2XW9A

Crystal structure of complement factor d mutant s183a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
228
structure length
226
Chain Sequence
ILGGEAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDAGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR D
publication title Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 226
sequence length 228
ec nomenclature ec 3.4.21.46: Complement factor D.
pdb deposition date 2010-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xw9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xw9A01
4E7RG 1GJ9B 4IS5A 1LPZB 1EPTC 3LGYA 4JZDH 4KTSA 4XBDA 1BUIA 1ZTLA 1OP2A 3L6PA 5GWZA 3BTEE 1EJMA 1P04A 1O5EH 2PUXB 1S6FA 4O9VA 3E1XB 1J17T 1JXPA 1C5LH 1NFYA 2VWNA 5EU8A 3Q3XA 1FPHH 1UTOA 1NFUA 1FLEE 3BG4C 1BDAA 4RN6A 3V13A 1C1TA 4ABDA 3U98H 3CENA 5HXFA 3F68H 1V2KT 2JH0D 3DUXH 2P3TB 4NZLA 1UHBB 4GPGA 2A7JA 2ZGJA 3EA7A 1SGDE 2SGEE 3QTOH 1GI7B 1O30A 2ANYA 1VJAU 1C5YB 1ESTA 3ZZ7A 1GBFA 4ZKNU 1RIWC 2DE8A 4YM9A 1PQ5A 1UK2A 1XXDA 4I8GA 4Y7AA 1HGTH 3A7YA 3CS7A 1UVPA 4HTCH 1SGYE 3A87A 1MBMA 4VGCB 3FAOA 4BTUB 3RXSA 3KN2A 3MNSA 5L2ZH 1LMWB 1CHOF 1BRBE 4FVBA 2J9NA 2AH4X 2JETC 3NXPA 2ZHWH 1AE8H 5E2OA 1Y3UA 1EP6A 1JMOH 3IITA 1TALA 1O3KA 4AFUA 2XWAA 3A81A 1AQ7A 1SSXA 1UTKA 1TOCB 1SGCA 1WUNH 1KXFA 2B5TB 2OD3B 1QR3E 5DG6A 1PQAA 4XBCA 1C2JA 3GY3A 4X2XA 1JIMA 1DICA 2ASUB 1GJBB 3L33A 1KTTB 1BTPA 4MPXA 1ZSLA 5EQSA 2ANKH 5JB8S 1OOKB 3S7KB 3BTQE 2VIWA 1SMFE 1FI8A 3DT0H 1GVZA 3A8DA 2PKSB 1OPHB 1XKAC 2A5KA 4JK5A 4WH8A 5E2PA 1P3EA 4RKJB 4UFFH 3SGAE 5ABWA 1D3DB 1WTHD 2H9HA 5ETXA 1C2HA 1O2NA 3MU5A 4LXBH 2A4OA 4JK6A 1GJ4H 3RC6A 1E35B 1ELDE 5L30H 2B0FA 1CT4E 3D49H 3GCTF 2IN2A 1UVUH 4DURA 1V2NT 3SU1A 1V2JT 4Q7YA 3MI4A 1ELVA 2B9LA 1T8NA 3B8JA 5AFZH 2J2UA 5EOKA 4Z0KA 3LC5A 1P2IA 4ISLA 4Y0YE 6LPRA 4NA7A 1GHWH 3T5FH 1Z7KA 1A5HA 1KXDA 1Y3XA 1QRZA 2Z3CA 2P8OB 1BHXB 2Z7FE 3TNTA 4Q2KA 3PMJA 2WPJS 3HATH 1SC8U 3M36A 5A8XA 1RXPA 2XRCA 4DW2U 2CN0H 3P8GA 2M5TA 1P05A 5AHGH 4THNH 2PGBB 4IN2A 1WSSH 3ZZ6A 1O2OA 1ELAA 2SNWA 2V3OH 1T4VH 1MH0A 1TBZH 1TMTH 1TX8A 4ZROA 1QRXA 1KTSB 2G81E 4M7GA 2FLBH 3F9HA 1HRTH 2NU4E 3UNQA 2O8WA 1O32A 3LJJA 2FP7B 1GJ8B 1KYNA 1FY4A 1OWKA 2W26A 2XTTB 2GCHG 1YPHE 3RM0H 3M3VA 3MFJA 1A3BH 2ZWLH 2SGQE 2BDCA 2Z3EA 3RXJA 1AI8H 1P11E 7KMEH 4K3JA 5T6FA 1J16A 2AIQA 2WYGA 5CMXH 1J15A 4E05H 5FBIA 1ELBA 3QO6A 5TCCA 1GWAA 1Y3VA 2A0QB 1K1OA 4KKDA 4JZEH 3KNXA 3LGUA 4K5ZA 1UVOA 1HAHH 3TGJE 4U32A 2TGTA 1C1RA 2RDLA 2FODA 1BJUA 3RXLA 1BTZA 1J9CH 3OSYA 1GMDF 3P92A 3QK1A 2BOHB 4K2YA 2CF8H 5ESBA 3UR6A 1QL8A 1Z8GA 3SU4A 1ZPBA 1D6RA 3CS0A 1G3CA 5GCHF 2H5DA 2R0KA 3D65E 3TITA 1TLDA 2F9UA 3T27A 3N7OA 2OC7A 1O5AB 3D62A 2UUFB 1YYY1 2PV9B 4CRGA 5A2MH 4MVNA 2WINI 3PO1B 1SPJA 1AWHB 2QCYA 3ENSB 2RA0A 3ZZCA 5EG4A 2J4IA 5C5OA 1NRNH 5DGJA 3GY2A 5CE1A 5C1UA 1A61H 3ODFA 4AOQA 1P12E 5FBEA 1X7AC 3SV8A 1C1NA 2IJOB 3MTYA 1FXYA 3CP7A 1QJ1B 3F1SB 1RD3B 1ELGA 4Z6AH 3MU8A 1TOMH 1HLTH 3BN9A 1LPKB 1XXFA 2EI7A 2C8XB 4LK4A 3QN7A 4Y8YA 1C5UA 3KF2A 1UO6A 3ZZ9A 1AE5A 1W0ZU 1ZTKA 1YPLH 3UIRA 1PYTD 2J92A 4ABAA 1TMUH 1FY1A 2K1QA 1UCYK 4WMFA 1FY5A 3LKWA 3KQDA 1P8VC 2F9VA 1P10A 1TBQH 1MTNC 1QHRB 1MKWK 4FUIA 2WV4A 3RXAA 1GJ5H 3KQBA 4B1TA 1CHOG 4JCNA 1H1BA 1V2OT 4OS4A 1GDQA 1UTMA 5DJ7A 3A83A 1VITG 5EXNA 1L0ZA 1SBWA 1TFXA 3FP8E 1FQ3A 1N6XA 3SNAA 1BA8B 2VWLA 1TQ0B 1O5CB 1AVGH 5C1YA 1ZSKA 2AIPA 1ELCA 2O9QA 5TJXA 1YCPM 3RMNH 1TAWA 4J2YB 1C2IA 1Y8TA 1C1OA 3A7WA 3GCHC 1C5OH 1EAWA 2ZPRA 5I25A 1BCUH 2A2XH 1O38A 2W7SA 3ZV8A 2HNTF 4YLQH 4FUCA 4YOIA 3VPKA 4K60A 4YO9A 5JBTA 1P3CA 3SQEE 1AB9C 3BSQA 2VWOA 3ATIA 2QXGA 1DX5M 1GJ7B 1RRKA 2R2WU 2OC8A 1EZUC 2BHGA 1CA0C 1CBWC 3GCTG 2FDAA 3E0NB 1SOZA 4DIHH 1TB6H 4Y11E 1MCTA 1HPGA 1TX6A 1BQYA 1ZSJA 1K21H 3MO9A 1O35A 1O5BB 3BTKE 4ZMAH 4OS7A 2UWLA 1C5ZB 1E34B 3AASA 3K6ZA 1Z71A 1PPEE 2O8TA 4ESTE 2BLWA 1CSOE 3ZYEA 2B8OH 3ZVBA 3TU7H 4A5TS 1K1PA 1P2OA 1GVKB 1DY9A 2G4TA 4AN7A 3LT3A 3SBKA 6CHAC 1IQMA 1OSSA 2QA9E 1P03A 2OUAA 2BY7X 5B6OA 1V2TT 1SVPA 4JYVH 3EGKH 4XE4A 1EXFA 1P09A 2ZKSA 4WMDA 1QA7A 4ZHAA 3V3MA 1HAYB 2V3HH 1TGCA 7GCHG 1NFWA 1QBVH 1PPBH 2ZGXH 3GCOA 3SI3H 1O2SA 3SU0A 2GMTB 1RJXB 1Z6JH 1KDQB 3RXFA 1GHVH 1SGRE 1UTLM 2HNTC 3AW1A 4A7IB 4A1TA 2FXRA 1Q31A 4INLA 3E3TA 2O8LA 1GMCF 4CR5A 3UUZA 5DP7A 1DUAA 1ID5H 4GUXA 2D8WA 2ZPQA 2A7HA 2P94A 5J4SA 2ANWA 4YOGA 5EQRA 3SU2A 3SQHE 1BBRE 1W11U 2ZHEH 4HFPB 1UTNA 1KXBA 2NU2E 2WPKS 1T31A 5F8ZA 1H8IH 1XVMA 2A32A 2BD5A 3GISB 5BPEA 3STIA 4A1VA 1IQEA 3LGVA 1O3FA 4X8VH 1T7CA 3ZVGA 1NM6A 4X2YA 5HM2A 1UJ1A 2A2QH 1NC6A 2HRVA 1EAIA 3QUMP 1CGJE 2BTCE 4R0IA 2GX4A 1EPTB 1AWFH 1GHYH 3R0FA 3UR9A 4BAQB 3A8CA 5A09A 1GMDG 5EODA 2ZTXA 1HYLA 3ITIA 3T25A 3ZVDA 1IHTH 2EI8A 2BQ6B 5GCHG 1MU8B 1O33A 2QY0B 3UWIA 2AMPA 5E0GA 1V2PT 1YPEH 3BG4B 1QB9A 1Z8IB 1HV7A 2GZ8A 3PYHA 3WY8A 3MNXA 2AFQB 2GCTC 2VIOA 2ZU3A 3HK3B 4TPYA 5DP3A 1TGBA 3ZZ3A 5FX6A 4XSKU 2FO9A 2J94A 4MQAA 2VWMA 1NS3A 1HAXB 1TABE 1C5WB 1S6HA 1RIWB 2Z9LA 2HOBA 3S0NA 3O8RA 1T8LA 2G52A 1OYQA 2TIOA 3I77A 4CHAC 4ZXYH 1O39A 1JRSA 1MAXA 2ZCLP 3SHCH 2SGDE 2H1UA 1MU6B 3VFEA 1DS2E 