ5 A;  3W1G A;  2OQ0 A;  3UDF A;  3GO5 A;  1XPO A;  1HR0 L;  1SBB B;  3NPP A;  3J7A 5;  5IYD G;  1KRT A;  5AJ3 Q;  1UEB A;  3RNU A;  2RBM A;  1BDO A;  1RTO A;  3K7A B;  3CMA A;  4DNI A;  1XTC D;  1MI2 A;  3GTP B;  3HOW H;  5LMU Q;  4DR4 Q;  3TP6 A;  2NVY H;  2GVA A;  1LM0 A;  4JPB W;  4U68 A;  3M4P A;  1J8I A;  1VQJ A;  2F0J A;  3PIP 3;  2NTS A;  1R9T B;  1ET6 A;  1S5C D;  1A8V A;  1SYG A;  1O7Y A;  1I4R A;  2QDB A;  3MEF A;  1STY A;  3CCS A;  5M3M B;  2K5Q A;  2HIX A;  2K14 A;  1I6V C;  3KF6 A;  1UAP A;  2PW7 A;  4KD3 A;  1L2F A;  1B50 A;  1U4M A;  1BR9 A;  1PRT D;  3H3V H;  4P72 A;  3CCR A;  1XWE A;  4L5T A;  4A3D B;  5J22 A;  4QUF A;  3NBI A;  4X64 L;  3LWE A; 
#chains in the Genus database with same CATH homology
 4S3S A;  1TS4 A;  1SNC A;  2K32 A;  3MAQ A;  1EQV A;  2Z8L A;  1SNO A;  1HFN A;  5I2Y A;  1B1Z A;  5C4H A;  1PDQ A;  1D1I A;  3IKJ A;  2E2H B;  2FFK B;  1U4R A;  1YNN C;  4IUV A;  1EY9 A;  2DN8 A;  3KBX A;  1ILQ A;  4C3H B;  5C6A A;  4NMZ A;  3TP7 A;  3M7N A;  3SK8 A;  2JEA I;  2ICE C;  2LKV A;  3D4D A;  3N52 A;  2IX3 A;  1LTB D;  2KA7 A;  3ND8 A;  3T16 A;  4M1U B;  1GUT A;  1SSO A;  5EPL A;  1CA6 A;  2G9H D;  2JA7 B;  4JBW A;  2B2Y A;  2B2U A;  2B2Y C;  1LT4 D;  3S2H B;  1ESR A;  1PZI D;  2F0V A;  1UEA B;  3D4R A;  1XX8 A;  1PTO B;  1S5F D;  3OMC A;  1QIL A;  2J0T D;  2L55 A;  2H1E A;  1A3U A;  4ABN A;  3PUW A;  2JA6 B;  1EZ8 A;  2CQA A;  2KUM A;  4XTC S;  3H09 A;  5E1F A;  3RZD B;  2NVX B;  3FPU B;  4K14 A;  4HN7 A;  1WTR A;  4QF4 A;  2RDG A;  4MIU A;  1TWF B;  4IZ8 A;  3M7G A;  1KNA A;  4KV6 A;  4MN3 A;  5CV4 A;  5C0X G;  1CZW A;  4DN4 M;  1ENC A;  3DUZ A;  5JOB A;  2XN9 C;  1BXT A;  3Q23 A;  1MBY A;  2O5J C;  1KDB A;  2XSC A;  1EL0 A;  3MTS A;  1K8M A;  4X3S A;  2A68 C;  5EKI A;  2EYJ A;  4UAI A;  5C44 B;  3PUY A;  4G7H C;  4IFD G;  4A3K B;  2CVR A;  1I6H B;  5T1I A;  1UUP A;  1RF2 D;  1SYC A;  2EZV A;  3NSW A;  3NWT A;  2QF7 A;  4X3K A;  2Z4I A;  5M3F B;  2K1B A;  3BS1 A;  1JWM D;  1Y8N B;  3PUV A;  4RA8 A;  2NUC A;  