2XVZA

Cobalt chelatase cbik (periplasmatic) from desulvobrio vulgaris hildenborough (co-crystallized with cobalt)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
AQKTGILLVAFGTSVEEARPALDKMGDRVRAAHPDIPVRWAYTAKMIRAKLRAEGIAAPSPAEALAGMAEEGFTHVAVQSLHTIPGEEFHGLLETAHAFQGLPKGLTRVSVGLPLIGTTADAEAVAEALVASLPADRKPGEPVVFMGHGTPHPADICYPGLQYYLWRLDPDLLVGTVEGSPSFDNVMAELDVRKAKRVWLMPLMAVAGDHARNDMAGDEDDSWTSQLARRGIEAKPVLHGTAESDAVAAIWLRHLDDALARLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution in a Family of Chelatases Facilitated by the Introduction of Active Site Asymmetry and Protein Oligomerization.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
molecule keywords CHELATASE, PUTATIVE
total genus 98
structure length 263
sequence length 263
ec nomenclature ec 4.99.1.3: Sirohydrochlorin cobaltochelatase.
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06180 CbiK Cobalt chelatase (CbiK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xvzA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xvzA02
2JH3A 2QD3A 1L8XA 2QD1A 1HRKA 4KLCA 1QGOA 1LD3A 2QD2A 1N0IA 3HCPA 3W1WA 2AC2A 2H1WA 2XWQA 1DOZA 2C8JA 3HCRA 3M4ZA 4CCSA 2Q2OA 2PO5A 2DJ5A 1TJNA 2HREA 2XVXA 2HK6A 2AC4A 2QD5A 2HRCA 1LBQA 2Q2NA 1C1HA 3GOQA 2PNJA 4F4DA 2H1VA 2XWPA 4KLRA 2XVZA 4KMMA 2XWSA 1AK1A 3HCOA 4MK4A 1C9EA 2QD4A 2XVYA 3HCNA 3LYHA 2Q3JA 4KLAA 3AQIA 2PO7A
chains in the Genus database with same CATH superfamily
1JI3A 5EJMA 3WYGA 1TKCA 3N2NA 3OZUA 5LIPA 1G5FA 1E6EA 4QEDA 3FPGA 4GL2A 5AW0A 4HAUA 2XMRA 1IDN1 4GSKA 1P7VA 3A4NA 4UZSA 3QTLA 3GLHA 1P7ZA 3E4CA 5JNRA 5DP2A 5HIIA 4GL4A 3P7MA 1UPUA 3EK2A 3NV7A 1WPXA 3A6KA 1NQUA 3DV2A 3FZNA 2HB6A 3H8SA 1DBRA 4FNAA 4WY8A 4WL0A 5HA5A 3NBAA 5ICFA 1EB9A 2ZYUX 3DHYA 3RSGA 1ODJA 2VT7A 3WLNA 1KYTA 2V4MA 2X86A 3PTLA 4KQFA 1FLNA 3ZK8A 1CHDA 1TJ5A 2ZTUA 1GTL1 4NBSA 1EM8B 3D2BA 1EK6A 1C81A 2P8JA 3OX4A 3NJ4A 4HGOA 4NONA 4BGEA 5JG7A 1U3CA 5KEIA 4F2WA 5KWJA 1OH8A 4YGXB 2AJTA 1EVYA 3BN3A 1F2TB 2VI5A 3PRYA 3AEKA 3ETJA 4J91A 3KXLA 4M55A 4N5NA 1S2LA 3W6ZA 3QEBZ 1NFFA 3WGQA 1IAVA 4GR4A 1DMSA 1E0AA 4II3A 2DBYA 3G2JA 2H2WA 8ABPA 4AG3A 4JJ4A 3PQ2A 2QTHA 3HJTA 1ZRHA 1FXSA 1HE8B 1FP4A 2W11A 4L8FA 4HWKA 1GPAA 3SFVA 4YJ2F 4J0GA 1B6GA 2PU7A 3C15C 3IKMB 3TJMA 2ZBVA 3PHJA 4IV8A 4GOXA 4R98A 4Y0VA 1EP2B 5A9SB 2I8AA 5FAXA 5LYYA 3SJUA 4BVHA 5BMVF 1VI5A 3VXKA 3GEEA 5KTPA 4BVLA 3QMPA 2QEQA 4HJRA 4DMHA 5LQJA 4E3ZA 1ZMXA 3O90A 3T4XA 1TYAE 2NGRA 4Y1EA 1VBKA 4S2EA 1SELA 5HSGA 3IALA 4MYSA 1SXJA 1Z37A 3SBDA 4FXOA 2GEKA 2OO5C 2YIJA 5AJVB 5ITWA 1DUIA 1Z2CA 2WT9A 2VHQA 4RD4A 2WF7A 5JMOA 2H9AA 2ZE6A 1RTTA 5BSHA 2CB9A 3WSWA 5KC8A 1MJ5A 2J3MA 3FRHA 3RYCA 2XT9A 2GN2A 3PGMA 1LK7A 3T3EA 2CNOA 1U3VA 3NPAA 3VU9B 3Q6NA 4D82A 2PUHA 1TQ6A 3K4PA 5G40A 5DSTA 5EE5B 1AE1A 1FF9A 3AW9A 1FDWA 4M7WA 1V7CA 2J33A 1Y63A 2PZEA 3CF0A 2D2XA 2OUIA 1ZM3A 4ZXFA 5G0TA 5J5AA 2I2BA 3KUUA 4GX5A 4WW0A 3T12A 3RLIA 5T4BA 3ETCA 3QMMA 1KIMA 1NJSA 1HGXA 3HCPA 4H6WA 3W1WA 4HQ0A 1JDTA 5AHKA 2ZAOA 4H1WA 1TLLA 1T8SA 2G77B 2OFOA 5CDFA 2LRHA 1T2EA 1X9HA 2RK4A 3RF6A 3DR5A 3H3FA 3HRIA 1JDPA 1CF9A 2W42A 3PX7A 4NBTA 1T5IA 2I78A 1YFZA 1C29B 1UZLA 1GTVA 1GADO 2AVNA 1XZLA 4QHTA 3I72A 3BKXA 3BXOA 1K3TA 3Q72A 4O4HA 1YWGO 2F64A 2ZI5A 4LXUA 1LX6A 1M5TA 1BMFA 1JIKA 1SD5A 4MGEA 3TFWA 5C1DA 2VHUA 3QPVA 3N2YA 3RKUA 4BS9A 5P8WA 4CIYA 1KF0A 1YOVA 4LHXA 3NCTA 1TZJA 2COKA 2GCOB 3IQEA 3NKLA 1FQWA 2P9QA 3LOPA 2WJZB 3WLMA 1A7AA 3AJ9A 1QU2A 4PG6A 3C45A 1QWOA 2W8BB 1W76A 2VZ9A 4NCXA 3N8DA 4ZAYA 2VQDA 4I50B 2AZXA 1CDZA 2H5LA 2ZS7A 3WXBA 3TN7A 3IUJA 2V5UA 4YV0A 2ZP1A 1CQZA 3GXBA 4RC9A 4W1QA 1LEHA 1U80A 1VSBA 1AQJA 1P5ZB 1G8JA 1VKJA 5DE3A 3GX1A 3L05A 5EP1A 3AKEA 2W2VA 2B1IA 3CA8A 1I33A 4K1LA 3O0TA 2AX3A 3EG9B 1L7VC 3DZBA 4YJFB 3Q12A 3AEQA 4YRTA 3ZBUA 3BCHA 4BYGA 4OK6A 5MGBA 5KYTA 5E6SB 3PP8A 3D6FA 3OZVA 3PT9A 2PZ8A 2OBYA 4RPCA 3KQLA 3DAHA 4Q9KA 1SUBA 3QPAA 4MW4A 1W0CA 4ID9A 1KTVA 1PZEA 4YRFA 1T6ZA 1Y1PA 4R2KA 5TIIA 1E0JA 4BFCA 4K7JA 3S2EA 5I4IA 3QUAA 3IVAA 3I6MA 4YYEA 1ECCA 1PZHA 2JW5A 4PCAA 4LZZA 4M9UA 5G3ZA 2FQXA 1OGYA 2D00A 2H2IA 4D79A 1SHUX 4IHQA 3CZRA 1Z73A 5DW3A 2VUTA 4P84A 2QX4A 1T0JB 3GZNB 3HJGA 2QXTA 3MOSA 4W9MC 1FPMA 2ACEA 3FBWA 4N3NA 4RF3A 2KMLA 4MLDA 3U4IA 3I12A 3X1DA 3LUPA 2JRCA 2BAGA 3OQPA 3ZWOA 5C8YF 1Y4DE 4HDSA 1TA9A 1YI1A 4E5PA 1ULBA 1HSZA 3E2PA 4G23A 4Q3BA 4Q4DA 1QP4A 3L92A 2FSIA 3SXPA 4QYMA 2PZJA 3PFWO 5DYIA 1TD9A 4MYRA 5CRIA 5I4KA 3AF3A 1IHUA 1VFPA 2R2AA 1U1FA 1JL3A 3CPEA 3FFAA 3B9PA 3PHIA 1SCUB 4Z4QA 1XDSA 3WLKX 3PKJA 5BSWA 1BQ4A 3PWSA 4WECA 1YC2A 4YLGA 2GUGA 1RYZA 2YL2A 2V6MA 4BJ5A 5JATA 1BRMA 2YRWA 3DE2X 3OQMA 2AE1A 2XGMA 2QTMA 1WHSA 3LFTA 1DQNA 2VJPA 5BN5A 1ENYA 4ZOLF 5K0EA 3W6OA 4S24A 1OZ0A 2MYNA 3QEOA 1DAIA 3EAFA 1E7WA 1GPUA 4KTVE 3ROXA 1R4AA 1UBLS 2RCNA 3AV0B 5HF6A 4F4UA 3LLMA 4F84A 4RANA 1ADGA 2OBFA 3M5WA 4C05A 4Q7JB 2ZIVB 1FDIA 4QUGA 4EI7A 3U61B 2B7BA 3NP9A 4A2PA 5EJFA 5L95A 4HBZA 1DDOA 2WB4A 3H84A 2G1KA 2PWBA 5KVVA 1IY2A 2V0CA 3M9LA 2EFHB 4UW9A 4PRYA 4V2UA 2NTVA 3LCVB 3P2MA 1GTZA 5HE9A 5HKLA 1CT9A 1N77A 2BFFA 3VBCA 3WLEA 3LT5A 4YRLA 3RSHA 4CCAA 1DBVO 4D3FA 3K8OE 2WWGA 