1HCGA 2HPPH 2Y7ZA 3SGQE 3FFGA 2ZFTA 1V3XA 2G55A 3I29A 2G00A 2JETB 4I32A 1LHDH 4LZ4B 2ANMH 1EX3A 1TNJA 3AAVA 1VCPA 5JBBS 1BRUP 3M5MA 1HAPH 2A31A 3FZZA 1C2MA 1BJVA 2ZFPH 3BTME 1EOJA 1TYNA 4CRCA 2AMDA 3BTTE 1S83A 1C4Y2 1Y5BT 2ZO3H 1OP8A 4KGAA 5F8XA 8GCHF 3GOVB 3FP6E 3I78A 1EKBB 4UFEH 4D7GA 5EGMA 2EC9H 3F9FA 3RXVA 5K0HA 1EASA 2PR3A 4X1NU 3MNBA 2FI3E 2OC1A 1O3NA 1O3IA 3BEIB 3UOUA 3ZZAA 3ZV9A 2ZHFH 1SR5C 2Z94A 2Y82A 1WTGH 3DHKH 1A7SA 2GGVB 2I6QA 3F6UH 5C5NA 1C1VH 1RS0A 4GSOA 3UFAA 2FI5E 5LH8A 2Z3DA 1HNEE 1SLWB 1BITA 3RXUA 4BOHA 4FUJA 4X0WU 4AB9A 2ULLA 3AVZA 3MOCA 4U30A 4AFQA 2ODPA 1CGIE 3C27B 3U8TH 2W7UA 1GBHA 3PM3A 1O2LA 2BXTH 1Y3WA 1IQLA 1GI6A 1WBGB 5JYIA 1QJ6B 4ISOA 1FIWA 1QIXB 3PMBB 2GV6A 2XBXA 4X8SH 1MZDA 1BTWA 1VR1H 2AGEX 3RXHA 2ZDNA 1XVOA 2AS9A 2EA3A 3VGCC 3A8BA 1HAOH 2CGAA 2ALPA 2WPMS 5DO4H 1MQ5A 4BANB 3H7TA 1GBMA 2Q6DA 4NZQA 1O3CA 1B5GH 1YPJH 2P3FH 4DCDA 1ANCA 1TBRH 3M5LA 3VB3A 1GJ6A 1TONA 3DFLA 2OC0A 1QQUA 3ELAH 4NFEA 1D6WA 5FPTA 1B0FA 2ZDVH 3UNSA 4ABFA 4OS6A 1SGTA 2Y80A 5DP8A 4WY3A 4MNWA 1GDUA 1ETTH 3BEUA 4IGDA 1WQVH 2ZTYA 5DKMA 1CVWH 2VU8E 1ETSH 4KP0A 3B9FH 4SGBE 1KSNA 2XXLA 1G3DA 3VB4A 1VITF 1G9IE 1IQKA 4B2BA 1GGDC 2IPHA 3S7HB 1HIAB 3M61U 2Z9KA 1C2GA 4UE7H 2O8UA 3ATMA 3PWBA 1UVTH 1XUJA 4HZHA 1QURH 2PKAB 3FVFB 3HK6B 3M5NA 3TJUA 5EW2H 2OBOA 4AYYB 2VVVA 2PWXA 1BZXE 1JRTA 1ARCA 3QLPH 1GI8B 1EATA 2BY9X 2VIQA 1FONA 1AUJA 1ZRBA 4H42U 1V2UT 1C9PA 4CREA 2VNTA 3W95A 1BTXA 1CHGA 1SGFA 4CBNA 1KXAA 1HUTH 5K7RA 4MPVA 2FYQA 3TVJB 3LJOA 3GY5A 1A1RA 1GI4A 4ZH8A 4ABJA 1GBEA 2C8ZB 4NGAH 1GHXH 3MU4A 1V2ST 3VXFH 4YESB 1C1MA 3O8DA 1P02A 4CR9A 4K8YA 3LDXH 1EB1H 5ESTE 1W7XH 1GMCG 3FANA 3SU3A 1DWBH 1C5QA 4K8BA 4CH8B 3RDZA 2D2DA 1K22H 4FUFA 1G30B 5E0HA 1NTPA 1ORFA 3MU0A 1DXPA 3TNSA 3OY5U 1BB0B 1QQ4A 4ABHA 1ARBA 2F83A 3LC3A 3M35A 4JYTA 2F3CE 2HVXA 3RXMA 1ZOMA 2FLRH 3E0PB 3P8NA 4BNRA 2KAIA 2QYIA 2ZDMA 5F6MA 3V7TA 1Y3YA 3PMAB 3VXEH 4FUBA 6GCHG 1UK3A 4E7NA 1BTYA 1A0JA 2GT8A 1SLXB 4YOJA 1MD7A 1WYKA 2ZFFH 1JIRA 3KCGH 3ZZ4A 4AG2A 3MO3A 1GG6C 1AZZA 1UCYH 2AMQA 4FUEA 3M7QA 1E37B 4NCYA 2TRMA 3T28A 4IC6A 1EZXC 3V12A 2Y7XA 2SFAA 1LHEH 2BQ7B 1HFDA 3A82A 3SNBA 5IYTA 3ZZ5A 4R8TB 2VGCC 2ZGCA 3MH5A 7GCHF 1PPCE 3BTHE 1P2MA 1QGFA 1DM4B 3A7ZA 1QFKH 1W8BH 2XBYA 3HKJB 1GBLA 1C9TA 1PQ7A 3BTFE 1EZSC 2YNAA 1G2LA 3K2UA 2ZECA 3GICB 3KL6A 2Z9JA 2PTNA 4XOJA 4ABGA 4ISIH 4Y79A 5HM9A 3NCLA 1J14A 1GBDA 1H8DH 2IOTA 4BTTB 1MTNB 1V2WT 1W13U 3QGNB 1CGHA 1MD8A 3GCNA 1MKXH 1O3PB 3A7XA 2BM2A 3RMLH 4AB8A 3A7VA 1DY8A 1PQ8A 1SL3A 1FJSA 1BBRK 2RCEA 4AX9H 4NSVA 1TRMA 2V0BA 2R3UA 9ESTA 1KXCA 1V2QT 2Q6FA 5L2YH 4Y71A 1AFEH 1Y5AT 5AVDA 1O36A 5DP6A 2F9BH 2PHBA 2XC4A 1DLKB 3U1JB 1SGPE 1EZQA 1TPOA 4F4OC 5LGOA 8GCHG 3RXEA 1AGJA 3U9AH 1ZMNA 2H2ZA 3SJKA 2VIVA 3ZVCA 1IQIA 2QXIA 1RFNA 3GCHB 4OGYA 5DPAA 5SGAE 4YLUA 1C5VA 4I8HA 1KLTA 2LPRA 1UVSH 1H9IE 1RTLA 3SU5A 3RXRA 4AYVB 4ZAEA 1WCZA 1AB9B 1TX7A 2A5IA 2SGFE 3TGKE 2FS9A 2BX4A 2ZGBH 2G8TA 2GP9B 3P8OA 3SO3A 4BXSA 1P2JA 3SI4H 2THFB 3PB1E 2QIQA 4GCHG 1CA0B 1CBWB 2HPQH 2ZQ2A 1C5NH 3P17H 2ESTE 1E0FD 1OP0A 1NRSH 1SGIB 3F9GA 3RP2A 2JH6D 5TCAA 1LO6A 1QTFA 1MQ6A 1W10U 2NU1E 3ZVAA 4NWKA 3TK6A 2TBSA 1QL9A 1HJAC 2QV1A 1YBWA 4NG9H 3PROA 1GI1A 1NN6A 1TA6A 4PROA 3QTVH 1QBOA 1LTOA 1AFQC 1LCYA 5F03A 1C1QA 5FPSA 2ZIQH 1O2YA 3VB7A 1O2TA 1W12U 6CHAB 2BDAA 4AFZA 3MHWU 2FOBA 3S9AA 2F9NA 1YPHC 2QAAA 3ATKA 4NFFA 5A8ZA 3TJVA 2J95A 2RA3A 3OY6U 4ABEA 1O2WA 3S69A 3KQEA 3UQVA 2ZP0H 1IQHA 1S82A 4X6NA 5FPYA 5JPMH 4TPIZ 1UTJA 3BTGE 2QXJA 2BQWB 1O2ZA 3GY4A 4D9QA 1G36A 5GPIB 1C2EA 1J8AA 1NRRH 9LPRA 1C5RA 4O97A 3TGIE 3UPEA 5IDKA 2WUCA 1FN6A 1SFQB 1N6YA 4I33A 1F0SA 1UTPA 1Z1JA 1TNKA 2FYRA 2GZ9A 3PWCA 2G51A 3TH4H 2ZU5A 2OXSA 1SLVB 1DSUA 1D9IA 2A1DB 2WUBA 5CHAB 1W0YH 4X6MA 1QL7A 4BAMB 5A0AE 4DY7B 2NWNA 1CU1A 1GBCA 3BTWE 2FIRH 1IQFA 4B75A 1H9HE 3NK8A 2QF3A 1YP9A 2WYJA 3BG8A 2ZU1A 1ABJH 3A86A 1JOUB 4FVDA 1O2JA 3SV2H 3KHVA 1E36B 3LGTA 7LPRA 3ZZBA 1XUKA 1TWXB 1S0QA 2ZHDA 1PPGE 1W7GH 3HGNA 1NT1A 4ABIA 1L1JA 2BLQA 1A0LA 1LQDB 1ZJKA 2SGAA 1NRPH 1ZR0A 1ELFA 4GLYA 1MUEB 2GCTB 4MDSA 4IN1A 2RG3A 1ZHMA 1AKSA 2GD4B 1MBQA 2P3UB 2ZHQH 4BAHB 2ALVA 2A4RA 1RTFB 1MTVA 1XUGA 3MH6A 4DG4A 1IAUA 3ZZDA 4DT7B 4Y0ZE 2Q6GA 4Q7ZA 2F9OA 3ZYDA 4CHAB 1AZ8A 2BX3A 1DITH 3KQCA 2FEQH 5LPRA 1O3GA 2OP9A 5E8EH 4ZKSU 1GBIA 3RXPA 3P95A 3HGPA 3UNRA 3ATWA 1EUFA 2CV3A 2Z9IA 2ZFRH 1N8OC 4ZHMU 1SLUB 3MNCA 5PTPA 1BT7A 1YC0A 4SGAE 5C20A 1NU9A 2GDDA 3D23A 1T8OA 2C8WB 4X6PA 1EAUA 1VGCB 8ESTE 4QT8C 4YT7H 2HLCA 4D76A 3BIUH 2QGRA 2C4FH 1UHBA 2AGIX 1GBTA 1GI9B 4B2AA 1F5RA 4WF8A 4XFQA 1VZQH 4UONA 3OYPA 1H9LB 1ZRKA 3BIVH 4Y6DA 2BD8A 2A4QA 1HAVA 1O34A 1Q3XA 1ZTJA 1C2DA 2ZZUH 2FOHA 3RXIA 1DT2A 2FOCA 5CHAC 4Q80A 1LDTT 1VCQA 2FOAA 1DSTA 3BV9B 5T6DA 6GCHF 4ISHH 1O2MA 5C67A 2FMJA 2H5CA 1FY3A 4NIYA 1GHAF 4H6SB 3RXTA 5FAHA 2PTCE 1SQOA 1ZGVA 1SFIA 3UOPA 1FAXA 2EEKA 1O2QA 3DD2H 2VVUA 1QNJA 1XUHA 1Z8RA 1HXEH 1RTKA 4K1EA 4CRBA 2V35A 1SHYA 4O3TA 1PFXC 2TGPZ 3EE0B 2BD4A 3F9EA 1P2KA 1PJPA 3PMHB 4I8JA 1O3OA 2GDEH 1Z6EA 3TK5A 2YOLA 1FY8E 1V2RT 4AGKA 1GJDB 2UWOA 1NY22 