4TSS A;  4ZKB B;  1QOH A;  5FO9 B;  1EZ6 A;  5LL6 X;  2L5T A;  3OMG A;  5G3L F;  4QUC A;  5TSS A;  4DK1 A;  4K5W A;  3HGB A;  1OO9 B;  2K04 A;  1K83 B;  3OWF A;  2EYM A;  2F3W A;  5IGB A;  2VXW A;  3SK6 A;  1B3A A;  1VCI A;  3E5S A;  2CW0 C;  2ZXO A;  4J6H A;  4K6D A;  2XNA C;  3MC0 B;  4ZAI A;  4XT3 B;  1TY2 A;  3VR3 A;  4C3J B;  1SAP A;  4RKL A;  5M5Y B;  5I9P A;  1SJE D;  4RAU C;  1NUC A;  1LAB A;  5ELB A;  1GJX A;  2IPK D;  5JVG 3;  3PO3 B;  1SYD A;  5HUR A;  1WD0 A;  1YNN D;  5DAU A;  2R3Z A;  3WOF A;  1AN8 A;  4U67 3;  5IGG A;  4K6L A;  4TKO B;  2BE5 D;  4QCL A;  4TRD A;  1SNQ A;  4ZK9 B;  4BS9 A;  1JQY D;  4HMI A;  1EEF D;  1T5E A;  3ZYY X;  2B63 B;  3OPO A;  1QB5 D;  2M00 A;  1ZYR D;  1DOK A;  2N55 A;  1G29 1;  3CQZ B;  4F87 A;  4FF1 A;  2JXM B;  3NK9 A;  2L12 A;  3QWN A;  3SDZ A;  1EFI D;  4Q0F A;  4L6T B;  3KK7 A;  4EVO A;  2L0C A;  3HZX A;  1CT1 D;  3I91 A;  1CQF A;  3FPP A;  3PO2 B;  2FIN B;  3GV6 A;  1W6K A;  3VYS A;  5KNC A;  2N88 A;  1WCM B;  1F2Y A;  3BDC A;  4XT1 B;  1EIG A;  5E4X A;  3NTI A;  4Q5V A;  1NSN S;  3HEJ A;  1Q3L A;  2WAQ B;  2R61 A;  2B2T A;  2RVL A;  4FXG C;  2FHT A;  3S16 B;  1HQM C;  2MUY A;  1PTO H;  1C4Q A;  1OXS C;  3S1R B;  4RWS C;  1EOT A;  4O42 A;  1GUG A;  2KHS A;  1TT2 A;  1TWA B;  2Q8T A;  4CHT B;  4IFD J;  1G2T A;  3HOX B;  3E6Z X;  4IFD H;  2PO4 A;  1MGS A;  1SDF A;  1FNU A;  5EKL A;  1Q90 A;  4A3J B;  1SFO B;  5C4X B;  3CU7 A;  3SEB A;  1RKN A;  5CR3 A;  5CV5 A;  1SMY C;  3I3C A;  4L63 B;  4IUP A;  3KLR A;  1TWH B;  1STG A;  1HTL D;  5KIX A;  3K5M A;  1E2V A;  4LMQ D;  1H9R A;  2EY5 A;  3KF8 A;  3SK4 A;  3DEP A;  3TP5 A;  3EA6 A;  1HRJ A;  1XYI A;  4OO1 H;  1F9R A;  1EWC A;  3KUP A;  5EQ0 A;  4BBS B;  1EU3 A;  3RD4 A;  4K2L A;  3VR4 A;  3NE5 B;  3VA7 A;  2B8G A;  5C4Z A;  3J81 L;  3MVV A;  4XYQ A;  3URY A;  4CKC A;  1IYU A;  3QOL A;  1DCZ A;  3SE0 A;  3BG3 A;  4BA2 I;  4M8A A;  2NN6 G;  5BN5 A;  1WTV A;  3HG9 A;  1FNW A;  2L1B A;  5CBA E;  4C3H G;  2F0L A;  1EY6 A;  3H94 A;  2YU9 B;  3J80 L;  