3ANXA 2H8KA 1DQSA 1RAGA 3ONWA 4L15A 4NCKA 3NTXA 3NLLA 5DN9A 3X3HA 1DKMA 1ABEA 1XD8A 4QPNA 3ZYZA 3GAAA 3EOBI 3ER6A 3AHDA 3KQHA 3A06A 1LSUA 5EWJA 4MS1A 1EZZA 2GN4A 4P58A 3ZWAA 4S1OA 1QS0B 4RL4A 4ZYYA 1NJ8A 3X2FA 2CDBA 1NU8A 1H2XA 1W0JD 1IPEA 2OXEA 3JALA 4B6RA 1SXGA 1M6VB 3CR3C 4RM2A 4TTVA 3G89A 3S40A 5KU7A 1Y8RA 2M6RA 1OGJA 4MUJA 2VRNA 3ZHVA 2CJYA 2G8LA 1OXVA 4R4JA 1MV8A 3AL0C 1ZWLA 1BKSB 4TKUB 1DKOA 3KYBA 3ZNPA 2QZJA 2O07A 1ONBA 1QSGA 2HSJA 2P4HX 3V1MA 1VI6A 2LCFA 1KS9A 1QYXA 4B45A 1N2OA 2NTYC 3ND6A 5A0TA 3L4BA 4ZCQA 2UYQA 2VRCA 3LQ4A 4HNTA 2RGNA 4CMIB 1QCYA 3DPIA 5A9SA 3F7TA 1ZONA 1Q0PA 3UBMA 1CZUA 4NJMB 1NXOA 1PFUA 4JLDA 1BMTA 1MVOA 3C3XA 3IDSA 1GTRA 2BP7B 1JE1A 1QHNA 2OV2A 3C3KA 4B75A 1F7UA 4YCSA 1W93A 1ZJYA 2XOXA 3G0OA 1K6EA 3V6MA 4FDLA 1YNSA 2CLHB 1QFXA 3W78A 4N5LA 1AN0A 4M0EA 3QUBA 1LGYA 1GTSA 3MUEA 3E53A 4MWSA 2XCLA 3AUUA 1KU6A 3C85A 5DT9A 1MEJA 3KKNA 5BW4A 1X7WA 1TADA 2ZM6B 2VAMA 1DI0A 2HC9A 3ZCPA 3HADA 4L9RA 4YYZA 2FPWA 2V55B 4TT3A 1DG3A 3KSZO 4Y1RB 3WBKA 1XRRA 4DLXA 4DUZB 2AV6A 4HXEB 1NE7A 1EZ1A 3U49A 5EAIA 3DO5A 1BD3A 1O89A 1WUYA 4NPCA 2G4CA 3U4HA 2JVIA 2LBPA 2NXCA 2X6TA 3UG6A 2ZCJA 3VYSB 5B2FA 1P75A 4QUAA 3ZIAA 3QITA 4F5DA 2OB2A 1YZVA 3GFSA 4RY8A 3IH5A 3TLKA 2GN9A 4E11A 3O8OA 1FTSA 3G6KA 2FF7A 4H60A 4K28A 1T8YA 5IASA 1BFDA 1U7PA 1AIPA 2YWHA 3DEIA 4MR7B 3K30A 1U2SA 2RGUA 2REBA 1VG8A 4AZWA 4R1NA 4QYIB 2YMLA 1V0JA 3ESBA 3KYCB 2OHFA 1BXRB 3G9UA 3CWQA 2FWMX 4FNGA 4IVQA 4TX1A 3PFKA 4RF4A 1BJRE 4RIFA 1XV5A 2C2BA 5BORA 1EE9A 1KVSA 3SSNA 4JOSA 1QHFA 2CLKB 3KD3A 3N58A 4EMUA 2VQFB 4D4MA 3PDHA 1CERA 2B8NA 3BD7A 3L0OA 4MRNA 3R7DA 5AW2A 2ZAIA 1MDFA 1L7NA 1WMAA 3KEMA 3KX2A 3Q9LA 3D6UA 4I4TF 1IL0A 1VP3A 1LPPA 4ZVNA 5BW5A 3GNSA 2DTEA 3JX9A 3Q2IA 3L7YA 1PQPA 2IV3A 3TE7A 4CXMA 3DV0A 3OLXA 4R9SA 1FRFS 4U2FA 4MROA 2F3SA 1IULA 3UCXA 1SULA 4AN0A 1O6ZA 4Z4IA 2AKAB 1KWGA 3MIIA 3EGEA 3OIWA 4UE3S 4AN1A 5LSAA 4I36A 4Z4GA 1MPTA 1PJZA 1IM8A 1YDHA 2VNAA 3VO2A 1XD9A 4DV4B 3ZGYA 4BJ3A 1F8UA 1KKLA 1BNCA 4LRTB 5IZCA 3OKCA 5JNUA 3CEHA 5FOWA 3UNXA 1V5WA 2R47A 4MK4A 5FPKA 1R5BA 3VHRA 1J8VA 4IIFA 5C18A 2IS2A 1NG9A 3MTBA 3K16A 3FPSA 5BVGB 5F33A 3UW1A 5JXGA 4MEAA 2MINB 2V9CA 4H77A 4LRSB 4UUNA 5DV9A 6YASA 1S1MA 3U6BA 4P3XA 3SC4A 3N74A 3FSGD 2FK8A 2Q1YA 3IJPA 4PYKA 1DKRA 1L4BA 2C9OA 1V8OA 2QD5A 2NO0A 2Y99A 1JLLB 3FUXA 4URUR 1EK0A 1C4WA 4DLUA 4DKXA 2OECA 3ICCA 4OQEA 3T15A 2C84A 5K99A 1BE1A 3MINA 4JX8A 3O7MA 2I6FA 4BZQA 2PCLA 3MRTA 2OTCA 2WTBA 2WMOB 1S2IA 2Q6TA 1D9ZA 4C29A 2P1DA 4EX6A 3FWPA 4K6HA 3FMGA 2XA9A 5DWDA 5AM3A 5FEUA 1HOTA 6ADHA 4QPZA 3ET4A 5HXAA 3LT4A 4XXHA 3UJ6A 2V3CC 1OR8A 4DXDA 4AP5A 4JS0A 1NRIA 4BLTA 1E9EA 1OYWA 2BMJA 1NVMB 2Q07A 4P0TA 4R1SA 3ESAA 3ELWA 4H15A 2QHXA 2QJOA 4HS4A 3PLNA 3PJGA 3OPYB 2OO5A 2XT0A 5A4DA 2ZLBA 1H2BA 1RWBA 1D2MA 3W2GA 3LH5A 3KJZA 1NI3A 1UM8A 3X1XA 5IBQA 4AJEA 3N7TA 1OC2A 1OFGA 2AHRA 1UBCA 2BFNA 5BW6B 1WZNA 1N7IA 4I7EA 3EGDA 2Q1UA 1ACMA 1KYYA 1JJAA 2G0TA 4LJ5A 4Z6KA 4BP1A 2GO7A 3ITKA 1K6MA 2JB9A 1LVHA 2IPNA 2Q7OE 4KN8A 1RHQA 2H7YA 4JLVA 4PGFA 4A91A 4KQMA 5IARA 1NJ5A 5AUPB 3PK0A 4OFZA 4KQ6A 3PXAA 4XVUA 1JPNA 1SEPA 1IZZA 2IY7A 2ZBEA 4G5RA 4MGHA 4NBNA 1C8BA 1J6UA 4TWJA 2ZJZA 3A28A 3KNZA 4G56A 4B83A 2O59A 1Z2EA 3CRMA 5AJUA 1VE3A 1CZNA 1DIAA 1U2GA 2ZE5A 4LF4B 4ZREA 5KYUB 4K88A 4CI0B 3U26A 1OTHA 4EQ6A 4I5FA 4PTZA 4LVCA 1TLFA 4F7WA 1GGNA 5F3WB 5B1SA 3FVWA 4M8KA 4K9RA 2J9GA 1XXHA 2CK3A 4GP7A 5K0CA 1RHJA 2A9PA 2O14A 3D0QA 4YBRA 4RK4A 3DG9A 2OBXA 1FE8A 2CW5A 3CX3A 1FNBA 3HNRA 3GPIA 3WKDA 3GEGA 2B1RA 2UUCB 2X7HA 3FKQA 3IR5A 4BFZA 4DA9A 3G2NA 3IV7A 1ZVQA 3VM6A 3AHIA 3UMYA 1CHNA 1OTYA 4UTRA 1YQEA 4NZ9A 1CR4A 1K66A 1YBFA 4M0DA 2JGDB 4YJHB 5JZ9A 4UBIA 4IPTA 1XRNA 2FWPA 5B36A 1C41A 2OOSA 2W6IA 2YVAA 1YQDA 2Q9AA 5BUSA 1B8UA 2UYOA 4ND5A 2JJ2D 3BXFA 2X4DA 4PHGA 2MJLA 1W0KA 3DL4A 2WF8A 5JY1A 3F7OA 1W4LA 2DBRA 2V5VA 1NI5A 2Y05A 4EAQA 3CS3A 1P19A 5F5LA 2NVWA 3VI4B 4Z4FA 3OPNA 4B81A 1H5QA 1I30A 3SBEA 4BEWA 3FTCA 1KAHA 4KQ9A 4BNIA 4MI6A 3R7NA 1FSSA 4H08A 2C7GA 2ZUWA 3H7IA 1GG9A 4HAWA 2W6ZA 3VC7A 1SK9A 2WUFA 4JN6B 4NCIA 4E21A 5IKEA 4WNCA 5JZBA 1QHIA 1SUEA 2O7QA 4G89A 4ETNA 2A3NA 4F93B 4GBMA 4FWBA 4O4HB 4CEIA 4IV5A 2CNDA 3MCAA 5EPOA 3E70C 3N1UA 1C9MA 2N47A 4H6XA 4DC1A 2I71A 5AXAA 3A6HA 5HZGA 1QP7A 3PFHA 1ZCJA 3B6EA 5JZVA 1Z3CA 3J7AC 4H17A 4KXVA 3T8YA 4WJLA 1V5IA 3OIUA 3PJDA 1GL3A 3UHPA 4DLZA 1E7QA 4CDMA 1FJHA 1ZXXA 4ZI7B 2B35A 2C88A 3TH5A 5DM60 5J1SB 2B4RO 2R6GA 3ESXA 4EEKA 3TZKA 2NT4A 3CHYA 3U9LA 4J76A 4UVDA 4MGZR 1QM5A 3LECA 4M98A 4MNTA 1UKEA 1CJCA 1VL1A 4EMTA 2GFIA 1HNZB 1NVKA 5AK4A 2G4LA 3RYFB 3RYHA 3ZH9B 2O2YA 2OG1A 1HDGO 1PS0A 3B82A 3KT6A 1M34B 3MJVA 2VEOA 3K5HA 2W6QA 1QIIA 3H1BA 1P72A 1PUJA 1V1MA 4ND1A 5AHOA 5JV5A 2I2FA 2B4QA 3H4VA 2X4LA 2OZPA 4DMRA 1HQCA 4RHFA 5FLEX 4KWCA 3PL1A 1QKIA 3HB1A 1M76A 2NTJA 2X4IA 3L1KA 1GA1A 4MINA 5AJTA 3S6JA 5BO5A 4WBNB 4UTVA 1GDHA 2A4MA 1XZMA 2BY4A 2YDXA 3FYDA 4EIWA 5IULC 4P4TA 1XEWX 3ZWVA 3BL8A 4D42A 2QRVA 3V32A 2CT8A 2HIHA 1J8DA 1QIMA 3JQ7B 2OGUA 4HAXA 5EIWA 3FNRA 3VR3A 3QX8A 4ETMA 2QPAA 3IR7A 1ZD1A 4MEJA 5CD9A 2JFWA 4KPFC 4G26A 1GAJA 5AXDA 4XJXA 3ZVLA 3ZZNA 1LNSA 