2BY8X 4UEHH 3QZQA 1P06A 3O8CA 3VGCB 1V6DA 1DWCH 2H9EH 3W94A 5BRRE 3RC5A 2JH5D 2OINA 1ZZZA 4X1PU 1OYTH 1QRWA 2NU0E 2YNBA 1AIXH 1NROH 2Y81A 2STBE 4I7YH 2TGDA 1WU1A 5FXLA 5DK1A 3T2NA 1F0UA 3LH3A 1NFXA 2ZU4A 5JBCS 4HI3A 1ZYOA 5JDUB 1ETRH 1SB1H 1FUJA 1FNIA 1L4DA 1AVXA 1BMAA 2FTMA 4RSPA 1VGCC 2ZA5A 2ZF0H 2TPIZ 2FS8A 3SHAH 2QC2A 3UREA 2B7DH 1K1IA 3S9CA 3SUGA 1GCTB 3TJNA 3SUEA 3GYMA 3QGJA 1Y5UT 1GGDB 1A5IA 1ZHPA 4MG3A 1BRCE 1Q2WA 1EB2A 1VJ9U 1XUFA 3SJ9A 3EA9A 2GV7A 3PLPA 1NRQH 4K69A 1BMNH 3ZZ8A 1JWTA 2FOEA 1BTHH 4FXGH 1SGFG 2OLGA 5GXPA 2ZCHP 1GPZA 1L4ZA 1FN8A 1ABIH 1FPCH 4BAOB 2CXVA 1OWDA 7ESTE 2I6SA 4DOQA 2PGQB 1W14U 1O2IA 1P2QA 1LKBA 1O2GH 5L6NH 1EOLA 1IQGA 2WPLS 2UUYA 1MAYA 3LIWA 3Q3KA 1C2KA 1AD8H 3EA8A 3E16B 4JZIA 2W3IA 3EAJA 4GCHF 1GI2A 1HAGE 1GJCB 1WV7H 4I8KA 4Y8XA 1K1JA 4WVPE 3RXQA 2ZG0H 3V0XA 2A7CA 1XKBC 1LHCH 1XM1A 1NO9H 4OGXA 1S84A 4WJG2 1OKXA 3TPIZ 1O3HA 3KGPA 2D1JA 1GI3A 3FP7E 3Q77A 1LHFH 5GDSH 4DIIH 1O3JA 1THRH 4YT6H 5A8YA 4TY6A 2ZFQH 3RU4D 1O0DH 1YF4A 2PW8H 3SNCA 4F49A 3SU6A 1GG6B 5FX5A 4A1XA 1HAZB 4D8NA 3O8BA 2BZAA 2J38A 2XBWA 3K6YA 1KIGH 1TGSZ 1B0EA 3MU1A 3RXCA 1L2EA 4XDEA 4OS1A 1TNIA 2LNCA 3T62A 2WPIS 1LHGH 5E0JA 1U6QA 3VB6A 4ISNA 4IMZA 2VGCB 4ASHA 4MPWA 3SJOA 1GCTC 3RM2H 1O3AA 1GBJA 3A80A 1HAVB 2UUJB 1GHBF 1BBRH 2AEIH 1TGTA 2VVCA 4X1QU 1K28D 5JBAS 3LONA 3IG6B 3TLOA 4AG1A 1P9SA 2H6MA 3SV9A 3ESTA 2WPHS 1GVLA 1TRNA 1YCPK 1AO5A 2Y5FA 2STAE 1DANH 1OXGA 4B76A 1GJAB 3NPSA 1K1NA 2ZDAH 4CRAA 3MO6A 1LKAA 1QY6A 3LH1A 1EAXA 3RMMH 3JZ2B 4FU8A 1LPGB 1ACBE 4GHQA 1TQ7B 1YPKH 3LPRA 1GL1A 3HKIB 3SV6A 1DLEA 4J1YA 2OBQA 1TIOA 1ZPCA 1KXEA 3SNEA 3T29A 2VH6A 1BIOA 3PV4A 1S81A 5LPEA 3G01A 1O5DH 1ZMLA 3U1IB 1O3MA 4U2WA 3NUMA 2ZCKP 1C5XB 4JYUH 4UD9H 2Z9GA 1G37A 3QZRA 2A5AA 1WQSA 1EQ9A 1ZLRA 1GCDA 2FZZA 4MNXA 4BTIB 4NIVA 2A4GA 3L3TA 4MNYA 3SGBE 1TPAE 4X6OA 3VEQB 4LZ1H 1GHAG 1W3CA 3A8AA 3TJOA 1OWEA 3P70B 2BDHA 3NZIA 1FMGA 4ZHLU 1W2KH 3GYLB 1EJNA 3OX7U 4NWLA 4ZUHA 2Q1JA 1MKWH 1SI5H 3MYWA 3RU4E 1YKTA 3EYDA 4JZFH 1NZQH 2FPZA 3DFJA 1A46H 3URCA 1CT2E 4X8TH 4YZUA 2ZPSA 1S85A 5EXLA 2VINA 1O2UA 1C2FA 1SG8B 1C4V2 2HGTH 4VGCC 5HGGA 4DGJA 4LOYH 1HJAB 5FCRA 2ZEBA 1IHSH 2BVRH 1GI5A 2BD2A 2VIPA 5EXMA 5FHTA 5T6GA 1SQAA 2W3KA 4B71A 1A0HB 3AW0A 2ZGHA 1BHXF 2BY6X 2FWWA 1AFQB 1ESBA 1TA2A 1OWHA 3BTDE 2PFEA 3EDXB 1GMHF 1DWEH 1KLJH 1TE0A 2BYAX 1S5SA 2XC5A 2VB0A 1D3TB 3B23B 3KIDU 2F9PA 4FU7A 1IQJA 1O31A 4H4FA 3OU0A 3LU9B 4WWYA 1D3PB 1TPPA 3LGWA 1T8MA 3U69H 2J34A 2HWLB 6ESTA 3SJ8A 2R2MB 1A5GH 1Y59T 3NWUA 1THPB 1V2MT 1ANEA 4U01A 2P59A 1C5TA 4KTCA 3Q00A 3QDZB 2BOKA 1GDNA 3M3SA 4CH2B 1VITH 1TMBH 1P57B 2FESH 5FCKA 2PKSC 3RLWH 1O2VA 1GI0A 1XUIA 1ZJDA 1UTQA 4FUGA 1S0RA 4WMEA 2P95A 4TY7A 4A92A 4INKA 1PPHE 3FZDA 4X8UH 3LGIA 1O3LA 2DE9A 2BVXH 4IW4E 4GHTA 4AZ2B 2ODYB 1BMLA 1O2HA 2G5NA 1D3QB 2PLXA 1TPSA 1VCWA 4DJZB 3M5OA 1SGQE 2DUCA 2ZDLA 3GY6A 3R3GB 2C90B 1BOQA 2AGGX 1AMHA 1QCPA 1V2VT 1C5MD 1CE5A 4DVAU 3SNDA 4TWYA 2ZNKH 5I46H 1AVWA 3SV7A 1OX1A 3URDA 1KDQA 2EI6A 2BD7A 4K1TA 1C1WH 2C8YB 3TIUA 4D7FA 4NA9H 3A7TA 2P8OC 2VJ1A 2AERH 2BVSH 1MTWA 1WOFA 1G2MA 3GDSA 4UDWH 1OS8A 3UQOA 4I8LA 1K1MA 2BD9A 1TGNA 1O3EA 1C1PA 1A2CH 2FTLE 1GBBA 2FI4E 1SOTA 2BDGA 1K1LA 3Q3YA 3HPTB 2XWBI 1RGQA 3ODDA 3RUOA 1ZGIA 1ZPZA 5T3HA 4NSYA 3GDVA 3U8OH 2GZ7A 2ZFSA 4UFDH 3ZVEA 1EPTA 1JBUH 8KME2 2BXUH 1G3EA 3STJA 2C3SA 1N8OB 3RLYH 1T4UH 3U8RH 3E91A 3S9BA 3RXKA 1C1UH 1K9OE 2OTVA 5LPFA 1GHBG 1NPMA 1HAIH 2XCNA 2KAIB 1HXFH 1C4U2 3DA9B 3MWIU 2OQ5A 4CBOA 4D9RA 3PTBA 3P6ZB 8LPRA 2XC0A 3SUDA 5DP4A 2HNTE 2VH0A 2BB4A 3UWJH 4NIXA 4MLFB 5HMAA 4OS2A 3TH3H 5A0BA 1FDPA 1QBNA 1MTSA 2PUQH 1ELEE 1OWJA 5GJ4B 4X1RU 3E6PH 3PLKA 4GAWA 1ZHRA 4RKOB 2ZQ1A 4IMQA 5C1XA 3EQ0H 3LOXA 1DE7H 3SOSA 1F0RA 1AUTC 1H4WA 3M7UA 4Y10E 3TK9A 3MH7A 2QXHA 4NA8A 2FOMB 1WAYB 4FU9A 2ZU2A 1THSH 1LVBA 2P93A 2GKVE 2WV5A 2UUKB 3OTJE 3GDUA 3PO1C 1BTUA 1MKXK 2XYAA 1QB1A 1YPGH 5EW1H 3GY8A 3M37A 3BEFB 1O2KA 2W5EA 1SGEE 1AN1E 1DWDH 1TNHA 4H6TA 1E38B 3ZVFA 3AAUA 4NIWA 4AGJA 1QB6A 1DUEA 1O37A 1ANDA 4HGCA 1INCA 1F5LA 4JMYA 5JB9S 2CJIA 1MMJN 4AFSA 1HB0B 1LQEA 4FUDA 1YLDA 2BDBA 1C1SA 1KY9A 1O5FH 3M3TA 4IBLH 1C5PA 3A84A 2VIDA 2CHAB 2H9TH 1OWIA 3A85A 4MTBA 2A45B 2QF0A 4INHA 4A6LA 4Y8ZA 2G5VA 4ZKOU 3H7OA 1P2NA 5AF9H 1V2LT 1M9UA 1GL0E 4WH6A 1O5GH 1SQTA 4K1SA 1MZAA 2D26C 1DDJA 1DPOA 3SJIA 5HYOA 4TYDA 3SZNA 4GVUA 1F5KU 1LVYA 1DOJA 1PPFE 1MTUA 4X2VA 1FAKH 1PPZA 5DP9A 1CQQA 2F91A 1LVOA 3E90B 4MNVA 2ZI2H 2NU3E 1GMHG 2Y5GA 4OS5A 3TH2H 4XBBA 3GY7A 1EP5A 4Y76A 1BRAA 1UMAH 5C2ZA 3QX5H 1Z1IA 2ILNA 3H5CB 1F92A 2BD3A 4FUHA 1FV9A 2AYWA 2BLVA 1KLIH 1CO7E 5EPNA 1DXWA 4KELA 3RC4A 3UY9A 2Z6BD 2OCVB 4ZKRU 4AORA 1C2LA 3SW2B 2GT7A 1HJ8A 5EPYA 2R9PA 4I31A 1O2XA 4CRFA 1A4WH 4Y7BA 1F0TA 3VB5A 1HIAA 3Q76A 1NU7B 1L1GA 1GBKA 3ATLA 3K65B 4YTAA 5EQQA 5H4IB 2BZ6H 2PKAA 1D4PB 3RXGA 1XX9A 4O3UA 3KEEA 4B2CA 1C5SA 3BF6H 1CA8B 3UTUH 1BMMH 5J4QA 1AHTH 3K9XB 2FM2A 1A3EH 2CMYA 4WXVA 3MH4A 1P0SH 1EJAA 3RMOH 5GIBA 3JZ1B 3NKKA 1ESAA 2BLOA 1G32B 1O3BA 1FZZA 1ANBA 3P8FA 1YCPH 1YPMH 1F2SE 4JZ1A 2ZC9H 3PLBA 5DP5A 1DFPA 4B74A 