2XWKA

Siap r147a mutant in complex with neu5ac
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
309
structure length
309
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLAVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tripartite ATP-Independent Periplasmic (Trap) Transporters Use an Arginine-Mediated Selectivity Filter for High Affinity Substrate Binding.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
total genus 121
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xwkA00
4P1LA 4DI4B 3GYYA 2ZZVA 2VPOA 2HZKA 4OVQA 4OA4A 4MEVA 4O7MA 4OVSA 2XWKA 4PF8A 4XF5A 2CEYA 3B50A 4MNIA 5I5PA 4MMPA 4DI3D 2PFYA 2XWVA 4P47A 4PE3A 4MHFA 4PGPA 4XFEA 4NHBA 4PDDA 4N4UA 4MIJA 4PFBA 5IM2A 5IGAA 4XEQA 4LN5A 4N6KA 3U65A 5IZZA 4YICA 4MNCA 4N8GA 2XA5A 5I7IA 4X8RA 4PBQA 4UABA 5CM6A 4P8BA 3FXBA 4PETA 4MX6A 4OANA 4OVRA 4PFRA 4PAIA 4N15A 4PC9A 4PFIA 4NAPA 4N8YA 2CEXA 4P56A 4PAKA 2HZLA 2ZZXA 4O8MA 4OVTA 5LTCA 4PGNA 4PAFA 4PF6A 4MCOA 2V4CA 2VPNA 2ZZWA 4NX1A 2WX9A 4N17A 2PFZA 4N91A 4P1EA 4NGUA 4O94A 2XWIA 2WYPA 4NN3A 4OVPA 4N6DA 4PCDA 2XXKA 4X04A 4NQ8A 2XWOA 4NF0A 4PBHA 4PDHA 4NG7A 4YZZA 4MNPA 4P9KA 2HPGA 4MAGA 4P3LA 2WYKA
chains in the Genus database with same CATH superfamily
1AMFA 1AH5A 1LB9A 1WVJA 3PMWA 2DOJA 4ELRA 3UP9A 1IIWA 2HZKA 2DXYA 4OZ9A 1QGXA 2GHAA 5ET6A 2H25A 5T3JA 4P0GA 5I84A 3KBZA 2AYSA 4IO6A 2O6AA 3FXUA 5IZ3B 3C9HA 3NOHA 3UN6A 5ITPA 3EQ1A 1B2HA 1LEVA 2L5VA 4PFBA 1N7XA 5IZ3A 4NF5A 4BDOA 4KD5A 3H6TA 1FPEA 2AL4A 4ECFA 1UIVA 5IAIA 4I9DA 1Q9DA 1KA1A 1IQ7A 1LBWA 3UIFA 3S9EA 3HO7A 4XKNA 3CFXA 3MYUA 5KCJA 4OYVA 2Z23A 1HSJA 2FIXA 1FBHA 3VLWA 4H5GA 3KOSA 1FW0A 3P7IA 1NH7A 1Y4CA 2UVIA 1D9VA 2B4MA 3IB2A 1B9JA 4QSEA 4ZEIA 1Y1MA 3R6UA 4LA9A 2OBGA 3VE1B 4GFRA 4FORA 4M4GA 3PPNA 4PFWA 1ZJLA 4E0XA 2G29A 1Y3QA 4YZZA 3H6VA 4R75A 3IFCA 3RGYA 5AA4B 1XT8A 4OVJA 2H5YA 3FZVA 2F5XA 4ZS9A 1NV1A 3BIHA 3K6WA 1DTZA 3S9LC 3K2DA 4OVSA 4MNIA 3O28A 1FBCA 1II5A 1LSTA 3Q29A 4MHFA 3H06B 2UYEA 1ELJA 3G3IA 3QXMA 1SDXA 2PT1A 4NF4A 1IXGA 4IB2A 1FBFA 5IZZA 2I3VA 5JK4A 5DEXA 3T66A 4P8BA 1S9TA 3K1PA 4OVRA 1RYOA 5DEXB 3RYDA 2D21A 4F1UA 2OK2A 3FXRA 1SW1A 2QPQA 4PGNA 4F29A 2PFZA 3LSLA 4Q5TA 4GX6A 1B05A 3IOTA 2XWIA 1FRPA 2OWSA 2B4LA 2DVCA 4JBZA 3BKIB 4QF9A 3TTKA 2XWOA 3N6UA 1SVXB 4F18A 5FTHA 1XOCA 4MAGA 3VDFA 1DTGA 4IR8A 1LB8A 3LUYA 3TTRA 2DXRA 3MUQA 4G77A 3RPWA 4GX4A 3O66A 2M8CA 5KZTA 4YU0A 3ZSFA 3EHTA 5I57B 1FQAA 4ONYA 2NUVA 2VGQA 4I3EA 3KC0A 3CSGA 3GXAA 3EPEA 1LFGA 5I5PA 2VD3A 1UTHB 3HPIA 3OO9A 3I6VA 4U22A 4PGPA 3A29A 1LFHA 3PD9A 3Q28A 3MVWA 4NHBA 5J1DA 3ECRA 4YKPA 3FVKA 2CZKA 1QULA 4F1VA 1OIBA 1B7HA 4U4XA 4NF5B 3KSJA 1MM6A 2VP1A 2RCAA 2HHMA 4XXUA 3A09A 4RYAA 1WDNA 5TU0A 1FPBA 2OX3A 4U1ZA 5HM4B 3V8XB 3OMBA 1RDZA 3U94A 4BLAA 3FUZA 4BDRA 1B32A 4G2ZA 4GXSB 5FTIA 4LVQA 4PFIA 1D9YA 1JNFA 4H8JA 2LAOA 4NWCA 2D5WA 2F78A 2WBDA 2B3FA 3M8UA 2Q8MA 2W7YA 2XX9A 3CIJA 4I1DA 4LQ2A 4KPTA 1QKAA 2DE4A 1P1UA 4NE4A 4NQ8A 4PDHA 1TXFA 4MNPA 1JW5A 2F7CA 4DI4B 3HFUA 1P99A 3K0VA 3FVGA 3IO4A 3OO7A 3ILTB 4DLDA 5DVJA 4RNSA 5CMKA 1SBPA 2CZIA 4OA4A 4XKPA 1FQDA 3PUZE 3DLNA 4RK2A 3RPLB 1GR2A 3QYTA 3M3LA 5H8FB 2Y5LA 2XWVA 3HHFA 1UQWA 4LUBA 3ROJA 3PUWE 3G3HA 4QFLA 2REGA 1QUIA 1MS7A 2V84A 3MAMA 3PUVE 4QFKA 3T96B 5L8DA 2WEFA 4HE2A 4EDPA 5F24A 4U1OA 2XA5A 1NV0A 5KDTA 1P1WA 2Q74A 1B6HA 4N15A 5EHMA 2YJPA 1INPA 3MWBA 5KDTB 4DZ1A 3G3KA 2RC9A 3HV1A 3FJGA 1NFTA 2ZZXA 4JDFA 3ISPA 3ZKKA 1URSA 5H8QB 1EYKA 2B3BA 3TTMA 5L9OA 1FTKA 3K6VA 1LCFA 3OSQA 3PPQA 3SERA 1MPDA 2O7IA 3FBPA 1A7LA 1IMBA 1H76A 4QSDA 4F39A 4PBHA 2DWJA 1N3WA 2GH9A 2ESNA 4OFOA 3LC8A 3OD7A 1LBZA 1FPLA 2RCBA 3IOUA 5ICTA 2QVUA 3E9XA 1EYJA 2GRVA 1N04A 2Q89A 1FQBA 1GVCA 3L6HA 4OVQA 1N3XA 1Z7ME 1ZBMA 3K4UA 4KQPA 2P3NA 