3JWEA 4AICA 2VH5R 4IH9A 2IHYA 2AK3A 3SDZA 4EG5A 1Q77A 3VOTA 1JFTA 1JU3A 3IOBA 1OXMA 3RC8A 3I62A 4KQWA 2W00A 4BGDA 3DT6A 5I9SA 1RLUA 5SZJA 1O95A 1V1RB 4EG6A 1JYSA 1H0HA 3OEED 1I3MA 3GFTA 4B79A 3FNHA 1X80B 5C1IA 3U7EB 4MDFA 3R3JA 1MA3A 4EG8A 4F3YA 1TPYA 2GHIA 2DWPA 2IYFA 5C46F 4B3DA 3D7KA 3WYDA 1SU4A 1V11A 1H3FA 3UBTA 3DC7A 3QWBA 5BNWA 1O57A 1WMEA 1SUIA 3RSSA 1DTWA 3EAQA 3ENQA 4UE2A 1GLVA 1WMDA 3H42B 1D04A 5AKZA 2J4FA 2QUIA 1AUXA 3OPYA 1PWYE 4JELA 2IODA 4E5UA 5F23A 1Z6XA 1BW9B 1RLMA 5DGCA 2XIQA 4E5KA 1XNRB 1L7PA 3FUWA 3QKRB 5ERGB 4BDSA 2GKOA 3I6IA 2YHSA 1TVKB 5JPCA 4LDZA 1A1SA 4OI4A 1S89A 4OHKA 5A3VA 4IVPA 1LK5A 3ROPA 3A1SA 4NV1A 2FZVA 4I2NA 1ZMOA 1SHTX 1UAYA 3Q3GE 5IU6A 3KCQA 1Y8ZA 2IQIA 3LZ6A 4X0EA 5DNVA 4LOKA 3MMNA 3UB3A 1MRZA 1NUUA 4UQOA 1ZGGA 5I48A 1PFGA 1WW2A 2JAUA 3LQ1A 1Q0LA 2VNKA 1NLFA 4B6OA 4X85A 1FJGB 3L6BA 2BRUC 5JCPA 3ELYA 5UKDA 2JFZA 1F8GA 3D5QA 4PG7A 3AUYA 5LQSA 2FUNB 4CLHA 5IDWA 3Q2OA 4TTPA 4L5BA 5IHXA 1XCJA 5LYJF 4KIGA 4FE3A 1NP7A 4DCOA 1E8NA 1ZJ5A 4MQUA 4MMYB 3IVRA 4RSHA 3HVIA 4NG4A 4X8OA 1RM4A 4JR1A 3THWA 1WNFA 1RRGA 4FZ3A 4PAGA 2BFPA 3PUVA 2EQ5A 3MT9A 1BHQ1 1M8FA 1XTKA 3RADC 5JJCA 1XLTA 3S81A 3A04A 4IO1A 3ASUA 5KJEA 4WZZA 2YICA 3H9UA 5K5EA 3TG2A 1HRDA 2B2NA 2AZ4A 3P0IA 4O59O 3TZEA 2B3DA 4WINA 4OMDA 1W85B 4YP9A 2VP3A 1W5BA 2GO1A 4IDGA 2DPYA 1NQ5A 3G82C 3BDIA 4A10A 1E92A 1XG5A 1XWFA 3GLHE 3C6YA 4Q01A 1KZ4A 5F1YA 1FSFA 3DZJA 3PCTA 2CDAA 2JFYA 1LPOA 2AFIB 3FY4A 1O87A 2FHSA 4GR9A 2IBSA 2VXCA 4BUZA 1H69A 1N2ZA 2FPGA 3LCJA 4CM3A 2UU9B 4D98A 4AYXA 3MZ0A 1G8MA 1QGZA 3ANTA 3FCXA 1Z8NA 2ZVDA 3N70A 4MGYR 3SJBA 3TW6A 4B4UA 5B6JA 5IKXA 3ORQA 5TVKA 3L7DA 2C3MA 2PWPA 1VHWA 2B69A 1E3EA 1TMYA 1LKZA 4C0WA 5ABPA 5KOHB 1BXRA 3GYGA 4N5IX 3LQRA 3NV9A 4TZKA 3OCCA 4A2QA 1EE2A 3NUQA 4UAVA 2CLMB 3HB4X 5DMXA 4HDKB 1UKAA 2PUTA 5CXSA 5IM4A 2DUNA 5JCJD 5LOVF 1R00A 2EZ9A 2XB6A 3NRCA 3PENA 3QQPA 2RHBA 4DCTA 3R4VA 2O5CA 4H31A 5A06A 3HNPA 1PJTA 4PQRA 3K0CA 1RQLA 5EKXA 3O8OB 1A8IA 3N07A 2PEYA 1D4ZA 1X8LA 3NBXX 4RVHA 4G01B 2RK6A 3QRWA 4I1VA 3CT4A 3SVZA 3WRWA 2QRLA 4A2CA 4HAIA 4IWYA 5IYZA 3QVVA 5HEKA 2VN8A 5IT0A 1V8BA 1XKQA 3ZS9A 4QDZA 1FQOA 2F67A 1AY0A 3SEZA 4DF3A 1UBNA 2BF4A 3UJBA 4XRGA 1UK9A 4LI0A 5DO9A 3AEQB 2IUEA 1HORA 2RHOA 2ZB3A 3GA0A 4M22A 3STXA 5C7YA 4D3SA 5EJEA 1ODSA 5FPQA 1JIIA 5E6RA 1NFQA 3PR3A 2WNIA 4OFWA 3OO1A 1RPNA 5K3OA 1QRUA 1DL5A 2CZGA 5KREA 3EPHA 1AVTA 2RJNA 1P6QA 2H1VA 2UVPB 4NAVA 4MPTA 5BSVA 1DHRA 2FDXA 3QBTA 4FLMA 4PC1A 3ER8A 3ZOKA 2IEBA 2HWWA 1XKXA 1YDMA 2OM6A 2QNBA 4B73A 3ENKA 3I58A 4CM1A 3G8DA 4YPVA 5AVTA 2CKDA 3P71T 3JQAB 3LBYA 3RUIA 4EA8A 6PFKA 2PPVA 2YBDA 1HH4A 2CXUA 4BMVA 1KTIA 1ISIA 3EXHB 4H9GA 3DBIA 1DBIA 4MJXA 5ERYA 5ALXA 1UKZA 1A71A 1YZNA 1TTQB 3F9RA 4RHTA 1TK3A 3K0FA 4JEHA 2UZ1A 1USKA 4ZQHA 4D43A 1SCBA 2AEJA 2I7DA 4U8HA 2GOYA 4DZTA 2CSUA 3GN2A 4DYHA 1HT3A 4LJLA 3ZDRA 1PV1A 3CGWA 3Q8MA 3WBJA 4X1KB 4LHEA 4ENWA 2FZKA 2WKSA 3L1VA 1NBAA 2G80A 4UREA 1IIBA 4GW3A 1BE6A 1T2AA 4CLOA 1AGPA 4OYHA 4CMBA 3PC6A 5CFRA 4FFNA 3FRIA 1VLMA 2LXNA 2CKMA 1L4YA 1GYPA 3LUHA 2ZJ4A 4QFMA 5CD1A 1KQFA 2NV2B 1LJLA 5B1DA 1N32B 1WXGA 3DO8A 4X8MA 4DRYA 2TYSB 1NA5A 3DB1A 1JQDA 2JCGA 1PJLA 2WNHA 3MUOA 2WQZA 2FLKA 4QOGA 4U8GA 5E4FA 4GYYA 4JC4A 1JR3E 3T7DA 2I29A 2Q2OA 1JHRA 4P35A 2HUNA 2ZIZA 2XMPA 2QUHA 1T8WA 2XQGA 4RQBA 5JLJA 3INTA 2OZKA 2Y0PA 4UUAA 1Z7WA 1MN6A 4GRAA 4U7GA 3AR7A 2MWMA 1YUNA 2R60A 4YQZA 5EJ7A 1FVOA 4AC9A 1QDLB 2VK2A 3ILHA 2P6PA 4Z9YA 1N2SA 2ZVQX 1E6LA 4GWGA 4YS6A 3KB2A 5IC6A 1N2EA 3UOGA 3AU9A 3MJRA 4ZA2A 3PDIB 4YN3A 4J29A 4PYNA 4QTZA 2MMGA 4RS4A 2QTRA 4H16A 5KKNB 4P7FA 4KXFB 4OM8A 3OIDA 2HQBA 1IMJA 2WEKA 2ACVA 1OIVA 1UM9A 2LZ0A 4DCMA 2FN7A 3LQFA 1Z2DA 5JHGB 3OEHD 3CQ9A 1Z6YA 1FDOA 3CCBA 5ED0A 4I08A 5DWVA 1IN5A 2FYTA 1BSVA 3J81k 2ANCA 4ADSG 2VTEA 3T5CA 3O1HB 3ROKA 2IT1A 1F5SA 2JPDA 3QXGA 3NU1A 3ZYCA 4O33A 1VTKA 1H2EA 2DTDA 1X2BA 2JJMA 2Z3WA 2GBLA 3OC6A 2PH1A 4HNAA 3H3JA 2RGYA 2WM3A 2A14A 1Q3KA 3LT0A 4E3WA 1COZA 2HCRA 4OP1A 4GMGA 4OJNA 4RMGA 4UOQA 4BNWA 4YCMA 2FK7A 4ROTA 3K96A 1R16A 4EYQA 1RYNA 4NYMR 3NI2A 3G2MA 2ZXFA 4NBUA 1U0GA 2D5LA 3WGYA 4D26A 2ZBPA 3LVRE 4LY9A 3AOGA 1PEAA 1L1FA 4WBNF 2YV1A 3O82A 1JZQA 1H1TA 1ZI8A 2JGIA 4MQ4A 4UTXA 5A7HA 3ZI7A 2D1FA 2JGEA 2Y1DA 3D6AA 1RVV1 2FU5C 4G5GA 3D6NB 4JLSA 4AJOA 4OGWA 4QGSA 3WK7A 4IXTA 3DXZA 4RO0A 3C5CA 2PD6A 1XEXA 2XAUA 3U80A 1MX3A 4X84A 3L0PA 5TXGA 2PKXA 3RU7A 4D9EA 4ZYLA 3IQWA 4R5MA 4R83A 4EF5A 1MENA 4ZJUA 2G7ZA 1HZZA 3OZBA 3K70D 3ZH2A 3STVA 1DOHA 1OBOA 3AF1A 4YASA 4ZOAA 1LQ2A 1I3NA 1U7WA 1USUA 1K88A 2VRWA 4IFTA 4KCGA 2Y1KA 4R8RA 1I4OA 3D8HA 2EZTA 2GF9A 2NO1A 2R6DA 4RMNA 4S1VA 3ZN2A 1JTEA 3AWIA 3OZTA 4QEZA 3KLOA 2XGGA 3ENZA 4RWEA 4D25A 1RJWA 3QMWA 4QT0A 1KFKB 1XD2B 1B1CA 1RM5A 1VGRA 2FPSA 1BE0A 3GLRA 4GYWA 2AMFA 4ZVOA 5KCMA 2IF2A 4G0YA 4X1IB 4C4OA 4GE0A 1K8XB 2D2FA 1VJRA 2J9ZB 4M46A 3T7RA 2HSZA 5JDIA 4ZZ2A 3PA6A 1AXEA 2FQYA 5IDVA 1FZTA 4JJEA 4RHXA 1XMSA 1JDBB 1ZKDA 2V98A 2O0HA 4GH5A 1N4AA 1PO7A 2DECA 1JV2B 3BDAA 3WIDA 4K6OA 3NNSA 1GVHA 1F3LA 3IV6A 5BYJA 3RVPA 1KIFA 4R71A 3BG5A 5EUQB 2VXOA 1OH6A 4NBLA 4AJ1A 2GCNA 2WVGA 3RRNA 3OZCA 4EFDA 4FCVA 3X2EA 