2CHAC 1CT0E 3RXOA 3SUFA 5G4BA 1P01A 1XMNB 2BDIA 2BMGB 2C93B 1PYTC 4O03A 1HDTH 4CRDA 2GCHF 3MMGA 1SHHB 2PSXA 1K2I1 1T32A 1O2RA 4IC5A 1L1NA 1TRYA 1FIZA 2ZDKA 5C3NA 4MPUA 2XCFA 2SGPE 3A89A 2XBVA 3T26A 1AU8A 2Y5HA 1YGCH 1QJ7B 1HJ9A 2XNIA 4KTUA 1F7ZA 1GBAA 2R3YA 2QN5T 2BY5X 1G3BA 1B7XB 2GVFA 1O3DA 2FX4A 2CF9H 2GMTC 1UCYE 1Z8JB 2UWPA 4E06H 2ODQA 3QWCH 2Y6TA 3SN8A 1MCVA 1SGNE 5A0CA 1IQNA 1HBTH 1IOEA 2JKHA 1LVMA 3SORA 4WXIA 1YLCA 4X1SU 2FX6A 2HALA 3A88A 3E8LA 3PTNA 2PSYA 2XW9A 5F8TA 2GTBA 2TGAA 2FOFA 1QA0A 2R0LA 2SNVA 2BDYA 4ZXXH 1P9UA 2FOGA 1NESE 4BXWA 1DVAH 3RXBA 1O2PA 3IWMA 2O8MA 1AKSB 5AFYH 1GHZA 3C1KA 1UK4A 2G4UA 4B73A 1ELTA 1YM0A 3RU4T 1TNGA 3RXDA 1N1LA 4BAKB 1ZMJA 1TNLA 2OQUA 3M7TA 2P16A 4Q7XA 4UFGH 1AY6H 2V6NA 4ABBA 4TWWA 4X2WA 2ZTZA
chains in the Genus database with same CATH superfamily
4E7RG 1GJ9B 4IS5A 1LPZB 1EPTC 3LGYA 4JZDH 4KTSA 4XBDA 1BUIA 1ZTLA 4Z1MD 1OP2A 3L6PA 5GWZA 3BTEE 1EJMA 1P04A 1O5EH 2PUXB 1S6FA 4O9VA 3E1XB 1J17T 1JXPA 1C5LH 1NFYA 2VWNA 5EU8A 3Q3XA 1FPHH 1UTOA 1NFUA 1FLEE 3BG4C 1BDAA 4RN6A 3V13A 1C1TA 4ABDA 3U98H 3MQKC 3CENA 5HXFA 3F68H 1V2KT 2JH0D 3DUXH 2P3TB 4NZLA 1UHBB 4GPGA 2A7JA 2ZGJA 3EA7A 1SGDE 2SGEE 3QTOH 1GI7B 1O30A 2ANYA 1COWD 1VJAU 1C5YB 1ESTA 3ZZ7A 1GBFA 1OHHD 2WHXA 4ZKNU 1RIWC 2DE8A 4YM9A 1PQ5A 1UK2A 1XXDA 4I8GA 4Y7AA 1HGTH 3A7YA 3CS7A 1UVPA 4HTCH 1SGYE 3A87A 1MBMA 4VGCB 3FAOA 4BTUB 3RXSA 3KN2A 3MNSA 5L2ZH 1LMWB 1CHOF 1BRBE 4FVBA 2J9NA 2AH4X 2JETC 3NXPA 2ZHWH 1AE8H 5E2OA 1Y3UA 1EP6A 1JMOH 3IITA 1TALA 1O3KA 4AFUA 2XWAA 3A81A 1AQ7A 1SSXA 1UTKA 2V3MA 1TOCB 1SGCA 1WUNH 1KXFA 2B5TB 2OD3B 1QR3E 5DG6A 1PQAA 4XBCA 1C2JA 3GY3A 4X2XA 1JIMA 1DICA 1H8HD 2ASUB 1GJBB 3L33A 1KTTB 1BTPA 4MPXA 1ZSLA 5EQSA 5C17A 2ANKH 5JB8S 1OOKB 3S7KB 3BTQE 2VIWA 1SMFE 1FI8A 3DT0H 1GVZA 1MABB 3A8DA 2PKSB 1OPHB 1XKAC 2A5KA 4JK5A 4WH8A 5E2PA 3FOAA 1P3EA 4RKJB 4UFFH 3SGAE 5ABWA 1D3DB 1WTHD 2H9HA 5ETXA 1C2HA 3OFND 1O2NA 3MU5A 4LXBH 2A4OA 4JK6A 1GJ4H 3RC6A 1E35B 1ELDE 5L30H 2B0FA 1CT4E 3D49H 3GCTF 2IN2A 1UVUH 4DURA 1V2NT 3SU1A 1V2JT 4Q7YA 3MI4A 4HG6A 1ELVA 2B9LA 1T8NA 3B8JA 5AFZH 2J2UA 5EOKA 4Z0KA 3LC5A 1P2IA 1FX0B 4ISLA 4Y0YE 6LPRA 4NA7A 1GHWH 3T5FH 1Z7KA 1A5HA 1KXDA 1Y3XA 1QRZA 2Z3CA 2P8OB 1BHXB 2Z7FE 3TNTA 4Q2KA 3PMJA 2WPJS 3HATH 1SC8U 3M36A 4RT0A 5A8XA 1RXPA 2XRCA 4DW2U 2CN0H 3P8GA 2M5TA 1P05A 5AHGH 4THNH 5KECA 2PGBB 2J97A 4IN2A 1WSSH 3ZZ6A 1O2OA 1ELAA 2SNWA 2V3OH 1T4VH 1MH0A 1TBZH 1TMTH 1TX8A 4ZROA 1QRXA 1KTSB 2J98B 2G81E 4M7GA 3OTPA 2FLBH 3F9HA 1HRTH 2NU4E 3UNQA 2O8WA 1O32A 3LJJA 2FP7B 1GJ8B 1KYNA 1FY4A 1OWKA 3F2FA 2W26A 2XTTB 2GCHG 1YPHE 3RM0H 3M3VA 3MFJA 1A3BH 2ZWLH 2SGQE 2BDCA 2Z3EA 3RXJA 1AI8H 1NBME 1P11E 7KMEH 4K3JA 5T6FA 1J16A 2AIQA 2WYGA 5CMXH 1J15A 4E05H 5FBIA 1ELBA 3QO6A 5TCCA 1GWAA 3FKSD 1Y3VA 2A0QB 1K1OA 4KKDA 4JZEH 3KNXA 3LGUA 4K5ZA 1UVOA 1HAHH 3TGJE 4U32A 2TGTA 1C1RA 2RDLA 2FODA 1BJUA 3RXLA 2JIZD 1BTZA 1J9CH 3OSYA 1GMDF 3P92A 3QK1A 2BOHB 4K2YA 2CF8H 5ESBA 3UR6A 1QL8A 1Z8GA 3SU4A 1ZPBA 1D6RA 3CS0A 1G3CA 5GCHF 2H5DA 2R0KA 3D65E 3TITA 1TLDA 2F9UA 3T27A 3N7OA 2OC7A 1O5AB 3D62A 2UUFB 1YYY1 2PV9B 4CRGA 5A2MH 4MVNA 2WINI 3PO1B 1SPJA 1AWHB 2QCYA 3ENSB 2RA0A 3ZZCA 5EG4A 2J4IA 5C5OA 1NRNH 5DGJA 3GY2A 5CE1A 5C1UA 1A61H 3ODFA 4AOQA 1P12E 5FBEA 1X7AC 3SV8A 1C1NA 2IJOB 3MTYA 1FXYA 3CP7A 1QJ1B 3F1SB 3KQ5A 2WV9A 1RD3B 1ELGA 4Z6AH 3MU8A 1TOMH 1WXRA 1HLTH 3BN9A 1LPKB 4P02A 1XXFA 2EI7A 2C8XB 4LK4A 3QN7A 4Y8YA 1C5UA 2EQNA 3KF2A 1UO6A 3ZZ9A 5HIZA 3UAIC 1AE5A 1W0ZU 1ZTKA 1YPLH 3UIRA 1PYTD 2KM0A 2J92A 4ABAA 2IPQX 1TMUH 1FY1A 2W6JD 2K1QA 1UCYK 4WMFA 1FY5A 3LKWA 2L74A 3KQDA 1P8VC 2F9VA 1P10A 1S6LA 1TBQH 1MTNC 1QHRB 1MKWK 4FUIA 2WV4A 3RXAA 1GJ5H 3KQBA 4B1TA 1CHOG 4JCNA 1H1BA 1V2OT 4OS4A 1GDQA 1UTMA 5DJ7A 3A83A 1VITG 5EXNA 1L0ZA 1SBWA 1TFXA 3FP8E 1FQ3A 1N6XA 3N99A 3SNAA 1BA8B 2VWLA 1TQ0B 1O5CB 4YXWD 1AVGH 2KCYA 5C1YA 1ZSKA 2AIPA 1ELCA 2O9QA 2JJ2D 2QF4A 5TJXA 1YCPM 3RMNH 1TAWA 4J2YB 1C2IA 1Y8TA 4RI0A 1C1OA 3A7WA 3GCHC 1C5OH 1EAWA 2ZPRA 5I25A 1BCUH 2A2XH 1O38A 2W7SA 3ZV8A 3FO8D 2HNTF 4YLQH 4FUCA 4YOIA 3VPKA 4K60A 4YO9A 5JBTA 4B6FA 1P3CA 3SQEE 1AB9C 3BSQA 4I86A 2VWOA 3ATIA 2QXGA 1DX5M 1GJ7B 1RRKA 2R2WU 2BHGA 1EZUC 2OC8A 1W0KD 3N7EA 1CA0C 1CBWC 3GCTG 2FDAA 3E0NB 1SOZA 4DIHH 1TB6H 4Y11E 1MCTA 1HPGA 1TX6A 1BQYA 1ZSJA 1K21H 3MO9A 1O35A 1O5BB 3BTKE 4ZMAH 4OS7A 2UWLA 1C5ZB 1E34B 2K8IA 3AASA 3K6ZA 1Z71A 1PPEE 2O8TA 4ESTE 2BLWA 1CSOE 5T1VA 3ZYEA 2B8OH 2KCPA 3ZVBA 3TU7H 4A5TS 1K1PA 1P2OA 1GVKB 1DY9A 2G4TA 4AN7A 3LT3A 3SBKA 6CHAC 1IQMA 1OSSA 2QA9E 1P03A 2OUAA 2BY7X 5B6OA 1V2TT 3SZEA 3F0PA 1SVPA 4JYVH 3EGKH 4XE4A 1EXFA 1P09A 2ZKSA 4WMDA 1QA7A 4ZHAA 3V3MA 1HAYB 1QZ8A 2V3HH 1TGCA 7GCHG 1NFWA 1QBVH 1PPBH 2ZGXH 3GCOA 3SI3H 1O2SA 3SU0A 2GMTB 1RJXB 1Z6JH 1KDQB 3RXFA 1GHVH 1SGRE 1UTLM 2HNTC 3AW1A 4A7IB 4A1TA 2FXRA 1Q31A 4INLA 3E3TA 2O8LA 1GMCF 4CR5A 3UUZA 5DP7A 1DUAA 1ID5H 4GUXA 2D8WA 2ZPQA 2A7HA 2P94A 5J4SA 2ANWA 4YOGA 5EQRA 3SU2A 3SQHE 1BBRE 1W11U 2ZHEH 4HFPB 1UTNA 1KXBA 2NU2E 2WPKS 1T31A 1YLNA 2F4LA 5F8ZA 1H8IH 1XVMA 2A32A 2BD5A 3GISB 5BPEA 3STIA 4A1VA 1IQEA 3LGVA 