4F22A 4PF8A 3G7WA 4PQJA 1IXIA 5FHMA 2A5SA 4U21A 3U72A 2HQ0A 2UVGA 4R6HA 1NNFA 4NF8A 4YMAA 2RINA 2Q88A 1A8FA 4GBVA 4YMBA 3O9PA 2REJA 2XXIA 3OENA 2HXRA 1NV3A 5H8NB 3H3GA 3E78A 4OANA 2O84X 4OMBA 3I5OA 5H8NA 1POY1 4GWXA 1B0LA 4F2OA 3TDJA 5CMCA 4X48A 3MZ1A 5KCJB 5CC2A 3SKPA 4P56A 3FATA 4OHNA 2Y84A 2F7AA 2XD2A 4OVTA 1OQHA 4NWDA 4RPNA 4C1TA 3MZ9A 4FE8A 2R71A 1A8EA 3VV5A 2V93A 2XD3A 3S2VA 3RPLA 4MF3A 4WEDA 2OZZA 5H8FA 4F3BA 1B5JA 4YB7A 3HHGA 4OEUA 5I56B 5J16A 3L6GA 1MXYA 4ELOA 1B5IA 3Q25A 3RLFE 1MQDA 1MDP1 4P3LA 2OJTA 1D9QA 1CE2A 1URGA 5A5LA 3MVZA 1KZ8A 1NNKA 3GLBA 4OTEA 4RK9A 4ZEBA 3VXBA 2GQ1A 1MXWA 4LATA 2XWKA 4GVOA 1LGBC 4DI3D 2NWJA 1P1QA 1FTLA 1NV6A 4LZ8A 4TOZA 1P1NA 1B1HA 2DDKA 1T0KA 1ZKBA 1R1NA 2F3DA 3JZJA 1B0HA 4F3SA 5H8QA 1MY3A 3MJNA 2ZNTA 5IGAA 4NF6B 2XXUA 4Z7EA 1BLFA 3V89B 1DBZA 2QJEA 2QS1A 3MBPA 1B3LA 1M5CA 4ZZEA 2DQVA 3FJMA 1Y4TA 2QMWA 4IY5A 4PE5B 1WODA 3UGWA 3H7MA 1B51A 1H45A 1IMFA 1SD3A 1MH4A 4DCXA 2Q2AA 2DE3A 1Y20A 5TP9B 4WKMA 1DK4A 5IZ1A 1OLCA 4BDLA 4BDNA 4DXUA 3EHUA 3FXQA 1LFIA 3MPKA 2P0SA 2WX9A 1S7YA 5I2KA 4HCWA 4TQUQ 1FPFA 5EQ8A 2ANJA 2MKZA 2BJIA 3I3VA 1QUJA 1MY2A 4GXAA 4EXKA 3ZKLA 1M5BA 2WKYA 1H43A 4P9KA 3MC2A 1MQJA 4JVDA 4C1UA 2DE2A 4HXVA 4RXLA 3OEKA 3QMFA 4H46A 2P2AA 3K00A 3DM0A 4OQOA 4LP2B 1A54A 1G0HA 4OETA 4DCYA 1SI1A 4MEVA 3QK6A 5FHNA 3B50A 1JEVA 1USYH 4FECA 5K2XA 2PFYA 2GHBA 5I2KB 3K01A 4KYSA 1O63A 1NI9A 3B6QA 3HCQA 3BFUA 4NF8B 2F8DA 4H65A 5DVFA 3ODBA 3HN0A 1FQFA 1MXUA 4GWZA 5BUUA 3CR9A 4IY6A 4YB5A 4ZE8A 4RPOA 2NOOA 4UABA 2PVUA 3IB1A 1GGGA 2XXHA 1IMEA 1B4ZA 3IK6B 4GBWA 2Z8EA 3DELB 4YKKA 3VLVA 3RNNA 2DWIA 3O6GA 3MP6A 1FTMA 3EN3A 4QXDA 2OWZA 1MPCA 3C4MA 1J1NA 3C36A 3KFMA 2I4BA 3MVXA 2XXWA 1YYZA 1LAHE 4RA1A 2FYIA 3T9HB 3RT6B 2AL5A 4OVPA 3MP8A 2R6GE 5ICQA 3RTWB 2RC8A 1NL5A 3VVFA 1M5FA 3K1NA 3QAXA 1NH8A 3R7XA 2Z8DA 4POWA 1NNTA 4NG7A 4KFQA 2QS3A 3TELA 3RN8A 1B5HA 2Q9TA 3H03A 4X1DA 2ALUA 1PBQA 3RQTA 2Y7KA 5EHSA 3TYHA 4O3CA 3QUFA 4GF8A 1DOTA 3MSTA 2R8TA 2ZMBA 1FCKA 4EF1A 1SW4A 4IO5A 4P47A 2VOZA 5F7VA 3KN7A 4EXLA 1B7UA 1BTJA 1QKBA 5B7DA 4G8MA 4BDQA 2IA4A 4RY1A 1XI6A 3O6IA 4MIJA 4NF6A 1FTJA 1MXVA 4XEQA 4LN5A 2YLNA 4N13A 1ZLQA 4IO7A 2O1MA 3S9MC 1EU8A 5DVIA 3K6UA 4YICA 2Y5KA 3FIRA 4X8RA 2RC7A 2Q8JA 3V83A 1KWHA 1Z7NE 3B6TA 4JWYA 1QVSA 5EYGA 1NKXA 4ND9A 3KOTA 3GBAA 1YPNA 2NXOA 2Y7RA 3N94A 2O69A 5ESYA 5CI5A 4DE8A 4ELPA 2GFEA 2OWTA 4H1XA 3W9WA 2V3UA 1SPIA 3N5LA 2HAUA 5CBRA 3DP4A 2WYPA 3CG1A 1SQYA 3SEUA 1I6BA 2I4CA 4N07A 3H6WA 3FJ7A 5ET8A 1Y3PA 4XTCQ 4P1LA 3OO6A 1LAXA 2XXXA 4M1VA 3S4UA 3T9VA 1B40A 4QRZA 3IAZA 4F1YA 5A5XA 4UACA 4F3GA 3TZAA 5AA2B 3A3CA 2DS9A 3OSRA 3C34A 4Q0CA 3TKDA 4F19A 4UA8A 3KBRA 2F34A 3LSXA 5B70A 5EQ7A 5CRYA 3PV0E 2I58A 5HBCA 4C0RA 5AA1A 3TQWA 4OWDA 1NUYA 4FBPA 1D4NA 4R74A 1TFAA 4JVCA 4MBPA 5I56A 4F2QA 1EYIA 5ET7A 2ZNSA 4N8GA 3IR1A 1EZOA 4XIGQ 1N84A 3VLUA 4IGTA 3PTYA 4YKJA 2VHAA 2VT5A 2WBBA 2PX1A 4E0WA 2HAVA 3FGSA 4X9TA 1RDXA 1PDAA 4HE1A 5I58B 3KG2A 5AE4A 3T0JA 1MXZA 1JETA 3QIMA 2G93A 2OCUA 2UYFA 2QS4A 1M5DA 4XKQA 4H6DA 5I2NB 2ZYKA 2QFLA 3GBBA 1FPGA 1B3EA 3OEMA 3VFJA 2O68A 4KI0E 3TTNA 1FBEA 1QJMA 3IJXB 4DDDA 3MW0A 4KR5A 4MLQA 4GWUA 1NV2A 4ELQA 4KCCA 1PC3A 4FIMA 2V3TA 4DIGA 1MPBA 3USDA 2DYXA 1LAFE 1RKMA 1LBYA 3ILUB 3SEXA 1B3FA 1UTHA 3B8BA 3PUYE 1CNQA 3LR1A 4G68C 4QHQA 1PEBA 1DMBA 3SESA 1TWYA 4OFJA 2ONRA 3MVYA 5IM2A 5JTYA 3SETA 3QSLA 3MZBA 3RUMA 4HS7A 1ZTYA 3IO6A 4I8CA 5I7IA 4L17A 4O3BA 5H8HB 4QSCA 2OLBA 5ISUA 1A40A 1I6AA 2DVZA 1URDA 2I48A 3ZS6A 4N8YA 4GQOA 1ZU0A 4R6YA 3TAJA 2XXVA 3OXNA 1BKAA 3T9XB 4FAJA 2VPNA 1OVTA 2HXWA 4FEBA 1UIUA 2QRYA 3CI8A 3FD3A 3K1MA 5TPAB 1YCJA 5LOMA 4DXCA 2ABHA 1AWBA 1XHYA 2ONSA 3OELA 4OXVA 1FTAA 4H0WA 4PCDA 3CHGA 3T9UA 1MY1A 1Q1KA 3JYRA 5AA3A 4U4SA 1EH3A 