2XVSA

Crystal structure of human ttc5 (strap) c-terminal ob domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
166
structure length
166
Chain Sequence
b'SMRQREQQLLEFLDRLTSLLESKGKVKTKKLQSMLGSLRPAHLGPCSDGHYQSASGQKVTLELKPLSTLQPGVNSGAVILGKVVFSLTTEEKVPFTFGLVDSDGPCYAVMVYNIVQSWGVLIGDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TETRATRICOPEPTIDE REPEAT PROTEIN 5
publication title The P53 Cofactor Strap Exhibits an Unexpected Tpr Motif and Oligonucleotide-Binding (Ob)-Fold Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 43
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2010-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.550 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xvsA00
2XVSA 4ABNA
chains in the Genus database with same CATH superfamily
5CV5A 1STBA 3KF6B 2FMMA 4B3TQ 1G2SA 4ME5A 1HFNA 4GLVB 3TSSA 3S14H 4X65L 4P73A 5AJ3L 4N8FA 2CKZB 2AHOB 3E3XA 4HIMA 3ICEA 1XNRQ 3MFGA 2YTXA 3SK4A 2LSSA 3QR8A 5IGBA 2F0TA 3G6JB 2RVLA 1K8MA 3J81c 3S1MB 5DM73 3K0YA 3HOWB 4Q5VA 4DV4L 1V1QA 4IUTA 4LF6L 1BCPC 5JJZA 4XT3B 3PGZA 3KDFA 2NVQH 5C4HA 3CC4A 3KLSX 2OTJA 1D1IA 2RDGA 1GO3E 4NMZA 3HEJA 3TP7A 5J39A 4KHPQ 1X32A 3H3VH 4QF4A 1GUGA 5LL6S 2UUBQ 3NBHB 5FK9C 2I5HA 3ITPA 1I6HB 3BZKA 4X66Q 4X3SA 4H13C 3MHBA 3T1YQ 3BYYB 1VF7A 4A3EG 1AEXA 2K50A 2NN6H 2MNAA 1HHVA 3T53B 3V2TA 2HUGA 5C4XH 1YJWA 4XT1B 2F0VA 2KOLA 2XTIA 1EFID 2JA6B 4R4QA 2CCZA 1K8OA 1FJGQ 3U50C 1PH3A 1Z7TA 4JI6Q 4V190 4BY7B 3MA2B 2VQEL 5CGKA 5ELFA 1BUVT 1EL0A 1TWCH 1F9PA 1KAAA 4TRDA 4KHVA 1JC7A 4A3CH 4WORA 3JAML 4PG3A 3M4QA 1CTMA 5KNDA 3NXWA 4IN3A 3STBD 1SYGA 1SYFA 5M3MG 3K59A 3BJUA 1QCBD 3QB3A 3F2BA 2ENBA 3CPWA 3I55A 4YIJA 2RA4A 5NUCA 4MIUA 1SROA 2HT1A 4LAAA 2CH4A 3RZDH 1EY0A 1EYDA 3PUYA 3J80E 4JI8L 1SYCA 2ZXPA 5IP7G 1T9HA 3CCQA 4PMWA 2JA5H 3MXNA 3S2HH 1Y14B 3H0GB 1SR3A 4GLXA 5D3IB 3OIPA 1C7YA 2A6HC 2NWGA 4JK1C 4ODGA 2RKSA 4ALPA 2IW3A 4DR4Q 4WJ3M 2UXBL 3A74A 1IKLA 3NHHA 5M5XH 1JWMD 2CH4W 3KBGA 5DLQE 4DK0A 4GNXB 3M4YA 4L8JA 1KDCA 5CBEE 3UDXA 1NTGA 1WI5A 2C35B 4K8IA 1GUNA 3PO2G 3QWNA 4AIMA 5IP9H 4C3IH 2R7ZG 5H1SE 3GTOH 3KBXA 1PZKD 4JV5L 2L5TA 3FKIH 4HCSA 3HOYG 5I4DA 2HCCA 1HNWL 2VB2X 1D5MC 4RHSA 4F7XA 1EUJA 3I56A 4BS9A 4DK3C 2F4VL 2JA8H 3GTLH 5HURA 3L2PA 1EQRA 1A2UA 4QB4A 3RNUA 5EKIA 4IFDJ 2KHSA 1A6XA 2E2IH 2KCCA 5FJ8G 1A63A 3K8AA 1PTOC 4P72A 1BBWA 1LTAD 2NVYH 4LF7L 3G7LA 2OQKA 1VQHA 2CWPA 2B63B 1DCZA 5BN4A 2ZJQA 4FF3A 3I4MB 1STAA 5EQ0A 4RGOS 1JR0D 3TP8A 4QJFA 3A7AB 3J80c 3AEVA 3D4RA 3QJYA 2FHTA 2VUMG 1D1KA 3DWQA 3S1RH 1MSHA 2E76C 4DV1L 1S5ED 2PYKA 2UU9Q 3M3YH 1PZID 1I50H 3DHQA 3D31A 1SBBB 1S5CD 3S14B 1KRSA 2XNAC 1A3TA 2PZUA 4IPGA 3R3OA 3CU7A 3K58A 3I72A 3P20A 4RFBA 1YNXA 3OMCA 1SNOA 2DGYA 5IT9L 3TS2A 1HZAA 5LMUQ 2KCMA 2NB0A 2F0MA 1RCVD 3NE5B 4A3FG 3H94A 4OXPA 2BA1A 2Z4IA 4DV7Q 1QUQB 3DM3A 3PSIA 1Q3LA 4HR7B 1AP0A 1X3PA 3I4OA 2F0OA 4JI3L 5IGDA 3MFYA 4BY1H 3WOFA 1B7YB 1FGBD 1VQMA 3MAQA 4ZQ3A 1VF5C 1ZYRC 3UE1A 1S3OA 2NVQB 4DR5Q 5JEAJ 4LFCQ 5E1FA 1TXYA 3F1ZA 3TBIB 5CR3A 3SK8A 1VDZA 3I2ZA 1LO5D 1XNRL 2R92H 5EGTA 1IBKQ 4R4OA 4C2MH 1E2ZA 3GTJH 4CDDC 1VQLA 2R3ZA 1JJGA 2R93G 4JPBW 4WFN3 5C5MA 1HTLD 2C5CA 5FLMG 1NCVA 3A7LA 2XIWA 4K0KQ 3PUXA 5C3EG 3T16A 2Q2IA 4DV3L 4B3SQ 5C4XB 3NTIA 4NXNL 4LFAQ 2QF7A 4K5WA 1WTOA 2G9HD 4ZLTF 1MJEA 1SXTA 3GTGH 3CPFA 4KHPL 2JA7B 1I4HA 1TWCB 1TR5A 3MEHA 4JBKA 1SNQA 4LF5Q 3A56A 3SE0A 1EWCA 5M3FG 3MTSA 5AFWA 5EAYA 5KYIA 4KI0A 2Z8LA 1SYEA 5DNFA 5IYBH 1BCPF 4PNYA 2F0JA 4IJLA 5CBAE 3ZJYC 2HIVA 1S40A 3SK5A 1N8RC 4R8IA 4X62L 4G57A 2O4XA 2IHFA 3RZDB 4C3HB 5C44H 1VQ6A 4I7ZC 3GTMH 2A6ED 4DV0L 4HSPA 2JA5B 3S2HB 4A3DB 5EPKA 3BU2A 3PIP3 1TWAH 3G6EA 3I4LA 2DY8A 5EBDA 1DOLA 4R4TA 2L12A 4KLKA 2K52A 4LF4L 2QDBA 4OGQC 4OX9L 2VY3A 1EOVA 2M9VA 3QOJA 4UAIA 4A93G 1STNA 4CHTB 1J9OA 1RF2D 2G5DA 2HD3A 2PO4A 4A3MG 2BOSA 3R2TA 3UDFA 1II3A 1H9JA 2VL6A 4C3IB 1EQQA 3GTOB 1QZGA 2VZAA 5C0XG 1NE3A 3J81i 3GTPH 5L37A 3FKIB 5IGGA 1PYWD 4X65Q 1Q81C 2OEOA 2D9UA 2K5QA 5AJ3Q 1TY0A 3GV3A 1NAPA 4NKLA 1N36L 1K28A 5GAHC 4HEDA 1A2TA 3QO2A 1U4LA 2B2VA 4HSVA 1SJED 2BE5C 1K73C 1PLFA 1V9PA 3STBC 1W3SA 2E2IB 1CZGA 1Z47A 4JI5L 1B9MA 4NDXA 2WB1E 5D65A 3MEFA 2NVYB 5KNBA 1SJHD 3TZDA 2K5WA 1Y1WG 1STGA 4PZ7A 1IBML 4DV4Q 3KOJA 4LF6Q 1F2MA 3IKJA 4BBSH 2PQEA 1SFOH 4L5RC 4FF1A 2ES2A 1VMPA 3KJOA 2RCNA 4DV2L 4RKLA 4QQBX 3OWFA 3EBEA 2JSOA 1HRJA 3IRBA 2K33A 1JMCA 1L1OA 1L0YB 3R93A 5EJWA 3FMCA 4OONA 4QCLA 2PI2E 1M1KC 4DNIA 4G7ZC 1D5XC 3AYHB 3NBHA 3OOCA 4DA2A 2K5DA 2WB1B 1UAPA 1K8AC 3SVMA 1YITA 3IAYA 3FEWX 2AUJD 3Q6SA 3PF4A 5IOCA 3E5SA 4JI7L 4A3GH 2ID0A 2VQEQ 2A74C 4WRDA 4JI1L 4BY1B 4LMQD 4PQXA 1HZ9A 1KHIA 2KEDA 3SK6A 1PTOF 3CQZH 1L1OC 1X54A 1G6PA 3E9IA 4DAVA 2EZVA 2C9OA 2EQSA 1EZ8A 2LY7A 4K6LA 1H9SA 2RBMA 1HNZL 4K2KA 2MGSA 1NSNS 1VQNA 1Y1VH 4FP5D 4OL7A 4XYQA 5D14A 5EKKA 4JI0L 2R92B 2O5JC 4CDEC 5E7NA 4C2MB 4JI8Q 3CCSA 3I4NG 1I4GA 1STYA 3K7UC 1EU4A 1WOCA 4NP5A 4GKJQ 3EA6A 1E2VA 1I4PA 1PYSB 1DM0B 1NBWA 2H5XA 1KTKA 1C0AA 4IALA 4TSSA 1YHBA 1VQJA 3KUPA 4A3BG 3J7A5 2EYFA 2XGTA 1EWIA 2UXBQ 5GADC 5KYLA 2R61A 4UPAA 4DF7A 2A19A 1NR4A 1V43A 3GTGB 1JICA 4I65A 5FO9B 5FLXL 2YU9H 3FRPB 3KJPA 2Q2TA 4G7OC 3TRZA 4WJ4A 3CC7A 2SNSA 1KNAA 5E4XA 3URYA 2K14A 4KTAA 4GNXA 1HFGA 4RGMA 3R8BA 2EPBA 3I73A 1TKWB 4JV5Q 2IX0A 2E74C 1O80A 4K8JA 3CXCA 1E3PA 5ELBA 1HNWQ 3G48A 5EPLA 1H9KA 4GOPB 2K05A 3EFXD 2F4VQ 2NVTH 5LL6X 4DK1A 1Y69U 3AFQA 5C0XI 3J80i 5C44B 3GTMB 3KF8A 1G51A 3X3MA 1RTNA 3TP6A 1PZJD 5CC4A 3RN2A 2F0EA 4HAEA 3GTQH 1LABA 2E2JH 1TWAB 4GNXC 3OW2A 3Q0AA 3N52A 3BVZA 1PH2A 4LF7Q 5ELNA 4JYAL 4ZKBB 1WJJA 2OQ0A 4LNQA 2B8FA 1D7QA 1RJTA 3S15H 3O13A 4MZ9A 3NELA 1CZWA 1YBYA 1KL9A 3PIO3 3GP7A 4OO1G 2K28A 4A76A 2H1EA 1GM5A 2EDGA 4RKBA 1Q1BA 1X65A 4DV1Q 5GROA 1D2BA 4DAYB 1WCMH 5C3XA 5HGQA 1C48A 4DU9A 1TT2A 3TEHB 3GTPB 3TREA 1J5EL 1XMQL 1CA5A 3P75A 4O0AA 1HNXQ 3PO2H 3VDYA 4KKTA 2JEAI 2QDLA 5I9PA 1VQFA 1U4MA 4R9WA 2E8GA 2GA4B 3K5LA 1W2BA 3DEPA 1MD2D 1VQEA 2N8NA 3UDGA 2KVMA 1BR9A 3HOXG 5ELCA 3PO3H 1PH6A 4A3KB 4JI3Q 1EFWA 3C2PA 3C1EA 3V05A 3CCEA 1CQFA 5T1IA 5FJ8H 4C1NK 3GDEA 4OIJA 1ET6A 3GD7A 1K9MC 1VQ7A 3K5OA 4BBSB 1SFOB 2A6EC 1B2TA 3A8JE 3AB9A 3D4DA 2N88A 4JI2L 4IZ8A 1QG7A 1KAWA 3UI2A 3TP5A 4RGTA 1UUPA 2WP8J 4ZUJA 3KYHC 3F2CA 1OXUA 4MTNA 1YZ6A 4K6DA 3HOWG 4IFDH 1QNUA 2B2YC 3CRKC 3MZ5A 1PDQA 5FOBB 3ULPA 2MO1A 1KDAA 4DUZL 4N8X1 1XYIA 4DV3Q 3V96A 4NXNQ 1JJCB 4IURA 4DAMA 3NK9A 4KKUA 4N9TA 5BN5A 4KY5A 4A3GB 2KCNA 1UE5A 4A3FH 1PRTB 1UWVA 2AQ3B 2OT2A 3I90A 1N9WA 2F3IA 1DYQA 2MO0A 1BNZA 4X3KA 1ASZA 3P7JA 2K75A 4JBMA 1I4QA 3CCJA 1PH1A 1TU2B 4NB3A 1NMFA 2F0UA 2ZTEA 1GXDC 4C56C 3HOVH 3P1HA 3FPPA 1PH8A 4AH6A 1Y1VB 2Z6BA 4DPGA 2JA6G 1B50A 2KECA 3PIPA 4X62Q 4BY7G 3EIVA 2FINB 1EU3A 1HUNA 4KV6A 2M00A 2WACA 1WVLA 5JPMC 4DV0Q 2RSOA 1GUTA 3E0EA 1FNUA 4F8MA 2QEJC 3SXHA 4KD4A 1K83H 2Y0SE 1AE2A 1JQYD 2MPMA 5FLMH 4HN7A 4LF4Q 3SEBA 4OX9Q 4DUYL 2Z4HA 5HGTA 1VQPA 3H91A 1SEBD 5JEAH 1H9MA 2FFKB 5T1GA 1Q46A 1VQIA 1QJOA 4GKKL 4KJNA 4A3LH 1GVPA 1PRTF 5D3DA 5E4WC 4GKJL 1MSGA 4P75A 3I8ZA 4OO1I 3PUZA 5ELEA 1VS0A 2L1BA 5GAEC 4XTCS 3VR6A 4R8NA 1PFSA 1JE4A 2EYOA 4O42A 1LT4D 1N36Q 4UP8A 3GTKH 1CHPD 2AUKA 2BDNA 2Y0SB 1E1TA 3HOZB 1HQRD 4FF2A 2KBNA 3K7AH 4B9WA 1EY8A 3X3NA 4JI5Q 1X55A 4J15A 1WTRA 2J0TD 2JEBI 1IBMQ 4B3RL 3D8GA 3LX0A 3S15B 2K32A 2RDFA 1EYAA 1ESFA 3VA5A 1PRTD 1DXMA 3U4VA 1ESRA 2D0OA 3AU7A 1RODA 2I5MX 4DV2Q 1HXYD 5IGFA 3DUZA 3LGJA 1WCMB 4JG2A 4WJWA 4RA8A 3EN2A 2E75C 4JC0A 4DR2L 1XPUA 1K0SA 3G71A 2L55A 2B63G 1B8AA 5C0XH 2MQHA 1B70B 4FVMA 2IX1A 2PNRC 4AYBE 4MNOA 1EY4A 2M2LA 3EVQA 1IW7D 1EQTA 2RHQB 4DR1L 1YI2A 2NZOA 2MFIA 4DK6C 3RD4A 1LT3D 4YWLA 2IWHA 3PO3B 4JI7Q 5DM63 5ELDA 1CKNB 1IXRA 4JI1Q 4GN4B 1T5EA 3OYYA 2OCEA 5EPJA 1Q86C 2WIIB 3S17H 1HNXL 1TWFH 2PZWA 3ND9A 3G4SA 4FXGC 4YCUA 5C5LA 4LF8L 1VQBA 1HH2P 2IY5B 3HKZE 1HNZQ 1VQAA 4K5XA 5I6WA 3I3CA 1XPRA 1XNQL 3CMAA 4DN4M 1W6KA 2DJFC 4DR7L 1GUOA 1Q8KA 2K4KA 3NTHA 4N9PA 4AYBB 4JI0Q 1UE6A 4U673 