1O3FA 4X8VH 1T7CA 3ZVGA 1NM6A 4X2YA 5HM2A 1UJ1A 2A2QH 1NC6A 2HRVA 1EAIA 3QUMP 1CGJE 2BTCE 4R0IA 3N7DA 2GX4A 1EPTB 1AWFH 1GHYH 3R0FA 3UR9A 4BAQB 3A8CA 5A09A 1GMDG 5EODA 2ZTXA 1HYLA 3ITIA 3T25A 3ZVDA 1IHTH 2EI8A 2BQ6B 3DSGA 5GCHG 1MU8B 1O33A 2QY0B 3UWIA 2AMPA 5E0GA 1V2PT 1YPEH 3BG4B 1QB9A 1Z8IB 1HV7A 2GZ8A 3PYHA 3WY8A 3MNXA 2AFQB 2GCTC 2VIOA 2ZU3A 3HK3B 4TPYA 5DP3A 1TGBA 3ZZ3A 5FX6A 4XSKU 2FO9A 2J94A 4MQAA 2VWMA 1NS3A 1HAXB 1TABE 5B6LA 1C5WB 3SYJA 1S6HA 1RIWB 2Z9LA 2HOBA 2W6ID 3S0NA 3O8RA 1T8LA 2G52A 1OYQA 2TIOA 3I77A 4CHAC 4ZXYH 1O39A 1JRSA 1MAXA 2ZCLP 3SHCH 2SGDE 2H1UA 1MU6B 3VFEA 1DS2E 1HCGA 2HPPH 2Y7ZA 3SGQE 3FFGA 2ZFTA 1V3XA 2G55A 3I29A 2G00A 2JETB 4I32A 1LHDH 3AK5A 4LZ4B 2ANMH 5C0UA 1EX3A 1TNJA 3AAVA 1VCPA 5JBBS 1BRUP 3M5MA 1HAPH 2A31A 3FZZA 1C2MA 1BJVA 2ZFPH 3BTME 1EOJA 1TYNA 4CRCA 2AMDA 3BTTE 1S83A 1C4Y2 1Y5BT 2ZO3H 1OP8A 4KGAA 5F8XA 8GCHF 3GOVB 3FP6E 3I78A 1EKBB 4UFEH 4D7GA 5EGMA 2EC9H 3F9FA 3RXVA 5K0HA 1EASA 2PR3A 4X1NU 3MNBA 2FI3E 2OC1A 1O3NA 1O3IA 3BEIB 3UOUA 3ZZAA 3ZV9A 2ZHFH 1SR5C 2Z94A 2Y82A 1WTGH 3DHKH 1A7SA 2GGVB 2I6QA 3F6UH 5C5NA 1C1VH 1RS0A 4GSOA 3UFAA 2FI5E 5LH8A 2Z3DA 1HNEE 1SLWB 1BITA 3RXUA 4BOHA 4FUJA 4X0WU 4AB9A 2ULLA 3AVZA 3MOCA 4U30A 4AFQA 2ODPA 1CGIE 3C27B 3U8TH 2W7UA 1GBHA 3PM3A 1O2LA 3OE7D 2BXTH 1Y3WA 1IQLA 1GI6A 1WBGB 5JYIA 1QJ6B 4ISOA 1FIWA 1QIXB 3PMBB 2GV6A 2XBXA 4X8SH 1MZDA 1BTWA 1VR1H 2AGEX 3RXHA 2ZDNA 1XVOA 2AS9A 2EA3A 3VGCC 3A8BA 1HAOH 2CGAA 2ALPA 2WPMS 5DO4H 1MQ5A 4BANB 3H7TA 1GBMA 2Q6DA 4NZQA 1O3CA 1B5GH 1YPJH 2P3FH 4DCDA 1ANCA 1TBRH 3M5LA 3VB3A 1GJ6A 1TONA 3DFLA 2OC0A 1QQUA 3ELAH 4NFEA 1D6WA 5FPTA 1B0FA 2ZDVH 3UNSA 4ABFA 4OS6A 1SGTA 2Y80A 5DP8A 4WY3A 4MNWA 1GDUA 1ETTH 3BEUA 4IGDA 1WQVH 2ZTYA 5DKMA 1CVWH 2VU8E 1ETSH 4KP0A 3B9FH 4SGBE 1KSNA 2XXLA 1G3DA 3VB4A 1VITF 1G9IE 1IQKA 4B2BA 1GGDC 2IPHA 3S7HB 4Q63A 1HIAB 3UB0A 3M61U 2Z9KA 1C2GA 2KCOA 3VG8A 4UE7H 2O8UA 3ATMA 3PWBA 4Q4LA 1UVTH 1XUJA 4HZHA 1QURH 2PKAB 3FVFB 3HK6B 3M5NA 3TJUA 5EW2H 2OBOA 4AYYB 2VVVA 2PWXA 1BZXE 1JRTA 1ARCA 3QLPH 1GI8B 2J5UA 3FN8A 1EATA 2BY9X 3WWBA 2VIQA 1FONA 1AUJA 1ZRBA 4H42U 2YMSC 1V2UT 1C9PA 4CREA 2VNTA 3W95A 1BTXA 1CHGA 1SGFA 4CBNA 1KXAA 1HUTH 5K7RA 4MPVA 2FYQA 3TVJB 2QE7D 3LJOA 3GY5A 1A1RA 1GI4A 4ZH8A 4ABJA 1GBEA 2C8ZB 4NGAH 1GHXH 3MU4A 1V2ST 3VXFH 4YESB 1C1MA 3O8DA 1P02A 4CR9A 4K8YA 3LDXH 1EB1H 5ESTE 1W7XH 1GMCG 3FANA 3SU3A 1DWBH 1C5QA 4K8BA 4CH8B 3RDZA 2D2DA 1K22H 4FUFA 1G30B 5E0HA 1NTPA 1ORFA 3MU0A 1DXPA 2CK3D 3TNSA 3OY5U 1BB0B 1QQ4A 4ABHA 1ARBA 2F83A 3LC3A 3M35A 4JYTA 2F3CE 2HVXA 3RXMA 1ZOMA 2FLRH 3E0PB 3P8NA 4BNRA 2KAIA 2QYIA 2ZDMA 5F6MA 3V7TA 1Y3YA 3PMAB 3VXEH 4FUBA 6GCHG 1UK3A 4E7NA 1BTYA 1A0JA 2GT8A 5HKKD 1SLXB 4YOJA 1MD7A 1WYKA 2ZFFH 1JIRA 3KCGH 3ZZ4A 4AG2A 3MO3A 1GG6C 1AZZA 1UCYH 2AMQA 4FUEA 3M7QA 1E37B 3PRDA 4NCYA 2TRMA 3T28A 4IC6A 1EZXC 3V12A 2Y7XA 2SFAA 1LHEH 2BQ7B 1HFDA 3A82A 3SNBA 5IYTA 3ZZ5A 4R8TB 2VGCC 2ZGCA 3MH5A 7GCHF 1PPCE 3BTHE 1P2MA 1QGFA 1DM4B 3A7ZA 1QFKH 1W8BH 2XBYA 3HKJB 1GBLA 1C9TA 1PQ7A 3BTFE 1EZSC 2YNAA 1G2LA 3K2UA 2ZECA 3GICB 3KL6A 2Z9JA 3OEED 2PTNA 4XOJA 4ABGA 4ISIH 4Y79A 3OEHD 3NCLA 5HM9A 1J14A 1GBDA 1H8DH 2IOTA 4BTTB 1MTNB 1V2WT 1W13U 3QGNB 1CGHA 1MD8A 3GCNA 1MKXH 1O3PB 3A7XA 2BM2A 3RMLH 4AB8A 3A7VA 1DY8A 1PQ8A 1SL3A 1FJSA 1BBRK 2RCEA 4AX9H 4NSVA 1TRMA 2V0BA 2R3UA 9ESTA 1KXCA 1V2QT 2Q6FA 5L2YH 4Y71A 1AFEH 5CHBA 1Y5AT 3OAAD 5AVDA 1O36A 5DP6A 2F9BH 2PHBA 2XC4A 1DLKB 3U1JB 1SGPE 1EZQA 1TPOA 4F4OC 5LGOA 8GCHG 3RXEA 1AGJA 3U9AH 1ZMNA 2H2ZA 3SJKA 2VIVA 3ZVCA 2XOKD 3F3BA 1IQIA 2QXIA 1RFNA 3GCHB 4OGYA 5DPAA 5SGAE 4YLUA 1C5VA 4I8HA 1KLTA 2LPRA 1UVSH 1H9IE 1RTLA 3SU5A 3RXRA 4AYVB 4ZAEA 1WCZA 1AB9B 1TX7A 2A5IA 2KCAA 2SGFE 3TGKE 2FS9A 2BX4A 2ZGBH 2G8TA 2GP9B 3P8OA 3SO3A 4BXSA 1P2JA 3SI4H 2THFB 3PB1E 2QIQA 4GCHG 1CA0B 1CBWB 2HPQH 2ZQ2A 1C5NH 3P17H 2ESTE 1E0FD 3WWFA 1OP0A 1NRSH 1SGIB 3F9GA 3EE7A 3RP2A 2JH6D 5TCAA 1LO6A 1QTFA 2WSSD 1MQ6A 1W10U 2NU1E 3ZVAA 4NWKA 3TK6A 2TBSA 1QL9A 1HJAC 2QV1A 1YBWA 4NG9H 3PROA 1GI1A 1NN6A 1TA6A 4PROA 3QTVH 1QBOA 1LTOA 1AFQC 1LCYA 5F03A 1C1QA 5FPSA 2ZIQH 1O2YA 3VB7A 1O2TA 2KX4A 1W12U 6CHAB 2BDAA 4AFZA 4ZCNA 3MHWU 2FOBA 3S9AA 2F9NA 1YPHC 2QAAA 3ATKA 4NFFA 5A8ZA 3TJVA 5F53A 2J95A 2RA3A 3OY6U 4ABEA 1O2WA 3S69A 3KQEA 3UQVA 2ZP0H 1IQHA 1S82A 4X6NA 5FPYA 5JPMH 4F48B 4TPIZ 1UTJA 3BTGE 2QXJA 2BQWB 1O2ZA 3GY4A 4D9QA 1G36A 5GPIB 1C2EA 1J8AA 1NRRH 9LPRA 1C5RA 4O97A 3TGIE 3UPEA 5IDKA 2WUCA 1FN6A 1SFQB 2EY4C 1N6YA 4I33A 1F0SA 1UTPA 1Z1JA 1TNKA 2FYRA 2GZ9A 3PWCA 2G51A 3TH4H 3DSOA 2ZU5A 2OXSA 1SLVB 1DSUA 1D9IA 2A1DB 2WUBA 5CHAB 1W0YH 4X6MA 1QL7A 4OM9A 4BAMB 5A0AE 4DY7B 2NWNA 1CU1A 1GBCA 3BTWE 2FIRH 1IQFA 4B75A 1H9HE 3NK8A 2QF3A 1YP9A 2WYJA 3BG8A 2ZU1A 1ABJH 3A86A 1JOUB 4FVDA 1O2JA 3SV2H 3KHVA 1E36B 3LGTA 7LPRA 3ZZBA 1XUKA 1TWXB 1S0QA 2ZHDA 1PPGE 1W7GH 3HGNA 1NT1A 4ABIA 2RFKC 1L1JA 2BLQA 1A0LA 1LQDB 1SQRA 1ZJKA 2SGAA 1NRPH 1ZR0A 1ELFA 4GLYA 1MUEB 2GCTB 4MDSA 4IN1A 2RG3A 1ZHMA 1AKSA 2GD4B 1MBQA 2P3UB 2ZHQH 4BAHB 2ALVA 2A4RA 2K0QA 1RTFB 1MTVA 1XUGA 3MH6A 4DG4A 1IAUA 3ZZDA 4DT7B 4Y0ZE 2Q6GA 4ACAA 