2QL3A 4H5FA 1BIYA 4JSOA 5AA2A 4NTLA 4KHZE 5I59B 3SEYA 5EQAA 5DW8A 4EUOA 2HEUA 1IMCA 2THIA 3H4ZA 1MDQA 4O3AA 2E1SA 2RF1A 1VFDA 1A55A 4G8HA 4PE3A 4MLVA 1JW1A 2I49A 2NVUB 4WXJA 4JWOA 1YXIA 3T22A 2XXTA 4KYDA 4KCDA 4ZDMA 2FHYA 1SW5A 4PFTA 4WEPA 2F6PA 2O51A 4GIZA 3TMGA 5A5XB 4MNCA 1R6ZA 1AIVA 3LBSA 1H44A 1OMPA 4JVIA 5ITOA 4PBQA 2PBWA 1B46A 3K02A 3TPAA 4OEVA 3G3JA 5I59A 3DP8A 1JW4A 1LBVA 1US4A 4ZE9A 3JV9A 4Z0IA 3LSFB 4N6PA 2HZLA 5LTCA 1P1OA 3RTFB 2ZZWA 4AS4A 3SEWA 4N17A 1FPIA 1I69A 4I40A 4NF4B 3KJTA 4G68A 4N6DA 4ESWA 2ZYNA 2UVJA 1DCUA 4EQ9A 4X04A 3UK4A 3FVOA 5CMBA 1NV7A 2FVZA 5TP9A 2QMXA 1JQFA 1PB7A 1MQGA 2H4IA 1JEUA 2X7PA 3TEPA 1I6QA 1IITA 3PPOA 4OFLA 4MH5A 1QUKA 4ZEDA 2CZHA 2DP8A 3CG3A 4EQ7A 1DPPA 2PYYA 3TFLA 4GRKA 3E3KA 1Q35A 4R9GA 2DSFA 4R72A 4PDDA 2Z8FA 1XVXA 1IXHA 3SDFA 1O64A 4POXA 2ZNUA 3K6XA 3M3FA 3CFLA 4QFPA 1NUXA 2AIXA 3KC1A 4PFRA 4PAIA 4O7IA 1IUDA 2H99A 3G3FA 2R9JA 1LAGE 4JXIA 4ZEFA 2DWHA 1XS5A 1PB8A 3E4RA 1FPJA 1B58A 1FBPA 4R9FA 1VSOA 1ANFA 4IO3A 3W9VA 3IOVA 4GX3A 4NX1A 2YPNA 4N91A 4P1EA 1LBCA 1IMDA 3D1RA 3WAEA 1GV8A 2P1SA 4JSDA 5EYHA 3B6WA 4KXPA 4GOTA 1VFEA 1IZ1A 2PMSA 2I0BA 2E0SA 4R73A 2FBPA 2F36A 2Y7WA 3CFZA 3DP6A 3N26A 5L9SA 4HCYA 2I3WA 3GYYA 4OERA 4TLMB 2XXQA 3IOWA 2F3BA 1ZMGA 1B3GA 1Y3NA 1QW0A 3SEVA 5DTBA 1A99A 4H8IA 2I6EA 3MPLA 4PFUA 2FIEA 1D3KA 4GWSA 1MRPA 2UXAA 1YZ0A 4X1BA 1JVXA 2CEYA 1MXXA 4DXBA 2D3IA 3M3KA 4PP0A 3TUSA 1O7TA 4HW8A 1LLSA 1OQGA 3D4CA 5M2VA 3BBRA 4ESXA 1N7WA 5ET5A 4NMYA 1MY4A 1N76A 1FSAA 1SI0A 1PB9A 3TODA 1SYIA 2QVVA 3HSTA 1NV5A 1POTA 3IFAA 3U93A 1TT1A 1HSEA 3PUXE 4PETA 2ZXTA 4EQBA 4H67A 4THIA 4MFIA 4H45A 2H9BA 1GTKA 5L9MA 1FBGA 3PD8A 4NAPA 4YAHX 5AA2D 3PMVA 2XX8A 2CEXA 3IORA 4PAKA 1UTBA 4O8MA 1B4HA 2F7BA 2CMOA 1IXCA 4PAFA 1LCTA 4EF2A 5EYFA 3CSBA 2ONKE 3O2AA 4G4PA 2KLFA 4ZEKA 3VXCA 1AL3A 3U8QA 1OVBA 5ELVA 1SYHA 1FQCA 2V25A 1NMUA 4LONB 1MY0A 2A5TA 2PT2A 3UA8A 1JP4A 5BWJA 4QBAA 4OENA 3N6TA 2KQZA 3FV1A 4K3FA 4AQ4A 3PU5A 3TCGA 4YKIA 3V5AA 1YAEA 2P3VA 3BIGA 1BP5A 2Z22A 2RKMA 4I3YA 2Y7PA 3IJOB 5I3SA 1M5EA 2KR0A 2O1LA 2VPOA 5I57A 1US5A 3FASA 4G61A 4ZZAA 4GLIA 1FJ6A 3T93B 2F6GA 1DSNA 3O6HA 3KSXA 3C33A 4XFEA 4U2RA 5TPAA 2H98A 4GL0A 1EZ9A 3H6UA 2Y7IA 4KYEA 3QUJA 1FBDA 1Y1ZA 3TCFA 1NUWA 5CBSA 4FJPA 4U23A 4NEDA 3EKIA 3KEIA 4PTKA 4MX6A 3U1OA 1K9ZA 3PGFA 4GWOA 2HFBA 3PMXA 4AB6A 5H8HA 2QS2A 1F9BA 4R6KA 3FV2A 1NV4A 5IKBA 1CB6A 3IB0A 1IEJA 3ONMA 4AS5A 3IX1A 3AXFA 2UVHA 2Q2CA 2QSXA 1JVYA 4NN3A 1R9QA 1FPDA 3LSWA 1FJ9A 4FEDA 3Q26A 3WAFA 3S9NC 1ATGA 2O7UA 2B65A 2IEEA 3D4GA 3O29A 3G3GA 2QVRA 5HPQA 4ZECA 1DPEA 1MG1A 4Q8RA 5LDZA 4RJZA 2XHDA 3E13X 2BJJX 3C35A 3EF7A 3KGCA 3THIA 2VD2A 1L5TA 4O7MA 3O97A 1AOVA 4MMPA 2HCAA 1K9YA 4GD5A 3EHSA 2ZYOA 3BFTA 4HE0A 2XXRA 5H8SA 3KN3A 5I2NA 4N4UA 3T1BA 4PFYA 4JB7A 2F35A 4P11A 4QFOA 1B3HA 5F1QA 2X26A 3CVGA 4P0IA 3KN8A 1R9LA 3MQ9A 4GL8A 5K2YA 3RY3A 5CM6A 1MQHA 2PCRA 4TLLB 2A5TB 1BK4A 3B7DA 1LBBA 4ISUA 4LZ5A 1OLAA 1MQIA 1YTVA 1EZPA 4R2BA 1VR5A 1VE4A 1FPKA 3E79A 1UTBB 4Q30B 4PF6A 4MCOA 2V4CA 1HSLA 2JJKA 1H3DA 4GWWA 4N81A 4NGUA 4O94A 4OESA 1RYXA 1PBPA 3KZGA 3Q27A 1USYE 3R26A 3PPPA 1G0IA 5JEIA 3LUZA 2HPGA 5FBPA 1LBXA 2WYKA 3C31A 3OO8A 4LZ7A 5AA4A 2ZZVA 1RDYA 4F3PA 4MJOA 2F97A 3GZGA 1FTOA 3TQLA 3CRBA 3VVEA 4R2FA 1B1XA 4XF5A 1VDWA 4IO4A 1MH3A 3IL1B 1B52A 5I58A 3VVDA 3F11A 4F31B 1ZIUA 4I62A 2XX7A 4G8NA 5JTYB 3C32A 2FA7A 4N6KA 4XKRA 3U65A 4LQ5A 3KJ7A 3W15C 2CZLA 5CMMA 5EQ9A 5DYHA 3A3UA 3FXBA 3PPRA 2FNCA 1IMAA 1SW2A 4BDMA 3SZPA 4QFNA 4PC9A 4AB5A 3TCHA 1KA0A 1TFDA 1XVYA 3MP1A 3UORA 1XC1A 1NUZA 4IO2A 3RT8A 1Y9UA 4YB6A 2ZYMA 4IGRA 1B7ZA 2DWAA 1FQEA 1MM7A 5FHOA 1N0TA 2XXPA 1NNPA 4HTGA 3OOAA 2XXYA 2V3QA 2I0CA 3FVNA 2X7QA 4G68B 3U92A 3LV0A 4JWXA 2XXKA 5DT6A 4NF0A 1S50A 4GWYA 4FATA 3TTLA