2V4DA 3FVQA 1EIHA 5M9OA 4RCOA 3Q8DA 4AQYL 1G6ZA 2ATWA 4CGYB 3U9OA 3W1GA 2B2TA 1XTDA 4XQQA 1UEBA 4H44C 4X64L 4ABNA 1WTWA 2B3GA 1ZXTA 2NZHA 3OW7A 1EYGA 1S4ZA 4FF4A 1FL0A 1IHZA 1RIPA 2X69A 4DKAC 3FPUB 2JJQA 4LK1C 5COYA 1XTCD 3HKZB 3CCMA 4QL5A 1HPCA 1H9RA 1B4OA 1ONLA 1HR0L 1PFBA 1ML0D 1PA6A 2MUYA 4A3JH 1QILA 2EJFC 2F0WA 2ZXOA 3ERQA 4POGA 2NN6G 2B2TC 3HOVB 2H4OA 2EE1A 3UE0A 4RMFA 4CDCC 5C4XG 5TSSA 3R2IA 1C8CA 2E2HH 3M85A 1WTHA 4IUPA 3CCRA 1KNEA 2K6AA 1KIXA 5IODA 1Q12A 2JA7G 1SE3A 1I5FA 1Q1EA 4L5TA 4A3CG 2E5LL 2HHHL 3TMEA 3PIOA 4K14A 1SE4A 1LT5D 3JAME 3I7FA 3H6MA 4A4IA 3VR3A 3S1QH 1JE5A 1T5XD 1YJNA 4XYOA 4JYAQ 2QA4A 5JJLA 2BDOA 5IYDG 1BXTA 1SNPA 2F4IA 2F1MA 1LTBD 2O2LD 4C3HG 1V1OA 1LTID 1U4PA 1X3EA 1PXUA 3K6OA 1OTCA 4FNFA 2A73B 2PW7A 4HJAA 4KHZA 4A3DG 4BXXH 4EQNA 1QNKA 1X56A 1DONA 4G7HC 5A2QL 5C0XJ 2CWAA 4HTHA 4QUFA 1XMQQ 1J5EQ 1DOMA 2L11A 1NY4A 4DAYA 2KHIA 3H09A 1I94L 1KLUD 2VNUD 1RDPD 3NBIA 3D0FA 3NUCA 3A8IE 3GTKB 1M4VA 1NUCA 1ZEQX 5M5XB 3NWSA 1CT1D 3IL8A 1GUSA 1VCIA 3S1NH 3B6YA 1SYBA 4POFA 4C3IG 4R4IA 2WKDA 4A3IH 4U68A 3K5MA 4L63B 3FKIG 3T51B 4DR6L 3DWPA 4YCVA 1CHQD 4A75A 4CDFC 4R4CA 3J81L 4X6AH 2EXDA 2F0LA 1SE2A 5FKAC 2XN9C 1MGSA 2JK8A 4LWCA 3KF6A 4Z9CB 1LTSD 1TWHH 3I91A 2JA8B 3MXNB 3GTLB 2A68D 4JI2Q 2O5IC 4C3JG 2HCIA 2PNHA 4EQPA 1F2ZA 2CW0D 4DGZA 1PH9A 4OO1H 4KK7A 1D8LA 1TS5A 3CF5A 2NVXH 2WFWA 3JAMc 1EEID 2HQEA 2RHSB 4YHHQ 5I2YA 3BVGA 3RZOH 5FO8B 2KA7A 2N3SA 5JVG3 4ME3A 2E2DC 3HG9A 3SHLA 1FVIA 1QVCA 4B9XA 4ZCKA 4DUZQ 4APVA 1V1PB 3UDIA 5G3LF 3S1RB 2VS1A 1IKMA 1SMXA 3CW2C 4Y7NH 2DUDA 3HOXH 3M3YB 1FNWA 2XRSD 4LW1A 4H02A 1I50B 3S17B 1CKMA 3F2DA 3DWAA 1EIYB 2WB1G 1ZKOA 2IX3A 2PMZE 3K81C 5CMDA 1CSPA 3QG1A 3OMGA 3J7YW 3BVMA 5IT9E 4PV1C 1G2TA 2D62A 3KFUA 1GOZA 2NYZD 4BY1G 1LV9A 2NN6I 5JPNC 3Q23A 4TKOB 5M5WH 2LKVA 2N78A 1MBYA 1FD7D 5CV4A 3HOWH 1PRTC 1LACA 2A8VA 1BQQT 4DXFA 5G3LD 2QILA 1X6OA 4HIDA 4DUYQ 3BDCA 4DNRB 2WAQB 2A6HD 1Y8NB 3EROA 3OWEB 3CC2A 3A5ZB 2PMZB 1R9TH 1FYCA 1IYJB 1A62A 1QVGA 1JOKA 3GTJB 3NQIA 4A3JB 5EBCA 3AFPA 4GKKQ 2NUCA 4Q0FA 2RF4A 1IW7C 1CK1A 2EJGC 2OXPA 1I6HH 3KLRA 1IL8A 5C4JH 2DNEA 1PHJA 4ZAIA 3S16H 2PCFB 1VQ9A 1TQOA 4CJ1B 4OIKA 3CRLC 4A3EH 5KNCA 1DZ1A 1NMGA 3MXUA 3RLFA 4EQ5A 1LUZA 1S5DD 1RHPA 2SNMA 4BWGB 3BZDB 4OWWB 3VA7A 3M4PA 2PQAB 5IYBG 4GLAC 2B8GA 2NZ1D 3PUWA 2TSSA 5IYCG 2OF1A 3S1QB 4PZ8A 3E0JA 3HS0C 4J1MA 5IT9c 1VQKA 1EIGA 1ILQA 1C4QA 4B3RQ 1PFMA 1OXTA 2EY1A 4OELB 4TVAB 2SDFA 5M3MH 5C44G 4BBRG 4OWXB 1ICWA 4E6IA 3OIQA 4LFBL 2HIXA 3J80L 2D5DA 3M4OH 1PFNA 2JYOA 1G291 1XJVA 1MKHA 4JBJA 1Q7YC 3L3OC 2ALYB 1YNJD 2JQOA 5A2QE 4DR2Q 1Q82C 3GQBA 5IP7H 3DXJC 3NTKA 4J8QA 4L6TB 3A55A 1K3BC 2L0CA 4S3SA 4DR1Q 1KLGD 3F2UA 3M7GA 3S1NB 1GKHA 1M90C 1PVOA 1I4RA 2V1CC 4B08A 4A3IB 4LUVA 3TQYA 5K36G 1EEFD 1HZBA 4DFAA 3M9BA 1B3QA 2AWNA 4ZKCB 3HOUG 3SR1A 3RLNA 2R7ZH 3ND8A 5CORA 3ER0A 4LF8Q 2HQLA 3MC0B 2EY2A 2VQFL 4KY6A 3HOYH 2F3WA 2FMCA 2G9DA 1X9NA 1XXGA 1NJIC 3HP3A 1XNQQ 3GV6A 2RQXA 3KLWA 1KABA 4L5QA 4A3KG 4DR7Q 3GO5A 1L0XB 4XQJA 4JOIA 2NVXB 5HY6A 2EY6A 2AWOA 2F0DA 3NP8A 2AQ1B 1N33L 4ZK9B 1WTPA 1MJCA 1SNMA 4JCVE 1E0BA 3PQIA 4AQYQ 2K04A 3QIAA 2EYPA 2SEBD 2IL8A 2B2YA 1QUQA 2ZJRA 4XDXA 1UNSA 2D2CC 4FXKC 5E3FA 4BBSG 1VQCA 1N32L 4X64Q 2NTSA 4FO2A 1EOTA 1G91A 4RCNA 3MWYW 1PYBA 1JWUD 1QVFA 1GHKA 1AFPA 1X3FA 4Y7NB 4JOIC 4HIKA 1RD9D 2VUMH 3HRZC 1L0WA 3S24A 1HR0Q 4YHHL 3HGBA 2EJMA 4DV5L 3KK7A 2Z0SA 4KD3A 5IIFA 2JXMB 5ISRA 2WINB 4CKBA 4JW0A 1CFMA 2B29A 2N55A 4F88A 2ASBA 4A3GG 4UY8C 1BVSA 1NR2A 2JE6I 5BN3A 1OXSC 3TS0A 2KCTA 1H95A 1FR3A 1O7ZA 5DAUA 5J3BA 5M5WB 1PH7A 2E5LQ 1MI2A 2HHHQ 1L2FA 2UXCL 1X3GA 1S72A 3CQZB 1JCKB 1QB5D 2RSNA 3CMEA 4JI4L 4F87A 4FYDA 3OTOL 1I3QH 2B2UA 2A68C 5A35A 3C46A 2B2WA 4ID6A 1VQ4A 3H3VC 3FP9A 1U5KA 1Y1VG 4ZYSA 2CW0C 2KJXA 2XWJB 1P16A 1KD1C 2KQ3A 1L1OB 1HZCA 2A69D 2J4XA 4KMUC 1R9TB 3M7NA 5DEHA 2A1AA 4RWSC 4DR3L 5FO7B 5C4JB 4DNTB 1A3UA 5M5YH 2B2UC 2R93H 2B2WC 3S16B 1ET9A 1OXXK 3QOLA 1I94Q 3VR5A 2UXDL 5F2DA 4A3EB 1IBLL 2I0QA 2LS01 1RL2A 4NW2A 5C3EH 4QUCA 5JJIA 4PMCA 1LYLA 4IPHA 5IWAL 4UP9A 2ZTDA 2JA7H 1JOQA 2YU9B 5FLXE 1H9SB 1J6QA 3W1BA 4IUQA 3NENA 3JAMi 3H0GG 1ENAA 3PMFA 2BE5D 2K5VA 4RH6A 4DR6Q 1JB7A 4EGVA 1S5FD 1C9OA 4KY7A 1TVXA 5M3FH 1LM0A 2DN8A 5M3MB 2Y0SG 1LLRD 4HJ7A 5I2XA 5IYDH 1SMYD 2VXWA 4QIWE 3HOZG 2NVTB 1U0LA 3SGIA 4OEMB 1B1ZA 4C3HH 3MXPA 3CCVA 3M4OB 2Q2UA 2KHJA 1JB3A 4MHEA 5KEEA 1O7LA 3GTQB 4NPSA 5LMNL 2E2JB 2VW9A 4A3DH 1E1OA 1Z9FA 1JWSD 1YHQA 3ONAB 4H0LC 5JOBA 1DOKA 3J81j 3WDNA 2UUAL 3U4ZA 1JOOA 1JJ2A 2XRQD 1EZ6A 1XMOL 1SDFA 1U4RA 2TMPA 3FDTA 1LT6D 1O7YA 5C6AA 4M8AA 1QOHA 2F0SA 5JAVA 4DV6L 1UE1A 1WCMG 2CVRA 4A93H 3DMUA 5LMNW 4UDUC 3TDQA 4NXML 4A3MH 4QIWB 2ZM6L 1YHAA 2MP1A 3I70A 3N6RA 1QZHA 3HFZB 4J6HA 4RG1A 3PO2B 5CYUA 1V1PA 3VYRA 2R7ZB 3BS1A 3T1HL 3KF8B 2UUCL 1HJPA 2ZJPA 3HOYB 2F0QA 3Q22A 3I4MG 1SSOA 1KC8C 2RDHA 3ZYYX 4KN4C 2GVBA 2CFMA 1GJXA 3EQLC 1Y8OB 2A5HA 2LFNA 5FLXc 3PO3G 1TWGH 2EOTA 1G8ZD 1UEAB 2F0GA 1O78A 1PTOH 4C3JH 2CQAA 1N34L 1M8AA 2QCPX 1K0RA 4XIGS 5K5PA 1F9RA 4X3UA 3J7AF 4RAUC 1YVCA 2Q8IB 2CHBD 3PF5A 2I5LX 2YV5A 4FXDA 4O2DA 4LF9L 3KLSA 2IJ0A 2KEEA 3S2DH 1JORA 1AN8A 1ENFA 1EY6A 1Y1WH 1WYDA 4IUUA 3S9WA 4R1JA 4IOAA 3Q24A 1EWHA 4AYBG 3K5NA 4PMBA 1YNJC 2IHEA 1J8IA 2FXQA 3CAMA 2VUMB 1GHJA 2I46A 1Y8PB 4IFDG 2XSCA 1ENCA 1SRUA 4PZ6A 1SAPA 2PI2A 1U9RA 3DEOA 4YCWA 4I7AA 4L5SA 4IJHA 2ZXRA 1YNND 1VQGA 5GQOA 4YY3L 2I07B 3VYTA 3BZCA 1SLJA 1IYVA 3LWEA 3HKZG 4P71A 2EIFA 5IGCA 3VYUA 4A3FB 5BR8Q 1CM9A 3A8KE 3OPOA 1DD2A 1WTVA 1BCPB 1PH5A 2SOBA 4YWKA 1QE6A 4B3TL 4V0BA 4IQZA 1A8VA 5I6YA 4HIOA 1I3QB 4HMIA 2WKCA 1NNXA 1TS2A 3HOVG 2BA0A 2K1BA 3U9SA 2ICEC 2HDMA 4GS3A 1OO9B 1LTTD 1EIFA 2AMCB 3CCLA 1KXLA 1CSQA 2PQAA 1AE3A 1UE7A 5EKLA 3MVVA 3BYTB 1LTGD 4K2LA 4LFBQ 2YTVA 4LUOA 1HR0W 3DM1A 4GOPA 3NSWA 4KJOA 1JT8A 1MHWC 2PW5A 2R7DA 2F0FA 2BH8A 3KDFB 2P5ZX 4HMJA 3W2DA 3I4NH 5M5YB 2NTTA 2MHVA 2R93B 4ILWA 4GN3B 1AW7A 1K83B 5C4ZA 4DXGA 2DY7A 4CBVA 4UP7A 1R4PB 5J22A 1SE8A 3D4WA 2GN5A 3D6CA 2F0KA 1O7IA 5JEAG 4XQNA 1F2YA 2X6GA 3D3RA 5C3EB 3DLLA 1I6VC 1CUKA 4A3BH 2HDLA 2K5HA 1SYDA 4OHJA 2OWOA 4Y52H 3AMUA 1PV4A 1DJRD 2IT1A 1VQ8A 4A3LG 4HJ9A 2F0IA 1AZQA 2JA5G 2UUBL 2MJ8A 4GOPC 3ULJA 5CV7A 2EVBA 1TY2A 4X66L 3IFDA 5KRUA 1QWYA 5M3FB 4RHRA 3T1YL 2DJGC 1LTLA 5IYCH 2EYJA 1WD1A 3HKSA 3E6ZX 4IOCA 1Q8IA 1EY9A 1IYUA 3AQQA 3PCOB 3TN2A 3L0OA 2VQFQ 3BG3A 4KN7C 5CV9A 5LHY1 3U58A 1DGSA 3FHWA 1OXVA 1FJGL 2Q8RE 4BBRH 4JI6L 4OWTB 3T13A 1HTPA 3K7AB 5IP9G 1YIJA 2QEXA 4RGNA 1N33Q 3VR4A 3TZUA 4CJ2C 1LTRD 1WTQA 3K57A 4QMGA 1F2LA 2A69C 2F3VA 4HJ8A 2LMCB 2LXJA 1B3AA 4G4KA 1N32Q 1S5BD 2JA8G 1XPOA 2YTYA 4B3MQ 1EYCA 2VB3X 5J1ZA 3W5OA 1BF4A 5KGUA 1PMRA 2QGQA 3W3AA 3A0JA 4A93B 3RUZA 3F8TA 2JA9A 4M1UB 1BCPD 1EY7A 1XWEA 3EJIA 4A3MB 4GZYC 1I4XA 5K36H 2L4NA 4IPDA 1BOSA 4CJ0B 1CI3M 1GD7A 4DV5Q 2BH2A 2F0HA 3HOUH 3NEMA 4H7BA 4DR4L 1P8LA 1HUMA 2K5NA 4IFDI 3ULLA 1F77A 2R7FA 1ILPA 2Z1CA 1TWGB 2Q8TA 1R4QB 5I9OA 1PTOB 4BA1I 5IY0A 4C3JB 3A54A 2LXKA 3E9HA 1EY5A 2PZTA 4A3KH 3C3LA 5GAGC 4JVZA 4P74A 1A3VA 2CQOA 4FDBA 2EXZA 2UXCQ 1K3RA 1TWFB 2JN4A 4EX5A 4JI4Q 1SMYC 1RKNA 1X3QA 2GVAA 2KUMA 3LWUA 4DAPA 1CA6A 3L7ZC 1B44D 2WV6D 3OTOQ 2WAQE 3S2DB 1Z6HA 1V8QA 3H3VI 3NPPA 4IO9A 1Y1WB 1ICFB 4QY7A 3H15A 3IFTA 4O1NA 2B2VC 1AH9A 2J7ZA 3LNNA 1B9NA 2AQ2B 3CCUA 1KQSA 2FJ2A 1HA6A 2K01A 1VQ5A 3ERSX 5CV8A 3RR5A 5CV6A 1BKBA 3S1MH 4IUNA 3BDLA 4DR3Q 2F0PA 3K0XA 4MN3A 3PV0A 3OSOA 1BBUA 1Q90A 2EYHA 2WAQG 3J7AV 2UXDQ 2KENA 1SNCA 1D5ZC 1IBLQ 2B39A 4LJZC 4ULLA 3CKIB 2R92G 1TIID 3PUVA 5IWAQ 4A3JG 2UU9L 4IUVA 2Z6KA 4UHVA 4X3TA 2RCFA 5C3WA 5ELOA 4EQOA 1KDBA 2NBFA 2L15A 2ZT9C 2E2HB 5LMUL 2R6GA 4BA2I 1WFQA 1SNDA 4DV7L 2JA6H 4QGUA 1YJ9A 2EY5A 2EYLA 3D6WA 1IL2A 2X6LA 5BR8L 4BY7H 2XWBB 4ZRZA 5IE8A 1PH4A 2Z6KC 4MTKA 2QW7A 5LMNQ 3I4NB 1STHA 4GN5A 1FGUA 2UUAQ 4K5VA 3A5UA 2EYMA 4LFCL 4DR5L 1XMOQ 2N49A 4A3BB 1PTOD 1SN8A 2JP1A 4ZUIA 3WOEA 1K8GA 3VYSA 1EQVA 4XXEA 3BDOA 4BXXG 1HQMC 2YYZA 4DV6Q 1IBKL 1E7ZA 1TS4A 1YNNC 4CKCA 4JBWA 3JC66 3MXGA 4NXMQ 1BO0A 2ZM6Q 3C1FA 1CQVA 2ICIA 1HA5A 2Q2HA 5JJKA 1GUWA 1E24A 3H0GH 2L9HA 2DNCA 4TQUS 3L9AX 3T1HQ 1A0IA 4K0KL 3CHBD 1YEZA 2UUCQ 1BDOA 2XVSA 4B3SL 4LFAL 4EVOA 3WWVA 3NQTA 2F0NA 3RMHA 3RLOA 4BBRB 5JVH3 3NWTA 3VR2A 3HOZH 4A3IG 2QKIC 4KKSA 1N34Q 3SDZA 4IPCA 3K80C 4LF5L 1A15A 3T4AC 1F9SA 5KIXA 1E22A 2Z9HA 2F03A 3J81E 5IGEA 1B53A 4LF9Q 1CKNA 1VQDA 2OTLA 1RTOA 1CKOA 1VQOA 1E2WA 1STEA 4CKEA 3RN5A 1TS3A 1TWHB 1KRTA 1MIUA 1XX8A 1ZYRD 2AKWB 3J7ZC 1ASYA 1WTXA 1D6EC 1FNVA 4C1NI 2ZTCA 2BCOA 1AZPA 4P2CB 1W6JA 4HJ5A 3RZOB 4LUZA 3OHXC 3CD6A 3HOUB 2K03A 3HZXA 1F9QA 3T56B 2B63H 2PPBC 4HCEA 4YY3Q 1VMCA 3CP0A 3I4MH 4B3ML 1BBXC 1WD0A 2K7VA 1HCZA 2D0PA 2F52A 2IPKD 3HOXB 1IZ6A 4YWMA