4Q7ZA 1E1RD 2F9OA 3ZYDA 4CHAB 5C0TA 1AZ8A 2BX3A 1DITH 3KQCA 2FEQH 5LPRA 1O3GA 2OP9A 5E8EH 4ZKSU 1GBIA 3RXPA 3P95A 3HGPA 3UNRA 3ATWA 1EUFA 2CV3A 2Z9IA 2ZFRH 1N8OC 4ZHMU 1SLUB 3MNCA 5PTPA 1BT7A 1YC0A 4SGAE 5C20A 1NU9A 2GDDA 3D23A 1T8OA 2C8WB 4X6PA 1EAUA 1VGCB 4TT3D 8ESTE 5EJLA 4QT8C 4YT7H 2KFWA 2HLCA 4D76A 2QF5A 2JJ1D 3BIUH 2QGRA 2C4FH 1UHBA 2AGIX 1GBTA 1GI9B 4B2AA 1F5RA 4WF8A 3DSPA 4XFQA 1VZQH 2YMSD 4UONA 3OYPA 1H9LB 1ZRKA 3BIVH 4Y6DA 2BD8A 2A4QA 1HAVA 1O34A 1Q3XA 1ZTJA 1C2DA 2ZZUH 2FOHA 3RXIA 1DT2A 2FOCA 5CHAC 4Q80A 1LDTT 1VCQA 2FOAA 1DSTA 3BV9B 5T6DA 6GCHF 4ISHH 1O2MA 5C67A 2FMJA 2H5CA 1FY3A 4NIYA 1GHAF 4H6SB 3RXTA 5FAHA 2PTCE 1SQOA 1ZGVA 1SFIA 3UOPA 3H09A 1FAXA 2EEKA 1O2QA 3DD2H 2VVUA 1QNJA 1XUHA 1Z8RA 1HXEH 1RTKA 4K1EA 4CRBA 2V35A 1SHYA 4O3TA 1PFXC 2RDEA 2TGPZ 3EE0B 2BD4A 3F9EA 1P2KA 1PJPA 3PMHB 4I8JA 1O3OA 2GDEH 1Z6EA 3TK5A 2YOLA 1FY8E 1V2RT 4AGKA 1GJDB 2UWOA 1NY22 2BY8X 4UEHH 3QZQA 1P06A 3O8CA 3VGCB 1V6DA 1DWCH 2H9EH 3W94A 3WW7A 5BRRE 3RC5A 2JH5D 2OINA 1ZZZA 3F2HA 4X1PU 1OYTH 1QRWA 2NU0E 2YNBA 1AIXH 1NROH 2IJD1 2Y81A 2STBE 4I7YH 2TGDA 1WU1A 5FXLA 5DK1A 3T2NA 1F0UA 3LH3A 1NFXA 2ZU4A 5JBCS 4HI3A 1ZYOA 5JDUB 1ETRH 1SB1H 1FUJA 5EJZA 1BMFD 1FNIA 1L4DA 1AVXA 1BMAA 2FTMA 5EIYA 4RSPA 1VGCC 2ZA5A 2ZF0H 2TPIZ 2FS8A 3SHAH 2QC2A 3UREA 2B7DH 1K1IA 3S9CA 3SUGA 1GCTB 3TJNA 3SUEA 3GYMA 3QGJA 1Y5UT 1YY3A 1GGDB 1A5IA 1ZHPA 4MG3A 1BRCE 1Q2WA 1EB2A 1VJ9U 1XUFA 3SJ9A 3EA9A 2GV7A 3PLPA 1NRQH 4K69A 4M9FA 1BMNH 3ZZ8A 1JWTA 2FOEA 1BTHH 3PV5A 4FXGH 1SGFG 2OLGA 5GXPA 3KYGA 2ZCHP 1GPZA 1L4ZA 2YMSB 1FN8A 1ABIH 1FPCH 4BAOB 2CXVA 1OWDA 7ESTE 2I6SA 4RT1A 4DOQA 2PGQB 1W14U 1O2IA 1P2QA 1LKBA 1O2GH 5L6NH 1EOLA 1IQGA 2WPLS 2J98A 1MAYA 2UUYA 3LIWA 3Q3KA 1C2KA 1AD8H 3EA8A 3E16B 4JZIA 2W3IA 3EAJA 4GCHF 1GI2A 1HAGE 1GJCB 1WV7H 4I8KA 4Y8XA 1K1JA 4WVPE 3RXQA 2ZG0H 3V0XA 2A7CA 1XKBC 1LHCH 1XM1A 1NO9H 4OGXA 1S84A 4WJG2 1OKXA 4XD7D 3TPIZ 1O3HA 3KGPA 1KMHB 2D1JA 1E79D 1GI3A 3FP7E 3Q77A 3U28C 1LHFH 5GDSH 4DIIH 1O3JA 1THRH 4YT6H 5A8YA 4TY6A 2ZFQH 3RU4D 1O0DH 1YF4A 2PW8H 3SNCA 4F49A 3SU6A 1GG6B 5FX5A 4A1XA 1HAZB 4D8NA 3O8BA 2BZAA 2J38A 2XBWA 3K6YA 1KIGH 1TGSZ 1B0EA 3MU1A 3RXCA 1L2EA 4XDEA 4OS1A 1TNIA 2LNCA 3T62A 2WPIS 1LHGH 5E0JA 1U6QA 3VB6A 4ISNA 4IMZA 2VGCB 1H8ED 4MPWA 3SJOA 4ASHA 5DN6D 1GCTC 3RM2H 1O3AA 1GBJA 3A80A 1HAVB 2UUJB 1GHBF 1BBRH 4F55A 2AEIH 1TGTA 2VVCA 4X1QU 1K28D 5JBAS 3LONA 3IG6B 3TLOA 4AG1A 1P9SA 2H6MA 2VBCA 3SV9A 3ESTA 2WPHS 1GVLA 1TRNA 1YCPK 1AO5A 2Y5FA 2STAE 1DANH 1OXGA 4B76A 1GJAB 3NPSA 1K1NA 2ZDAH 4CRAA 3MO6A 1LKAA 1QY6A 1NBMD 3LH1A 1EAXA 3RMMH 3JZ2B 4FU8A 1LPGB 1ACBE 4GHQA 1TQ7B 1YPKH 3LPRA 1GL1A 3HKIB 3SV6A 1DLEA 4J1YA 2OBQA 1TIOA 1ZPCA 1KXEA 3SNEA 3T29A 2VH6A 1BIOA 3PV4A 1S81A 5LPEA 3G01A 1O5DH 1ZMLA 3U1IB 1O3MA 4U2WA 2M2AA 3NUMA 2ZCKP 1C5XB 4JYUH 1EFRD 4UD9H 2Z9GA 1G37A 3QZRA 2A5AA 1WQSA 1EQ9A 1ZLRA 1GCDA 2FZZA 4MNXA 4BTIB 4NIVA 2GJGA 2A4GA 3L3TA 4MNYA 3SGBE 1TPAE 4X6OA 3VEQB 5EJ1A 4LZ1H 1GHAG 1W3CA 3A8AA 3TJOA 1OWEA 3P70B 2BDHA 3NZIA 1FMGA 4ZHLU 1W2KH 3GYLB 1EJNA 3OX7U 4NWLA 4ZUHA 2Q1JA 1MKWH 1SI5H 3MYWA 3RU4E 1YKTA 3EYDA 4JZFH 1NZQH 2FPZA 3DFJA 1A46H 3URCA 1CT2E 4X8TH 4YZUA 2ZPSA 1S85A 2LP6A 5EXLA 2VINA 1O2UA 1C2FA 1SG8B 1C4V2 2HGTH 4VGCC 5HGGA 4DGJA 4LOYH 1HJAB 3CNRA 2ZEBA 1IHSH 5FCRA 2BVRH 1GI5A 2BD2A 2VIPA 5EXMA 5FHTA 5T6GA 1SQAA 2W3KA 4B71A 1A0HB 3AW0A 2ZGHA 1BHXF 2BY6X 2FWWA 1AFQB 1ESBA 1TA2A 2HVYB 1OWHA 3BTDE 2PFEA 3EDXB 1GMHF 1DWEH 1KLJH 1TE0A 2BYAX 1S5SA 2XC5A 2VB0A 1D3TB 3B23B 3KIDU 2F9PA 4FU7A 1IQJA 1O31A 4H4FA 3OU0A 3LU9B 4WWYA 1D3PB 1TPPA 3LGWA 1T8MA 3U69H 2J34A 2HWLB 6ESTA 3SJ8A 2R2MB 1A5GH 1Y59T 3NWUA 1W0JD 1THPB 1V2MT 2WZQA 1ANEA 4U01A 2P59A 1C5TA 4KTCA 3Q00A 3QDZB 2BOKA 1GDNA 3M3SA 4CH2B 1VITH 1TMBH 1P57B 2FESH 5FCKA 2PKSC 3RLWH 1O2VA 1GI0A 1XUIA 1ZJDA 1UTQA 1E1QD 4FUGA 1S0RA 4WMEA 2P95A 4TY7A 4A92A 4INKA 1PPHE 3FZDA 4X8UH 3LGIA 1O3LA 2DE9A 2BVXH 4IW4E 3KYFA 4GHTA 4AZ2B 2ODYB 1BMLA 1O2HA 2G5NA 1D3QB 2PLXA 1TPSA 1VCWA 4DJZB 3M5OA 1SGQE 2DUCA 2ZDLA 3GY6A 3R3GB 2C90B 1BOQA 2AGGX 3GS9A 1AMHA 1QCPA 1V2VT 1C5MD 1CE5A 4DVAU 3SNDA 4TWYA 2ZNKH 2L6OA 5I46H 1AVWA 3SV7A 1OX1A 3URDA 1KDQA 2EI6A 2BD7A 4K1TA 1C1WH 2C8YB 3TIUA 4D7FA 2KR7A 4ACBA 4NA9H 3A7TA 2P8OC 2VJ1A 2AERH 3F0OA 2BVSH 1MTWA 1WOFA 1G2MA 3GDSA 4UDWH 1OS8A 3UQOA 4I8LA 1K1MA 2BD9A 1TGNA 1O3EA 1C1PA 1A2CH 2FTLE 1GBBA 2FI4E 1SOTA 2BDGA 1K1LA 3Q3YA 4TSFD 3HPTB 2XWBI 1RGQA 3ODDA 3RUOA 1ZGIA 1ZPZA 5T3HA 4NSYA 3GDVA 3U8OH 2GZ7A 5CDFE 2ZFSA 4UFDH 3ZVEA 1EPTA 1JBUH 8KME2 2BXUH 1G3EA 3STJA 2C3SA 1N8OB 3RLYH 1T4UH 3U8RH 3E91A 3S9BA 3RXKA 1C1UH 1K9OE 1YWUA 2OTVA 5LPFA 1GHBG 1NPMA 1HAIH 1UW7A 2XCNA 2KAIB 1HXFH 1C4U2 5KEDA 3DA9B 3MWIU 2OQ5A 4CBOA 4D9RA 3PTBA 3P6ZB 8LPRA 2XC0A 3SUDA 5KGOA 4P00A 5DP4A 2HNTE 2VH0A 2BB4A 3UWJH 4NIXA 4MLFB 3NRLA 4OS2A 5HMAA 3TH3H 5A0BA 1FDPA 1QBNA 1MTSA 2PUQH 1ELEE 1OWJA 5GJ4B 4X1RU 3E6PH 3PLKA 4GAWA 5DSFA 1ZHRA 2JDID 4RKOB 2ZQ1A 4IMQA 5C1XA 3EQ0H 3LOXA 1DE7H 3SOSA 1F0RA 1AUTC 1H4WA 3M7UA 4Y10E 1WDIA 3TK9A 3MH7A 2QXHA 4NA8A 2FOMB 1WAYB 4FU9A 2ZU2A 1THSH 1LVBA 2P93A 2GKVE 