chains in the Genus database with same CATH topology
3IFCA 2QVRA 2DE2A 4HXVA 4IR8A 4P1LA 1D9QA 3GYYA 3HFUA 4DI4B 2P3VA 3QMFA 3BIGA 5A5LA 1LBZA 4M1VA 2ZZVA 1RDYA 2F3BA 1FBEA 4GX4A 4H46A 5LDZA 1KZ8A 4MJOA 1FPLA 4GWUA 2QVUA 4I3YA 1EYJA 5EQAA 2F5XA 1NV2A 5I3SA 2GQ1A 1G0HA 2KR0A 2FIEA 2VPOA 1NV1A 3BIHA 2HZKA 4I3EA 4OVQA 2CZIA 3KC0A 4GWSA 4OA4A 4G61A 4MEVA 3MSTA 4O7MA 1IMCA 2P3NA 1YZ0A 1QGXA 2XWKA 4JVDA 4OVSA 1FJ6A 4PF8A 2CZHA 2CEYA 4XF5A 3B50A 2R8TA 1LBYA 4MNIA 5ET6A 3RPLB 1VDWA 5I5PA 4MMPA 4DI3D 2PFYA 5T3JA 2Y5LA 2XWVA 1FBCA 3B8BA 4F19A 1CNQA 1K9YA 4P47A 4PE3A 5EQ7A 4MHFA 1NI9A 1NV6A 3KBZA 3A29A 4PGPA 4HE0A 3ROJA 2DDKA 4XFEA 5IZ3B 3NOHA 1YXIA 2F3DA 5J1DA 4NHBA 1NUYA 4FBPA 4PDDA 2CZKA 1LEVA 1XI6A 4N4UA 5ET5A 4F1VA 2L5VA 4MIJA 4PFBA 5IM2A 3T1BA 5IGAA 4GBVA 1FBDA 4XEQA 4LN5A 2FHYA 5IZ3A 4N6KA 1FSAA 1NUWA 4JVCA 1DBZA 3U65A 1FBFA 2QVVA 1EYIA 1FPEA 4GWZA 4YICA 5IZZA 4MNCA 5JK4A 2HHMA 5ET7A 2WEFA 2Y5KA 4HE2A 1NV5A 1FPBA 2OX3A 3EKIA 3IFAA 4JVIA 4N8GA 2XA5A 5F24A 5I7IA 4X8RA 1NV0A 1Q9DA 2HXRA 1KA1A 1NV3A 4PBQA 4UABA 5EQ9A 1NUXA 3E78A 5CM6A 1RDZA 1LBWA 2Q74A 3FXBA 4P8BA 2PCRA 4MX6A 4OANA 4PETA 3PTYA 4OVRA 1K9ZA 3KC1A 1IMAA 1IMEA 1BK4A 4PAIA 4PFRA 4O7IA 1IMFA 4GBWA 4H45A 3MYUA 4N15A 4PC9A 3SZPA 5EYGA 4PFIA 1INPA 1FBGA 4NAPA 3RYDA 2VT5A 2DVZA 2WBBA 4QXDA 4PTKA 2DE3A 5DW8A 4GWXA 1KA0A 1LBVA 2FIXA 4F1UA 1FPJA 1NV4A 4X9TA 1FBHA 1DK4A 1FBPA 1NUZA 2OWZA 4N8YA 2WBDA 5ESYA 5IZ1A 1FPKA 3E79A 2CEXA 4P56A 5ET8A 4PAKA 2HZLA 3W9VA 2ZZXA 4O8MA 4OVTA 3ISPA 5LTCA 2QPQA 1RDXA 2B4MA 4PAFA 4MCOA 4GX3A 2V4CA 4PF6A 2VPNA 1EYKA 2JJKA 2ZZWA 4NX1A 4PGNA 4HE1A 3W9WA 4AS4A 4AS5A 1YYZA 2WX9A 4N17A 2PFZA 4GWWA 4N81A 4HCWA 2V3QA 4N91A 4GX6A 4NGUA 1SPIA 4O94A 1FPIA 4P1EA 2Q8MA 1FPFA 5EQ8A 1IMDA 2WYPA 2XWIA 3D1RA 2MKZA 4I40A 4NN3A 3RPLA 4OVPA 3T0JA 1AWBA 1FPDA 1FRPA 1FTAA 2B4LA 2BJIA 4N6DA 3LV0A 5EYHA 1FJ9A 4KXPA 4PCDA 2XXKA 3FBPA 2DE4A 3CHGA 1DCUA 1IMBA 4X04A 4NQ8A 2XWOA 4NF0A 4PBHA 4PDHA 4NG7A 4F18A 5J16A 1JP4A 1NV7A 2WYKA 1G0IA 2FVZA 4GWYA 4QBAA 2FBPA 4YZZA 4MNPA 4P9KA 2KQZA 2HPGA 3LUZA 4MAGA 5FBPA 2QFLA 4HCYA 1LBXA 4P3LA 2Q9TA 1FPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1L A;  4DI4 B;  3GYY A;  2ZZV A;  2VPO A;  2HZK A;  4OVQ A;  4OA4 A;  4MEV A;  4O7M A;  4OVS A;  2XWK A;  4PF8 A;  4XF5 A;  2CEY A;  3B50 A;  4MNI A;  5I5P A;  4MMP A;  4DI3 D;  2PFY A;  2XWV A;  4P47 A;  4PE3 A;  4MHF A;  4PGP A;  4XFE A;  4NHB A;  4PDD A;  4N4U A;  4MIJ A;  4PFB A;  5IM2 A;  5IGA A;  4XEQ A;  4LN5 A;  4N6K A;  3U65 A;  5IZZ A;  4YIC A;  4MNC A;  4N8G A;  2XA5 A;  5I7I A;  4X8R A;  4PBQ A;  4UAB A;  5CM6 A;  4P8B A;  3FXB A;  4PET A;  4MX6 A;  4OAN A;  4OVR A;  4PFR A;  4PAI A;  4N15 A;  4PC9 A;  4PFI A;  4NAP A;  4N8Y A;  2CEX A;  4P56 A;  4PAK A;  2HZL A;  2ZZX A;  4O8M A;  4OVT A;  5LTC A;  4PGN A;  4PAF A;  4PF6 A;  4MCO A;  2V4C A;  2VPN A;  2ZZW A;  4NX1 A;  2WX9 A;  4N17 A;  2PFZ A;  4N91 A;  4P1E A;  4NGU A;  4O94 A;  2XWI A;  2WYP A;  4NN3 A;  4OVP A;  4N6D A;  4PCD A;  2XXK A;  4X04 A;  4NQ8 A;  2XWO A;  4NF0 A;  4PBH A;  4PDH A;  4NG7 A;  4YZZ A;  4MNP A;  4P9K A;  2HPG A;  4MAG A;  4P3L A;  2WYK A; 
#chains in the Genus database with same CATH topology