chains in the Genus database with same CATH topology
5CV5A 1STBA 2FMMA 1G2SA 4ME5A 1HFNA 3TSSA 3MFGA 5IGBA 3SK4A 2F0TA 3G6JB 2RVLA 1K8MA 3S1MB 5DM73 3K0YA 3HOWB 4Q5VA 4IUTA 1BCPC 5JJZA 4XT3B 5C4HA 3KLSX 1D1IA 2RDGA 4NMZA 3HEJA 3TP7A 5J39A 1X32A 4QF4A 1GUGA 5LL6S 5FK9C 3ITPA 1I6HB 4X3SA 4H13C 3MHBA 3BYYB 1VF7A 1AEXA 2NN6H 1HHVA 3T53B 3V2TA 2HUGA 4XT1B 2F0VA 2KOLA 2JA6B 1EFID 1K8OA 4BY7B 1Z7TA 4V190 3MA2B 5CGKA 5ELFA 1BUVT 1EL0A 1F9PA 1KAAA 4TRDA 4KHVA 1JC7A 4WORA 3JAML 1CTMA 5KNDA 3NXWA 4IN3A 1SYGA 1SYFA 3K59A 1QCBD 3QB3A 2ENBA 4YIJA 2RA4A 5NUCA 4MIUA 4LAAA 1EY0A 1EYDA 3PUYA 3J80E 1SYCA 2ZXPA 4PMWA 3MXNA 3H0GB 5D3IB 3OIPA 2A6HC 2NWGA 4JK1C 4ODGA 2RKSA 2IW3A 1IKLA 3NHHA 1JWMD 3KBGA 4DK0A 3M4YA 4L8JA 1KDCA 5CBEE 4K8IA 1GUNA 3QWNA 3KBXA 1PZKD 2L5TA 4HCSA 5I4DA 2HCCA 2VB2X 1D5MC 4RHSA 4F7XA 4BS9A 5HURA 1A2UA 4QB4A 5EKIA 4IFDJ 2KHSA 1A6XA 2KCCA 1PTOC 1LTAD 3G7LA 2B63B 1DCZA 5BN4A 4FF3A 3I4MB 1STAA 5EQ0A 4RGOS 1JR0D 3TP8A 3A7AB 3D4RA 3QJYA 2FHTA 1D1KA 3DWQA 1MSHA 2E76C 1S5ED 2PYKA 1PZID 3DHQA 3D31A 1SBBB 1S5CD 3S14B 2XNAC 1A3TA 2PZUA 3R3OA 3CU7A 3K58A 3I72A 3P20A 4RFBA 3OMCA 1SNOA 5IT9L 2NB0A 2F0MA 1RCVD 3NE5B 3H94A 2BA1A 2Z4IA 1Q3LA 4HR7B 1AP0A 1X3PA 2F0OA 5IGDA 3MFYA 3WOFA 1FGBD 3MAQA 4ZQ3A 1VF5C 1ZYRC 2NVQB 5JEAJ 5E1FA 3TBIB 5CR3A 3SK8A 1VDZA 1LO5D 5EGTA 1E2ZA 2R3ZA 4WFN3 5C5MA 1HTLD 2C5CA 1NCVA 3A7LA 2XIWA 3PUXA 3T16A 5C4XB 3NTIA 2QF7A 4K5WA 1WTOA 2G9HD 4ZLTF 1SXTA 2JA7B 1I4HA 1TWCB 1TR5A 3MEHA 1SNQA 3A56A 3SE0A 1EWCA 3MTSA 5AFWA 5KYIA 4KI0A 2Z8LA 1SYEA 5DNFA 1BCPF 4PNYA 2F0JA 5CBAE 3SK5A 4R8IA 4G57A 2O4XA 3RZDB 4C3HB 4I7ZC 2A6ED 4HSPA 2JA5B 3S2HB 4A3DB 5EPKA 3PIP3 3I4LA 2DY8A 5EBDA 1DOLA 2L12A 2QDBA 4OGQC 2M9VA 3QOJA 4UAIA 1STNA 4CHTB 1J9OA 1RF2D 2PO4A 2BOSA 3R2TA 1II3A 1H9JA 4C3IB 3GTOB 5C0XG 3FKIB 5IGGA 1PYWD 2OEOA 2D9UA 2K5QA 1TY0A 3GV3A 1NAPA 4NKLA 4HEDA 1A2TA 3QO2A 1U4LA 2B2VA 4HSVA 1SJED 2BE5C 1PLFA 2E2IB 1CZGA 1Z47A 1B9MA 4NDXA 5D65A 2NVYB 5KNBA 1SJHD 3TZDA 2K5WA 1STGA 1F2MA 3IKJA 2PQEA 4FF1A 1VMPA 4RKLA 3OWFA 2JSOA 1HRJA 2K33A 1L0YB 3R93A 5EJWA 3FMCA 4QCLA 4G7ZC 1D5XC 3NBHA 3OOCA 4DA2A 2K5DA 2WB1B 1UAPA 3SVMA 3IAYA 3FEWX 2AUJD 3Q6SA 5IOCA 3E5SA 2ID0A 2A74C 4WRDA 4BY1B 4LMQD 4PQXA 2KEDA 3SK6A 1PTOF 4DAVA 2EZVA 2C9OA 1EZ8A 2LY7A 4K6LA 1H9SA 2RBMA 4K2KA 2MGSA 1NSNS 4FP5D 4OL7A 4XYQA 5D14A 5EKKA 2R92B 2O5JC 4C2MB 1I4GA 1STYA 1EU4A 4NP5A 3EA6A 1E2VA 1I4PA 1DM0B 1KTKA 4IALA 4TSSA 3KUPA 2EYFA 5KYLA 2R61A 4DF7A 1NR4A 1V43A 3GTGB 1JICA 4I65A 5FO9B 5FLXL 3FRPB 4G7OC 2SNSA 1KNAA 5E4XA 3URYA 4KTAA 1HFGA 4RGMA 3R8BA 2EPBA 3I73A 1TKWB 2IX0A 2E74C 1O80A 4K8JA 5ELBA 5EPLA 1H9KA 2K05A 3EFXD 5LL6X 4DK1A 1Y69U 5C0XI 5C44B 3GTMB 3KF8A 3X3MA 1RTNA 3TP6A 1PZJD 5CC4A 2F0EA 4HAEA 1LABA 1TWAB 3Q0AA 3N52A 3BVZA 4ZKBB 2B8FA 1RJTA 3O13A 1CZWA 3PIO3 3GP7A 4OO1G 2K28A 2H1EA 2EDGA 4RKBA 1Q1BA 1D2BA 5C3XA 1C48A 4DU9A 1TT2A 3GTPB 1CA5A 3P75A 4KKTA 2JEAI 5I9PA 1U4MA 4R9WA 2GA4B 3K5LA 3DEPA 1MD2D 2KVMA 1BR9A 5ELCA 4A3KB 3C2PA 3C1EA 3V05A 1CQFA 5T1IA 4C1NK 4OIJA 1ET6A 3GD7A 4BBSB 3K5OA 1SFOB 2A6EC 1B2TA 3A8JE 3AB9A 3D4DA 2N88A 4IZ8A 1QG7A 3UI2A 3TP5A 4RGTA 1UUPA 2WP8J 4ZUJA 1OXUA 4K6DA 4IFDH 1QNUA 2B2YC 3CRKC 3MZ5A 1PDQA 5FOBB 1KDAA 1XYIA 3V96A 4IURA 5BN5A 3NK9A 4KKUA 4N9TA 4A3GB 4KY5A 2KCNA 1PRTB 2AQ3B 2OT2A 3I90A 1DYQA 1BNZA 4X3KA 3P7JA 1I4QA 1TU2B 2F0UA 4C56C 1GXDC 3P1HA 3FPPA 1Y1VB 1B50A 2KECA 2FINB 1EU3A 1HUNA 4KV6A 2M00A 2WACA 1WVLA 5JPMC 2RSOA 1GUTA 1FNUA 4F8MA 2QEJC 3SXHA 4KD4A 1JQYD 2MPMA 4HN7A 3SEBA 2Z4HA 5HGTA 3H91A 1SEBD 5JEAH 1H9MA 2FFKB 5T1GA 1QJOA 4KJNA 1PRTF 5D3DA 5E4WC 1MSGA 3I8ZA 4OO1I 3PUZA 5ELEA 2L1BA 4XTCS 3VR6A 4R8NA 1JE4A 2EYOA 4O42A 1LT4D 1CHPD 2AUKA 2BDNA 2Y0SB 3HOZB 1HQRD 4FF2A 4B9WA 1EY8A 3X3NA 1WTRA 2J0TD 2JEBI 3D8GA 3LX0A 3S15B 2K32A 2RDFA 1EYAA 1ESFA 3VA5A 1PRTD 1DXMA 1ESRA 3AU7A 1RODA 1HXYD 5IGFA 3DUZA 1WCMB 4WJWA 4RA8A 2E75C 2L55A 5C0XH 4FVMA 2IX1A 2PNRC 1EY4A 2M2LA 3EVQA 1IW7D 1EQTA 3RD4A 1LT3D 2IWHA 3PO3B 5DM63 5ELDA 1T5EA 5EPJA 2WIIB 2PZWA 3ND9A 4FXGC 5C5LA 4K5XA 5I6WA 3I3CA 4DN4M 1W6KA 1GUOA 4N9PA 3NTHA 4AYBB 4U673 2V4DA 3FVQA 1EIHA 5M9OA 4RCOA 1G6ZA 4CGYB 3U9OA 2B2TA 4XQQA 4H44C 4ABNA 1WTWA 1ZXTA 3OW7A 1S4ZA 4FF4A 1IHZA 2X69A 3FPUB 4LK1C 5COYA 1XTCD 3HKZB 1HPCA 1H9RA 1B4OA 1ONLA 1PFBA 1ML0D 2MUYA 1QILA 2EJFC 2F0WA 2ZXOA 3ERQA 2NN6G 2B2TC 3HOVB 2H4OA 2EE1A 5TSSA 3R2IA 1C8CA 3M85A 4IUPA 1KNEA 2K6AA 5IODA 1Q12A 1SE3A 1Q1EA 3TMEA 4K14A 1SE4A 1LT5D 3JAME 3H6MA 3VR3A 1T5XD 4XYOA 2BDOA 1BXTA 1SNPA 2F4IA 2F1MA 1LTBD 2O2LD 4C3HG 1V1OA 1LTID 1U4PA 1PXUA 3K6OA 4FNFA 2A73B 2PW7A 4KHZA 4EQNA 1QNKA 1DONA 4G7HC 5A2QL 5C0XJ 4HTHA 4QUFA 1DOMA 2L11A 4DAYA 3H09A 1KLUD 2VNUD 1RDPD 3NBIA 3NUCA 3A8IE 3GTKB 1M4VA 1NUCA 1ZEQX 5M5XB 3NWSA 1CT1D 3IL8A 1GUSA 1VCIA 1SYBA 4C3IG 2WKDA 4U68A 3K5MA 4L63B 3T51B 3DWPA 1CHQD 3J81L 2F0LA 1SE2A 5FKAC 2XN9C 1MGSA 4Z9CB 1LTSD 2JA8B 3I91A 3GTLB 2A68D 2O5IC 4C3JG 2HCIA 4EQPA 1F2ZA 2CW0D 4DGZA 4OO1H 4KK7A 1TS5A 1EEID 2HQEA 5I2YA 3BVGA 5FO8B 2KA7A 5JVG3 2E2DC 3HG9A 3SHLA 4B9XA 1V1PB 5G3LF 3S1RB 1IKMA 3M3YB 1FNWA 2XRSD 1I50B 3S17B 3DWAA 1ZKOA 2IX3A 5CMDA 3QG1A 3OMGA 3J7YW 3BVMA 5IT9E 4PV1C 1G2TA 2D62A 1GOZA 2NYZD 1LV9A 2NN6I 5JPNC 3Q23A 4TKOB 2LKVA 1MBYA 1FD7D 5CV4A 1PRTC 1LACA 1BQQT 4DXFA 5G3LD 2QILA 3BDCA 4DNRB 2WAQB 2A6HD 1Y8NB 3EROA 3OWEB 2PMZB 1FYCA 1JOKA 3GTJB 3NQIA 4A3JB 5EBCA 2NUCA 4Q0FA 1IW7C 1CK1A 2EJGC 2OXPA 3KLRA 1IL8A 2DNEA 4ZAIA 2PCFB 1TQOA 4CJ1B 4OIKA 3CRLC 1DZ1A 5KNCA 3MXUA 3RLFA 1S5DD 1RHPA 2SNMA 4BWGB 3BZDB 3VA7A 2B8GA 2NZ1D 3PUWA 2TSSA 3S1QB 2OF1A 3E0JA 3HS0C 4J1MA 1EIGA 1ILQA 1C4QA 1PFMA 1OXTA 2EY1A 2SDFA 1ICWA 4E6IA 3OIQA 3J80L 2D5DA 1PFNA 2JYOA 1G291 3L3OC 5A2QE 1YNJD 3GQBA 3DXJC 3NTKA 4J8QA 4L6TB 3A55A 2L0CA 4S3SA 1KLGD 3F2UA 3M7GA 3S1NB 1I4RA 4B08A 4A3IB 5K36G 1EEFD 4DFAA 2AWNA 4ZKCB 3SR1A 3ND8A 5CORA 3MC0B 2EY2A 4KY6A 2F3WA 2FMCA 2G9DA 1XXGA 3HP3A 3GV6A 2RQXA 1KABA 3GO5A 1L0XB 4XQJA 2NVXB 2EY6A 2AWOA 2F0DA 3NP8A 2AQ1B 4ZK9B 1WTPA 1SNMA 1E0BA 2K04A 3QIAA 2EYPA 2SEBD 2IL8A 2B2YA 4XDXA 1UNSA 2D2CC 4FXKC 5E3FA 2NTSA 4FO2A 1EOTA 1G91A 4RCNA 3MWYW 1JWUD 1GHKA 1AFPA 4Y7NB 1RD9D 3HRZC 3HGBA 2EJMA 3KK7A 5IIFA 4KD3A 2JXMB 5ISRA 2WINB 4CKBA 1CFMA 2N55A 4F88A 2JE6I 1NR2A 5BN3A 1OXSC 1FR3A 1O7ZA 5DAUA 5M5WB 1MI2A 3CQZB 1JCKB 1QB5D 2RSNA 4F87A 4FYDA 2B2UA 2A68C 5A35A 3C46A 2B2WA 4ID6A 3H3VC 4ZYSA 2CW0C 2KJXA 2XWJB 2KQ3A 2A69D 2J4XA 4KMUC 1R9TB 3M7NA 5DEHA 4RWSC 5FO7B 5C4JB 4DNTB 1A3UA 2B2UC 2B2WC 3S16B 1ET9A 1OXXK 3QOLA 3VR5A 5F2DA 4A3EB 2LS01 4NW2A 4QUCA 4PMCA 1JOQA 2YU9B 5FLXE 1H9SB 4IUQA 4RH6A 1ENAA 3PMFA 2BE5D 4EGVA 1S5FD 4KY7A 1TVXA 2DN8A 5M3MB 1LLRD 5I2XA 1SMYD 2VXWA 2NVTB 1B1ZA 3MXPA 3M4OB 1JB3A 4MHEA 5KEEA 1O7LA 3GTQB 2E2JB 1JWSD 3ONAB 4H0LC 5JOBA 1DOKA 3WDNA 1JOOA 2XRQD 1EZ6A 1SDFA 1U4RA 2TMPA 1LT6D 1O7YA 3FDTA 5C6AA 4M8AA 1QOHA 2F0SA 5JAVA 2CVRA 3DMUA 4UDUC 3TDQA 4QIWB 3I70A 2MP1A 3N6RA 4J6HA 3PO2B 5CYUA 1V1PA 3VYRA 2R7ZB 3BS1A 3HOYB 2F0QA 3Q22A 1SSOA 2RDHA 3ZYYX 4KN4C 1GJXA 3EQLC 1Y8OB 2A5HA 2LFNA 2EOTA 1G8ZD 1UEAB 2F0GA 1O78A 1PTOH 2CQAA 1M8AA 2QCPX 4XIGS 5K5PA 1F9RA 4X3UA 3J7AF 4RAUC 2Q8IB 2CHBD 4FXDA 3KLSA 2IJ0A 2KEEA 1JORA 1ENFA 1AN8A 1EY6A 