4H44 C;  3IAY A;  4FF3 A;  1STE A;  1BUV T;  5AFW A;  5I4D A;  5ELF A;  4B9X A;  2SEB D;  1STN A;  2FJ2 A;  3MWY W;  4A3E B;  4CKE A;  2J7Z A;  1EIH A;  1FR3 A;  5ELC A;  5JJZ A;  5JEA G;  4OO1 G;  4OL7 A;  1SE4 A;  3ERQ A;  2F0M A;  3K0Y A;  2EY1 A;  1O80 A;  2IJ0 A;  2A69 C;  1DM0 B;  3GTO B;  2NZ1 D;  3Q24 A;  4KN4 C;  4DFA A;  1FD7 D;  2E2D C;  3M4Y A;  3NTH A;  1V43 A;  2F0N A;  4FF4 A;  2F3V A;  1SE3 A;  1TU2 B;  2YYZ A;  3FEW X;  2F0K A;  2F0E A;  1WTX A;  1F9Q A;  3MXU A;  4KK7 A;  1EY8 A;  3T53 B;  1WTP A;  2E2I B;  5C4J B;  1GUN A;  4FNF A;  2Z4H A;  1BCP D;  4EQP A;  3GTL B;  5J39 A;  3TZU A;  2ENB A;  2Q8I B;  1LAC A;  2PW5 A;  1I3Q B;  5A2Q L;  2A5H A;  3I4M B;  2WIN B;  5C5L A;  1Z6H A;  2L11 A;  2IX1 A;  2F0W A;  1SYB A;  3CRK C;  4HSP A;  2XWJ B;  3MA2 B;  3N6R A;  1ZXT A;  5ELE A;  3BVM A;  1Y8P B;  1C48 A;  1BCP C;  3DM1 A;  4KI0 A;  3LX0 A;  4C1N I;  2Y0S B;  4BY7 B;  3BVG A;  4K8J A;  4NKL A;  1Q1E A;  4Y7N B;  1CTM A;  2EJM A;  5D14 A;  1Z7T A;  2C9O A;  3A8J E;  5C0X H;  4QMG A;  3U9S A;  2RDF A;  4RH6 A;  1II3 A;  3A56 A;  4FP5 D;  3FRP B;  4DK0 A;  1EYA A;  4JK1 C;  4TQU S;  1TII D;  4WOR A;  4KKS A;  1G91 A;  1GUO A;  1UNS A;  3J7A F;  1A6X A;  4HCS A;  4L8J A;  3QB3 A;  4ID6 A;  2RSO A;  3L3O C;  1ILP A;  5C5M A;  1KLG D;  3H91 A;  1LT6 D;  4R8N A;  2HQE A;  3OSO A;  4KHV A;  1CM9 A;  1HPC A;  2NN6 H;  4C3J G;  3S1Q B;  3V2T A;  1E0B A;  3R8B A;  1R4Q B;  1QE6 A;  4KN7 C;  4RKB A;  4AYB B;  4KY7 A;  1JB3 A;  2K03 A;  3E0J A;  2RQX A;  2EJF C;  1WTW A;  1STA A;  2WV6 D;  4ZUJ A;  5D3I B;  1C8C A;  2RSN A;  4IUQ A;  5FOB B;  1QNU A;  5KYL A;  3K5N A;  2AUK A;  3D8G A;  1CZG A;  5D65 A;  3S14 B;  2HCI A;  5IGD A;  2NYZ D;  3PUZ A;  2EYO A;  4IUR A;  1TVX A;  2F0T A;  2HDL A;  2PZT A;  2O2L D;  5EKK A;  5FK9 C;  2IL8 A;  5JPN C;  4PQX A;  2AUJ D;  3DEO A;  4FO2 A;  3ND9 A;  3CHB D;  4RCN A;  3J7Y W;  2DY7 A;  3QOJ A;  1CQV A;  2F4I A;  1F77 A;  1S5E D;  1FGB D;  1JCK B;  4CGY B;  1SYF A;  4IUU A;  1U4L A;  4PMW A;  