 1AMF A;  1AH5 A;  1LB9 A;  1WVJ A;  3PMW A;  2DOJ A;  4ELR A;  3UP9 A;  1IIW A;  2HZK A;  2DXY A;  4OZ9 A;  1QGX A;  2GHA A;  5ET6 A;  2H25 A;  5T3J A;  4P0G A;  5I84 A;  3KBZ A;  2AYS A;  4IO6 A;  2O6A A;  3FXU A;  5IZ3 B;  3C9H A;  3NOH A;  3UN6 A;  5ITP A;  3EQ1 A;  1B2H A;  1LEV A;  2L5V A;  4PFB A;  1N7X A;  5IZ3 A;  4NF5 A;  4BDO A;  4KD5 A;  3H6T A;  1FPE A;  2AL4 A;  4ECF A;  1UIV A;  5IAI A;  4I9D A;  1Q9D A;  1KA1 A;  1IQ7 A;  1LBW A;  3UIF A;  3S9E A;  3HO7 A;  4XKN A;  3CFX A;  3MYU A;  5KCJ A;  4OYV A;  2Z23 A;  1HSJ A;  2FIX A;  1FBH A;  3VLW A;  4H5G A;  3KOS A;  1FW0 A;  3P7I A;  1NH7 A;  1Y4C A;  2UVI A;  1D9V A;  2B4M A;  3IB2 A;  1B9J A;  4QSE A;  4ZEI A;  1Y1M A;  3R6U A;  4LA9 A;  2OBG A;  3VE1 B;  4GFR A;  4FOR A;  4M4G A;  3PPN A;  4PFW A;  1ZJL A;  4E0X A;  2G29 A;  1Y3Q A;  4YZZ A;  3H6V A;  4R75 A;  3IFC A;  3RGY A;  5AA4 B;  1XT8 A;  4OVJ A;  2H5Y A;  3FZV A;  2F5X A;  4ZS9 A;  1NV1 A;  3BIH A;  3K6W A;  1DTZ A;  3S9L C;  3K2D A;  4OVS A;  4MNI A;  3O28 A;  1FBC A;  1II5 A;  1LST A;  3Q29 A;  4MHF A;  3H06 B;  2UYE A;  1ELJ A;  3G3I A;  3QXM A;  1SDX A;  2PT1 A;  4NF4 A;  1IXG A;  4IB2 A;  1FBF A;  5IZZ A;  2I3V A;  5JK4 A;  5DEX A;  3T66 A;  4P8B A;  1S9T A;  3K1P A;  4OVR A;  1RYO A;  5DEX B;  3RYD A;  2D21 A;  4F1U A;  2OK2 A;  3FXR A;  1SW1 A;  2QPQ A;  4PGN A;  4F29 A;  2PFZ A;  3LSL A;  4Q5T A;  4GX6 A;  1B05 A;  3IOT A;  2XWI A;  1FRP A;  2OWS A;  2B4L A;  2DVC A;  4JBZ A;  3BKI B;  4QF9 A;  3TTK A;  2XWO A;  3N6U A;  1SVX B;  4F18 A;  5FTH A;  1XOC A;  4MAG A;  3VDF A;  1DTG A;  4IR8 A;  1LB8 A;  3LUY A;  3TTR A;  2DXR A;  3MUQ A;  4G77 A;  3RPW A;  4GX4 A;  3O66 A;  2M8C A;  5KZT A;  4YU0 A;  3ZSF A;  3EHT A;  5I57 B;  1FQA A;  4ONY A;  2NUV A;  2VGQ A;  4I3E A;  3KC0 A;  3CSG A;  3GXA A;  3EPE A;  1LFG A;  5I5P A;  2VD3 A;  1UTH B;  3HPI A;  3OO9 A;  3I6V A;  4U22 A;  4PGP A;  3A29 A;  1LFH A;  3PD9 A;  3Q28 A;  3MVW A;  4NHB A;  5J1D A;  3ECR A;  4YKP A;  3FVK A;  2CZK A;  1QUL A;  4F1V A;  1OIB A;  1B7H A;  4U4X A;  4NF5 B;  3KSJ A;  1MM6 A;  2VP1 A;  2RCA A;  2HHM A;  4XXU A;  3A09 A;  4RYA A;  1WDN A;  5TU0 A;  1FPB A;  2OX3 A;  4U1Z A;  5HM4 B;  3V8X B;  3OMB A;  1RDZ A;  3U94 A;  4BLA A;  3FUZ A;  4BDR A;  1B32 A;  4G2Z A;  4GXS B;  5FTI A;  4LVQ A;  4PFI A;  1D9Y A;  1JNF A;  4H8J A;  2LAO A;  4NWC A;  2D5W A;  2F78 A;  2WBD A;  2B3F A;  3M8U A;  2Q8M A;  2W7Y A;  2XX9 A;  3CIJ A;  4I1D A;  4LQ2 A;  4KPT A;  1QKA A;  2DE4 A;  1P1U A;  4NE4 A;  4NQ8 A;  4PDH A;  1TXF A;  4MNP A;  1JW5 A;  2F7C A;  4DI4 B;  3HFU A;  1P99 A;  3K0V A;  3FVG A;  3IO4 A;  3OO7 A;  3ILT B;  4DLD A;  5DVJ A;  4RNS A;  5CMK A;  1SBP A;  2CZI A;  4OA4 A;  4XKP A;  1FQD A;  3PUZ E;  3DLN A;  4RK2 A;  3RPL B;  1GR2 A;  3QYT A;  3M3L A;  5H8F B;  2Y5L A;  2XWV A;  3HHF A;  1UQW A;  4LUB A;  3ROJ A;  3PUW E;  3G3H A;  4QFL A;  2REG A;  1QUI A;  1MS7 A;  2V84 A;  3MAM A;  3PUV E;  4QFK A;  3T96 B;  5L8D A;  2WEF A;  4HE2 A;  4EDP A;  5F24 A;  4U1O A;  2XA5 A;  1NV0 A;  5KDT A;  1P1W A;  2Q74 A;  1B6H A;  4N15 A;  5EHM A;  2YJP A;  1INP A;  3MWB A;  5KDT B;  4DZ1 A;  3G3K A;  2RC9 A;  3HV1 A;  3FJG A;  1NFT A;  2ZZX A;  4JDF A;  3ISP A;  3ZKK A;  1URS A;  5H8Q B;  1EYK A;  2B3B A;  3TTM A;  5L9O A;  1FTK A;  3K6V A;  1LCF A;  3OSQ A;  3PPQ A;  3SER A;  1MPD A;  2O7I A;  3FBP A;  1A7L A;  1IMB A;  1H76 A;  4QSD A;  4F39 A;  4PBH A;  2DWJ A;  1N3W A;  2GH9 A;  2ESN A;  4OFO A;  3LC8 A;  3OD7 A;  1LBZ A;  1FPL A;  2RCB A;  3IOU A;  5ICT A;  2QVU A;  3E9X A;  1EYJ A;  2GRV A;  1N04 A;  2Q89 A;  1FQB A;  1GVC A;  3L6H A;  4OVQ A;  1N3X A;  1Z7M E;  1ZBM A;  3K4U A;  4KQP A;  2P3N A;  4F22 A;  4PF8 A;  3G7W A;  4PQJ A;  1IXI A;  5FHM A;  2A5S A;  4U21 A;  3U72 A;  2HQ0 A;  2UVG A;  4R6H A;  1NNF A;  4NF8 A;  4YMA A;  2RIN A;  2Q88 A;  1A8F A;  4GBV A;  4YMB A;  3O9P A;  2REJ A;  2XXI A;  3OEN A;  2HXR A;  1NV3 A;  5H8N B;  3H3G A;  3E78 A;  4OAN A;  2O84 X;  4OMB A;  3I5O A;  5H8N A;  1POY 1;  4GWX A;  1B0L A;  4F2O A;  3TDJ A;  5CMC A;  4X48 A;  3MZ1 A;  5KCJ B;  5CC2 A;  3SKP A;  4P56 A;  3FAT A;  4OHN A;  2Y84 A;  2F7A A;  2XD2 A;  4OVT A;  1OQH A;  