4IUUA 3S9WA 3Q24A 1EWHA 3K5NA 4PMBA 1YNJC 1J8IA 2VUMB 1GHJA 2I46A 1Y8PB 4IFDG 2XSCA 1ENCA 1SAPA 1U9RA 3DEOA 2ZXRA 1YNND 2I07B 3VYTA 1IYVA 3LWEA 5IGCA 3VYUA 4A3FB 1CM9A 3A8KE 3OPOA 1DD2A 1WTVA 1BCPB 2SOBA 1QE6A 4V0BA 4IQZA 5I6YA 1I3QB 4HMIA 2WKCA 1TS2A 2BA0A 2K1BA 3U9SA 2ICEC 2HDMA 1OO9B 1LTTD 5EKLA 3MVVA 3BYTB 1LTGD 4K2LA 3DM1A 3NSWA 4KJOA 2PW5A 2F0FA 4HMJA 3W2DA 5M5YB 2NTTA 2MHVA 2R93B 4ILWA 1AW7A 1K83B 5C4ZA 4DXGA 2DY7A 4CBVA 1R4PB 5J22A 3D4WA 3D6CA 2F0KA 5JEAG 4XQNA 1F2YA 2X6GA 3D3RA 5C3EB 1I6VC 2HDLA 4OHJA 1SYDA 3AMUA 1DJRD 2IT1A 2F0IA 1AZQA 2MJ8A 5CV7A 2EVBA 1TY2A 3IFDA 5KRUA 1QWYA 5M3FB 4RHRA 2EYJA 1WD1A 3E6ZX 1Q8IA 1EY9A 1IYUA 3TN2A 3BG3A 4KN7C 5CV9A 5LHY1 1OXVA 2Q8RE 3T13A 1HTPA 3K7AB 4RGNA 3VR4A 3TZUA 4CJ2C 1LTRD 1WTQA 3K57A 4QMGA 1F2LA 2A69C 2F3VA 2LMCB 1B3AA 4G4KA 1S5BD 1EYCA 2VB3X 5J1ZA 1BF4A 5KGUA 1PMRA 3W3AA 4A93B 3RUZA 4M1UB 1BCPD 1EY7A 1XWEA 3EJIA 4A3MB 4GZYC 1I4XA 5K36H 2L4NA 1BOSA 4CJ0B 1CI3M 2F0HA 4H7BA 1HUMA 4IFDI 1F77A 1ILPA 2Z1CA 1TWGB 2Q8TA 1R4QB 5I9OA 1PTOB 4BA1I 4C3JB 3A54A 1EY5A 2PZTA 3C3LA 1A3VA 2EXZA 1TWFB 1SMYC 1RKNA 1X3QA 2KUMA 3LWUA 4DAPA 1CA6A 3L7ZC 1B44D 2WV6D 3S2DB 1Z6HA 1V8QA 3NPPA 1Y1WB 3IFTA 4O1NA 2B2VC 2J7ZA 3LNNA 1B9NA 2AQ2B 1HA6A 2FJ2A 2K01A 5CV8A 5CV6A 4IUNA 3BDLA 2F0PA 4MN3A 3PV0A 3OSOA 1Q90A 2EYHA 3J7AV 1SNCA 1D5ZC 2B39A 4LJZC 4ULLA 3CKIB 1TIID 3PUVA 4IUVA 4X3TA 5C3WA 4EQOA 1KDBA 2NBFA 2ZT9C 2E2HB 2R6GA 4BA2I 1SNDA 2EY5A 2EYLA 3D6WA 2X6LA 2XWBB 4ZRZA 3I4NB 1STHA 4K5VA 2EYMA 4A3BB 1PTOD 2JP1A 4ZUIA 3WOEA 3VYSA 1EQVA 4XXEA 3BDOA 1HQMC 2YYZA 1TS4A 1YNNC 4CKCA 4JBWA 3MXGA 1BO0A 3C1FA 1CQVA 2ICIA 1HA5A 1GUWA 2L9HA 2DNCA 4TQUS 3L9AX 3CHBD 1BDOA 2XVSA 4EVOA 3NQTA 2F0NA 3RMHA 4BBRB 5JVH3 3NWTA 3VR2A 2QKIC 4KKSA 3SDZA 1A15A 3T4AC 1F9SA 5KIXA 2F03A 3J81E 5IGEA 1B53A 1RTOA 1E2WA 1STEA 4CKEA 1TS3A 1TWHB 1XX8A 1ZYRD 1WTXA 1D6EC 1FNVA 4C1NI 2BCOA 1AZPA 4P2CB 1W6JA 3RZOB 3OHXC 3HOUB 2K03A 3HZXA 1F9QA 3T56B 2PPBC 4HCEA 1VMCA 1BBXC 1WD0A 2K7VA 1HCZA 2IPKD 3HOXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XVS A;  4ABN A; 
#chains in the Genus database with same CATH topology
 5CV5 A;  1STB A;  3KF6 B;  2FMM A;  4B3T Q;  1G2S A;  4ME5 A;  1HFN A;  4GLV B;  3TSS A;  3S14 H;  4X65 L;  4P73 A;  5AJ3 L;  4N8F A;  2CKZ B;  2AHO B;  3E3X A;  4HIM A;  3ICE A;  1XNR Q;  3MFG A;  2YTX A;  3SK4 A;  2LSS A;  3QR8 A;  5IGB A;  2F0T A;  3G6J B;  2RVL A;  1K8M A;  3J81 c;  3S1M B;  5DM7 3;  3K0Y A;  3HOW B;  4Q5V A;  4DV4 L;  1V1Q A;  4IUT A;  4LF6 L;  1BCP C;  5JJZ A;  4XT3 B;  3PGZ A;  3KDF A;  2NVQ H;  5C4H A;  3CC4 A;  3KLS X;  2OTJ A;  1D1I A;  2RDG A;  1GO3 E;  4NMZ A;  3HEJ A;  3TP7 A;  5J39 A;  4KHP Q;  1X32 A;  3H3V H;  4QF4 A;  1GUG A;  5LL6 S;  2UUB Q;  3NBH B;  5FK9 C;  2I5H A;  3ITP A;  1I6H B;  3BZK A;  4X66 Q;  4X3S A;  4H13 C;  3MHB A;  3T1Y Q;  3BYY B;  1VF7 A;  4A3E G;  1AEX A;  2K50 A;  2NN6 H;  2MNA A;  1HHV A;  3T53 B;  3V2T A;  2HUG A;  5C4X H;  1YJW A;  4XT1 B;  2F0V A;  2KOL A;  2XTI A;  1EFI D;  2JA6 B;  4R4Q A;  2CCZ A;  1K8O A;  1FJG Q;  3U50 C;  1PH3 A;  1Z7T A;  4JI6 Q;  4V19 0;  4BY7 B;  3MA2 B;  2VQE L;  5CGK A;  5ELF A;  1BUV T;  1EL0 A;  1TWC H;  1F9P A;  1KAA A;  4TRD A;  4KHV A;  1JC7 A;  4A3C H;  4WOR A;  3JAM L;  4PG3 A;  3M4Q A;  1CTM A;  5KND A;  3NXW A;  4IN3 A;  3STB D;  1SYG A;  1SYF A;  5M3M G;  3K59 A;  3BJU A;  1QCB D;  3QB3 A;  3F2B A;  2ENB A;  3CPW A;  3I55 A;  4YIJ A;  2RA4 A;  5NUC A;  4MIU A;  1SRO A;  2HT1 A;  4LAA A;  2CH4 A;  3RZD H;  1EY0 A;  1EYD A;  3PUY A;  3J80 E;  4JI8 L;  1SYC A;  2ZXP A;  5IP7 G;  1T9H A;  3CCQ A;  4PMW A;  2JA5 H;  3MXN A;  3S2H H;  1Y14 B;  3H0G B;  1SR3 A;  4GLX A;  5D3I B;  3OIP A;  1C7Y A;  2A6H C;  2NWG A;  4JK1 C;  4ODG A;  2RKS A;  4ALP A;  2IW3 A;  4DR4 Q;  4WJ3 M;  2UXB L;  3A74 A;  1IKL A;  3NHH A;  5M5X H;  1JWM D;  2CH4 W;  3KBG A;  5DLQ E;  4DK0 A;  4GNX B;  3M4Y A;  4L8J A;  1KDC A;  5CBE E;  3UDX A;  1NTG A;  1WI5 A;  2C35 B;  4K8I A;  1GUN A;  3PO2 G;  3QWN A;  4AIM A;  5IP9 H;  4C3I H;  2R7Z G;  5H1S E;  3GTO H;  3KBX A;  1PZK D;  4JV5 L;  2L5T A;  3FKI H;  4HCS A;  3HOY G;  5I4D A;  2HCC A;  1HNW L;  2VB2 X;  1D5M C;  4RHS A;  4F7X A;  1EUJ A;  3I56 A;  4BS9 A;  4DK3 C;  2F4V L;  2JA8 H;  3GTL H;  5HUR A;  3L2P A;  1EQR A;  1A2U A;  4QB4 A;  3RNU A;  5EKI A;  4IFD J;  2KHS A;  1A6X A;  2E2I H;  2KCC A;  5FJ8 G;  1A63 A;  3K8A A;  1PTO C;  4P72 A;  1BBW A;  1LTA D;  2NVY H;  4LF7 L;  3G7L A;  2OQK A;  1VQH A;  2CWP A;  2B63 B;  1DCZ A;  5BN4 A;  2ZJQ A;  4FF3 A;  3I4M B;  1STA A;  5EQ0 A;  4RGO S;  1JR0 D;  3TP8 A;  4QJF A;  3A7A B;  3J80 c;  3AEV A;  3D4R A;  3QJY A;  2FHT A;  2VUM G;  1D1K A;  3DWQ A;  3S1R H;  1MSH A;  2E76 C;  4DV1 L;  1S5E D;  2PYK A;  2UU9 Q;  3M3Y H;  1PZI D;  1I50 H;  3DHQ A;  3D31 A;  1SBB B;  1S5C D;  3S14 B;  1KRS A;  2XNA C;  1A3T A;  2PZU A;  4IPG A;  3R3O A;  3CU7 A;  3K58 A;  3I72 A;  3P20 A;  4RFB A;  1YNX A;  3OMC A;  1SNO A;  2DGY A;  5IT9 L;  3TS2 A;  1HZA A;  5LMU Q;  2KCM A;  2NB0 A;  2F0M A;  1RCV D;  3NE5 B;  4A3F G;  3H94 A;  4OXP A;  2BA1 A;  2Z4I A;  4DV7 Q;  1QUQ B;  3DM3 A;  3PSI A;  1Q3L A;  4HR7 B;  1AP0 A;  1X3P A;  3I4O A;  2F0O A;  4JI3 L;  5IGD A;  3MFY A;  4BY1 H;  3WOF A;  1B7Y B;  1FGB D;  1VQM A;  3MAQ A;  4ZQ3 A;  1VF5 C;  1ZYR C;  3UE1 A;  1S3O A;  2NVQ B;  4DR5 Q;  5JEA J;  4LFC Q;  5E1F A;  1TXY A;  3F1Z A;  3TBI B;  5CR3 A;  3SK8 A;  1VDZ A;  3I2Z A;  1LO5 D;  1XNR L;  2R92 H;  5EGT A;  1IBK Q;  4R4O A;  4C2M H;  1E2Z A;  3GTJ H;  4CDD C;  1VQL A;  2R3Z A;  1JJG A;  2R93 G;  4JPB W;  4WFN 3;  5C5M A;  1HTL D;  2C5C A;  5FLM G;  1NCV A;  3A7L A;  2XIW A;  4K0K Q;  3PUX A;  5C3E G;  3T16 A;  2Q2I A;  4DV3 L;  4B3S Q;  5C4X B;  3NTI A;  4NXN L;  4LFA Q;  2QF7 A;  4K5W A;  1WTO A;  2G9H D;  4ZLT F;  1MJE A;  1SXT A;  3GTG H;  3CPF A;  4KHP L;  2JA7 B;  1I4H A;  1TWC B;  1TR5 A;  3MEH A;  4JBK A;  1SNQ A;  4LF5 Q;  3A56 A;  3SE0 A;  1EWC A;  5M3F G;  3MTS A;  5AFW A;  5EAY A;  5KYI A;  4KI0 A;  2Z8L A;  1SYE A;  5DNF A;  5IYB H;  1BCP F;  4PNY A;  2F0J A;  4IJL A;  5CBA E;  3ZJY C;  2HIV A;  1S40 A;  3SK5 A;  1N8R C;  4R8I A;  4X62 L;  4G57 A;  2O4X A;  2IHF A;  3RZD B;  4C3H B;  5C44 H;  1VQ6 A;  4I7Z C;  3GTM H;  2A6E D;  4DV0 L;  4HSP A;  2JA5 B;  3S2H B;  4A3D B;  5EPK A;  3BU2 A;  3PIP 3;  1TWA H;  3G6E A;  3I4L A;  2DY8 A;  5EBD A;  1DOL A;  4R4T A;  2L12 A;  4KLK A;  2K52 A;  4LF4 L;  2QDB A;  4OGQ C;  4OX9 L;  2VY3 A;  1EOV A;  2M9V A;  3QOJ A;  4UAI A;  4A93 G;  1STN A;  4CHT B;  1J9O A;  1RF2 D;  2G5D A;  2HD3 A;  2PO4 A;  4A3M G;  2BOS A;  3R2T A;  3UDF A;  1II3 A;  1H9J A;  2VL6 A;  4C3I B;  1EQQ A;  3GTO B;  1QZG A;  2VZA A;  5C0X G;  1NE3 A;  3J81 i;  3GTP H;  5L37 A;  3FKI B;  5IGG A;  1PYW D;  4X65 Q;  1Q81 C;  2OEO A;  2D9U A;  2K5Q A;  5AJ3 Q;  1TY0 A;  3GV3 A;  1NAP A;  4NKL A;  1N36 L;  1K28 A;  5GAH C;  4HED A;  1A2T A;  3QO2 A;  1U4L A;  2B2V A;  4HSV A;  1SJE D;  2BE5 C;  1K73 C;  1PLF A;  1V9P A;  3STB C;  1W3S A;  2E2I B;  1CZG A;  1Z47 A;  4JI5 L;  1B9M A;  4NDX A;  2WB1 E;  5D65 A;  3MEF A;  2NVY B;  5KNB A;  1SJH D;  3TZD A;  2K5W A;  1Y1W G;  1STG A;  4PZ7 A;  1IBM L;  4DV4 Q;  3KOJ A;  4LF6 Q;  1F2M A;  3IKJ A;  4BBS H;  2PQE A;  1SFO H;  4L5R C;  4FF1 A;  2ES2 A;  1VMP A;  3KJO A;  2RCN A;  4DV2 L;  4RKL A;  4QQB X;  3OWF A;  3EBE A;  2JSO A;  1HRJ A;  3IRB A;  2K33 A;  1JMC A;  1L1O A;  1L0Y B;  3R93 A;  5EJW A;  3FMC A;  4OON A;  4QCL A;  2PI2 E;  1M1K C;  4DNI A;  4G7Z C;  1D5X C;  3AYH B;  3NBH A;  3OOC A;  4DA2 A;  2K5D A;  2WB1 B;  1UAP A;  1K8A C;  3SVM A;  1YIT A;  3IAY A;  3FEW X;  2AUJ D;  3Q6S A;  3PF4 A;  5IOC A;  3E5S A;  4JI7 L;  4A3G H;  2ID0 A;  2VQE Q;  2A74 C;  4WRD A;  4JI1 L;  4BY1 B;  4LMQ D;  4PQX A;  1HZ9 A;  1KHI A;  2KED A;  3SK6 A;  1PTO F;  3CQZ H;  1L1O C;  1X54 A;  1G6P