2JSO A;  4C1N K;  3S1N B;  3J81 E;  4G57 A;  2A6E D;  2B39 A;  2BDO A;  2GA4 B;  1RJT A;  3TME A;  4RHR A;  3WDN A;  3NXW A;  3KLS A;  5I6W A;  1DZ1 A;  4DXF A;  5A35 A;  3O13 A;  3EQL C;  4A93 B;  2WB1 B;  4NDX A;  2IX0 A;  4K5V A;  5EPJ A;  4V0B A;  1AZQ A;  3NBH A;  4DAV A;  3HOY B;  2I46 A;  1SMY D;  5CC4 A;  2AQ3 B;  3WOE A;  4A3I B;  1EU4 A;  3MEH A;  1LTS D;  1JOO A;  5M9O A;  3MXN A;  2JE6 I;  3S2D B;  3OHX C;  5CV6 A;  2K05 A;  2XWB B;  4A3G B;  1S5B D;  3DMU A;  3EVQ A;  3ONA B;  4C3I B;  1KLU D;  5LHY 1;  2NBF A;  1EWH A;  1O78 A;  1HUN A;  1A2T A;  5FKA C;  4KHZ A;  5C0X I;  3OOC A;  5DM7 3;  1DON A;  2ZXP A;  1VMC A;  4RGM A;  2XRS D;  3R2I A;  1JWU D;  1RHP A;  4XQN A;  3U9O A;  3RMH A;  3W2D A;  2QKI C;  2X69 A;  2DNE A;  3RLF A;  2OXP A;  4DU9 A;  1M4V A;  1KNE A;  3MXP A;  1LV9 A;  4QB4 A;  4K8I A;  3LWU A;  5FLX L;  2EPB A;  4KY6 A;  2HUG A;  1QJO A;  3K59 A;  2F0D A;  5FO7 B;  5IOD A;  1TS5 A;  5G3L D;  3I70 A;  2E76 C;  3T51 B;  1DXM A;  1QG7 A;  3HOV B;  3GTM B;  3D6W A;  1CHQ D;  3JAM L;  2KCN A;  2EY2 A;  2NVT B;  3QJY A;  3H0G B;  4DNT B;  1PTO C;  4G7O C;  2F0F A;  4P2C B;  2MJ8 A;  3T4A C;  3HOZ B;  3VYT A;  2EE1 A;  4OO1 I;  3I72 A;  1VF5 C;  5KNB A;  1PXU A;  1H9S A;  4OHJ A;  1QNK A;  3R93 A;  5KGU A;  1LTR D;  2XVS A;  1PZK D;  3OIQ A;  3IFT A;  4RGO S;  2SNS A;  4KKU A;  5E3F A;  1JOR A;  1D1K A;  2EYP A;  4CJ0 B;  3NTK A;  2MPM A;  1ROD A;  4FF2 A;  4CJ1 B;  1A15 A;  4E6I A;  1BCP B;  1LLR D;  2JEB I;  2EVB A;  2K33 A;  1NR4 A;  4PNY A;  4F88 A;  5T1G A;  3IL8 A;  1RDP D;  3H3V C;  3NQI A;  1NAP A;  4XXE A;  2MGS A;  1L0Y B;  3SK5 A;  1PMR A;  1JOQ A;  1GHJ A;  4CKB A;  2RDH A;  2F0P A;  2B2V A;  1WD1 A;  3BZD B;  1DYQ A;  3Q6S A;  2KED A;  4V19 0;  3D3R A;  3MZ5 A;  1SXT A;  2EXZ A;  2F0U A;  2LFN A;  1Q8I A;  1X3P A;  1WTQ A;  1KDC A;  1JR0 D;  1GUS A;  1DOL A;  1SND A;  5IIF A;  1JC7 A;  5CMD A;  2R92 B;  5EBD A;  1H9K A;  2F0H A;  1O7Z A;  3F2U A;  1PTO D;  4OGQ C;  4EQN A;  2AWO A;  5C0X J;  4EQO A;  