1E5LA 3HYNA 1R0BA 3B70A 1IQ0A 3BMCB 1BWSA 3DYBA 1AKEA 4QZVA 3AJEA 3P4UA 1DRVA 4O1HA 3HC7A 5DBOA 5KVAA 4CEJB 2HLDA 5EEGA 2W43A 2XUDA 2CXTA 2WM9B 5G1NA 3MBIA 5A3JA 3WNZA 1NWCA 3AF6A 1RSZA 5EZYF 1MQ9A 4HN9A 3T3DA 3MQ2A 1E3MA 2OBLA 1NW9B 3EVDA 3GAFA 1QRAA 5LQUA 3D1JA 4NS4A 1JVNA 1JPUA 5BMVA 3KETA 2XBLA 2CNWD 1DCMA 2ZSJA 1O96B 1SVUA 4IDQA 5ALOA 1PG0A 1J39A 4Z8YA 4C21A 1XKTA 2C98A 2MSWA 3L7OA 2PGXA 2G63A 3GDWA 1E63A 2QMUA 2YTZA 3MWEB 3NKVA 3PVCA 4M1OA 4LRQA 3GRZA 2J5XA 1KI8A 4OHZA 1OD6A 2P3OA 3G9QA 3QKSB 2OCBA 1AS0A 2HFJA 4X90A 5H3CA 2EBHX 3VYVA 1SO8A 1MQSA 3KJFA 4KKXB 4LXQA 4YB8A 4OHMA 3GNQA 1QUEA 3UXMA 3U4MA 1L7BA 4XRRA 3IEXA 1KHHA 2OKGA 2E5WA 2YXLA 3FR8A 3G59A 3RYCB 3H5NA 2DR3A 1UINA 1CRPA 4L22A 3FH0A 4XDGA 3CN9A 2QQEA 2H0AA 3VPHA 2BSXA 2OZLB 2XB8A 3DVLA 3R0VA 1OPRA 3WGJA 5GONB 4K0KB 5JALA 1N1EA 5ECGC 1E79A 1E61A 2EFEB 2R84A 2WM2A 5IN5A 2XJ4A 1AHNA 1DHTA 3LUCA 2W2MA 4ND6A 4R8SA 4YX9A 1ZOSA 1Z29A 3H1TA 5F21A 1YOVB 1KOFA 2DY0A 2GCPA 4CR7A 3F7MA 5JTTA 3QHQA 2QV0A 1AS2A 3RHFA 2EYQA 3NEYA 4CQMA 2O8FA 3W90A 3STWA 1TL7C 5FA5A 3KELA 2EZ8A 4EKEA 3ZIAD 2Q4OA 3D43A 3DHEA 2FR8C 1T5LA 2I2AA 4GE3A 4EFLA 4YAUA 1NBHA 4D6XA 5K3EA 2ZB8A 4FI3C 3LLUA 8AT1A 5BQ3A 2HTEA 3LQKA 2OXTA 3ZWBA 3BWEA 3D2AA 1JQJC 5CJPA 1KOLA 4A8TA 7AT1A 1M2GA 1O8CA 1R15A 1WM1A 2VJLA 2ATIA 2WAOA 3IHLA 3NTLA 3S2SA 3ZKWB 3CLUC 2YZMA 5K0BA 2EF1A 3WICA 4MP8A 1GZUA 1NTOA 2FG7C 3MFYA 3RASA 4RXMA 4MVJP 4MUXA 2V7PA 2P5YA 3A58B 4KGXA 1IJKA 3GR6A 4RKRA 5AOAA 1U99A 1OMOA 1OXSC 4JUFA 4WEOA 4IKOA 4JODA 4MRVA 4B9EA 2FRDA 2PKCA 1C3LA 2Y1WA 1QF9A 1ZJ4A 3OMLA 3SIRA 4RBNA 1CDDA 1GRNA 3ZHTA 4BNVA 4EWLA 2ZT7A 1SZCA 2WNSA 4P4GA 2Q5OA 3HUTA 5U1PA 4B0PA 3N39C 3EFOA 3NXSA 2FA9A 4W99A 3TX6A 1TVKA 3AVQA 4JXZA 4I6JA 2LW7A 3QEMA 1Z7GA 5HJEA 3LJKA 3MMXA 4M9RA 5LA6A 1WD7A 3VR1A 4N48A 4E0BA 1XHEA 3WADA 2DLCX 4X3PA 3QKRA 2ZB2A 2ENUA 4Q1CA 1D0VA 1CU1A 4RZ2A 5JAZA 4H3KB 4XWWA 3F9CA 1YHZA 2DT8A 2ZK7A 3RU9A 1XCBA 3NHSA 4K2AA 4UAUA 2C7RA 1T36A 3S70A 1CFZA 3HEMA 4KXYA 1E77A 5JAOA 3G3EA 1X1TA 2W93A 3HJUA 4OMUA 4BKQA 4TXLA 3AF0A 3C2QA 1KRWA 3TXAA 5DISB 3LRXA 3TL3A 2ZIXA 4EX7A 1CY2A 4IHJF 1W30A 2CXXA 3PGA1 2GCOA 4MTCA 3UUEA 5L3RA 2I8CA 3D6TB 1X38A 3RSQA 3PF9A 5EI5A 2NUPB 3QUTA 1XVAA 5F64A 2OZVA 1L9KA 3SM9A 2OCIA 4HN4B 2OBBA 3SJZA 2O2ZA 2FFBA 1H23A 4REMA 1EB8A 4QJ5A 1T8UA 3USCS 3CWZA 3OQVA 4MDEA 2ORVA 4OX9B 4DSUA 1VJTA 4QLBA 3X1KA 2X1HA 1S2OA 4ZGWA 4F2DA 5FL7A 1V37A 2EFYA 4HFMA 3DW3X 4C0BA 4IDCA 3DVQX 1EIWA 3V8MA 1DGQA 3PJRA 1OI4A 4X1YB 1KC3A 2G6BA 5C80A 4EY4A 3NBYC 2IYUA 5HOEA 2OQIA 2V7VA 4MVYA 5D5QA 4ISCA 4JJ7A 1ORTA 1ODFA 2HBQA 3BX1A 3O9ZA 3PE3A 3QZUA 1N2IA 2EQAA 3QJ5A 1P18A 4I1IA 1Y1RA 2MYUA 1R0RE 3RG8A 1F9AA 3BBLA 3F98A 3UB4A 2NQ8A 2GJ4A 4WBNA 1ZZEA 4O1MA 2ZTLA 1C1XA 4EVQA 1ZC3A 5KX5F 4QM7A 2O2DA 4B3CA 3LAWA 1YK1A 4ZZ0A 1G5HA 4E5MA 5KYVA 5B4TA 4DPMA 1Z8HA 2F3QA 2IWRA 1VECA 1J5PA 1FMTA 1O94A 4F4HA 5K8CA 2GZDA 1YJ8A 1ML4A 1WMBA 2W2KB 2CNNA 2RK3A 4D74A 1Z5UA 5F1PA 3GRUA 1I2BA 3KE8A 4V38A 3PPYA 2N46A 5DHTA 1X0XA 1PD1A 2O0JA 2Z8ZA 4CN8A 1C1DB 1C3OA 2FPRA 3ZY4A 2WG2A 3H5LA 1MDBA 4BVBA 4ER0A 5JDIC 4J4HA 3HA3A 4QBTA 3UT5B 3DEFA 1JJVA 3LPCA 4HQOA 4BMSA 1AQNA 1G20E 4IUYA 3ZBPA 3U7FB 3EW9A 4O4JA 5A0FA 1QQTA 2JKYA 2FMHA 4ZRNA 2WUGA 1G2PA 1L4KA 3D3KA 3DPUA 1SPXA 4B74A 4F1JA 3B51X 3SIXA 1M0WA 2IUYA 5CXUA 4M0FA 1JP7A 2XAAA 3MLBA 5CNMA 5EZ6B 5E3JA 1CRWG 2W90A 1UAGA 2WYVA 3REQA 1A9OA 3DQPA 2PKQO 3SF8B 5L7WA 1JBQA 2PWYA 5IEJA 5IT4A 1UPAA 1JHOA 4Z2AA 4XASA 4LZNA 5DNAA 1KH1A 4CRWB 3E9CA 3KPVA 4MIOA 5JJ5A 2R44A 5LMZA 3KD2A 2OCKA 4PN3A 3UTDA 2VQEB 1NW4A 5AUNB 3ZDDA 3GRFA 3FCOA 4PZEA 2X6QA 1AGRA 5T67A 3SE0A 4ZC1A 4G5SA 4BWFB 1EDEA 1GZSA 2WAAA 4RY2A 2WINI 4IZOA 4EFNA 1K2WA 1K89A 2ZTHA 2WA2A 4GLJA 3CJRA 4MMZB 3RV3A 1E3JA 3Q0IA 1Y6RA 2HGZA 4X7MA 3GLFA 1TRHA 1O08A 1Z6GA 4JUIA 2FPIB 2QY6A 1QV7A 1TE2A 1YB2A 2NO7A 3F5FA 1KI7A 4NLLA 4R8MA 4WERA 3R9IA 5KNDH 5L6MB 4XJTA 2I8LA 3CONA 2M6SA 3JZFA 2PANA 2WHPB 5B37A 1XJ0A 1QMPA 1BHJA 2NUBA 3DBLA 4ZOQI 2J4DA 5L7TA 1XTRA 1NY5A 2HDWA 2YN0A 1JKFA 4EHHA 4PBRA 1Z8FA 3DBLB 3U6KA 1DIGA 3DHNA 4D3XA 3W3ZB 1JHYA 5B1IA 1C3EA 2VBGA 2C4KA 4WK2B 4IDAA 1JFFB 2DFTA 4CG3A 1JG2A 1YMVA 2Y93A 3ND7A 4LC0A 1DBPA 3KOOA 4K03A 2DVMA 2JF0A 1QHSA 4TPKA 5E1DA 4BMXA 2XNCA 1JRLA 3M4NA 3BK7A 1JLRA 3REFA 1ZNWA 2AOTA 3W7AA 1IU9A 1A7JA 1UIMA 1X7WB 3P0JA 3H1FA 2WF9A 1U3WA 2O2HA 4JIGA 1CJBA 3GL9A 2QRNA 2RC5A 3Q5GA 4UUMA 4XGNA 3BUSA 3KHKA 3A9CA 1P0CA 1TIPA 4RAOA 3HY3A 3ICWA 1D4FA 2IGBA 1HOXA 3W8NA 1ECGA 2WHEA 3GJXC 2DWOA 1U9CA 1YIOA 2VO1A 5BYKA 1T15A 1YL7A 1LBSA 3FYTA 1LB1B 3HKCB 2WKPA 1SY7A 3OZXA 4ZQFA 3C14C 3RM3A 4DIMA 1M1YA 3RIEA 3P4YA 2JGKA 5H82A 4XIJA 3K1AA 5H4GA 4KYVA 3VMMA 1XVUA 2DKOA 2JRLA 3TNLA 3QPDA 3NHPA 3I01M 3WHKA 3GDOA 1PT9A 2JK1A 3QXJA 4R2JA 5I7VA 4F6RB 2ZYGA 1R6XA 1UM9B 4QTUB 3DV0B 3QVGA 1JYEA 2X76A 2R87A 3LMKA 1Q0SA 1ZUWA 4JCCA 3HE3A 3ROFA 4CR6A 1K7YA 3A9VA 3LG2A 3S2ZA 4J2HA 5EQFA 2PS3A 1QV9A 2I66A 5HFJA 2VP0A 2IXTA 4Q03A 4C0QC 4P36A 1OLXB 1Z6AA 1T8TA 3ANLA 3A3YA 4PFSA 4BLOA 6NULA 3DTTA 3M6WA 4RDXA 2V96A 4QARA 1XTJA 3DP7A 2RKWA 2PJZA 1JJ7A 3SYKA 3AHHA 1Z5PA 1SB9A 2IFTA 4K05A 