4NWD A;  4RPN A;  4C1T A;  3MZ9 A;  4FE8 A;  2R71 A;  1A8E A;  3VV5 A;  2V93 A;  2XD3 A;  3S2V A;  3RPL A;  4MF3 A;  4WED A;  2OZZ A;  5H8F A;  4F3B A;  1B5J A;  4YB7 A;  3HHG A;  4OEU A;  5I56 B;  5J16 A;  3L6G A;  1MXY A;  4ELO A;  1B5I A;  3Q25 A;  3RLF E;  1MQD A;  1MDP 1;  4P3L A;  2OJT A;  1D9Q A;  1CE2 A;  1URG A;  5A5L A;  3MVZ A;  1KZ8 A;  1NNK A;  3GLB A;  4OTE A;  4RK9 A;  4ZEB A;  3VXB A;  2GQ1 A;  1MXW A;  4LAT A;  2XWK A;  4GVO A;  1LGB C;  4DI3 D;  2NWJ A;  1P1Q A;  1FTL A;  1NV6 A;  4LZ8 A;  4TOZ A;  1P1N A;  1B1H A;  2DDK A;  1T0K A;  1ZKB A;  1R1N A;  2F3D A;  3JZJ A;  1B0H A;  4F3S A;  5H8Q A;  1MY3 A;  3MJN A;  2ZNT A;  5IGA A;  4NF6 B;  2XXU A;  4Z7E A;  1BLF A;  3V89 B;  1DBZ A;  2QJE A;  2QS1 A;  3MBP A;  1B3L A;  1M5C A;  4ZZE A;  2DQV A;  3FJM A;  1Y4T A;  2QMW A;  4IY5 A;  4PE5 B;  1WOD A;  3UGW A;  3H7M A;  1B51 A;  1H45 A;  1IMF A;  1SD3 A;  1MH4 A;  4DCX A;  2Q2A A;  2DE3 A;  1Y20 A;  5TP9 B;  4WKM A;  1DK4 A;  5IZ1 A;  1OLC A;  4BDL A;  4BDN A;  4DXU A;  3EHU A;  3FXQ A;  1LFI A;  3MPK A;  2P0S A;  2WX9 A;  1S7Y A;  5I2K A;  4HCW A;  4TQU Q;  1FPF A;  5EQ8 A;  2ANJ A;  2MKZ A;  2BJI A;  3I3V A;  1QUJ A;  1MY2 A;  4GXA A;  4EXK A;  3ZKL A;  1M5B A;  2WKY A;  1H43 A;  4P9K A;  3MC2 A;  1MQJ A;  4JVD A;  4C1U A;  2DE2 A;  4HXV A;  4RXL A;  3OEK A;  3QMF A;  4H46 A;  2P2A A;  3K00 A;  3DM0 A;  4OQO A;  4LP2 B;  1A54 A;  1G0H A;  4OET A;  4DCY A;  1SI1 A;  4MEV A;  3QK6 A;  5FHN A;  3B50 A;  1JEV A;  1USY H;  4FEC A;  5K2X A;  2PFY A;  2GHB A;  5I2K B;  3K01 A;  4KYS A;  1O63 A;  1NI9 A;  3B6Q A;  3HCQ A;  3BFU A;  4NF8 B;  2F8D A;  4H65 A;  5DVF A;  3ODB A;  3HN0 A;  1FQF A;  1MXU A;  4GWZ A;  5BUU A;  3CR9 A;  4IY6 A;  4YB5 A;  4ZE8 A;  4RPO A;  2NOO A;  4UAB A;  2PVU A;  3IB1 A;  1GGG A;  2XXH A;  1IME A;  1B4Z A;  3IK6 B;  4GBW A;  2Z8E A;  3DEL B;  4YKK A;  3VLV A;  3RNN A;  2DWI A;  3O6G A;  3MP6 A;  1FTM A;  3EN3 A;  4QXD A;  2OWZ A;  1MPC A;  3C4M A;  1J1N A;  3C36 A;  3KFM A;  2I4B A;  3MVX A;  2XXW A;  1YYZ A;  1LAH E;  4RA1 A;  2FYI A;  3T9H B;  3RT6 B;  2AL5 A;  4OVP A;  3MP8 A;  2R6G E;  5ICQ A;  3RTW B;  2RC8 A;  1NL5 A;  3VVF A;  1M5F A;  3K1N A;  3QAX A;  1NH8 A;  3R7X A;  2Z8D A;  4POW A;  1NNT A;  4NG7 A;  4KFQ A;  2QS3 A;  3TEL A;  3RN8 A;  1B5H A;  2Q9T A;  3H03 A;  4X1D A;  2ALU A;  1PBQ A;  3RQT A;  2Y7K A;  5EHS A;  3TYH A;  4O3C A;  3QUF A;  4GF8 A;  1DOT A;  3MST A;  2R8T A;  2ZMB A;  1FCK A;  4EF1 A;  1SW4 A;  4IO5 A;  4P47 A;  2VOZ A;  5F7V A;  3KN7 A;  4EXL A;  1B7U A;  1BTJ A;  1QKB A;  5B7D A;  4G8M A;  4BDQ A;  2IA4 A;  4RY1 A;  1XI6 A;  3O6I A;  4MIJ A;  4NF6 A;  1FTJ A;  1MXV A;  4XEQ A;  4LN5 A;  2YLN A;  4N13 A;  1ZLQ A;  4IO7 A;  2O1M A;  3S9M C;  1EU8 A;  5DVI A;  3K6U A;  4YIC A;  2Y5K A;  3FIR A;  4X8R A;  2RC7 A;  2Q8J A;  3V83 A;  1KWH A;  1Z7N E;  3B6T A;  4JWY A;  1QVS A;  5EYG A;  1NKX A;  4ND9 A;  3KOT A;  3GBA A;  1YPN A;  2NXO A;  2Y7R A;  3N94 A;  2O69 A;  5ESY A;  5CI5 A;  4DE8 A;  4ELP A;  2GFE A;  2OWT A;  4H1X A;  3W9W A;  2V3U A;  1SPI A;  3N5L A;  2HAU A;  5CBR A;  3DP4 A;  2WYP A;  3CG1 A;  1SQY A;  3SEU A;  1I6B A;  2I4C A;  4N07 A;  3H6W A;  3FJ7 A;  5ET8 A;  1Y3P A;  4XTC Q;  4P1L A;  3OO6 A;  1LAX A;  2XXX A;  4M1V A;  3S4U A;  3T9V A;  1B40 A;  4QRZ A;  3IAZ A;  4F1Y A;  5A5X A;  4UAC A;  4F3G A;  3TZA A;  5AA2 B;  3A3C A;  2DS9 A;  3OSR A;  3C34 A;  4Q0C A;  3TKD A;  4F19 A;  4UA8 A;  3KBR A;  2F34 A;  3LSX A;  5B70 A;  5EQ7 A;  5CRY A;  3PV0 E;  2I58 A;  5HBC A;  4C0R A;  5AA1 A;  3TQW A;  4OWD A;  1NUY A;  4FBP A;  1D4N A;  4R74 A;  1TFA A;  4JVC A;  4MBP A;  5I56 A;  4F2Q A;  1EYI A;  5ET7 A;  2ZNS A;  4N8G A;  