4ILW A;  3GTK B;  2XRQ D;  1ESF A;  4ZKC B;  5COR A;  3RZO B;  4FXK C;  4HMJ A;  1QCB D;  1U4P A;  2EYL A;  5JVH 3;  3C1F A;  1EYD A;  2PQE A;  3TP8 A;  4ZLT F;  2K28 A;  3C46 A;  3PIO 3;  5IGF A;  1RTN A;  3GP7 A;  3SR1 A;  4IUN A;  2SNM A;  3T13 A;  2B8F A;  2KEE A;  4HSV A;  3UI2 A;  4X3U A;  4WFN 3;  1KTK A;  2QIL A;  3DHQ A;  2K5W A;  2A73 B;  4H13 C;  2FMC A;  1IW7 C;  2ZXR A;  1Z47 A;  2NTT A;  4ZUI A;  3CKI B;  2R93 B;  4XQJ A;  1PRT F;  4MHE A;  3HOW B;  2M9V A;  3OW7 A;  5A2Q E;  1J9O A;  4C3I G;  4HCE A;  5EJW A;  2LS0 1;  3M4O B;  1HFG A;  1ZYR C;  1T5X D;  1ET9 A;  1HCZ A;  2O5I C;  2SDF A;  2WII B;  1AEX A;  2B2W C;  2QCP X;  1PFM A;  3TSS A;  1K8O A;  4A3M B;  1D5M C;  1ENA A;  3DWQ A;  1BOS A;  1ML0 D;  3NHH A;  1V1P A;  3I4N B;  2EOT A;  4IFD I;  5KRU A;  3BDL A;  2ICI A;  5IGC A;  1GOZ A;  4WJW A;  5COY A;  1VF7 A;  1I4P A;  1MD2 D;  1U9R A;  4RCO A;  1TKW B;  5KYI A;  1PYW D;  1EQT A;  1RCV D;  3HRZ C;  3D4W A;  3KLS X;  1A2U A;  4Z9C B;  2F0Q A;  1OXX K;  4WRD A;  5DEH A;  4ZYS A;  5KND A;  2D9U A;  1EY7 A;  4RFB A;  1B4O A;  2LY7 A;  3I4L A;  1BQQ T;  5K5P A;  2DY8 A;  2A74 C;  1LTG D;  1ZKO A;  2BDN A;  3A8I E;  1CI3 M;  2JYO A;  2VUM B;  3V96 A;  3SVM A;  1ONL A;  1A3V A;  2QEJ C;  1TY0 A;  5CBE E;  5FLX E;  1IKM A;  2E75 C;  5ISR A;  3GD7 A;  4R9W A;  4F8M A;  1D6E C;  2CHB D;  3VYU A;  5KEE A;  2AWN A;  3OWE B;  2NVQ B;  2BCO A;  3QIA A;  3KBG A;  5IT9 E;  4K2K A;  1HHV A;  3P75 A;  4XQQ A;  3I8Z A;  3C1E A;  5M5X B;  2KEC A;  2VB2 X;  3S17 B;  4ZRZ A;  1EY4 A;  5M5W B;  1F9P A;  4DA2 A;  1G6Z A;  1H9S B;  2R6G A;  1EEI D;  2B2T C;  2HCC A;  2KVM A;  4HTH A;  1OXU A;  1I4H A;  1Y8O B;  3K57 A;  3DXJ C;  4BA1 I;  1WVL A;  1IYV A;  1AZP A;  2KOL A;  1B44 D;  4UDU C;  2K6A A;  1NR2 A;  3M3Y B;  2PNR C;  2L4N A;  5NUC A;  5I6Y A;  3M85 A;  1HQR D;  1I50 B;  3FDT A;  1JE4 A;  5D3D A;  1I4Q A;  4B9W A;  2G9D A;  4CJ2 C;  3GQB A;  3Q0A A;  3G7L A;  1BO0 A;  4RGN A;  1HA5 A;  1G2S A;  1BF4 A;  1CA5 A;  2A6H C;  4OIK