A;  3E9I A;  4DAV A;  2EZV A;  2C9O A;  2EQS A;  1EZ8 A;  2LY7 A;  4K6L A;  1H9S A;  2RBM A;  1HNZ L;  4K2K A;  2MGS A;  1NSN S;  1VQN A;  1Y1V H;  4FP5 D;  4OL7 A;  4XYQ A;  5D14 A;  5EKK A;  4JI0 L;  2R92 B;  2O5J C;  4CDE C;  5E7N A;  4C2M B;  4JI8 Q;  3CCS A;  3I4N G;  1I4G A;  1STY A;  3K7U C;  1EU4 A;  1WOC A;  4NP5 A;  4GKJ Q;  3EA6 A;  1E2V A;  1I4P A;  1PYS B;  1DM0 B;  1NBW A;  2H5X A;  1KTK A;  1C0A A;  4IAL A;  4TSS A;  1YHB A;  1VQJ A;  3KUP A;  4A3B G;  3J7A 5;  2EYF A;  2XGT A;  1EWI A;  2UXB Q;  5GAD C;  5KYL A;  2R61 A;  4UPA A;  4DF7 A;  2A19 A;  1NR4 A;  1V43 A;  3GTG B;  1JIC A;  4I65 A;  5FO9 B;  5FLX L;  2YU9 H;  3FRP B;  3KJP A;  2Q2T A;  4G7O C;  3TRZ A;  4WJ4 A;  3CC7 A;  2SNS A;  1KNA A;  5E4X A;  3URY A;  2K14 A;  4KTA A;  4GNX A;  1HFG A;  4RGM A;  3R8B A;  2EPB A;  3I73 A;  1TKW B;  4JV5 Q;  2IX0 A;  2E74 C;  1O80 A;  4K8J A;  3CXC A;  1E3P A;  5ELB A;  1HNW Q;  3G48 A;  5EPL A;  1H9K A;  4GOP B;  2K05 A;  3EFX D;  2F4V Q;  2NVT H;  5LL6 X;  4DK1 A;  1Y69 U;  3AFQ A;  5C0X I;  3J80 i;  5C44 B;  3GTM B;  3KF8 A;  1G51 A;  3X3M A;  1RTN A;  3TP6 A;  1PZJ D;  5CC4 A;  3RN2 A;  2F0E A;  4HAE A;  3GTQ H;  1LAB A;  2E2J H;  1TWA B;  4GNX C;  3OW2 A;  3Q0A A;  3N52 A;  3BVZ A;  1PH2 A;  4LF7 Q;  5ELN A;  4JYA L;  4ZKB B;  1WJJ A;  2OQ0 A;  4LNQ A;  2B8F A;  1D7Q A;  1RJT A;  3S15 H;  3O13 A;  4MZ9 A;  3NEL A;  1CZW A;  1YBY A;  1KL9 A;  3PIO 3;  3GP7 A;  4OO1 G;  2K28 A;  4A76 A;  2H1E A;  1GM5 A;  2EDG A;  4RKB A;  1Q1B A;  1X65 A;  4DV1 Q;  5GRO A;  1D2B A;  4DAY B;  1WCM H;  5C3X A;  5HGQ A;  1C48 A;  4DU9 A;  1TT2 A;  3TEH B;  3GTP B;  3TRE A;  1J5E L;  1XMQ L;  1CA5 A;  3P75 A;  4O0A A;  1HNX Q;  3PO2 H;  3VDY A;  4KKT A;  2JEA I;  2QDL A;  5I9P A;  1VQF A;  1U4M A;  4R9W A;  2E8G A;  2GA4 B;  3K5L A;  1W2B A;  3DEP A;  1MD2 D;  1VQE A;  2N8N A;  3UDG A;  2KVM A;  1BR9 A;  3HOX G;  5ELC A;  3PO3 H;  1PH6 A;  4A3K B;  4JI3 Q;  1EFW A;  3C2P A;  3C1E A;  3V05 A;  3CCE A;  1CQF A;  5T1I A;  5FJ8 H;  4C1N K;  3GDE A;  4OIJ A;  1ET6 A;  3GD7 A;  1K9M C;  1VQ7 A;  3K5O A;  4BBS B;  1SFO B;  2A6E C;  1B2T A;  3A8J E;  3AB9 A;  3D4D A;  2N88 A;  4JI2 L;  4IZ8 A;  1QG7 A;  1KAW A;  3UI2 A;  3TP5 A;  4RGT A;  1UUP A;  2WP8 J;  4ZUJ A;  3KYH C;  3F2C A;  1OXU A;  4MTN A;  1YZ6 A;  4K6D A;  3HOW G;  4IFD H;  1QNU A;  2B2Y C;  3CRK C;  3MZ5 A;  1PDQ A;  5FOB B;  3ULP A;  2MO1 A;  1KDA A;  4DUZ L;  4N8X 1;  1XYI A;  4DV3 Q;  3V96 A;  4NXN Q;  1JJC B;  4IUR A;  4DAM A;  3NK9 A;  4KKU A;  4N9T A;  5BN5 A;  4KY5 A;  4A3G B;  2KCN A;  1UE5 A;  4A3F H;  1PRT B;  1UWV A;  2AQ3 B;  2OT2 A;  3I90 A;  1N9W A;  2F3I A;  1DYQ A;  2MO0 A;  1BNZ A;  4X3K A;  1ASZ A;  3P7J A;  2K75 A;  4JBM A;  1I4Q A;  3CCJ A;  1PH1 A;  1TU2 B;  4NB3 A;  1NMF A;  2F0U A;  2ZTE A;  1GXD C;  4C56 C;  3HOV H;  3P1H A;  3FPP A;  1PH8 A;  4AH6 A;  1Y1V B;  2Z6B A;  4DPG A;  2JA6 G;  1B50 A;  2KEC A;  3PIP A;  4X62 Q;  4BY7 G;  3EIV A;  2FIN B;  1EU3 A;  1HUN A;  4KV6 A;  2M00 A;  2WAC A;  1WVL A;  5JPM C;  4DV0 Q;  2RSO A;  1GUT A;  3E0E A;  1FNU A;  4F8M A;  2QEJ C;  3SXH A;  4KD4 A;  1K83 H;  2Y0S E;  1AE2 A;  1JQY D;  2MPM A;  5FLM H;  4HN7 A;  4LF4 Q;  3SEB A;  4OX9 Q;  4DUY L;  2Z4H A;  5HGT A;  1VQP A;  3H91 A;  1SEB D;  5JEA H;  1H9M A;  2FFK B;  5T1G A;  1Q46 A;  1VQI A;  1QJO A;  4GKK L;  4KJN A;  4A3L H;  1GVP A;  1PRT F;  5D3D A;  5E4W C;  4GKJ L;  1MSG A;  4P75 A;  3I8Z A;  4OO1 I;  3PUZ A;  5ELE A;  1VS0 A;  2L1B A;  5GAE C;  4XTC S;  3VR6 A;  4R8N A;  1PFS A;  1JE4 A;  2EYO A;  4O42 A;  1LT4 D;  1N36 Q;  4UP8 A;  3GTK H;  1CHP D;  2AUK A;  2BDN A;  2Y0S B;  1E1T A;  3HOZ B;  1HQR D;  4FF2 A;  2KBN A;  3K7A H;  4B9W A;  1EY8 A;  3X3N A;  4JI5 Q;  1X55 A;  4J15 A;  1WTR A;  2J0T D;  2JEB I;  1IBM Q;  4B3R L;  3D8G A;  3LX0 A;  3S15 B;  2K32 A;  2RDF A;  1EYA A;  1ESF A;  3VA5 A;  1PRT D;  1DXM A;  3U4V A;  1ESR A;  2D0O A;  3AU7 A;  1ROD A;  2I5M X;  4DV2 Q;  1HXY D;  5IGF A;  3DUZ A;  3LGJ A;  1WCM B;  4JG2 A;  4WJW A;  4RA8 A;  3EN2 A;  2E75 C;  4JC0 A;  4DR2 L;  1XPU A;  1K0S A;  3G71 A;  2L55 A;  2B63 G;  1B8A A;  5C0X H;  2MQH A;  1B70 B;  4FVM A;  2IX1 A;  2PNR C;  4AYB E;  4MNO A;  1EY4 A;  2M2L A;  3EVQ A;  1IW7 D;  1EQT A;  2RHQ B;  4DR1 L;  1YI2 A;  2NZO A;  2MFI A;  4DK6 C;  3RD4 A;  1LT3 D;  4YWL A;  2IWH A;  3PO3 B;  4JI7 Q;  5DM6 3;  5ELD A;  1CKN B;  1IXR A;  4JI1 Q;  4GN4 B;  1T5E A;  3OYY A;  2OCE A;  5EPJ A;  1Q86 C;  2WII B;  3S17 H;  1HNX L;  1TWF H;  2PZW A;  3ND9 A;  3G4S A;  4FXG C;  4YCU A;  5C5L A;  4LF8 L;  1VQB A;  1HH2 P;  2IY5 B;  3HKZ E;  1HNZ Q;  1VQA A;  4K5X A;  5I6W A;  3I3C A;  1XPR A;  1XNQ L;  3CMA A;  4DN4 M;  1W6K A;  2DJF C;  4DR7 L;  1GUO A;  1Q8K A;  2K4K A;  3NTH A;  4N9P A;  4AYB B;  4JI0 Q;  1UE6 A;  4U67 3;  2V4D A;  3FVQ A;  1EIH A;  5M9O A;  4RCO A;  3Q8D A;  4AQY L;  1G6Z A;  2ATW A;  4CGY B;  3U9O A;  3W1G A;  2B2T A;  1XTD A;  4XQQ A;  1UEB A;  4H44 C;  4X64 L;  4ABN A;  1WTW A;  2B3G A;  1ZXT A;  2NZH A;  3OW7 A;  1EYG A;  1S4Z A;  4FF4 A;  1FL0 A;  1IHZ A;  1RIP A;  2X69 A;  4DKA C;  3FPU B;  2JJQ A;  4LK1 C;  5COY A;  1XTC D;  3HKZ B;  3CCM A;  4QL5 A;  1HPC A;  1H9R A;  1B4O A;  1ONL A;  1HR0 L;  1PFB A;  1ML0 D;  1PA6 A;  2MUY A;  4A3J H;  1QIL A;  2EJF C;  2F0W A;  2ZXO A;  3ERQ A;  4POG A;  2NN6 G;  2B2T C;  3HOV B;  2H4O A;  2EE1 A;  3UE0 A;  4RMF A;  4CDC C;  5C4X G;  5TSS A;  3R2I A;  1C8C A;  2E2H H;  3M85 A;  1WTH A;  4IUP A;  3CCR A;  1KNE A;  2K6A A;  1KIX A;  5IOD A;  1Q12 A;  2JA7 G;  1SE3 A;  1I5F A;  1Q1E A;  4L5T A;  4A3C G;  2E5L L;  2HHH L;  3TME A;  3PIO A;  4K14 A;  1SE4 A;  1LT5 D;  3JAM E;  3I7F A;  3H6M A;  4A4I A;  3VR3 A;  3S1Q H;  1JE5 A;  1T5X D;  1YJN A;  4XYO A;  4JYA Q;  2QA4 A;  5JJL A;  2BDO A;  5IYD G;  1BXT A;  1SNP A;  2F4I A;  2F1M A;  1LTB D;  2O2L D;  4C3H G;  1V1O A;  1LTI D;  1U4P A;  1X3E A;  1PXU A;  3K6O A;  1OTC A;  4FNF A;  2A73 B;  2PW7 A;  4HJA A;  4KHZ A;  4A3D G;  4BXX H;  4EQN A;  1QNK A;  1X56 A;  1DON A;  4G7H C;  5A2Q L;  5C0X J;  2CWA A;  4HTH A;  4QUF A;  1XMQ Q;  1J5E Q;  1DOM A;  2L11 A;  1NY4 A;  4DAY A;  2KHI A;  3H09 A;  1I94 L;  1KLU D;  2VNU D;  1RDP D;  3NBI A;  3D0F A;  3NUC A;  3A8I E;  3GTK B;  1M4V A;  1NUC A;  1ZEQ X;  5M5X B;  3NWS A;  1CT1 D;  3IL8 A;  1GUS A;  1VCI A;  3S1N H;  3B6Y A;  1SYB A;  4POF A;  4C3I G;  4R4I A;  2WKD A;  4A3I H;  4U68 A;  3K5M A;  4L63 B;  3FKI G;  3T51 B;  4DR6 L;  3DWP A;  4YCV A;  1CHQ D;  4A75 A;  4CDF C;  4R4C A;  3J81 L;  4X6A H;  2EXD A;  2F0L A;  1SE2 A;  5FKA C;  2XN9 C;  1MGS A;  2JK8 A;  4LWC A;  3KF6 A;  4Z9C B;  1LTS D;  1TWH H;  3I91 A;  2JA8 B;  3MXN B;  3GTL B;  2A68 D;  4JI2 Q;  2O5I C;  4C3J G;  2HCI A;  2PNH A;  4EQP A;  1F2Z A;  2CW0 D;  4DGZ A;  1PH9 A;  4OO1 H;  4KK7 A;  1D8L A;  1TS5 A;  3CF5 A;  2NVX H;  2WFW A;  3JAM c;  1EEI D;  2HQE A;  2RHS B;  4YHH Q;  5I2Y A;  3BVG A;  3RZO H;  5FO8 B;  2KA7 A;  2N3S A;  5JVG 3;  4ME3 A;  2E2D C;  3HG9 A;  3SHL A;  1FVI A;  1QVC A;  4B9X A;  4ZCK A;  4DUZ Q;  4APV A;  1V1P B;  3UDI A;  5G3L F;  3S1R B;  2VS1 A;  1IKM A;  1SMX A;  3CW2 C;  4Y7N H;  2DUD A;  3HOX H;  3M3Y B;  1FNW A;  2XRS D;  4LW1 A;  4H02 A;  1I50 B;  3S17 B;  1CKM A;  3F2D A;  3DWA A;  1EIY B;  2WB1 G;  1ZKO A;  2IX3 A;  2PMZ E;  3K81 C;  5CMD A;  1CSP A;  3QG1 A;  3OMG A;  3J7Y W;  3BVM A;  5IT9 E;  4PV1 C;  1G2T A;  2D62 A;  3KFU A;  1GOZ A;  2NYZ D;  4BY1 G;  1LV9 A;  2NN6 I;  5JPN C;  3Q23 A;  4TKO B;  5M5W H;  2LKV A;  2N78 A;  1MBY A;  1FD7 D;  5CV4 A;  3HOW H;  1PRT C;  1LAC A;  2A8V A;  1BQQ T;  4DXF A;  5G3L D;  2QIL A;  1X6O A;  4HID A;  4DUY Q;  3BDC A;  4DNR B;  2WAQ B;  2A6H D;  1Y8N B;  3ERO A;  3OWE B;  3CC2 A;  3A5Z B;  2PMZ B;  1R9T H;  1FYC A;  1IYJ B;  1A62 A;  1QVG A;  1JOK A;  3GTJ B;  3NQI A;  4A3J