2VUHB 3IJ5A 2CXOA 4EFMA 1XE3A 1SBTA 1IOZA 4LJ8A 4L8YA 4YPOA 1NP3A 3QA3E 3URKA 5A6VA 4CT4B 2B98A 3BE6A 4LOHA 4GICA 4XM1A 2J08A 2JIQA 4B3GA 4A23A 4X6LA 1EFRD 2ON6A 4X97A 3F3SA 4V0QA 3E5HA 4J0FA 3NDPA 1Z25A 4QBKA 3ZCQA 1FRZA 1OX6A 4OGLA 1WCWA 4WBXC 3G2LA 4R84A 3W5IA 4PYLA 1XR3A 1OOEA 5LMCA 1I01A 1SVNA 3KOXA 4EB6B 3K6SA 4B0OA 1G4HA 3K7EA 1XN1A 3JQCA 2A2ZA 3NIFB 3DHVA 3I9LA 4XTCS 3QUQA 4G1CA 4NR0A 1QHEA 1WXQA 3I9JA 4Q3DA 2VDQB 3T0IA 5DNDA 1RBQA 5KNCH 1WV1A 3B1ZA 4TV9B 2OKCA 3GEPA 5CX1B 2ZI9A 3EXHA 1WXEA 2WKWA 3VKHA 2JLWA 1GEGA 3ZXXA 4QD3A 3VV2A 4XWTA 4A3SA 1KNXA 3EDRA 1KZ7B 4ARAA 2WQ6A 3ACDA 5FA6A 1GPMA 1Z39A 2ETVA 1OILA 1PAUA 1IH8A 1LLUA 3V9AA 4QVKA 1DT3A 4Q4HA 4N6GA 1Q22A 3JD0A 4A6DA 2POCA 1DWUA 3GAZA 5EJ5A 2QMQA 4ARZA 1UADA 3DH0A 4G5YA 4EAAA 1MOQA 1T9AA 2ZVPX 3KKOA 4YMHA 4Z0TA 2F8LA 2PRIA 3LX4A 4URYR 1QHYA 4YLEA 3SXUA 1SVOA 1RTKA 3GT7A 1Q95A 2PT9A 3U9SA 3UN1A 3WMWA 4F60A 2C8VA 3PA8A 2QLLA 3A8TA 4WKGA 5FL7D 4DMCA 3CR8A 3OFJA 1TA0A 3NDBB 2RSLA 1ZSYA 3MRVA 3E22B 2WDPA 4O4IB 4DPLA 1K7XB 1LBTA 4FINA 2VP2A 4B31A 4NMWA 3I0ZA 4E2ZA 3JALB 4KO1S 4IRUB 3V8EA 2TSYB 3I30X 2GPAA 3UJPA 3BIOA 4GI1A 1A98A 1KAMA 2FH5B 3BQNB 4E5VA 3DMNA 4X61A 2VLIA 4PNZA 3TRKA 1B15A 3IMKA 5A6SB 3QLUA 4BFLA 4CKBB 2PCJA 3ULKA 1DAOA 3GLGE 1UDRA 1EUDB 3AILA 3WIVA 3TZLA 1XTIA 2YOGA 5TEVA 4FKBA 2NZJA 4YRDA 2R7LA 5ICSA 2R6HA 3ZNNA 2IX3A 1EBUA 3CXRA 2ERYA 3V3KA 1EFTA 1ES9A 4L8GA 3RVSA 2YYZA 4QBGB 5DHPA 4EB8A 4DV3B 3U5ZB 4ZVKA 3K1ZA 2I6UA 4BFXA 5KQSA 1Z15A 5LP6B 2DSNA 4FDAA 4AF7A 5IK2D 5I9BA 1WXIA 3OWHA 1Z7EA 4OV6B 4BLVA 2WSBA 3SZLA 4BTEA 3PITA 2XUFA 3H6HA 4HN2A 4EJ6A 4FMPA 4BKPA 1JEYB 1EUQA 3KUKA 3U3MA 2JBAB 3D7RA 4M1TA 3VHXA 4AG6A 2VHJA 2OO7A 3M0EA 4N0MA 1L5LA 2XVXA 2BGKA 3B3JA 4DCJA 1WKVA 4E5SA 5ES4B 2V3WA 4Z0NA 3KT0A 4C4SA 5FDFA 3M5DA 1C7JA 5KQRA 2G04A 4MCAA 1M2VB 1SBZA 1R88A 1V7ZA 2HDHA 2NNLD 3C5EA 1IHDA 4TRRA 5E2IA 2ZSFA 3RC3A 2C9DA 3ZLTA 1E6MA 4GPEA 4OLHA 1XVLA 1RYYA 3L49A 4N01A 3W79A 3TQOA 2I03A 3FJYA 2P7IA 1DJQA 2C31A 2MHCA 3ICPA 3DDUA 2W4MA 1PF7E 2B3TA 3K09A 3JYNA 4R2IA 5KNLA 1UP4A 2OGTA 1X9GA 4R54A 2PMCA 1UXKA 3JARB 4QHSA 4HT3B 4DQKA 5BV1A 1S2DA 5K3DA 1SRRA 2HA7A 1VIDA 2C92A 1EVLA 3M5CA 4HATA 5GIPE 4IXDA 1KI2A 2ZPUA 1Y8CA 2C8JA 4B2IA 4NYMQ 4ER5A 4BYMA 5LKRA 3FCSB 1A7KA 1REQB 3CNHA 4AAYA 4C5CA 3EBPA 4MRMA 2O2GA 4RZSA 3WMFA 1U8TA 1G9XA 2ZKIA 1BVYF 1XTVA 3QE2A 4HB3A 4KE9A 2GBFA 4YJDA 5AHRA 5FO0A 3W2EA 5L4NA 3UJCA 1I4TD 4JJFA 1T9CA 3H5AA 3LC7O 1K9VF 1JFFA 2V74B 2ZRPA 3USZA 2LD4A 1TU0A 4A82A 1X1EA 2Q0XA 1R66A 3AKYA 3H2YA 2YMMA 2GK7A 3IX7A 2V58A 4U63A 4X94A 5AOVA 5IXSA 3EJWA 3ORRA 3VKGA 4PRKA 3DAPA 5ALEA 5LC1A 1RJGA 3T3GA 1N4DA 3P9RA 3QLEA 2IH2A 4MEBA 3I4FA 3TVYA 5HHTA 3TG8A 2GTIA 3TQHA 2J0UB 3OOSA 3HB7A 3E1GA 4X1KA 4U7JA 2JS7A 1GM5A 5EQDA 4LYFA 5F4ZA 1K7CA 2IDJA 3FWKA 1Z06A 4LV5B 3PR2B 1A27A 3TSCA 1CVIA 1RKXA 3I0MA 1M83A 4H4EA 3HJRA 1NKVA 2GI4A 3H6GA 3REGA 1RJDA 3LWBA 1MRSA 3SQLA 1IVYA 1YD7A 3SZMA 1HKHA 2IPOA 3E05A 3FW1A 3RFCA 3WGHA 1VLVA 3RRXA 2CJWA 2Q5JA 1GZHB 5GQSA 5A0VA 3LCRA 4CIVA 2JHAA 4M0KA 4AF6A 4H6PA 5EWMA 2XADA 2W6PA 2GWRA 2Y8EA 2ZIUB 3BA1A 3DFZA 3H9BA 4PGHA 3P19A 3RV4A 4CKYA 1AC5A 3VTAA 5CAEA 1HTWA 5B3AA 4PPFA 4D44A 3TFOA 3UXEA 1R6UA 4AN4A 2UVPA 2W5UA 5C7IO 1KQPA 5EHNA 4CV1A 2ZETA 1UT5A 1GA6A 4MWDA 1NDHA 3L8GA 2JNWA 4HDNB 2VDVE 1GFSA 2C2XA 5CVJA 2QV7A 1ISJA 3BORA 4K9MA 3CWCA 5DT2A 1BIFA 2NG1A 4X91A 3ZU2A 1HE5A 3H17A 5FLKA 4D8UA 3UGJA 5KS2A 3BL6A 1CUIA 4X8LA 2JIDA 5LA6F 2QR3A 3B1VA 4J6EA 1YTLA 5EG5A 1HFEL 2VPZA 4ZVSA 1DWQA 1G18A 3A10A 3K4HA 3PDWA 3BFXA 4ZEWA 4GOMD 4ZVQA 5JADA 2NO4A 1PFQA 5JISA 4OBXA 3H05A 3PUHA 1CNFA 1B3RA 1HL7A 3H0KA 4ITUA 4GKJB 2AOVA 3N2ZB 4TXHA 2R1VA 2DPXA 3FTNA 2B1QA 2PYZA 4O4IA 3VNSA 1TAGA 4AO7A 3QEKA 5A3RA 2A5FA 4JKIA 4XGRA 5JZMA 1RQGA 4KXLA 3SLKA 4MKZA 2DQSA 5I4CA 1VPDA 2ZYVX 2C7QA 3DBRA 3CO0S 3K9BA 4EHDA 1TK2A 1B1AA 1G42A 3DQZA 3OM9A 2WBLC 3KEFA 3MILA 3PCRB 4HS9A 4MJ3A 1UMCB 5F4BA 5GJVC 5BSTA 5HMMA 4PFQA 3FHJA 2CNBA 3P8ZA 3W7BA 5BUQA 3BM5A 4G81A 1KP3A 2R7AA 1G5IA 3OM0A 2QTLA 4ZAFA 2Y9MB 2G5CA 5EP4A 2QOEA 3PRJA 4UAJA 1F2UB 3GPDG 1B42A 4OA8A 1KA9H 3E82A 2H2FA 3H2SA 5ANRB 5KYWB 5BOVA 3ADKA 2XA2A 5FBHA 3BWXA 4RHUA 1Z07A 2BZ1A 2W8BA 5IC4A 3VU3A 1DOZA 5C81A 3PC8A 4U7TB 3IULA 1A9YA 4UJ3A 1PBTA 1W94A 2QIPA 3U4GA 5BN3B 5GWXA 5TEWA 2WIAA 1OWLA 1RD4A 3DWIA 5TF0A 1XLVA 4UMVA 4TL6A 3RK4A 3UAXA 3VO8A 4A0HA 1QX3A 3GRKA 4WCVA 4BRWA 4CLEA 1DEKA 4I4IA 1WDWB 2QJWA 3WQSB 1X1QA 5TGDA 1JMKC 1NY6A 3P9QA 1M1NB 5K45A 2H1IA 5B7NA 1HLDA 1CZRA 1E2NA 1KXJA 2JH3A 3WJ7A 2VJOA 3W0LB 1HEUA 4OHWA 1O0BA 4M87A 1E1RD 4E46A 3CKKA 2AWOA 2VDPB 3FNIA 2EKPA 3HPQA 3L07A 4DA6A 3OQHA 3UJNA 4CCYA 2ZZMA 3D3EA 5HKBA 2VPQA 3BEDA 3VR6A 4AD8A 1KYXA 3W8RA 4NF2A 4DG8A 5LU9A 4JI7B 1NVDA 2X9QA 2QQ0A 4GBJA 1FW6A 4LJ7A 2HH9A 1NJGA 5TQ2B 5LPNA 4BMNA 4Q1BA 2VP6A 4ZEVA 3DOJA 3G1UA 3EXG2 5EMNA 4OLFA 1ZBDA 2VIIA 4WUTA 4DOMA 5HQTA 2FZ5A 1RJ9A 2ROQA 3K1TA 1N6RA 5BR4A 3NTQA 1PT6A 1TCBA 1R27A 3AFIA 3VBEA 5IAKA 5HZMA 4GP9A 5GM2A 4FONA 3ZEAA 3WOHA 4CR8A 4G0WA 3UQZA 3G8BA 3VO9A 4LXTA 2H00A 2JA2A 3EQ9A 4AWAA 4F12A 1KO7A 4EG1A 3C4VA 3EZXA 1EGQA 1HEIA 1XPOA 2PUBA 