A;  2K01 A;  1YNJ D;  2B2V C;  4A3B B;  1OXT A;  1Y1V B;  4H7B A;  4OIJ A;  5CGK A;  2KJX A;  5C3E B;  3VYR A;  5J1Z A;  3K5O A;  2NB0 A;  2JA5 B;  1V1O A;  3P7J A;  2A69 D;  2EYF A;  5JAV A;  1JOK A;  5FO8 B;  3RUZ A;  3BVZ A;  1I4G A;  4F7X A;  4CBV A;  4PV1 C;  1W6J A;  3VR5 A;  1KAB A;  2B2W A;  4R8I A;  3C3L A;  1TS2 A;  1IL8 A;  1SE2 A;  2OEO A;  3QG1 A;  2TSS A;  2I07 B;  3A7A B;  1HA6 A;  1HXY D;  1EY5 A;  3BYT B;  1WTO A;  2AQ1 B;  1B9M A;  3S1M B;  2BA1 A;  5CYU A;  4IN3 A;  2X6L A;  1STB A;  4K5X A;  3BYY B;  2B2U C;  1ZEQ X;  3T56 B;  3QO2 A;  2K7V A;  2EJG C;  2E74 C;  1IW7 D;  5HGT A;  2F0S A;  3W3A A;  2WKC A;  1XXG A;  3LNN A;  1E2Z A;  3IFD A;  1F2M A;  5K36 G;  3H6M A;  5JPM C;  5I9O A;  4N9T A;  1NCV A;  2Q8R E;  1PZJ D;  1MSG A;  2D2C C;  5JEA J;  1TWC B;  5CV7 A;  5IGE A;  2AQ2 B;  3NUC A;  3R2T A;  3DWA A;  5BN4 A;  1CHP D;  2F0G A;  4XYO A;  3J7A V;  4FYD A;  2X6G A;  1VDZ A;  2J4X A;  2OF1 A;  2NWG A;  1X32 A;  1CFM A;  4KD4 A;  1L0X B;  4KTA A;  1PTO F;  2PYK A;  2EY6 A;  2RA4 A;  1KDA A;  2WAC A;  3X3N A;  1PLF A;  4O1N A;  3V05 A;  1DOM A;  1X3Q A;  2A6E C;  4DF7 A;  3NP8 A;  3FVQ A;  2PPB C;  3TBI B;  1MSH A;  4H0L C;  1ICW A;  1IHZ A;  4J8Q A;  1ENF A;  1AW7 A;  1QWY A;  3TZD A;  3TDQ A;  3EJI A;  1VMP A;  1BNZ A;  4G4K A;  1YNJ C;  4I7Z C;  5C3W A;  2CW0 D;  3HS0 C;  2PZW A;  1LTI D;  1FYC A;  2EYH A;  2ID0 A;  5C3X A;  3S9W A;  4KY5 A;  1O7L A;  1D5Z C;  4X3T A;  5IT9 L;  3EFX D;  4PMB A;  4RHS A;  1PFB A;  4FXD A;  3GTQ B;  4N9P A;  1GXD C;  4B08 A;  5CV9 A;  1F9S A;  1HTP A;  2V4D A;  1DD2 A;  2NVY B;  2OT2 A;  2IW3 A;  1IKL A;  1TR5 A;  4BBR B;  5E4W C;  3BDO A;  1STH A;  1H9J A;  2K5D A;  1JIC A;  2FMM A;  4J1M A;  2RKS A;  2JA8 B;  1PFN A;  4DAP A;  5F2D A;  4NP5 A;  3SHL A;  2H4O A;  1DJR D;  4LK1 C;  3NWS A;  4QIW B;  4KJN A;  4I65 A;  1H9M A;  3MHB A;  2MHV A;  3AB9 A;  5BN3 A;  4LAA A;  5CV8 A;  2PMZ B;  3X3M A;  1Q1B A;  4ME5 A;  3K58 A;  4BWG B;  3GV3 A;  2A6H D;  5DM6 3;  3Q22 A;  2PZU A;  4HED A;  1TS3 A;  3HP3 A;  1AFP A;  2F0O A;  3I90 A;  4KMU C;  3HKZ B;  4ULL A;  4DXG A;  1EY0 A;  3A54 A;  2TMP A;  3PMF A;  4HAE A;  3TN2 A;  1F2L A;  5K36 H;  4FVM A;  3D6C A;  2D62 A;  3SXH A;  1TWG B;  3G6J B;  2IT1 A;  1Y1W B;  4KKT A;  3P20 A;  2BA0 A;  5LL6 S;  1SNM A;  2KCC A;  3MXG A;  1PRT C;  5IOC A;  3A55 A;  4IUT A;  4C2M B;  4IAL A;  4XDX A;  4LJZ C;  4YIJ A;  3PV0 A;  4ZQ3 A;  1D2B A;  2DNC A;  4C56 C;  2F1M A;  5EPK A;  3VR2 A;  3GTG B;  3VA5 A;  3MFY A;  4DNR B;  3OIP A;  4ODG A;  2D5D A;  1PRT B;  4XIG S;  3D31 A;  2E2J B;  3A7L A;  3HOU B;  2L9H A;  3DWP A;  3A8K E;  1Y69 U;  1B9N A;  3C2P A;  3L7Z C;  1SJH D;  3MFG A;  1AP0 A;  2F03 A;  2BE5 C;  3I73 A;  1M8A A;  2MP1 A;  2IWH A;  2C5C A;  1F2Z A;  1SYE A;  1BCP F;  1JWS D;  1R4P B;  2VB3 X;  4KJO A;  1B53 A;  4NW2 A;  3AU7 A;  1BBX C;  1FNV A;  1GHK A;  2KQ3 A;  1SEB D;  4G7Z C;  5JEA H;  1HUM A;  2R7Z B;  3K5L A;  2JP1 A;  1V1P B;  2ZT9 C;  3FKI B;  1B2T A;  4DGZ A;  5I2X A;  3FMC A;  3GTJ B;  1RD9 D;  4GZY C;  2A68 D;  3L9A X;  1E2W A;  1CK1 A;  2VNU D;  3P1H A;  2BOS A;  3NQT A;  1A3T A;  1LT3 D;  3S15 B;  1KAA A;  3R3O A;  4HR7 B;  2M2L A;  1GUW A;  1LO5 D;  2F0I A;  1TQO A;  2WKD A;  4RGT A;  3K6O A;  1S4Z A;  1LT5 D;  4A3F B;  4PMC A;  2EDG A;  5ELD A;  1EYC A;  2Z1C A;  4DAY A;  4BY1 B;  3VR6 A;  1Q12 A;  3ITP A;  3ERO A;  5EGT A;  3CRL C;  2XIW A;  1G8Z D;  5EBC A;  1SNP A;  2NN6 I;  1OXV A;  3JAM E;  1S5D D;  2HDM A;  3J80 E;  3AMU A;  3PUX A;  5DNF A;  1LTT D;  4EGV A;  2LMC B;  1V8Q A;  2SOB A;  2O4X A;  2WP8 J;  1D5X C;  1I4X A;  2PCF B;  4IQZ A;  1LTA D;  3GO5 A;  1SBB B;  3NPP A;  2RBM A;  1BDO A;  1RTO A;  3K7A B;  1XTC D;  1MI2 A;  3GTP B;  3TP6 A;  1J8I A;  4U68 A;  2F0J A;  3PIP 3;  2NTS A;  1R9T B;  1ET6 A;  1S5C D;  1SYG A;  1O7Y A;  1I4R A;  2QDB A;  1STY A;  5M3M B;  2K5Q A;  1I6V C;  1UAP A;  2PW7 A;  4KD3 A;  1B50 A;  1U4M A;  1BR9 A;  1PRT D;  4A3D B;  1XWE A;  5J22 A;  4QUF A;  3NBI A;  3LWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...