B;  5EBC A;  3AFP A;  4GKK Q;  2NUC A;  4Q0F A;  2RF4 A;  1IW7 C;  1CK1 A;  2EJG C;  2OXP A;  1I6H H;  3KLR A;  1IL8 A;  5C4J H;  2DNE A;  1PHJ A;  4ZAI A;  3S16 H;  2PCF B;  1VQ9 A;  1TQO A;  4CJ1 B;  4OIK A;  3CRL C;  4A3E H;  5KNC A;  1DZ1 A;  1NMG A;  3MXU A;  3RLF A;  4EQ5 A;  1LUZ A;  1S5D D;  1RHP A;  2SNM A;  4BWG B;  3BZD B;  4OWW B;  3VA7 A;  3M4P A;  2PQA B;  5IYB G;  4GLA C;  2B8G A;  2NZ1 D;  3PUW A;  2TSS A;  5IYC G;  2OF1 A;  3S1Q B;  4PZ8 A;  3E0J A;  3HS0 C;  4J1M A;  5IT9 c;  1VQK A;  1EIG A;  1ILQ A;  1C4Q A;  4B3R Q;  1PFM A;  1OXT A;  2EY1 A;  4OEL B;  4TVA B;  2SDF A;  5M3M H;  5C44 G;  4BBR G;  4OWX B;  1ICW A;  4E6I A;  3OIQ A;  4LFB L;  2HIX A;  3J80 L;  2D5D A;  3M4O H;  1PFN A;  2JYO A;  1G29 1;  1XJV A;  1MKH A;  4JBJ A;  1Q7Y C;  3L3O C;  2ALY B;  1YNJ D;  2JQO A;  5A2Q E;  4DR2 Q;  1Q82 C;  3GQB A;  5IP7 H;  3DXJ C;  3NTK A;  4J8Q A;  4L6T B;  3A55 A;  1K3B C;  2L0C A;  4S3S A;  4DR1 Q;  1KLG D;  3F2U A;  3M7G A;  3S1N B;  1GKH A;  1M90 C;  1PVO A;  1I4R A;  2V1C C;  4B08 A;  4A3I B;  4LUV A;  3TQY A;  5K36 G;  1EEF D;  1HZB A;  4DFA A;  3M9B A;  1B3Q A;  2AWN A;  4ZKC B;  3HOU G;  3SR1 A;  3RLN A;  2R7Z H;  3ND8 A;  5COR A;  3ER0 A;  4LF8 Q;  2HQL A;  3MC0 B;  2EY2 A;  2VQF L;  4KY6 A;  3HOY H;  2F3W A;  2FMC A;  2G9D A;  1X9N A;  1XXG A;  1NJI C;  3HP3 A;  1XNQ Q;  3GV6 A;  2RQX A;  3KLW A;  1KAB A;  4L5Q A;  4A3K G;  4DR7 Q;  3GO5 A;  1L0X B;  4XQJ A;  4JOI A;  2NVX B;  5HY6 A;  2EY6 A;  2AWO A;  2F0D A;  3NP8 A;  2AQ1 B;  1N33 L;  4ZK9 B;  1WTP A;  1MJC A;  1SNM A;  4JCV E;  1E0B A;  3PQI A;  4AQY Q;  2K04 A;  3QIA A;  2EYP A;  2SEB D;  2IL8 A;  2B2Y A;  1QUQ A;  2ZJR A;  4XDX A;  1UNS A;  2D2C C;  4FXK C;  5E3F A;  4BBS G;  1VQC A;  1N32 L;  4X64 Q;  2NTS A;  4FO2 A;  1EOT A;  1G91 A;  4RCN A;  3MWY W;  1PYB A;  1JWU D;  1QVF A;  1GHK A;  1AFP A;  1X3F A;  4Y7N B;  4JOI C;  4HIK A;  1RD9 D;  2VUM H;  3HRZ C;  1L0W A;  3S24 A;  1HR0 Q;  4YHH L;  3HGB A;  2EJM A;  4DV5 L;  3KK7 A;  2Z0S A;  4KD3 A;  5IIF A;  2JXM B;  5ISR A;  2WIN B;  4CKB A;  4JW0 A;  1CFM A;  2B29 A;  2N55 A;  4F88 A;  2ASB A;  4A3G G;  4UY8 C;  1BVS A;  1NR2 A;  2JE6 I;  5BN3 A;  1OXS C;  3TS0 A;  2KCT A;  1H95 A;  1FR3 A;  1O7Z A;  5DAU A;  5J3B A;  5M5W B;  1PH7 A;  2E5L Q;  1MI2 A;  2HHH Q;  1L2F A;  2UXC L;  1X3G A;  1S72 A;  3CQZ B;  1JCK B;  1QB5 D;  2RSN A;  3CME A;  4JI4 L;  4F87 A;  4FYD A;  3OTO L;  1I3Q H;  2B2U A;  2A68 C;  5A35 A;  3C46 A;  2B2W A;  4ID6 A;  1VQ4 A;  3H3V C;  3FP9 A;  1U5K A;  1Y1V G;  4ZYS A;  2CW0 C;  2KJX A;  2XWJ B;  1P16 A;  1KD1 C;  2KQ3 A;  1L1O B;  1HZC A;  2A69 D;  2J4X A;  4KMU C;  1R9T B;  3M7N A;  5DEH A;  2A1A A;  4RWS C;  4DR3 L;  5FO7 B;  5C4J B;  4DNT B;  1A3U A;  5M5Y H;  2B2U C;  2R93 H;  2B2W C;  3S16 B;  1ET9 A;  1OXX K;  3QOL A;  1I94 Q;  3VR5 A;  2UXD L;  5F2D A;  4A3E B;  1IBL L;  2I0Q A;  2LS0 1;  1RL2 A;  4NW2 A;  5C3E H;  4QUC A;  5JJI A;  4PMC A;  1LYL A;  4IPH A;  5IWA L;  4UP9 A;  2ZTD A;  2JA7 H;  1JOQ A;  2YU9 B;  5FLX E;  1H9S B;  1J6Q A;  3W1B A;  4IUQ A;  3NEN A;  3JAM i;  3H0G G;  1ENA A;  3PMF A;  2BE5 D;  2K5V A;  4RH6 A;  4DR6 Q;  1JB7 A;  4EGV A;  1S5F D;  1C9O A;  4KY7 A;  1TVX A;  5M3F H;  1LM0 A;  2DN8 A;  5M3M B;  2Y0S G;  1LLR D;  4HJ7 A;  5I2X A;  5IYD H;  1SMY D;  2VXW A;  4QIW E;  3HOZ G;  2NVT B;  1U0L A;  3SGI A;  4OEM B;  1B1Z A;  4C3H H;  3MXP A;  3CCV A;  3M4O B;  2Q2U A;  2KHJ A;  1JB3 A;  4MHE A;  5KEE A;  1O7L A;  3GTQ B;  4NPS A;  5LMN L;  2E2J B;  2VW9 A;  4A3D H;  1E1O A;  1Z9F A;  1JWS D;  1YHQ A;  3ONA B;  4H0L C;  5JOB A;  1DOK A;  3J81 j;  3WDN A;  2UUA L;  3U4Z A;  1JOO A;  1JJ2 A;  2XRQ D;  1EZ6 A;  1XMO L;  1SDF A;  1U4R A;  2TMP A;  3FDT A;  1LT6 D;  1O7Y A;  5C6A A;  4M8A A;  1QOH A;  2F0S A;  5JAV A;  4DV6 L;  1UE1 A;  1WCM G;  2CVR A;  4A93 H;  3DMU A;  5LMN W;  4UDU C;  3TDQ A;  4NXM L;  4A3M H;  4QIW B;  2ZM6 L;  1YHA A;  2MP1 A;  3I70 A;  3N6R A;  1QZH A;  3HFZ B;  4J6H A;  4RG1 A;  3PO2 B;  5CYU A;  1V1P A;  3VYR A;  2R7Z B;  3BS1 A;  3T1H L;  3KF8 B;  2UUC L;  1HJP A;  2ZJP A;  3HOY B;  2F0Q A;  3Q22 A;  3I4M G;  1SSO A;  1KC8 C;  2RDH A;  3ZYY X;  4KN4 C;  2GVB A;  2CFM A;  1GJX A;  3EQL C;  1Y8O B;  2A5H A;  2LFN A;  5FLX c;  3PO3 G;  1TWG H;  2EOT A;  1G8Z D;  1UEA B;  2F0G A;  1O78 A;  1PTO H;  4C3J H;  2CQA A;  1N34 L;  1M8A A;  2QCP X;  1K0R A;  4XIG S;  5K5P A;  1F9R A;  4X3U A;  3J7A F;  4RAU C;  1YVC A;  2Q8I B;  2CHB D;  3PF5 A;  2I5L X;  2YV5 A;  4FXD A;  4O2D A;  4LF9 L;  3KLS A;  2IJ0 A;  2KEE A;  3S2D H;  1JOR A;  1AN8 A;  1ENF A;  1EY6 A;  1Y1W H;  1WYD A;  4IUU A;  3S9W A;  4R1J A;  4IOA A;  3Q24 A;  1EWH A;  4AYB G;  3K5N A;  4PMB A;  1YNJ C;  2IHE A;  1J8I A;  2FXQ A;  3CAM A;  2VUM B;  1GHJ A;  2I46 A;  1Y8P B;  4IFD G;  2XSC A;  1ENC A;  1SRU A;  4PZ6 A;  1SAP A;  2PI2 A;  1U9R A;  3DEO A;  4YCW A;  4I7A A;  4L5S A;  4IJH A;  2ZXR A;  1YNN D;  1VQG A;  5GQO A;  4YY3 L;  2I07 B;  3VYT A;  3BZC A;  1SLJ A;  1IYV A;  3LWE A;  3HKZ G;  4P71 A;  2EIF A;  5IGC A;  3VYU A;  4A3F B;  5BR8 Q;  1CM9 A;  3A8K E;  3OPO A;  1DD2 A;  1WTV A;  1BCP B;  1PH5 A;  2SOB A;  4YWK A;  1QE6 A;  4B3T L;  4V0B A;  4IQZ A;  1A8V A;  5I6Y A;  4HIO A;  1I3Q B;  4HMI A;  2WKC A;  1NNX A;  1TS2 A;  3HOV G;  2BA0 A;  2K1B A;  3U9S A;  2ICE C;  2HDM A;  4GS3 A;  1OO9 B;  1LTT D;  1EIF A;  2AMC B;  3CCL A;  1KXL A;  1CSQ A;  2PQA A;  1AE3 A;  1UE7 A;  5EKL A;  3MVV A;  3BYT B;  1LTG D;  4K2L A;  4LFB Q;  2YTV A;  4LUO A;  1HR0 W;  3DM1 A;  4GOP A;  3NSW A;  4KJO A;  1JT8 A;  1MHW C;  2PW5 A;  2R7D A;  2F0F A;  2BH8 A;  3KDF B;  2P5Z X;  4HMJ A;  3W2D A;  3I4N H;  5M5Y B;  2NTT A;  2MHV A;  2R93 B;  4ILW A;  4GN3 B;  1AW7 A;  1K83 B;  5C4Z A;  4DXG A;  2DY7 A;  4CBV A;  4UP7 A;  1R4P B;  5J22 A;  1SE8 A;  3D4W A;  2GN5 A;  3D6C A;  2F0K A;  1O7I A;  5JEA G;  4XQN A;  1F2Y A;  2X6G A;  3D3R A;  5C3E B;  3DLL A;  1I6V C;  1CUK A;  4A3B H;  2HDL A;  2K5H A;  1SYD A;  4OHJ A;  2OWO A;  4Y52 H;  3AMU A;  1PV4 A;  1DJR D;  2IT1 A;  1VQ8 A;  4A3L G;  4HJ9 A;  2F0I A;  1AZQ A;  2JA5 G;  2UUB L;  2MJ8 A;  4GOP C;  3ULJ A;  5CV7 A;  2EVB A;  1TY2 A;  4X66 L;  3IFD A;  5KRU A;  1QWY A;  5M3F B;  4RHR A;  3T1Y L;  2DJG C;  1LTL A;  5IYC H;  2EYJ A;  1WD1 A;  3HKS A;  3E6Z X;  4IOC A;  1Q8I A;  1EY9 A;  1IYU A;  3AQQ A;  3PCO B;  3TN2 A;  3L0O A;  2VQF Q;  3BG3 A;  4KN7 C;  5CV9 A;  5LHY 1;  3U58 A;  1DGS A;  3FHW A;  1OXV A;  1FJG L;  2Q8R E;  4BBR H;  4JI6 L;  4OWT B;  3T13 A;  1HTP A;  3K7A B;  5IP9 G;  1YIJ A;  2QEX A;  4RGN A;  1N33 Q;  3VR4 A;  3TZU A;  4CJ2 C;  1LTR D;  1WTQ A;  3K57 A;  4QMG A;  1F2L A;  2A69 C;  2F3V A;  4HJ8 A;  2LMC B;  2LXJ A;  1B3A A;  4G4K A;  1N32 Q;  1S5B D;  2JA8 G;  1XPO A;  2YTY A;  4B3M Q;  1EYC A;  2VB3 X;  5J1Z A;  3W5O A;  1BF4 A;  5KGU A;  1PMR A;  2QGQ A;  3W3A A;  3A0J A;  4A93 B;  3RUZ A;  3F8T A;  2JA9 A;  4M1U B;  1BCP D;  1EY7 A;  1XWE A;  3EJI A;  4A3M B;  4GZY C;  1I4X A;  5K36 H;  2L4N A;  4IPD A;  1BOS A;  4CJ0 B;  1CI3 M;  1GD7 A;  4DV5 Q;  2BH2 A;  2F0H A;  3HOU H;  3NEM A;  4H7B A;  4DR4 L;  1P8L A;  1HUM A;  2K5N A;  4IFD I;  3ULL A;  1F77 A;  2R7F A;  1ILP A;  2Z1C A;  1TWG B;  2Q8T A;  1R4Q B;  5I9O A;  1PTO B;  4BA1 I;  5IY0 A;  4C3J B;  3A54 A;  2LXK A;  3E9H A;  1EY5 A;  2PZT A;  4A3K H;  3C3L A;  5GAG C;  4JVZ A;  4P74 A;  1A3V A;  2CQO A;  4FDB A;  2EXZ A;  2UXC Q;  1K3R A;  1TWF B;  2JN4 A;  4EX5 A;  4JI4 Q;  1SMY C;  1RKN A;  1X3Q A;  2GVA A;  2KUM A;  3LWU A;  4DAP A;  1CA6 A;  3L7Z C;  1B44 D;  2WV6 D;  3OTO Q;  2WAQ E;  3S2D B;  1Z6H A;  1V8Q A;  3H3V I;  3NPP A;  4IO9 A;  1Y1W B;  1ICF B;  4QY7 A;  3H15 A;  3IFT A;  4O1N A;  2B2V C;  1AH9 A;  2J7Z A;  3LNN A;  1B9N A;  2AQ2 B;  3CCU A;  1KQS A;  2FJ2 A;  1HA6 A;  2K01 A;  1VQ5 A;  3ERS X;  5CV8 