1XXHB 1Z47A 1TVCA 4RSRA 1XTUA 5EKTA 3H2IA 4TUYF 4H1UA 3D7SA 1S8OA 1YH3A 2R6FA 2X3FA 3CBGA 4KVAA 5ESRA 3TIIA 1JYFA 4WKPA 3VNQA 1NVWQ 4TROA 1HUQA 4WOCA 2QSYA 4W5OA 1CQJB 4B1FA 2C4VA 3NHMA 4FW9A 1O8BA 1GLNA 3OE7A 4WLFA 4Q9LA 1A9SA 1DU4A 1L1QA 2VOEA 4YT8A 1HNWB 3L8EA 2W6NA 3COVA 3H1PA 3NHFA 2H51A 2ZSHA 1Q2XA 3DUWA 5K3CA 4DQVA 4OJQA 4XQEA 3T7JA 2ZR0A 5K7SA 3GMTA 1U6KA 4MYUA 1JZTA 2NV6A 4JLBA 3IOYA 1UJ4A 3HWSA 3KJIA 1YUMA 3A1VA 1U3TA 1JFLA 3TO5A 3DEKA 5B5SA 1A8UA 4C7MA 4I66A 1SZDA 4JI2B 3SQNA 1AZLA 1V8PA 2P9BA 1IZ0A 2BUCA 3O8BA 1H94A 1UC8A 3NPMA 2WU1A 5KHOC 3KFVA 6ABPA 1XTSA 3D81A 3RGWS 2XCOA 3T4EA 4L57A 5GV7A 1U1GA 2PMBA 3WHPA 5LM3A 4ZEMA 3ZVRA 3DMHA 5JFOA 3RCBA 3L1IA 4BIMA 2ZBQA 4PM4A 4EL5A 5JJKA 4OM7A 2YZNA 2PVPA 4CQNA 2ZZNA 3HP4A 3EIEA 3KSDO 1ODIA 3QFHA 4IX1A 4NZPA 2I1LA 3I09A 3A9UA 1C7EA 2QN9A 4CF3A 3I8SA 4OHCA 1J24A 4HH4A 4CBVA 1Z4NA 4IIBA 1WLSA 3MINB 4DMFA 3FTPA 1JEDA 1TO6A 2ZJ2A 3ESQA 2Z6VA 4J0EA 2RAPA 3ZNOA 4KBFA 3RS4A 4CM4B 2UZ3A 5CK4A 3S2FA 1GQRA 2ZJBA 2ZXEA 4WASA 3VC3A 1Q7RA 4D4KA 3GUYA 1CVLA 3PXCX 4J0QA 4WVLA 4X7PA 1GT91 3MOGA 3OECA 4ZI7A 1QF7A 1KOJA 2CBGA 5COAA 1B74A 4FYMA 2YN2A 2WY2D 2IJGX 3NAZA 5JJIA 3D1VA 1N6NA 2VZLA 4WNAB 2FPLA 4ZRDA 2YMQA 3JATA 3LY8A 3UMJA 3QWAA 4BHTA 4Z3OA 4AECA 3I2JA 2EF0A 2PD4A 1PWEA 1IOWA 4RCYA 1GAQA 4IZIA 4LE2A 3PGJA 3INRA 1ZESA 4NECA 3WLPA 2VEDA 4PRLA 4HAVA 2Q3BA 1NXVA 4DMKA 4HGQA 4H35A 5BV8A 2OYCA 4KXWA 2W98A 4JLKA 1T2NA 4TWRA 4DR2B 3DEHA 4G0UA 2YWJA 4I9GA 3RT9A 3UWPA 3BILA 5J2TF 3X2SA 4IM7A 3O84A 4WT7A 3TEJA 1NQAO 4EY6A 4HYYA 2P0YA 4S1WA 1WDKA 3M6MD 4FDUA 4O3FA 5DTEA 2A9FA 1XROA 4M8IA 4WY2A 4NI5A 3KVYA 3G85A 1N8SA 1ADCA 4JP5A 4OQDA 5C37A 3H04A 3SJCA 1T36B 2VDKB 3MXOA 4B6GA 1JF8A 3TD6A 1VE9A 3BICA 3PUJA 1OV4A 2CF5A 2IE8A 1FTGA 2NVUB 4ARVA 1VPWA 2WPNA 1NNUA 3IDFA 3V8BA 5EZQA 5DLDA 1MKYA 3EIWA 3ITNA 4LHZA 3W5AA 1TEZA 3FCCA 5EXTA 3IP1A 3EF3A 4TTSA 2NLOA 1RXVA 4TMFA 3KYCA 1CW2B 3GFVA 4S1TA 2QLTA 3HVJA 4ZU1X 3STHA 4FCWA 1WZUA 1M9NA 4U6NA 4ZHSA 1LF5A 4GOKA 1CEYA 3F6BX 1COWA 3JZAA 4BC1A 1YQ9A 3EFOB 2R4QA 2W48A 1TNDA 1ZNYA 2GQ0A 4LZLA 2IEDA 4MVJA 4G1FA 4WLVA 2PUGA 4N8DA 3T1QA 1V6AA 1RQ2A 3G0GA 4NOJA 1P39A 4FDVA 3LBNA 1VHQA 4LY3A 5DZSA 5AWFC 1SN7A 4J2OA 5I8PA 2Q1TA 3MUFA 1T3ZA 3CUTA 1P45A 3IJRA 4JUCA 1K3UB 3OJ0A 4Q3KA 3S99A 4E1VA 4MPPA 4QXOA 2FDRA 2A57A 4KR0A 3ZHRA 4CTNA 2JFHA 3H2HA 1T4DA 2PX8A 5CW2A 3PU6A 5FYQA 1U7HA 4CV0A 4D9GA 2ODQA 2DBZA 1GSAA 1S2MA 2V6BA 1DJLA 1FNMA 5JXHA 4L3VA 2YXPX 3ISJA 4C6TB 1YL6A 1H6AA 4C5AA 3WB0A 5J63A 3ZDBA 3RS7A 3WFIA 4BU1A 1ZGBA 4FLEA 4M21A 1ZBQA 1BGXT 3KLPX 2CHQA 5JMTA 1FLVA 1ZD2P 1P73A 1HTTA 2BUBA 1CK4A 1SIBE 3DVRX 4HRXA 2EW2A 4NJEB 3TPZA 1GG5A 5BRAA 2PQ6A 2Q3JA 4MW1A 2B61A 3FMIA 2I3ZA 1IOLA 2GDJA 4TTIA 3ZDFA 3VA7A 1TC1A 4ZJZA 5JARA 1A9XB 1I32A 2Z3ZA 5A05A 4RTQA 4I14A 3HYLA 1Z08A 4HMQA 2IVZA 4MW7A 4A8JB 1X7ZB 1XMOB 1Q6ZA 2CCGA 4OSOA 5KAPA 4BV9A 3UMBA 1KY3A 1DLIA 2YINC 1Z45A 2D8AA 4W5WA 4UFPA 2EJUA 1AZSC 2KLHA 4CTKA 3E9YA 3ZGXA 1UJ6A 3KWJA 1UBKS 4M0MA 2J0UA 2WT4A 5LB2A 3OMWA 3JASA 2EG5A 4DJ5X 2H1HA 1QZXA 2IIVA 3VYUB 2Z83A 2OSBA 3F49S 1JHUA 1ZD5A 2JAHA 4MIYA 5DH9A 1YCDA 1A0OA 5GPBA 3RUDA 2XF2A 1NVTA 4J0JA 4AW9A 1LPNA 1HT1E 1JDUA 1E9AA 1OREA 4R6WA 4MQMA 2JCYA 2M2IA 2PH5A 2CFIA 3DEZA 3UK0A 4BLRA 5B12A 2WW8A 1CZHA 1O4VA 4BP3A 1MH9A 1XEXB 4CLRA 2VYNA 3CNOA 1YR3A 3EQ7A 1BYUA 2VZEA 3R0QA 3QXHA 3EVNA 4GXTA 4EI9A 5J59A 2ECKA 4DA4A 1SQ6A 2H57A 1KYQA 4OF4A 4YRJA 4CGYA 1FRVA 1I2AA 1KK1A 2C07A 2VDUE 2VTVA 4HWPA 2F59A 3BH6A 4OGGA 4PGMA 4UNNA 4YK7A 2XY4A 5CT6A 4JHXA 5FYDA 1Q11A 4UM5A 2B20A 4S3MA 4WWHA 3T52A 2EJVA 3V4VB 3MS4A 1NX6A 1W4CA 4RNCA 4WXYB 1YOBA 2C04A 2JFXA 4ND2A 1E4EB 1PG5A 3N8NA 4YMIA 3ELUA 3ZCTA 4HLDA 3BDVA 3WAGA 3T06B 2VLBA 2XMSA 3AETA 4OIMA 2R6R1 5EQTA 3HA7A 3HXKA 1ML3A 1YIDA 3FPJA 2FP4B 1U4OA 1ZK0A 2VQ3A 3KL2A 3KOWA 4QXPA 1UBRS 5DBFA 1WW3A 4B8ZA 1VDMA 1E1QD 4D0SA 2O50A 4OATA 1E1YA 1U31A 3EULA 1JHDA 4GVPA 5CHEA 3SC3A 2P1ZA 1GDTA 1E2UA 3W4JA 2G0NA 1SVKA 5D8DA 3W2HA 1Y82A 4C0LA 4NU5A 1RHRA 3EDYA 2H7VA 2FEWB 2D1TA 3FKSD 2WKQA 1MMFB 4II7A 3AFNA 4QDKA 4C1NA 3UFXA 2X1VA 5GVRA 4CM5A 1SMKA 4P1ZA 5E6RB 5ECWA 5A1TA 2OA0A 5FLXA 3W5BA 2XDYA 4ZQEA 1NU6A 1ZITA 3SFTA 2G5TA 3A6DA 3IPLA 4RJTA 3AESA 4XA8A 4XIFA 3WDKA 3N5KA 5JUWA 1NRXA 2YV2A 1ZM4A 4NNOA 4Y9UA 2DY1A 1B0ZA 3FTDA 1FBNA 1GKLA 1WNTA 2XODA 4EM6A 4WESB 2BBWA 1Z0JA 2HPVA 3E8MA 3ZHBA 1BFUA 5ALHA 4B44A 2BEWA 2P9JA 3G7UA 5AXCA 1QBGA 3K5IA 3AZQA 4HJXA 5DTMA 5KKAA 1EUDA 2VSXA 2O3JA 1MD9A 5LL6P 4B32A 1YA4A 1VRWA 2VPWA 4D9HA 2P2SA 4LVOA 4NMLA 4ERXA 4ACAA 1SC4A 4IIHA 4C0XA 5K8VA 3AIIA 4ECEA 4RFSB 2CHVA 3TQIA 2Z57A 4IY1A 1GR0A 2Z56A 3QU5A 3TTTA 4JVNA 5FFNA 3GEHA 3I4LA 4B6EA 4JOBA 4NV0A 4QTYA 1IBKB 4RJIA 2PVSA 2UVQA 2V7QD 2WJJA 2HLPA 5D85A 4HYTA 2ORED 4Z7NB 2WTAA 2PWZA 4I4CA 1B14A 4PPYA 2CNKA 1G2QA 1QFJA 2VPIA 2C95A 1CUZA 1VE1A 3AB8A 2YJ4A 3BHJA 3HBAA 3HJNA 3JQ8A 5KYUA 3LLCA 3QMVA 4LGVA 1SXJD 3O31A 5CH8A 4MV7A 3AM3A 3FOZA 3OETA 1QP8A 2CMDA 5DU2A 4S0ZA 1SKBA 2SICE 5CM2Z 2BZGA 2HT1A 3DMGA 4ZDKA 2E3JA 1M2JA 4XCXA 2J3EA 1W6RA 1N0WA 3TBKA 3V2GA 3PVZA 1T5TA 4X3CA 1VCHA 4EI2A 3DE1X 1DE0A 1FYEA 3EMVA 