2V7QD 2WV5A 2UUKB 3OTJE 2XNDD 3GDUA 3PO1C 1BTUA 1MKXK 2XYAA 1QB1A 1YPGH 4B6EA 5EW1H 3GY8A 3M37A 3BEFB 1O2KA 2W5EA 1SGEE 1AN1E 1DWDH 1TNHA 4H6TA 1E38B 3ZVFA 1VKYA 3AAUA 4NIWA 4AGJA 1QB6A 1DUEA 1O37A 1ANDA 4HGCA 1INCA 1F5LA 4JMYA 5JB9S 2CJIA 1MMJN 4AFSA 1HB0B 1LQEA 4FUDA 1YLDA 2BDBA 1C1SA 1KY9A 1O5FH 2F43B 3M3TA 4IBLH 1C5PA 3A84A 2VIDA 5FL7D 2CHAB 2H9TH 5GNDA 1OWIA 3A85A 4MTBA 2A45B 2QF0A 4INHA 4A6LA 4Y8ZA 2G5VA 4ZKOU 3H7OA 1P2NA 5AF9H 1V2LT 1M9UA 1GL0E 4WH6A 1O5GH 1SQTA 4K1SA 1MZAA 2D26C 1DDJA 1DPOA 3SJIA 5HYOA 4TYDA 3SZNA 4GVUA 1F5KU 1LVYA 1DOJA 1PPFE 1MTUA 4X2VA 1FAKH 1PPZA 5DP9A 1CQQA 2F91A 1LVOA 3E90B 4MNVA 2ZI2H 2NU3E 1GMHG 2Y5GA 4OS5A 3TH2H 4XBBA 3GY7A 1EP5A 4Y76A 1BRAA 1UMAH 5C2ZA 3QX5H 5C94A 3PV2A 1Z1IA 2ILNA 3H5CB 1F92A 2BD3A 4FUHA 1FV9A 2AYWA 2BLVA 1KLIH 1CO7E 4XRNA 5EPNA 1DXWA 1SKYE 4KELA 3RC4A 3UY9A 2Z6BD 2OCVB 4ZKRU 4AORA 1C2LA 3SW2B 2GT7A 1HJ8A 5EPYA 2R9PA 4I31A 1O2XA 4CRFA 1A4WH 4Y7BA 1F0TA 3VB5A 1HIAA 3Q76A 1NU7B 1L1GA 1GBKA 3ATLA 3K65B 4YTAA 5EQQA 5H4IB 2BZ6H 2PKAA 1D4PB 3RXGA 3PRBA 1XX9A 4O3UA 3KEEA 4B2CA 1C5SA 3BF6H 1CA8B 3UTUH 1BMMH 5J4QA 1AHTH 3K9XB 2FM2A 1A3EH 2CMYA 4WXVA 3DCLA 3MH4A 1P0SH 1EJAA 3RMOH 5GIBA 4FOUC 3JZ1B 3NKKA 1ESAA 2BLOA 5HIYA 1G32B 1O3BA 1FZZA 1ANBA 3P8FA 1YCPH 4ASUD 1YPMH 1F2SE 4JZ1A 2ZC9H 3PLBA 5DP5A 1DFPA 4B74A 2CHAC 1CT0E 3RXOA 1K0HA 2LELA 3SUFA 5G4BA 3ZIAD 4DT4A 1P01A 1XMNB 2BDIA 2BMGB 2C93B 1PYTC 4O03A 1HDTH 4CRDA 2GCHF 3MMGA 1SHHB 2PSXA 1K2I1 1T32A 1O2RA 4IC5A 1L1NA 1TRYA 1FIZA 2ZDKA 5C3NA 4MPUA 2XCFA 3F2GA 2SGPE 3A89A 2XBVA 3T26A 1AU8A 2Y5HA 1YGCH 2OK5A 1QJ7B 1HJ9A 2XNIA 4KTUA 1F7ZA 1GBAA 2R3YA 2QN5T 2BY5X 1G3BA 2PP6A 1B7XB 2GVFA 1O3DA 2FX4A 2CF9H 2GMTC 1UCYE 1Z8JB 2UWPA 4E06H 2ODQA 3QWCH 2HLDD 2Y6TA 1MCVA 1SGNE 3SN8A 5A0CA 1IQNA 1HBTH 1IOEA 2JKHA 1LVMA 3SORA 4WXIA 1YLCA 4X1SU 2FX6A 2HALA 3A88A 3E8LA 3PTNA 2PSYA 2XW9A 5F8TA 4FETA 2GTBA 2TGAA 2FOFA 5IK2D 1QA0A 2R0LA 2SNVA 2BDYA 4AC9A 4ZXXH 1P9UA 2FOGA 1NESE 4BXWA 1DVAH 3RXBA 2WPDD 1O2PA 3IWMA 2KZ4A 1AKSB 2O8MA 2AHME 5AFYH 1GHZA 3C1KA 1UK4A 2G4UA 4B73A 1ELTA 1YM0A 3RU4T 1TNGA 3RXDA 1N1LA 4BAKB 1ZMJA 1TNLA 2OQUA 3W1EA 3M7TA 2P16A 4Q7XA 4UFGH 1AY6H 2V6NA 4ABBA 4TWWA 4X2WA 2ZTZA
chains in the Genus database with same CATH topology
4E7RG 1GJ9B 4IS5A 1LPZB 1EPTC 3LGYA 4JZDH 4KTSA 4XBDA 1BUIA 1ZTLA 1OP2A 3L6PA 5GWZA 3BTEE 1EJMA 1P04A 1O5EH 2PUXB 1S6FA 4O9VA 3E1XB 1J17T 1JXPA 1C5LH 1NFYA 2VWNA 5EU8A 3Q3XA 1FPHH 1UTOA 1NFUA 1FLEE 3BG4C 1BDAA 4RN6A 3V13A 1C1TA 4ABDA 3U98H 3CENA 5HXFA 3F68H 1V2KT 2JH0D 3DUXH 2P3TB 4NZLA 1UHBB 4GPGA 2A7JA 2ZGJA 3EA7A 1SGDE 2SGEE 3QTOH 1GI7B 1O30A 2ANYA 1VJAU 1C5YB 1ESTA 3ZZ7A 1GBFA 4ZKNU 1RIWC 2DE8A 4YM9A 1PQ5A 1UK2A 1XXDA 4I8GA 4Y7AA 1HGTH 3A7YA 3CS7A 1UVPA 4HTCH 1SGYE 3A87A 1MBMA 4VGCB 3FAOA 4BTUB 3RXSA 3KN2A 3MNSA 5L2ZH 1LMWB 1CHOF 1BRBE 4FVBA 2J9NA 2AH4X 2JETC 3NXPA 2ZHWH 1AE8H 5E2OA 1Y3UA 1EP6A 1JMOH 3IITA 1TALA 1O3KA 4AFUA 2XWAA 3A81A 1AQ7A 1SSXA 1UTKA 1TOCB 1SGCA 1WUNH 1KXFA 2B5TB 2OD3B 1QR3E 5DG6A 1PQAA 4XBCA 1C2JA 3GY3A 4X2XA 1JIMA 1DICA 2ASUB 1GJBB 3L33A 1KTTB 1BTPA 4MPXA 1ZSLA 5EQSA 2ANKH 5JB8S 1OOKB 3S7KB 3BTQE 2VIWA 1SMFE 1FI8A 3DT0H 1GVZA 3A8DA 2PKSB 1OPHB 1XKAC 2A5KA 4JK5A 4WH8A 5E2PA 1P3EA 4RKJB 4UFFH 3SGAE 5ABWA 1D3DB 1WTHD 2H9HA 5ETXA 1C2HA 1O2NA 3MU5A 4LXBH 2A4OA 4JK6A 1GJ4H 3RC6A 1E35B 1ELDE 5L30H 2B0FA 1CT4E 3D49H 3GCTF 2IN2A 1UVUH 4DURA 1V2NT 3SU1A 1V2JT 4Q7YA 3MI4A 1ELVA 2B9LA 1T8NA 3B8JA 5AFZH 2J2UA 5EOKA 4Z0KA 3LC5A 1P2IA 4ISLA 4Y0YE 6LPRA 4NA7A 1GHWH 3T5FH 1Z7KA 1A5HA 1KXDA 1Y3XA 1QRZA 2Z3CA 2P8OB 1BHXB 2Z7FE 3TNTA 4Q2KA 3PMJA 2WPJS 3HATH 1SC8U 3M36A 5A8XA 1RXPA 2XRCA 4DW2U 2CN0H 3P8GA 2M5TA 1P05A 5AHGH 4THNH 2PGBB 4IN2A 1WSSH 3ZZ6A 1O2OA 1ELAA 2SNWA 2V3OH 1T4VH 1MH0A 1TBZH 1TMTH 1TX8A 4ZROA 1QRXA 1KTSB 2G81E 4M7GA 2FLBH 3F9HA 1HRTH 2NU4E 3UNQA 2O8WA 1O32A 3LJJA 2FP7B 1GJ8B 1KYNA 1FY4A 1OWKA 2W26A 2XTTB 2GCHG 1YPHE 3RM0H 3M3VA 3MFJA 1A3BH 2ZWLH 2SGQE 2BDCA 2Z3EA 3RXJA 1AI8H 1P11E 7KMEH 4K3JA 5T6FA 1J16A 2AIQA 2WYGA 5CMXH 1J15A 4E05H 5FBIA 1ELBA 3QO6A 5TCCA 1GWAA 1Y3VA 2A0QB 1K1OA 4KKDA 4JZEH 3KNXA 3LGUA 4K5ZA 1UVOA 1HAHH 3TGJE 4U32A 2TGTA 1C1RA 2RDLA 2FODA 1BJUA 3RXLA 1BTZA 1J9CH 3OSYA 1GMDF 3P92A 3QK1A 2BOHB 4K2YA 2CF8H 5ESBA 3UR6A 1QL8A 1Z8GA 3SU4A 1ZPBA 1D6RA 3CS0A 1G3CA 5GCHF 2H5DA 2R0KA 3D65E 3TITA 1TLDA 2F9UA 3T27A 3N7OA 2OC7A 1O5AB 3D62A 2UUFB 1YYY1 2PV9B 4CRGA 5A2MH 4MVNA 2WINI 3PO1B 1SPJA 1AWHB 2QCYA 3ENSB 2RA0A 3ZZCA 5EG4A 2J4IA 5C5OA 1NRNH 5DGJA 3GY2A 5CE1A 5C1UA 1A61H 3ODFA 4AOQA 1P12E 5FBEA 1X7AC 3SV8A 1C1NA 2IJOB 3MTYA 1FXYA 3CP7A 1QJ1B 3F1SB 1RD3B 1ELGA 4Z6AH 3MU8A 1TOMH 1HLTH 3BN9A 1LPKB 1XXFA 2EI7A 2C8XB 4LK4A 3QN7A 4Y8YA 1C5UA 3KF2A 1UO6A 3ZZ9A 1AE5A 1W0ZU 1ZTKA 1YPLH 3UIRA 1PYTD 2J92A 4ABAA 1TMUH 1FY1A 2K1QA 1UCYK 4WMFA 1FY5A 3LKWA 3KQDA 1P8VC 2F9VA 1P10A 1TBQH 1MTNC 1QHRB 1MKWK 4FUIA 2WV4A 3RXAA 1GJ5H 3KQBA 4B1TA 1CHOG 4JCNA 1H1BA 1V2OT 4OS4A 1GDQA 1UTMA 5DJ7A 3A83A 1VITG 5EXNA 1L0ZA 1SBWA 1TFXA 3FP8E 1FQ3A 1N6XA 3SNAA 1BA8B 2VWLA 1TQ0B 1O5CB 1AVGH 5C1YA 1ZSKA 2AIPA 1ELCA 2O9QA 