A;  3RR5 A;  5CV6 A;  1BKB A;  3S1M H;  4IUN A;  3BDL A;  4DR3 Q;  2F0P A;  3K0X A;  4MN3 A;  3PV0 A;  3OSO A;  1BBU A;  1Q90 A;  2EYH A;  2WAQ G;  3J7A V;  2UXD Q;  2KEN A;  1SNC A;  1D5Z C;  1IBL Q;  2B39 A;  4LJZ C;  4ULL A;  3CKI B;  2R92 G;  1TII D;  3PUV A;  5IWA Q;  4A3J G;  2UU9 L;  4IUV A;  2Z6K A;  4UHV A;  4X3T A;  2RCF A;  5C3W A;  5ELO A;  4EQO A;  1KDB A;  2NBF A;  2L15 A;  2ZT9 C;  2E2H B;  5LMU L;  2R6G A;  4BA2 I;  1WFQ A;  1SND A;  4DV7 L;  2JA6 H;  4QGU A;  1YJ9 A;  2EY5 A;  2EYL A;  3D6W A;  1IL2 A;  2X6L A;  5BR8 L;  4BY7 H;  2XWB B;  4ZRZ A;  5IE8 A;  1PH4 A;  2Z6K C;  4MTK A;  2QW7 A;  5LMN Q;  3I4N B;  1STH A;  4GN5 A;  1FGU A;  2UUA Q;  4K5V A;  3A5U A;  2EYM A;  4LFC L;  4DR5 L;  1XMO Q;  2N49 A;  4A3B B;  1PTO D;  1SN8 A;  2JP1 A;  4ZUI A;  3WOE A;  1K8G A;  3VYS A;  1EQV A;  4XXE A;  3BDO A;  4BXX G;  1HQM C;  2YYZ A;  4DV6 Q;  1IBK L;  1E7Z A;  1TS4 A;  1YNN C;  4CKC A;  4JBW A;  3JC6 6;  3MXG A;  4NXM Q;  1BO0 A;  2ZM6 Q;  3C1F A;  1CQV A;  2ICI A;  1HA5 A;  2Q2H A;  5JJK A;  1GUW A;  1E24 A;  3H0G H;  2L9H A;  2DNC A;  4TQU S;  3L9A X;  3T1H Q;  1A0I A;  4K0K L;  3CHB D;  1YEZ A;  2UUC Q;  1BDO A;  2XVS A;  4B3S L;  4LFA L;  4EVO A;  3WWV A;  3NQT A;  2F0N A;  3RMH A;  3RLO A;  4BBR B;  5JVH 3;  3NWT A;  3VR2 A;  3HOZ H;  4A3I G;  2QKI C;  4KKS A;  1N34 Q;  3SDZ A;  4IPC A;  3K80 C;  4LF5 L;  1A15 A;  3T4A C;  1F9S A;  5KIX A;  1E22 A;  2Z9H A;  2F03 A;  3J81 E;  5IGE A;  1B53 A;  4LF9 Q;  1CKN A;  1VQD A;  2OTL A;  1RTO A;  1CKO A;  1VQO A;  1E2W A;  1STE A;  4CKE A;  3RN5 A;  1TS3 A;  1TWH B;  1KRT A;  1MIU A;  1XX8 A;  1ZYR D;  2AKW B;  3J7Z C;  1ASY A;  1WTX A;  1D6E C;  1FNV A;  4C1N I;  2ZTC A;  2BCO A;  1AZP A;  4P2C B;  1W6J A;  4HJ5 A;  3RZO B;  4LUZ A;  3OHX C;  3CD6 A;  3HOU B;  2K03 A;  3HZX A;  1F9Q A;  3T56 B;  2B63 H;  2PPB C;  4HCE A;  4YY3 Q;  1VMC A;  3CP0 A;  3I4M H;  4B3M L;  1BBX C;  1WD0 A;  2K7V A;  1HCZ A;  2D0P A;  2F52 A;  2IPK D;  3HOX B;  1IZ6 A;  4YWM A; 
#chains in the Genus database with same CATH homology
 5CV5 A;  1STB A;  2FMM A;  1G2S A;  4ME5 A;  1HFN A;  3TSS A;  3MFG A;  5IGB A;  3SK4 A;  2F0T A;  3G6J B;  2RVL A;  1K8M A;  3S1M B;  5DM7 3;  3K0Y A;  3HOW B;  4Q5V A;  4IUT A;  1BCP C;  5JJZ A;  4XT3 B;  5C4H A;  3KLS X;  1D1I A;  2RDG A;  4NMZ A;  3HEJ A;  3TP7 A;  5J39 A;  1X32 A;  4QF4 A;  1GUG A;  5LL6 S;  5FK9 C;  3ITP A;  1I6H B;  4X3S A;  4H13 C;  3MHB A;  3BYY B;  1VF7 A;  1AEX A;  2NN6 H;  1HHV A;  3T53 B;  3V2T A;  2HUG A;  4XT1 B;  2F0V A;  2KOL A;  2JA6 B;  1EFI D;  1K8O A;  4BY7 B;  1Z7T A;  4V19 0;  3MA2 B;  5CGK A;  5ELF A;  1BUV T;  1EL0 A;  1F9P A;  1KAA A;  4TRD A;  4KHV A;  1JC7 A;  4WOR A;  3JAM L;  1CTM A;  5KND A;  3NXW A;  4IN3 A;  1SYG A;  1SYF A;  3K59 A;  1QCB D;  3QB3 A;  2ENB A;  4YIJ A;  2RA4 A;  5NUC A;  4MIU A;  4LAA A;  1EY0 A;  1EYD A;  3PUY A;  3J80 E;  1SYC A;  2ZXP A;  4PMW A;  3MXN A;  3H0G B;  5D3I B;  3OIP A;  2A6H C;  2NWG A;  4JK1 C;  4ODG A;  2RKS A;  2IW3 A;  1IKL A;  3NHH A;  1JWM D;  3KBG A;  4DK0 A;  3M4Y A;  4L8J A;  1KDC A;  5CBE E;  4K8I A;  1GUN A;  3QWN A;  3KBX A;  1PZK D;  2L5T A;  4HCS A;  5I4D A;  2HCC A;  2VB2 X;  1D5M C;  4RHS A;  4F7X A;  4BS9 A;  5HUR A;  1A2U A;  4QB4 A;  5EKI A;  4IFD J;  2KHS A;  1A6X A;  2KCC A;  1PTO C;  1LTA D;  3G7L A;  2B63 B;  1DCZ A;  5BN4 A;  4FF3 A;  3I4M B;  1STA A;  5EQ0 A;  4RGO S;  1JR0 D;  3TP8 A;  3A7A B;  3D4R A;  3QJY A;  2FHT A;  1D1K A;  3DWQ A;  1MSH A;  2E76 C;  1S5E D;  2PYK A;  1PZI D;  3DHQ A;  3D31 A;  1SBB B;  1S5C D;  3S14 B;  2XNA C;  1A3T A;  2PZU A;  3R3O A;  3CU7 A;  3K58 A;  3I72 A;  3P20 A;  4RFB A;  3OMC A;  1SNO A;  5IT9 L;  2NB0 A;  2F0M A;  1RCV D;  3NE5 B;  3H94 A;  2BA1 A;  2Z4I A;  1Q3L A;  4HR7 B;  1AP0 A;  1X3P A;  2F0O A;  5IGD A;  3MFY A;  3WOF A;  1FGB D;  3MAQ A;  4ZQ3 A;  1VF5 C;  1ZYR C;  2NVQ B;  5JEA J;  5E1F A;  3TBI B;  5CR3 A;  3SK8 A;  1VDZ A;  1LO5 D;  5EGT A;  1E2Z A;  2R3Z A;  4WFN 3;  5C5M A;  1HTL D;  2C5C A;  1NCV A;  3A7L A;  2XIW A;  3PUX A;  3T16 A;  5C4X B;  3NTI A;  2QF7 A;  4K5W A;  1WTO A;  2G9H D;  4ZLT F;  1SXT A;  2JA7 B;  1I4H A;  1TWC B;  1TR5 A;  3MEH A;  1SNQ A;  3A56 A;  3SE0 A;  1EWC A;  3MTS A;  5AFW A;  5KYI A;  4KI0 A;  2Z8L A;  1SYE A;  5DNF A;  1BCP F;  4PNY A;  2F0J A;  5CBA E;  3SK5 A;  4R8I A;  4G57 A;  2O4X A;  3RZD B;  4C3H B;  4I7Z C;  2A6E D;  4HSP A;  2JA5 B;  3S2H B;  4A3D B;  5EPK A;  3PIP 3;  3I4L A;  2DY8 A;  5EBD A;  1DOL A;  2L12 A;  2QDB A;  4OGQ C;  2M9V A;  3QOJ A;  4UAI A;  1STN A;  4CHT B;  1J9O A;  1RF2 D;  2PO4 A;  2BOS A;  3R2T A;  1II3 A;  1H9J A;  4C3I B;  3GTO B;  5C0X G;  3FKI B;  5IGG A;  1PYW D;  2OEO A;  2D9U A;  2K5Q A;  1TY0 A;  3GV3 A;  1NAP A;  4NKL A;  4HED A;  1A2T A;  3QO2 A;  1U4L A;  2B2V A;  4HSV A;  1SJE D;  2BE5 C;  1PLF A;  2E2I B;  1CZG A;  1Z47 A;  1B9M A;  4NDX A;  5D65 A;  2NVY B;  5KNB A;  1SJH D;  3TZD A;  2K5W A;  1STG A;  1F2M A;  3IKJ A;  2PQE A;  4FF1 A;  1VMP A;  4RKL A;  3OWF A;  2JSO A;  1HRJ A;  2K33 A;  1L0Y B;  3R93 A;  5EJW A;  3FMC A;  4QCL A;  4G7Z C;  1D5X C;  3NBH A;  3OOC A;  4DA2 A;  2K5D A;  2WB1 B;  1UAP A;  3SVM A;  3IAY A;  3FEW X;  2AUJ D;  3Q6S A;  5IOC A;  3E5S A;  2ID0 A;  2A74 C;  4WRD A;  4BY1 B;  4LMQ D;  4PQX A;  2KED A;  3SK6 A;  1PTO F;  4DAV A;  2EZV A;  2C9O A;  1EZ8 A;  2LY7 A;  4K6L A;  1H9S A;  2RBM A;  4K2K A;  2MGS A;  1NSN S;  4FP5 D;  4OL7 A;  4XYQ A;  5D14 A;  5EKK A;  2R92 B;  2O5J C;  4C2M B;  1I4G A;  1STY A;  1EU4 A;  4NP5 A;  3EA6 A;  1E2V A;  1I4P A;  1DM0 B;  1KTK A;  4IAL A;  4TSS A;  3KUP A;  2EYF A;  5KYL A;  2R61 A;  4DF7 A;  1NR4 A;  1V43 A;  3GTG B;  1JIC A;  4I65 A;  5FO9 B;  5FLX L;  3FRP B;  4G7O C;  2SNS A;  1KNA A;  5E4X A;  3URY A;  4KTA A;  1HFG A;  4RGM A;  3R8B A;  2EPB A;  3I73 A;  1TKW B;  2IX0 A;  2E74 C;  1O80 A;  4K8J A;  5ELB A;  5EPL A;  1H9K A;  2K05 A;  3EFX D;  5LL6 X;  4DK1 A;  1Y69 U;  5C0X I;  5C44 B;  3GTM B;  3KF8 A;  3X3M A;  1RTN A;  3TP6 A;  1PZJ D;  5CC4 A;  2F0E A;  4HAE A;  1LAB A;  1TWA B;  3Q0A A;  3N52 A;  3BVZ A;  4ZKB B;  2B8F A;  1RJT A;  3O13 A;  1CZW A;  3PIO 3;  3GP7 A;  4OO1 G;  2K28 A;  2H1E A;  2EDG A;  4RKB A;  1Q1B A;  1D2B A;  5C3X A;  1C48 A;  4DU9 A;  1TT2 A;  3GTP B;  1CA5 A;  3P75 A;  4KKT A;  2JEA I;  5I9P A;  1U4M A;  4R9W A;  2GA4 B;  3K5L A;  3DEP A;  1MD2 D;  2KVM A;  1BR9 A;  5ELC A;  4A3K B;  3C2P A;  3C1E A;  3V05 A;  1CQF A;  5T1I A;  4C1N K;  4OIJ A;  1ET6 A;  3GD7 A;  4BBS B;  3K5O A;  1SFO B;  2A6E C;  1B2T A;  3A8J E;  3AB9 A;  3D4D A;  2N88 A;  4IZ8 A;  1QG7 A;  3UI2 A;  3TP5 A;  4RGT A;  1UUP A;  2WP8 J;  4ZUJ A;  1OXU A;  4K6D A;  4IFD H;  1QNU A;  2B2Y C;  3CRK C;  3MZ5 A;  1PDQ A;  5FOB B;  1KDA A;  1XYI A;  3V96 A;  4IUR A;  5BN5 A;  3NK9 A;  4KKU A;  4N9T A;  4A3G B;  4KY5 A;  2KCN A;  1PRT B;  2AQ3 B;  2OT2 A;  3I90 A;  1DYQ A;  1BNZ A;  4X3K A;  3P7J A;  1I4Q A;  1TU2 B;  2F0U A;  4C56 C;  1GXD C;  3P1H A;  3FPP A;  1Y1V B;  1B50 A;  2KEC A;  2FIN B;  1EU3 A;  1HUN A;  4KV6 A;  2M00 A;  2WAC A;  1WVL A;  5JPM C;  2RSO A;  1GUT A;  1FNU A;  4F8M A;  2QEJ C;  3SXH A;  4KD4 A;  1JQY D;  2MPM A;  4HN7 A;  3SEB A;  2Z4H A;  5HGT A;  3H91 A;  1SEB D;  5JEA H;  1H9M A;  2FFK B;  5T1G A;  1QJO A;  4KJN A;  1PRT F;  5D3D A;  5E4W C;  1MSG A;  3I8Z A;  4OO1 I;  3PUZ A;  5ELE A;  2L1B A;  4XTC S;  3VR6 A;  4R8N A;  1JE4 A;  2EYO A;  4O42 A;  1LT4 D;  1CHP D;  2AUK A;  2BDN A;  2Y0S B;  3HOZ B;  1HQR D;  4FF2 A;  4B9W A;  1EY8 A;  3X3N A;  1WTR A;  2J0T D;  2JEB I;  3D8G A;  3LX0 A;  3S15 B;  2K32 A;  2RDF A;  1EYA A;  1ESF A;  3VA5 A;  1PRT D;  1DXM A;  1ESR A;  3AU7 A;  1ROD A;  1HXY D;  5IGF A;  3DUZ A;  1WCM B;  4WJW A;  4RA8 A;  2E75 C;  2L55 A;  5C0X H;  4FVM A;  2IX1 A;  2PNR C;  1EY4 A;  2M2L A;  3EVQ A;  1IW7 D;  1EQT A;  3RD4 A;  1LT3 D;  2IWH A;  3PO3 B;  5DM6 3;  5ELD A;  1T5E A;  5EPJ A;  2WII B;  2PZW A;  3ND9 A;  4FXG C;  5C5L A;  4K5X A;  5I6W A;  3I3C A;  4DN4 M;  1W6K A;  1GUO A;  4N9P A;  3NTH A;  4AYB B;  4U67 3;  2V4D A;  3FVQ A;  1EIH A;  5M9O A;  4RCO A;  1G6Z A;  4CGY B;  3U9O A;  2B2T A;  4XQQ A;  4H44 C;  4ABN A;  1WTW A;  1ZXT A;  3OW7 A;  1S4Z A;  4FF4 A;  1IHZ A;  2X69 A;  3FPU B;  4LK1 C;  5COY A;  1XTC D;  3HKZ B;  1HPC A;  1H9R A;  1B4O A;  1ONL A;  1PFB A;  1ML0 D;  2MUY A;  1QIL A;  2EJF C;  2F0W A;  2ZXO A;  3ERQ A;  2NN6 G;  2B2T C;  3HOV B;  2H4O A;  2EE1 A;  5TSS A;  3R2I A;  1C8C A;  3M85 A;  4IUP A;  1KNE A;  2K6A A;  5IOD A;  1Q12 A;  1SE3 A;  1Q1E A;  3TME A;  4K14 A;  1SE4 A;  1LT5 D;  3JAM E;  3H6M A;  3VR3 A;  1T5X D;  4XYO A;  2BDO A;  1BXT A;  1SNP A;  2F4I A;  2F1M A;  1LTB D;  2O2L D;  4C3H G;  1V1O A;  1LTI D;  1U4P A;  1PXU A;  3K6O A;  4FNF A;  2A73 B;  2PW7 A;  4KHZ A;  4EQN A;  1QNK A;  1DON A;  4G7H C;  5A2Q L;  5C0X J;  4HTH A;  4QUF A;  1DOM A;  2L11 A;  4DAY A;  3H09 A;  1KLU D;  2VNU D;  1RDP D;  3NBI A;  3NUC A;  3A8I E;  3GTK B;  1M4V A;  1NUC A;  1ZEQ X;  5M5X B;  3NWS A;  1CT1 D;  3IL8 A;  1GUS A;  1VCI A;  1SYB A;  4C3I G;  2WKD A;  4U68 A;  3K5M A;  4L63 B;  3T51 B;  3DWP A;  1CHQ D;  3J81 L;  2F0L A;  1SE2 A;  5FKA C;  2XN9 C;  1MGS A;  4Z9C B;  1LTS D;  2JA8 B;  3I91 A;  3GTL B;  2A68 D;  2O5I C;  4C3J G;  2HCI A;  4EQP A;  1F2Z A;  2CW0 D;  4DGZ A;  4OO1 H;  4KK7 A;  1TS5 A;  1EEI D;  2HQE A;  5I2Y A;  3BVG A;  5FO8 B;  2KA7 A;  5JVG 3;  2E2D C;  3HG9 A;  3SHL A;  4B9X A;  1V1P B;  5G3L F;  3S1R B;  1IKM A;  3M3Y B;  1FNW A;  2XRS D;  1I50 B;  3S17 B;  3DWA A;  1ZKO A;  2IX3 A;  5CMD A;  3QG1 A;  3OMG A;  3J7Y W;  3BVM A;  5IT9 E;  4PV1 C;  1G2T A;  2D62 A;  1GOZ A;  2NYZ D;  1LV9 A;  2NN6 I;  5JPN C;  3Q23 A;  4TKO B;  2LKV A;  1MBY A;  1FD7 D;  5CV4 A;  1PRT C;  1LAC A;  1BQQ T;  4DXF A;  5G3L D;  2QIL A;  3BDC A;  4DNR B;  2WAQ B;  2A6H D;  1Y8N B;  3ERO A;  3OWE B;  2PMZ B;  1FYC A;  1JOK A;  3GTJ B;  3NQI A;  4A3J B;  5EBC A;  2NUC A;  4Q0F A;  1IW7 C;  1CK1 A;  2EJG C;  2OXP A;  3KLR A;  1IL8 A;  2DNE A;  4ZAI A;  2PCF B;  1TQO A;  4CJ1 B;  4OIK A;  3CRL C;  1DZ1 A;  5KNC A;  3MXU A;  3RLF A;  1S5D D;  1RHP A;  2SNM A;  4BWG B;  3BZD B;  3VA7 A;  2B8G A;  2NZ1 D;  3PUW A;  2TSS A;  3S1Q B;  2OF1 A;  3E0J A;  3HS0 C;  4J1M A;  1EIG A;  1ILQ A;  1C4Q A;  1PFM A;  1OXT A;  2EY1 A;  2SDF A;  1ICW A;  4E6I A;  3OIQ A;  3J80 L;  2D5D A;  1PFN A;  2JYO A;  1G29 1;  3L3O C;  5A2Q E;  1YNJ D;  3GQB A;  3DXJ C;  3NTK A;  4J8Q A;  4L6T B;  3A55 A;  2L0C A;  4S3S A;  1KLG D;  3F2U A;  3M7G A;  3S1N B;  1I4R A;  4B08 A;  4A3I B;  5K36 G;  1EEF D;  4DFA A;  2AWN A;  4ZKC B;  3SR1 A;  3ND8 A;  5COR A;  3MC0 B;  2EY2 A;  4KY6 A;  2F3W A;  2FMC A;  2G9D A;  1XXG A;  3HP3 A;  3GV6 A;  2RQX A;  1KAB A;  3GO5 A;  1L0X B;  4XQJ A;  2NVX B;  2EY6 A;  2AWO A;  2F0D A;  3NP8 A;  2AQ1 B;  4ZK9 B;  1WTP A;  1SNM A;  1E0B A;  2K04 A;  3QIA A;  2EYP A;  2SEB D;  2IL8 A;  2B2Y A;  4XDX A;  1UNS A;  2D2C C;  4FXK C;  5E3F A;  2NTS A;  4FO2 A;  1EOT A;  1G91 A;  4RCN A;  3MWY W;  1JWU D;  1GHK A;  1AFP A;  4Y7N B;  1RD9 D;  3HRZ C;  3HGB A;  2EJM A;  3KK7 A;  5IIF A;  4KD3 A;  2JXM B;  5ISR A;  2WIN B;  4CKB A;  1CFM A;  2N55 A;  4F88 A;  2JE6 I;  1NR2 A;  5BN3 A;  1OXS C;  1FR3 A;  1O7Z A;  5DAU A;  5M5W B;  1MI2 A;  3CQZ B;  1JCK B;  1QB5 D;  2RSN A;  4F87 A;  4FYD A;  2B2U A;  2A68 C;  5A35 A;  3C46 A;  2B2W A;  4ID6 A;  3H3V C;  4ZYS A;  2CW0 C;  2KJX A;  2XWJ B;  2KQ3 A;  2A69 D;  2J4X A;  4KMU C;  1R9T B;  3M7N A;  5DEH A;  4RWS C;  5FO7 B;  5C4J B;  4DNT B;  1A3U A;  2B2U C;  2B2W C;  3S16 B;  1ET9 A;  1OXX K;  3QOL A;  3VR5 A;  5F2D A;  4A3E B;  2LS0 1;  4NW2 A;  4QUC A;  4PMC A;  1JOQ A;  2YU9 B;  5FLX E;  1H9S B;  4IUQ A;  4RH6 A;  1ENA A;  3PMF A;  2BE5 D;  4EGV A;  1S5F D;  4KY7 A;  1TVX A;  2DN8 A;  5M3M B;  1LLR D;  5I2X A;  1SMY D;  2VXW A;  2NVT B;  1B1Z A;  3MXP A;  3M4O B;  1JB3 A;  4MHE A;  5KEE A;  1O7L A;  3GTQ B;  2E2J B;  1JWS D;  3ONA B;  4H0L C;  5JOB A;  1DOK A;  3WDN A;  1JOO A;  2XRQ D;  1EZ6 A;  1SDF A;  1U4R A;  2TMP A;  1LT6 D;  1O7Y A;  3FDT A;  5C6A A;  4M8A A;  1QOH A;  2F0S A;  5JAV A;  2CVR A;  3DMU A;  4UDU C;  3TDQ A;  4QIW B;  3I70 A;  2MP1 A;  3N6R A;  4J6H A;  3PO2 B;  5CYU A;  1V1P A;  3VYR A;  2R7Z B;  3BS1 A;  3HOY B;  2F0Q A;  3Q22 A;  1SSO A;  2RDH A;  3ZYY X;  4KN4 C;  1GJX A;  3EQL C;  1Y8O B;  2A5H A;  2LFN A;  2EOT A;  1G8Z D;  1UEA B;  2F0G A;  1O78 A;  1PTO H;  2CQA A;  1M8A A;  2QCP X;  4XIG S;  5K5P A;  1F9R A;  4X3U A;  3J7A F;  4RAU C;  2Q8I B;  2CHB D;  4FXD A;  3KLS A;  2IJ0 A;  2KEE A;  1JOR A;  1ENF A;  1AN8 A;  1EY6 A;  4IUU A;  3S9W A;  3Q24 A;  1EWH A;  3K5N A;  4PMB A;  1YNJ C;  1J8I A;  2VUM B;  1GHJ A;  2I46 A;  1Y8P B;  4IFD G;  2XSC A;  1ENC A;  1SAP A;  1U9R A;  3DEO A;  2ZXR A;  1YNN D;  2I07 B;  3VYT A;  1IYV A;  3LWE A;  5IGC A;  3VYU A;  4A3F B;  1CM9 A;  3A8K E;  3OPO A;  1DD2 A;  1WTV A;  1BCP B;  2SOB A;  1QE6 A;  4V0B A;  4IQZ A;  5I6Y A;  1I3Q B;  4HMI A;  2WKC A;  1TS2 A;  2BA0 A;  2K1B A;  3U9S A;  2ICE C;  2HDM A;  1OO9 B;  1LTT D;  5EKL A;  3MVV A;  3BYT B;  1LTG D;  4K2L A;  3DM1 A;  3NSW A;  4KJO A;  2PW5 A;  2F0F A;  4HMJ A;  3W2D A;  5M5Y B;  2NTT A;  2MHV A;  2R93 B;  4ILW A;  1AW7 A;  1K83 B;  5C4Z A;  4DXG A;  2DY7 A;  4CBV A;  1R4P B;  5J22 A;  3D4W A;  3D6C A;  2F0K A;  5JEA G;  4XQN A;  1F2Y A;  2X6G A;  3D3R A;  5C3E B;  1I6V C;  2HDL A;  4OHJ A;  1SYD A;  3AMU A;  1DJR D;  2IT1 A;  2F0I A;  1AZQ A;  2MJ8 A;  5CV7 A;  2EVB A;  1TY2 A;  3IFD A;  5KRU A;  1QWY A;  5M3F B;  4RHR A;  2EYJ A;  1WD1 A;  3E6Z X;  1Q8I A;  1EY9 A;  1IYU A;  3TN2 A;  3BG3 A;  4KN7 C;  5CV9 A;  5LHY 1;  1OXV A;  2Q8R E;  3T13 A;  1HTP A;  3K7A B;  4RGN A;  3VR4 A;  3TZU A;  4CJ2 C;  1LTR D;  1WTQ A;  3K57 A;  4QMG A;  1F2L A;  2A69 C;  2F3V A;  2LMC B;  1B3A A;  4G4K A;  1S5B D;  1EYC A;  2VB3 X;  5J1Z A;  1BF4 A;  5KGU A;  1PMR A;  3W3A A;  4A93 B;  3RUZ A;  4M1U B;  1BCP D;  1EY7 A;  1XWE A;  3EJI A;  4A3M B;  4GZY C;  1I4X A;  5K36 H;  2L4N A;  1BOS A;  4CJ0 B;  1CI3 M;  2F0H A;  4H7B A;  1HUM A;  4IFD I;  1F77 A;  1ILP A;  2Z1C A;  1TWG B;  2Q8T A;  1R4Q B;  5I9O A;  1PTO B;  4BA1 I;  4C3J B;  3A54 A;  1EY5 A;  2PZT A;  3C3L A;  1A3V A;  2EXZ A;  1TWF B;  1SMY C;  1RKN A;  1X3Q A;  2KUM A;  3LWU A;  4DAP A;  1CA6 A;  3L7Z C;  1B44 D;  2WV6 D;  3S2D B;  1Z6H A;  1V8Q A;  3NPP A;  1Y1W B;  3IFT A;  4O1N A;  2B2V C;  2J7Z A;  3LNN A;  1B9N A;  2AQ2 B;  1HA6 A;  2FJ2 A;  2K01 A;  5CV8 A;  5CV6 A;  4IUN A;  3BDL A;  2F0P A;  4MN3 A;  3PV0 A;  3OSO A;  1Q90 A;  2EYH A;  3J7A V;  1SNC A;  1D5Z C;  2B39 A;  4LJZ C;  4ULL A;  3CKI B;  1TII D;  3PUV A;  4IUV A;  4X3T A;  5C3W A;  4EQO A;  1KDB A;  2NBF A;  2ZT9 C;  2E2H B;  2R6G A;  4BA2 I;  1SND A;  2EY5 A;  2EYL A;  3D6W A;  2X6L A;  2XWB B;  4ZRZ A;  3I4N B;  1STH A;  4K5V A;  2EYM A;  4A3B B;  1PTO D;  2JP1 A;  4ZUI A;  3WOE A;  3VYS A;  1EQV A;  4XXE A;  3BDO A;  1HQM C;  2YYZ A;  1TS4 A;  1YNN C;  4CKC A;  4JBW A;  3MXG A;  1BO0 A;  3C1F A;  1CQV A;  2ICI A;  1HA5 A;  1GUW A;  2L9H A;  2DNC A;  4TQU S;  3L9A X;  3CHB D;  1BDO A;  2XVS A;  4EVO A;  3NQT A;  2F0N A;  3RMH A;  4BBR B;  5JVH 3;  3NWT A;  3VR2 A;  2QKI C;  4KKS A;  3SDZ A;  1A15 A;  3T4A C;  1F9S A;  5KIX A;  2F03 A;  3J81 E;  5IGE A;  1B53 A;  1RTO A;  1E2W A;  1STE A;  4CKE A;  1TS3 A;  1TWH B;  1XX8 A;  1ZYR D;  1WTX A;  1D6E C;  1FNV A;  4C1N I;  2BCO A;  1AZP A;  4P2C B;  1W6J A;  3RZO B;  3OHX C;  3HOU B;  2K03 A;  3HZX A;  1F9Q A;  3T56 B;  2PPB C;  4HCE A;  1VMC A;  1BBX C;  1WD0 A;  2K7V A;  1HCZ A;  2IPK D;  3HOX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...