3IDAA 1C9YA 1KEZA 4O6VA 5KYGA 2WJYA 3GLGA 3IE2A 4IOLA 3JD2A 3I6ZA 3QELA 2VC2B 1DTSA 4F8YA 4KRXA 4ZJYA 4CMEC 2IU3A 4CI9A 2ZAGA 2HL6A 4BMOB 2YXNA 1DIHA 4JMPA 2X6RA 5EZYA 2Z8XA 2GAOA 2I80A 5CCDA 1N57A 4N6OA 3V3TA 2XECA 2NVBA 3R3UA 4BFYA 4EKGA 1A50B 2HM7A 4KEAA 5EHIA 2RI1A 2A5GA 3CB2A 3DMRA 2OCAA 3E1SA 4B40A 2BGUA 4DA0A 5IJZA 4BQRA 3SSAA 2QM3A 2CJFA 2JFGA 2VP5A 1U02A 2AYYA 2WD7A 1DC3A 2FW6A 3T61A 1G8GA 4X8HA 1EFPA 1T0IA 2ZSEA 4DT1A 4MSUA 5BSFA 2IF0A 3V4ZA 4BO0A 5FR2A 1ZSNA 3EY4A 1K7FB 4Q6WA 4Q7EA 3JZDA 4Q7QA 3DFMA 3NNDA 3QF4B 3DLIA 2QAGA 2DPMA 4YV2A 1CUSA 4YP7A 3HCBA 2JLRA 2FW7A 2PXCA 4A5SA 3S1LA 1H4SA 2I6SA 2IS6A 5E9AA 3UMGA 1A3CA 2PFSA 1YFLA 4AU1A 4MHOA 4ZEOA 3D8TA 5B7GA 4Q1AA 4TL8A 5L8VA 1FUIA 3D3WB 2HMAA 2BFEA 1WD5A 3LFHA 2BVNA 3P52A 4OK3A 1G41A 2J3KA 4MV8A 1F6DA 1GPKA 2CMKA 4E22A 3N7AA 1CLEA 3ZD7A 1U63A 1B8VA 2XCTB 4YJ3B 4DQUA 1A8HA 4JUBA 4RLSA 1E3SA 1TKRA 4L85A 3PXBA 4NBRA 1ZN9A 4YAEA 1OFVA 2NZVG 1QVAA 2Q28A 3CLSD 2VWQA 4XLLA 5LNK1 1Q1GA 1YRLA 3M82A 3HDQA 3S8YA 1W5TA 3HXLA 2BFWA 4P4UA 4A92A 4KPUB 3GN1A 4KQKA 4LDPA 2HRRA 3GBVA 3CMMA 3M6UA 1SWVA 4UVGA 1A9XA 2D5IA 1QGOA 4HQKA 4RH0A 1GARA 2EAUA 1YQUA 2GKGA 4QOFA 4CIBA 3CIOA 4YCLA 5JAPA 3G2KA 4DNFA 1TM2A 2GRAA 5J47A 2QM0A 1DC8A 4KOAA 4C0HA 3OH8A 4ESVA 5FPSA 4M76B 1I4EB 1TZMA 3LHDA 4A36A 2OLJA 2IZ5A 1NIPA 3W2TA 3B13B 5LD2C 1JILA 2IUUA 4LJYA 2XUGA 3TGPA 2PYIA 1RCUA 5EA2A 4LK2A 1Y1LA 5B1EA 1U0EA 4GBGA 2P4SA 2CJXA 4HDSB 5FJJA 4L51A 1CVRA 4D81A 1UH5A 5EIBD 3Q15C 4MKIA 3UGKA 5JOQA 5JEDA 5E0OA 4R3UC 4C7JA 1HMPA 1XZJA 1Z8DA 3EGIA 2WZCA 4L4XA 4HDRA 3AERA 2YJ5A 4K9PA 4NAHA 4TZ6A 1K97A 3EGXB 5HM8A 3STUA 4V1CA 1CBUA 3BGSA 1SHJA 4LRXA 3KSRA 3ZWYA 4CMAA 4EYSA 4GXQA 1GQOA 2Z5GA 3E22A 3ES9A 4KQ2A 4LBYA 4RDHA 1W1UA 5AVSA 3JSAA 4PXYA 3IUNA 1O77A 1XF1A 2H5EA 4XIYA 1UDWA 1QK5A 4OHFA 2N42A 5EOVA 3LBFA 5ER9A 1I7PA 1VMKA 3R8CA 2J6HA 1EJ0A 8ATCA 5IH7A 3AESB 1C4OA 1O6GA 3PVSA 4FQ7A 4B4KA 1Z5VA 4BB5A 5BT8A 1F3OA 2ZYAA 3D4IA 4IYJA 4EABA 3OOYA 1EGVB 4LXIA 5ALZA 4EDFA 3CG0A 1HQDA 2B7CA 1CR0A 4CODB 4FMDB 3QELB 1JQAA 3MOIA 3B5EA 1FDRA 5AW1A 3CVVA 5TS2A 4BOYA 4R40A 3SHOA 3PDUA 1Z13A 2Z4RA 4F3KA 2HA4A 5I8ZA 2WG1A 5FF9A 3VVBA 3G8AA 4F2HA 1CF4A 1KSFX 3PJFA 1AK9A 1C9JA 4XR4A 4KITB 4RH3A 1L8LA 1XAHA 2IXBA 3R3HA 5CB6A 1A8QA 4JT2A 2FZCA 2P9CA 1YZHA 3B6MA 2HMYB 4S05A 5EXSA 4EA7A 2RAUA 4RJLA 4KLZA 4BTLA 1T9GR 1J1ZA 2JIMA 3UIEA 2XUOA 2OVFA 5FOSA 3CLTD 2OLEA 1JEJA 1H85A 1U5BA 2V65A 1U2EA 2NZYA 1W6UA 4A8PA 4OQLA 1AKVA 1PX2A 1C3OB 3B12A 1XRSB 4TN1A 4Z99A 1XDDA 1A8PA 1LI5A 2NAFA 1RNLA 4XW2A 3FYUB 2GWHA 4JLPA 4AJIA 1BXZA 2XQFA 3TK1A 4IOMA 1Z68A 1SQGA 1E7RA 4U2BA 1UANA 3IAXA 2XSZD 4JT4A 5JO9A 1E4YA 1GNSA 2EKLA 1V45E 4J07A 3TW8B 2P4QA 2WV7A 3UVEA 1U9IC 4GKKB 1SG9A 3PHBE 1OA1A 1NXXA 3ITEA 4RAQA 4EEZA 1ZJ6A 4UU0A 1RQPA 1REQA 4OXIA 1E2HA 1AB6A 4G5HA 1M7HA 3VZCA 2WFAA 4O2BB 1LQTA 3EFHA 4I9FA 3R0IA 4MUHA 1M5UA 3M3DA 4YMUA 5F2KA 5KSYA 3AGPA 1UFVA 1OLXA 1NVBA 1U7UA 1F2DA 2BLLA 3NHLA 3GRPA 3QVGB 2GZMA 3MJCA 4FCCA 4H6VA 3CYFA 1RIIA 5B4UA 3EAGA 4GVXA 3ECSA 3P5SA 4ZAWA 3TCNA 1FIUA 2YWGA 1NDUA 2QN2A 4G4SP 3UWDA 3VPXA 3W3AD 5I4BA 5LD2B 3CU5A 5A71A 5SZKB 3H5TA 1QVWA 3NX4A 4MUEA 3M70A 4IXMA 5M04A 4U7HA 4UATA 1P0QA 2PYDA 3O3MB 1YE8A 3EUAA 1OHHA 1VSUA 1XNGA 4YRQA 2E5LB 3DF7A 3HFSA 3EXIB 4LQDA 5DBIA 3DMDA 3K71B 1N5OX 2YIDA 3QYPA 4MB2A 3TQFA 1C0PA 1ZOPA 3NRBA 4B7CA 3LC2O 3WL8A 3ZCXA 1E9CA 4MUIA 1R3UA 3D3NA 3ZE8A 3SIWA 3OLVA 2BCEA 1WZ2A 2ZYSA 3HKDA 3OTHA 3RLFA 5JD4A 2GM4A 4KJZA 4YQEA 2YVUA 2H3HA 1MBZA 1J22A 1RI4A 5EIOA 5H7XA 4IRXA 3T1YB 4MS4A 1LZLA 2VP9A 1J0DA 3AHGA 2FMFA 5AI6A 1ISPA 4GC5A 4W7SA 4ZARA 2AXEA 2AJCA 1G64A 4FGWA 2C2OA 3OU2A 1NUTA 4OH1A 4BNXA 4RL6A 5FBWB 3HBLA 3P0HA 5H16A 5EWLB 4QICA 5SY4A 3W3AH 4EUEA 1YB5A 1J70A 4KN9S 4HEQA 4ARUA 3UMMA 2RE8A 1ZPDA 4PXAA 1XVTA 4PN7A 2WFLB 2AI3A 1P62B 4XYBA 3PT5A 2OAEA 3OY7A 1J90A 1EE1A 2EQBA 2JJ1D 3LM8A 3NC4A 5E0KB 3RB8A 3RJMA 1E20A 3V80A 3T38A 3Q40A 3I8XA 5KJFA 3JWJA 3ND9A 1EK1A 5EPUA 1WXDA 1Z7BA 2PX4A 1G1MA 1MG0A 1WABA 2I7TA 3ROTA 3GU3A 4BPRA 2QRGA 2I2XB 4FIZA 4RGBA 1NMZA 5JLAA 2NU9B 5JMWA 3UJDA 4GPTA 4Z4EA 3GWZA 1LPSA 4TXNA 4DY4A 4JMLA 3PGLA 2IYEA 1FP2A 2F3UA 3QVLA 3OT5A 1U3FA 4K9NA 4Q4HB 3ICVA 3JWHA 1V11B 5PNTA 5TC4A 3LP8A 1X94A 1DAEA 1GLGA 1M2KA 2Q6KA 3B8EA 4R7ZA 4FMBB 2FPMA 2YQ5A 3JQBA 5B30A 1K4KA 1SCKA 3TOCA 5LYJA 1S3IA 4QA9A 4BTVA 2OHXA 2QYSA 4U6SA 1ECLA 5A4JA 2DPLA 2CLCX 4MO9A 2ID7A 4HRYA 4XX0A 2AN9A 2C8LA 2YJNA 4TRMA 3FYUC 3I1FA 3STYA 3WWCA 5BN3A 1P6XA 1PV2A 3U7JA 4LEIA 5DEIA 3ZE6A 4URHA 4EUSA 3KR2A 2PJRA 3MCWA 2L82A 5EIFA 1EP1B 4C0JA 1WXXA 4EGSA 4ZHQA 3OOEA 5AXBA 1G20B 5AOCA 4Q93A 2WICA 3M3PA 5JO0A 1SKYB 1X7YA 5M3BA 5BV7A 5A62A 2BV3A 3E48A 4RVSA 2O2EA 4IINA 3BAZA 3GJ4A 3ADBA 2IP4A 2PVCA 3OZSA 5AYVA 4BDTA 4F4JA 3QKUA 4MCHA 1DIOB 1T0BA 2HMSA 3BSWA 4EY8A 3A27A 3T3IA 1UBTS 4FUTA 1X8XA 2CWWA 2NTNA 4HI0E 1A2QA 3BE8A 4U02A 4V0RA 3L7CA 3NYWA 2DEUA 4LMRA 4B3SB 3MGAA 3DBRB 4KFSA 4MULA 5AHWA 5T8KA 1G0OA 4MPJA 3I76A 4HO1X 2ZT6A 1GNRA 2PBLA 4LDRA 1QYRA 1QTIA 3DD1A 3W1VA 2VHXA 1KS2A 4NYIQ 4OAQA 1DAGA 4IUCS 4QEKA 4Y2QA 4XSVA 1THGA 3VTFA 3RUHA 1Z18A 5KINB 5DYNA 