3IR1 A;  1EZO A;  4XIG Q;  1N84 A;  3VLU A;  4IGT A;  3PTY A;  4YKJ A;  2VHA A;  2VT5 A;  2WBB A;  2PX1 A;  4E0W A;  2HAV A;  3FGS A;  4X9T A;  1RDX A;  1PDA A;  4HE1 A;  5I58 B;  3KG2 A;  5AE4 A;  3T0J A;  1MXZ A;  1JET A;  3QIM A;  2G93 A;  2OCU A;  2UYF A;  2QS4 A;  1M5D A;  4XKQ A;  4H6D A;  5I2N B;  2ZYK A;  2QFL A;  3GBB A;  1FPG A;  1B3E A;  3OEM A;  3VFJ A;  2O68 A;  4KI0 E;  3TTN A;  1FBE A;  1QJM A;  3IJX B;  4DDD A;  3MW0 A;  4KR5 A;  4MLQ A;  4GWU A;  1NV2 A;  4ELQ A;  4KCC A;  1PC3 A;  4FIM A;  2V3T A;  4DIG A;  1MPB A;  3USD A;  2DYX A;  1LAF E;  1RKM A;  1LBY A;  3ILU B;  3SEX A;  1B3F A;  1UTH A;  3B8B A;  3PUY E;  1CNQ A;  3LR1 A;  4G68 C;  4QHQ A;  1PEB A;  1DMB A;  3SES A;  1TWY A;  4OFJ A;  2ONR A;  3MVY A;  5IM2 A;  5JTY A;  3SET A;  3QSL A;  3MZB A;  3RUM A;  4HS7 A;  1ZTY A;  3IO6 A;  4I8C A;  5I7I A;  4L17 A;  4O3B A;  5H8H B;  4QSC A;  2OLB A;  5ISU A;  1A40 A;  1I6A A;  2DVZ A;  1URD A;  2I48 A;  3ZS6 A;  4N8Y A;  4GQO A;  1ZU0 A;  4R6Y A;  3TAJ A;  2XXV A;  3OXN A;  1BKA A;  3T9X B;  4FAJ A;  2VPN A;  1OVT A;  2HXW A;  4FEB A;  1UIU A;  2QRY A;  3CI8 A;  3FD3 A;  3K1M A;  5TPA B;  1YCJ A;  5LOM A;  4DXC A;  2ABH A;  1AWB A;  1XHY A;  2ONS A;  3OEL A;  4OXV A;  1FTA A;  4H0W A;  4PCD A;  3CHG A;  3T9U A;  1MY1 A;  1Q1K A;  3JYR A;  5AA3 A;  4U4S A;  1EH3 A;  2QL3 A;  4H5F A;  1BIY A;  4JSO A;  5AA2 A;  4NTL A;  4KHZ E;  5I59 B;  3SEY A;  5EQA A;  5DW8 A;  4EUO A;  2HEU A;  1IMC A;  2THI A;  3H4Z A;  1MDQ A;  4O3A A;  2E1S A;  2RF1 A;  1VFD A;  1A55 A;  4G8H A;  4PE3 A;  4MLV A;  1JW1 A;  2I49 A;  2NVU B;  4WXJ A;  4JWO A;  1YXI A;  3T22 A;  2XXT A;  4KYD A;  4KCD A;  4ZDM A;  2FHY A;  1SW5 A;  4PFT A;  4WEP A;  2F6P A;  2O51 A;  4GIZ A;  3TMG A;  5A5X B;  4MNC A;  1R6Z A;  1AIV A;  3LBS A;  1H44 A;  1OMP A;  4JVI A;  5ITO A;  4PBQ A;  2PBW A;  1B46 A;  3K02 A;  3TPA A;  4OEV A;  3G3J A;  5I59 A;  3DP8 A;  1JW4 A;  1LBV A;  1US4 A;  4ZE9 A;  3JV9 A;  4Z0I A;  3LSF B;  4N6P A;  2HZL A;  5LTC A;  1P1O A;  3RTF B;  2ZZW A;  4AS4 A;  3SEW A;  4N17 A;  1FPI A;  1I69 A;  4I40 A;  4NF4 B;  3KJT A;  4G68 A;  4N6D A;  4ESW A;  2ZYN A;  2UVJ A;  1DCU A;  4EQ9 A;  4X04 A;  3UK4 A;  3FVO A;  5CMB A;  1NV7 A;  2FVZ A;  5TP9 A;  2QMX A;  1JQF A;  1PB7 A;  1MQG A;  2H4I A;  1JEU A;  2X7P A;  3TEP A;  1I6Q A;  1IIT A;  3PPO A;  4OFL A;  4MH5 A;  1QUK A;  4ZED A;  2CZH A;  2DP8 A;  3CG3 A;  4EQ7 A;  1DPP A;  2PYY A;  3TFL A;  4GRK A;  3E3K A;  1Q35 A;  4R9G A;  2DSF A;  4R72 A;  4PDD A;  2Z8F A;  1XVX A;  1IXH A;  3SDF A;  1O64 A;  4POX A;  2ZNU A;  3K6X A;  3M3F A;  3CFL A;  4QFP A;  1NUX A;  2AIX A;  3KC1 A;  4PFR A;  4PAI A;  4O7I A;  1IUD A;  2H99 A;  3G3F A;  2R9J A;  1LAG E;  4JXI A;  4ZEF A;  2DWH A;  1XS5 A;  1PB8 A;  3E4R A;  1FPJ A;  1B58 A;  1FBP A;  4R9F A;  1VSO A;  1ANF A;  4IO3 A;  3W9V A;  3IOV A;  4GX3 A;  4NX1 A;  2YPN A;  4N91 A;  4P1E A;  1LBC A;  1IMD A;  3D1R A;  3WAE A;  1GV8 A;  2P1S A;  4JSD A;  5EYH A;  3B6W A;  4KXP A;  4GOT A;  1VFE A;  1IZ1 A;  2PMS A;  2I0B A;  2E0S A;  4R73 A;  2FBP A;  2F36 A;  2Y7W A;  3CFZ A;  3DP6 A;  3N26 A;  5L9S A;  4HCY A;  2I3W A;  3GYY A;  4OER A;  4TLM B;  2XXQ A;  3IOW A;  2F3B A;  1ZMG A;  1B3G A;  1Y3N A;  1QW0 A;  3SEV A;  5DTB A;  1A99 A;  4H8I A;  2I6E A;  3MPL A;  4PFU A;  2FIE A;  1D3K A;  4GWS A;  1MRP A;  2UXA A;  1YZ0 A;  4X1B A;  1JVX A;  2CEY A;  1MXX A;  4DXB A;  2D3I A;  3M3K A;  4PP0 A;  3TUS A;  1O7T A;  4HW8 A;  1LLS A;  1OQG A;  3D4C A;  5M2V A;  3BBR A;  4ESX A;  1N7W A;  5ET5 A;  4NMY A;  1MY4 A;  1N76 A;  1FSA A;  1SI0 A;  1PB9 A;  3TOD A;  1SYI A;  2QVV A;  3HST A;  1NV5 A;  1POT A;  3IFA A;  3U93 A;  1TT1 