5TJXA 1YCPM 3RMNH 1TAWA 4J2YB 1C2IA 1Y8TA 1C1OA 3A7WA 3GCHC 1C5OH 1EAWA 2ZPRA 5I25A 1BCUH 2A2XH 1O38A 2W7SA 3ZV8A 2HNTF 4YLQH 4FUCA 4YOIA 3VPKA 4K60A 4YO9A 5JBTA 1P3CA 3SQEE 1AB9C 3BSQA 2VWOA 3ATIA 2QXGA 1DX5M 1GJ7B 1RRKA 2R2WU 2OC8A 1EZUC 2BHGA 1CA0C 1CBWC 3GCTG 2FDAA 3E0NB 1SOZA 4DIHH 1TB6H 4Y11E 1MCTA 1HPGA 1TX6A 1BQYA 1ZSJA 1K21H 3MO9A 1O35A 1O5BB 3BTKE 4ZMAH 4OS7A 2UWLA 1C5ZB 1E34B 3AASA 3K6ZA 1Z71A 1PPEE 2O8TA 4ESTE 2BLWA 1CSOE 3ZYEA 2B8OH 3ZVBA 3TU7H 4A5TS 1K1PA 1P2OA 1GVKB 1DY9A 2G4TA 4AN7A 3LT3A 3SBKA 6CHAC 1IQMA 1OSSA 2QA9E 1P03A 2OUAA 2BY7X 5B6OA 1V2TT 1SVPA 4JYVH 3EGKH 4XE4A 1EXFA 1P09A 2ZKSA 4WMDA 1QA7A 4ZHAA 3V3MA 1HAYB 2V3HH 1TGCA 7GCHG 1NFWA 1QBVH 1PPBH 2ZGXH 3GCOA 3SI3H 1O2SA 3SU0A 2GMTB 1RJXB 1Z6JH 1KDQB 3RXFA 1GHVH 1SGRE 1UTLM 2HNTC 3AW1A 4A7IB 4A1TA 2FXRA 1Q31A 4INLA 3E3TA 2O8LA 1GMCF 4CR5A 3UUZA 5DP7A 1DUAA 1ID5H 4GUXA 2D8WA 2ZPQA 2A7HA 2P94A 5J4SA 2ANWA 4YOGA 5EQRA 3SU2A 3SQHE 1BBRE 1W11U 2ZHEH 4HFPB 1UTNA 1KXBA 2NU2E 2WPKS 1T31A 5F8ZA 1H8IH 1XVMA 2A32A 2BD5A 3GISB 5BPEA 3STIA 4A1VA 1IQEA 3LGVA 1O3FA 4X8VH 1T7CA 3ZVGA 1NM6A 4X2YA 5HM2A 1UJ1A 2A2QH 1NC6A 2HRVA 1EAIA 3QUMP 1CGJE 2BTCE 4R0IA 2GX4A 1EPTB 1AWFH 1GHYH 3R0FA 3UR9A 4BAQB 3A8CA 5A09A 1GMDG 5EODA 2ZTXA 1HYLA 3ITIA 3T25A 3ZVDA 1IHTH 2EI8A 2BQ6B 5GCHG 1MU8B 1O33A 2QY0B 3UWIA 2AMPA 5E0GA 1V2PT 1YPEH 3BG4B 1QB9A 1Z8IB 1HV7A 2GZ8A 3PYHA 3WY8A 3MNXA 2AFQB 2GCTC 2VIOA 2ZU3A 3HK3B 4TPYA 5DP3A 1TGBA 3ZZ3A 5FX6A 4XSKU 2FO9A 2J94A 4MQAA 2VWMA 1NS3A 1HAXB 1TABE 1C5WB 1S6HA 1RIWB 2Z9LA 2HOBA 3S0NA 3O8RA 1T8LA 2G52A 1OYQA 2TIOA 3I77A 4CHAC 4ZXYH 1O39A 1JRSA 1MAXA 2ZCLP 3SHCH 2SGDE 2H1UA 1MU6B 3VFEA 1DS2E 1HCGA 2HPPH 2Y7ZA 3SGQE 3FFGA 2ZFTA 1V3XA 2G55A 3I29A 2G00A 2JETB 4I32A 1LHDH 4LZ4B 2ANMH 1EX3A 1TNJA 3AAVA 1VCPA 5JBBS 1BRUP 3M5MA 1HAPH 2A31A 3FZZA 1C2MA 1BJVA 2ZFPH 3BTME 1EOJA 1TYNA 4CRCA 2AMDA 3BTTE 1S83A 1C4Y2 1Y5BT 2ZO3H 1OP8A 4KGAA 5F8XA 8GCHF 3GOVB 3FP6E 3I78A 1EKBB 4UFEH 4D7GA 5EGMA 2EC9H 3F9FA 3RXVA 5K0HA 1EASA 2PR3A 4X1NU 3MNBA 2FI3E 2OC1A 1O3NA 1O3IA 3BEIB 3UOUA 3ZZAA 3ZV9A 2ZHFH 1SR5C 2Z94A 2Y82A 1WTGH 3DHKH 1A7SA 2GGVB 2I6QA 3F6UH 5C5NA 1C1VH 1RS0A 4GSOA 3UFAA 2FI5E 5LH8A 2Z3DA 1HNEE 1SLWB 1BITA 3RXUA 4BOHA 4FUJA 4X0WU 4AB9A 2ULLA 3AVZA 3MOCA 4U30A 4AFQA 2ODPA 1CGIE 3C27B 3U8TH 2W7UA 1GBHA 3PM3A 1O2LA 2BXTH 1Y3WA 1IQLA 1GI6A 1WBGB 5JYIA 1QJ6B 4ISOA 1FIWA 1QIXB 3PMBB 2GV6A 2XBXA 4X8SH 1MZDA 1BTWA 1VR1H 2AGEX 3RXHA 2ZDNA 1XVOA 2AS9A 2EA3A 3VGCC 3A8BA 1HAOH 2CGAA 2ALPA 2WPMS 5DO4H 1MQ5A 4BANB 3H7TA 1GBMA 2Q6DA 4NZQA 1O3CA 1B5GH 1YPJH 2P3FH 4DCDA 1ANCA 1TBRH 3M5LA 3VB3A 1GJ6A 1TONA 3DFLA 2OC0A 1QQUA 3ELAH 4NFEA 1D6WA 5FPTA 1B0FA 2ZDVH 3UNSA 4ABFA 4OS6A 1SGTA 2Y80A 5DP8A 4WY3A 4MNWA 1GDUA 1ETTH 3BEUA 4IGDA 1WQVH 2ZTYA 5DKMA 1CVWH 2VU8E 1ETSH 4KP0A 3B9FH 4SGBE 1KSNA 2XXLA 1G3DA 3VB4A 1VITF 1G9IE 1IQKA 4B2BA 1GGDC 2IPHA 3S7HB 1HIAB 3M61U 2Z9KA 1C2GA 4UE7H 2O8UA 3ATMA 3PWBA 1UVTH 1XUJA 4HZHA 1QURH 2PKAB 3FVFB 3HK6B 3M5NA 3TJUA 5EW2H 2OBOA 4AYYB 2VVVA 2PWXA 1BZXE 1JRTA 1ARCA 3QLPH 1GI8B 1EATA 2BY9X 2VIQA 1FONA 1AUJA 1ZRBA 4H42U 1V2UT 1C9PA 4CREA 2VNTA 3W95A 1BTXA 1CHGA 1SGFA 4CBNA 1KXAA 1HUTH 5K7RA 4MPVA 2FYQA 3TVJB 3LJOA 3GY5A 1A1RA 1GI4A 4ZH8A 4ABJA 1GBEA 2C8ZB 4NGAH 1GHXH 3MU4A 1V2ST 3VXFH 4YESB 1C1MA 3O8DA 1P02A 4CR9A 4K8YA 3LDXH 1EB1H 5ESTE 1W7XH 1GMCG 3FANA 3SU3A 1DWBH 1C5QA 4K8BA 4CH8B 3RDZA 2D2DA 1K22H 4FUFA 1G30B 5E0HA 1NTPA 1ORFA 3MU0A 1DXPA 3TNSA 3OY5U 1BB0B 1QQ4A 4ABHA 1ARBA 2F83A 3LC3A 3M35A 4JYTA 2F3CE 2HVXA 3RXMA 1ZOMA 2FLRH 3E0PB 3P8NA 4BNRA 2KAIA 2QYIA 2ZDMA 5F6MA 3V7TA 1Y3YA 3PMAB 3VXEH 4FUBA 6GCHG 1UK3A 4E7NA 1BTYA 1A0JA 2GT8A 1SLXB 4YOJA 1MD7A 1WYKA 2ZFFH 1JIRA 3KCGH 3ZZ4A 4AG2A 3MO3A 1GG6C 1AZZA 1UCYH 2AMQA 4FUEA 3M7QA 1E37B 4NCYA 2TRMA 3T28A 4IC6A 1EZXC 3V12A 2Y7XA 2SFAA 1LHEH 2BQ7B 1HFDA 3A82A 3SNBA 5IYTA 3ZZ5A 4R8TB 2VGCC 2ZGCA 3MH5A 7GCHF 1PPCE 3BTHE 1P2MA 1QGFA 1DM4B 3A7ZA 1QFKH 1W8BH 2XBYA 3HKJB 1GBLA 1C9TA 1PQ7A 3BTFE 1EZSC 2YNAA 1G2LA 3K2UA 2ZECA 3GICB 3KL6A 2Z9JA 2PTNA 4XOJA 4ABGA 4ISIH 4Y79A 5HM9A 3NCLA 1J14A 1GBDA 1H8DH 2IOTA 4BTTB 1MTNB 1V2WT 1W13U 3QGNB 1CGHA 1MD8A 3GCNA 1MKXH 1O3PB 3A7XA 2BM2A 3RMLH 4AB8A 3A7VA 1DY8A 1PQ8A 1SL3A 1FJSA 1BBRK 2RCEA 4AX9H 4NSVA 1TRMA 2V0BA 2R3UA 9ESTA 1KXCA 1V2QT 2Q6FA 5L2YH 4Y71A 1AFEH 1Y5AT 5AVDA 1O36A 5DP6A 2F9BH 2PHBA 2XC4A 1DLKB 3U1JB 1SGPE 1EZQA 1TPOA 4F4OC 5LGOA 8GCHG 3RXEA 1AGJA 3U9AH 1ZMNA 2H2ZA 3SJKA 2VIVA 3ZVCA 1IQIA 2QXIA 1RFNA 3GCHB 4OGYA 5DPAA 5SGAE 4YLUA 1C5VA 4I8HA 1KLTA 2LPRA 1UVSH 1H9IE 1RTLA 3SU5A 3RXRA 4AYVB 4ZAEA 1WCZA 1AB9B 1TX7A 2A5IA 2SGFE 3TGKE 2FS9A 2BX4A 2ZGBH 2G8TA 2GP9B 3P8OA 3SO3A 4BXSA 1P2JA 3SI4H 2THFB 3PB1E 2QIQA 4GCHG 1CA0B 1CBWB 2HPQH 2ZQ2A 1C5NH 3P17H 2ESTE 1E0FD 1OP0A 1NRSH 1SGIB 3F9GA 3RP2A 2JH6D 5TCAA 1LO6A 1QTFA 1MQ6A 1W10U 2NU1E 3ZVAA 4NWKA 3TK6A 2TBSA 1QL9A 1HJAC 2QV1A 1YBWA 4NG9H 3PROA 1GI1A 1NN6A 1TA6A 4PROA 3QTVH 1QBOA 1LTOA 1AFQC 1LCYA 5F03A 1C1QA 5FPSA 2ZIQH 1O2YA 3VB7A 1O2TA 1W12U 6CHAB 2BDAA 4AFZA 3MHWU 2FOBA 3S9AA 2F9NA 1YPHC 2QAAA 3ATKA 4NFFA 5A8Z