3WYNA 4R9VA 1FFXB 1KPIA 2QG4A 1JH8A 3JW8A 4G0NA 1U1DA 5EZSA 2R8EA 2XKBA 6AT1A 2ZWAA 1OWOA 4US0R 3O4RA 2AUTA 2AC7A 1YBVA 5GIOE 1TDJA 1TGVA 3R6GA 1QO0A 5JJLA 3R7WA 2D2VA 1Z22A 4HKTA 3V6LA 4N9WA 1HO3A 1KO5A 3GFBA 2ZPTX 3I1JA 2E0IA 4WNIA 4IIXA 1LX7A 4CUZA 1WBJB 2JFUA 2YXBA 5HRCA 5K6AC 3B1WA 1AKMA 4LSWA 1SBIA 1GUBA 5AVKA 1OB5A 1ECFA 1CUFA 1TTTA 1Z75A 1AG9A 4GOLD 5HR5A 3R77A 5FBQB 3R9XA 4J7CA 1ZOIA 3D31A 4FHCA 3B2NA 4GQIA 5THXA 3IOMA 3RVDA 4W9NA 2HHHB 3RTBA 1GNVA 1PDWA 2LDXA 4G4GA 1KDTA 5EFOA 4D80A 4TYWA 2G72A 3GF4A 1JB9A 1P1RA 2RBKA 2FWIA 4XUGB 1N8KA 2VJQA 1RKVA 3E7XA 2NXJA 2EOAA 2BH9A 2EYUA 1KJYA 1QGED 4L2IB 4TKVB 5D86A 4LDQA 1TYDE 1ZUIA 3OMXA 2CXHA 1D2EA 1MC8A 3R8XA 2P77A 1C8LA 5T41A 5AVVA 3GDHA 3PI7A 4AY5A 1UF9A 1H0RA 3B1XA 1U2GC 2PGOA 3NDJA 4KDCA 3ZJTA 2CN1A 2NU9A 3ICQB 3MSCA 3ZUPA 3AVYA 3V7YA 1ORHA 3G8YA 1TYZA 5GJBA 3H5WA 3N86A 3MHTA 4FN5A 2XQVA 3WIBA 4FT4A 4FZ5A 1PWZA 1OFUA 2CVHA 2F3PA 1JDJA 2PA3A 3JQ9C 5AI8A 3GHHA 4YP6A 2ASVA 3SU8A 4PG8A 3F6RA 4GG1A 4U0JA 1PL6A 2JK0A 3EZ9A 1XZNA 1W34A 1KJ9A 2GUWA 1BWRA 4ZOCA 1DARA 1MH1A 3NTVA 3RAPR 1TJNA 4LISA 1KJNA 3FYHA 4MUAA 3QQ5A 1XXLA 4BE7B 1CEEA 1Y4UA 3WIUA 5FAKA 3QV2A 2WF6A 3R7LA 1ZVJA 1J9GA 4HSEA 1RP1A 3HU2A 1M67A 3B38A 3EYAA 2GEVA 5LZ8A 1PQYA 1HMYA 4QNMA 4MRRA 3PFFA 4H7FA 1CQPA 2QVXX 2OE2A 4HD8A 4XFKA 5D7BA 1WR8A 4YAGA 3I2KA 1VJ1A 3BSSA 3ZVNA 5EINA 4DPKA 2Y1EA 4GI5A 5A03A 2I9KA 2KQUA 5A9TA 2Q6IA 2VYVA 2F1OA 2GPTA 3E7WA 5C3MA 4CMKA 4CKWA 3ZPXA 4EJSC 1C4XA 2PQ2A 3AUAA 3R5KA 1OXXK 5JVDB 5KYKA 1PE0A 2O2IA 2J3IA 1P7YA 3LUFA 4QPDA 2CL6X 1PU2A 3O8QB 2DLNA 4BMPB 3PC8C 4EHFA 3PUYA 1QG2A 4JP2A 3IQIX 4P3NA 4M49A 1GCGA 1C2TA 1U9IA 4O0MA 1GIAA 2ZJOA 1L7XA 3M34A 4DA7A 1HNNA 1U1EA 3QE3A 4ONEA 2IU6A 2HDOA 2QN3A 4NPHA 1XQXA 1O03A 2QU8A 1RYDA 2QN8A 1HKUA 2BISA 3GEBA 3GVHA 3O4JA 4LV8B 3GG9A 2GXSA 4FR2A 3GLKA 3R76A 4I5GA 5CHYA 3JQ7A 2IXEA 4MV9A 1UK6A 2B34A 2E1RA 2BFBA 2OXIA 1J1IA 4ITRC 4LWZA 2UYHA 1G38A 1ORVA 1ZH8A 2JFOA 2P67A 1ACJA 1JIVA 1Z62A 3FGZA 3GZNA 4G9BA 1XJWA 4BQIA 4PHTA 3QNWA 2ENWA 3F71A 4BMCA 1INLA 4LS3A 3OX1A 4DS3A 2K5UA 3M6LA 1KSHA 3MQFA 3P27A 1WU8A 3FM9A 4DMUB 4UXJA 1Y7LA 4FJ1A 4MA0A 2NU7B 3O4FA 3ROMA 2MYPA 4LHSA 3EPKA 3FHTA 2X9GA 2JGFA 4NZMA 1ZYUA 3VPFA 4ESEA 1JEOA 5LZ7A 4MV6A 2YFYA 3GGCA 4OSPA 3HZOA 2YWCA 2V97A 3MCUA 5FH9A 5G4KA 2NYUA 3UV7A 3VOAA 1M1NA 4WXPA 1N0HA 5DJ5A 4C01A 3AR8A 1PJBA 5JH7B 1BHSA 2A9QA 5J2UB 1XZIA 1VSVA 3O2JA 2EWVA 3OHSX 1U3DA 4KK3A 3U1VA 1N3LA 1I6WA 4HDAA 4EB0A 2OM2A 1Y8AA 4PZPA 2H18A 3NEJA 4RLHA 1ZH6A 4BQQA 2AD5A 3CRNA 4DLYA 3L8DA 2FUCA 1TAHA 5IUKC 3DW1X 3OLWA 4HC4A 3VZSA 3E9ZA 4OJYA 2WU3A 4EKYA 4YRZA 3R0XA 2C99A 3QPBA 4PIMA 5IKPA 4RTJA 4PXSA 3U62A 5CITA 1IPFA 2YDYA 2B36A 2BM1A 3JAWB 1TO2E 2H59A 5AT1A 2GAFA 2RH8A 3TE6A 2O4CA 4C87A 5K9ZA 4CTMA 4R8KA 4QDUA 4HOYA 4MW2A 1RBYA 1FTQA 1NASA 4JIMA 1DJPA 2QZZA 1U0HC 2G7MC 4GLOA 1QH8A 4IJKA 4KO8A 1CS0A 1WL8A 3AYXB 1CY4A 4BO8A 1AHPA 5FWXA 4Q47A 1V8DA 3IGFA 3MTJA 2DBVO 1WEHA 4V0OA 3CNNA 5DBHX 4IHJB 2QTVA 3DE7X 1XMJA 2JJYA 2FSUA 4G5XA 1LC3A 4FTWA 3AUTA 3KTAA 4D3ZA 1U3GA 4V02A 4MR9A 4M60A 3KR1A 3GVIA 4AKIA 4IGIA 2NU6B 1CJKC 3PD0A 1OU4A 2H1LA 2P62A 3OE1A 1Q83A 4WE3A 1P5HA 1EP3B 4PZAA 3D4PA 1SRQA 3MBKA 3S8MA 3G2HA 1PJAA 2X22A 2NU8B 1LVGA 1GDDA 3G68A 2C77A 4F3CA 3HTXA 4MKRA 2ZULA 3ZDXB 4B4OA 4GZMA 1Z88A 2X0EA 1JS1X 4BX9A 2PJDA 3FNBA 2W6MA 5CFMA 1AGXA 3LYUA 3L5OA 3V5NA 1ISRA 1GQ2A 2DWCA 5D5PA 1J2UA 5AKXA 4BXOB 3QVXA 1QHGA 4BEVA 3ESYA 4DCNA 1U3UA 2FOIA 4L9SA 2FZLA 4PNEA 5HRAA 1J25A 1U8CB 2CXQA 3X43A 3UK1A 3TZHA 2C7BA 3LYAA 3OKFA 4GX1A 1WPGA 3EXEA 3F5DA 3FAKA 4WOPA 2JCSA 1Y3IA 2R66A 1LDMA 1I9GA 2HNBA 4ND3A 2YWFA 3Q7SA 2QYOA 1EDZA 2HIMA 4IILA 4OQQA 4WX2B 4B71A 2B8EA 4CU5A 1DG1G 2P79A 3EXIA 4WGGA 3BC1A 3ZOZA 2ZIAA 3H5RA 5CG2A 3WGUA 3C87A 1AO3A 1ISMA 3NYIA 3ZK9A 3CTMA 3K5PA 3NM5A 2X41A 3FIUA 3PBKA 4O5AA 4V0KA 1W85A 2EJBA 4YMSA 1JHAA 2WHYA 3ASZA 2WWYA 3EGVA 2OILA 2CHFA 3PSAA 1AK1A 1F8FA 3P9YA 2P69A 3S27A 2ZREA 1HNXB 4BY9E 4CKWB 2W9XA 2X14A 4FFPA 1E4EA 2JZNA 4IJUA 4UPEA 2W2OA 4FGLA 4TL9A 2ZRGA 3EB9A 1V16B 2BFEB 5LUBA 2MTBA 4X65B 4MWZA 3N2GA 3ROQA 4KFCA 3MTEA 3RIMA 1K6XA 3GPCA 2JAXA 4GR5A 3ID6C 3SLRA 4MARA 4NHOA 4AUMA 5LXTA 1KZ1A 2Q5CA 1NLMA 4Y2JA 2XZOA 1URPA 1XKLA 4N5DA 3ZG6A 2CVZA 5EIHA 4EW1A 2PIAA 3UUFA 2JH8A 3L7NA 1NVUQ 1MB4A 4MCJA 4L3OA 2JATA 3DLAA 3HL4A 1ORWA 2GVZC 4TRNA 3TEMA 3G6WA 4ZAGA 4ENUA 5GTDA 3ZZ1A 1WS6A 4B8WA 1K5HA 4MW6A 5KNDD 1GILA 3HKBB 3LGAA 3RS8A 4DTIA 2QYTA 4HMOA 3DE3X 4OK5A 1I2CA 1U0OC 2IDZA 4I9UA 4ND7A 1KEPA 2Z4TA 2CEAA 4RZUA 2AIRA 3AFOA 4PE5B 1TCUA 2P2YA 1B73A 2YVQA 3AP3A 4HVTA 4S2UA 2YJGA 5CJJA 4CDNA 1OKKA 4YAIA 2ZI6A 4TMKA 4TXMA 4BNLA 3MVEA 3HB0A 4K3UA 5BVGA 4JBLA 2PJUA 1GCIA 2EEZA 5FWXB 3UXHA 5DGDA 3AVTA 2ICAA 4LOJA 4E07A 3GLUA 3TNDA 5G0WA 4AKHA 3V7NA 1E66A 4GVLA 5DYTA 1YQWA 3MTAA 4EZBA 1R9GA 3AY6A 4XWYA 4YUZA 5IFKA 3I92A 1RMTA 3BZWA 3OX3A 2Z2KA 1F0KA 1Z0IA 2FI1A 3LK6A 3ZQ4A 3I53A 2B1JA 3WLLA 4FWTA 2F55A 3WKCA 4BBPA 1KZYC 4PLWA 2NMVA 5IT5A 3GBPA 4EPTA 1GU1A 3HO8A 5SZIA 2WU0A 2IHUA 5K0LA 3JRXA 1VSTA 1YKSA 2BEVA 3VR5A 2ZBGA 4BPBA 1V8ZA 1B76A 1WCXA 1YVDA 3WK5A 2OV4A 3K5WA 4I3HA