A;  1HSE A;  3PUX E;  4PET A;  2ZXT A;  4EQB A;  4H67 A;  4THI A;  4MFI A;  4H45 A;  2H9B A;  1GTK A;  5L9M A;  1FBG A;  3PD8 A;  4NAP A;  4YAH X;  5AA2 D;  3PMV A;  2XX8 A;  2CEX A;  3IOR A;  4PAK A;  1UTB A;  4O8M A;  1B4H A;  2F7B A;  2CMO A;  1IXC A;  4PAF A;  1LCT A;  4EF2 A;  5EYF A;  3CSB A;  2ONK E;  3O2A A;  4G4P A;  2KLF A;  4ZEK A;  3VXC A;  1AL3 A;  3U8Q A;  1OVB A;  5ELV A;  1SYH A;  1FQC A;  2V25 A;  1NMU A;  4LON B;  1MY0 A;  2A5T A;  2PT2 A;  3UA8 A;  1JP4 A;  5BWJ A;  4QBA A;  4OEN A;  3N6T A;  2KQZ A;  3FV1 A;  4K3F A;  4AQ4 A;  3PU5 A;  3TCG A;  4YKI A;  3V5A A;  1YAE A;  2P3V A;  3BIG A;  1BP5 A;  2Z22 A;  2RKM A;  4I3Y A;  2Y7P A;  3IJO B;  5I3S A;  1M5E A;  2KR0 A;  2O1L A;  2VPO A;  5I57 A;  1US5 A;  3FAS A;  4G61 A;  4ZZA A;  4GLI A;  1FJ6 A;  3T93 B;  2F6G A;  1DSN A;  3O6H A;  3KSX A;  3C33 A;  4XFE A;  4U2R A;  5TPA A;  2H98 A;  4GL0 A;  1EZ9 A;  3H6U A;  2Y7I A;  4KYE A;  3QUJ A;  1FBD A;  1Y1Z A;  3TCF A;  1NUW A;  5CBS A;  4FJP A;  4U23 A;  4NED A;  3EKI A;  3KEI A;  4PTK A;  4MX6 A;  3U1O A;  1K9Z A;  3PGF A;  4GWO A;  2HFB A;  3PMX A;  4AB6 A;  5H8H A;  2QS2 A;  1F9B A;  4R6K A;  3FV2 A;  1NV4 A;  5IKB A;  1CB6 A;  3IB0 A;  1IEJ A;  3ONM A;  4AS5 A;  3IX1 A;  3AXF A;  2UVH A;  2Q2C A;  2QSX A;  1JVY A;  4NN3 A;  1R9Q A;  1FPD A;  3LSW A;  1FJ9 A;  4FED A;  3Q26 A;  3WAF A;  3S9N C;  1ATG A;  2O7U A;  2B65 A;  2IEE A;  3D4G A;  3O29 A;  3G3G A;  2QVR A;  5HPQ A;  4ZEC A;  1DPE A;  1MG1 A;  4Q8R A;  5LDZ A;  4RJZ A;  2XHD A;  3E13 X;  2BJJ X;  3C35 A;  3EF7 A;  3KGC A;  3THI A;  2VD2 A;  1L5T A;  4O7M A;  3O97 A;  1AOV A;  4MMP A;  2HCA A;  1K9Y A;  4GD5 A;  3EHS A;  2ZYO A;  3BFT A;  4HE0 A;  2XXR A;  5H8S A;  3KN3 A;  5I2N A;  4N4U A;  3T1B A;  4PFY A;  4JB7 A;  2F35 A;  4P11 A;  4QFO A;  1B3H A;  5F1Q A;  2X26 A;  3CVG A;  4P0I A;  3KN8 A;  1R9L A;  3MQ9 A;  4GL8 A;  5K2Y A;  3RY3 A;  5CM6 A;  1MQH A;  2PCR A;  4TLL B;  2A5T B;  1BK4 A;  3B7D A;  1LBB A;  4ISU A;  4LZ5 A;  1OLA A;  1MQI A;  1YTV A;  1EZP A;  4R2B A;  1VR5 A;  1VE4 A;  1FPK A;  3E79 A;  1UTB B;  4Q30 B;  4PF6 A;  4MCO A;  2V4C A;  1HSL A;  2JJK A;  1H3D A;  4GWW A;  4N81 A;  4NGU A;  4O94 A;  4OES A;  1RYX A;  1PBP A;  3KZG A;  3Q27 A;  1USY E;  3R26 A;  3PPP A;  1G0I A;  5JEI A;  3LUZ A;  2HPG A;  5FBP A;  1LBX A;  2WYK A;  3C31 A;  3OO8 A;  4LZ7 A;  5AA4 A;  2ZZV A;  1RDY A;  4F3P A;  4MJO A;  2F97 A;  3GZG A;  1FTO A;  3TQL A;  3CRB A;  3VVE A;  4R2F A;  1B1X A;  4XF5 A;  1VDW A;  4IO4 A;  1MH3 A;  3IL1 B;  1B52 A;  5I58 A;  3VVD A;  3F11 A;  4F31 B;  1ZIU A;  4I62 A;  2XX7 A;  4G8N A;  5JTY B;  3C32 A;  2FA7 A;  4N6K A;  4XKR A;  3U65 A;  4LQ5 A;  3KJ7 A;  3W15 C;  2CZL A;  5CMM A;  5EQ9 A;  5DYH A;  3A3U A;  3FXB A;  3PPR A;  2FNC A;  1IMA A;  1SW2 A;  4BDM A;  3SZP A;  4QFN A;  4PC9 A;  4AB5 A;  3TCH A;  1KA0 A;  1TFD A;  1XVY A;  3MP1 A;  3UOR A;  1XC1 A;  1NUZ A;  4IO2 A;  3RT8 A;  1Y9U A;  4YB6 A;  2ZYM A;  4IGR A;  1B7Z A;  2DWA A;  1FQE A;  1MM7 A;  5FHO A;  1N0T A;  2XXP A;  1NNP A;  4HTG A;  3OOA A;  2XXY A;  2V3Q A;  2I0C A;  3FVN A;  2X7Q A;  4G68 B;  3U92 A;  3LV0 A;  4JWX A;  2XXK A;  5DT6 A;  4NF0 A;  1S50 A;  4GWY A;  4FAT A;  3TTL A; 
#chains in the Genus database with same CATH homology
 3IFC A;  2QVR A;  2DE2 A;  4HXV A;  4IR8 A;  4P1L A;  1D9Q A;  3GYY A;  3HFU A;  4DI4 B;  2P3V A;  3QMF A;  3BIG A;  5A5L A;  1LBZ A;  4M1V A;  2ZZV A;  1RDY A;  2F3B A;  1FBE A;  4GX4 A;  4H46 A;  5LDZ A;  1KZ8 A;  4MJO A;  1FPL A;  4GWU A;  2QVU A;  4I3Y A;  1EYJ A;  5EQA A;  2F5X A;  1NV2 A;  5I3S A;  2GQ1 A;  1G0H A;  2KR0 A;  2FIE A;  2VPO A;  1NV1 A;  3BIH A;  2HZK A;  4I3E A;  4OVQ A;  2CZI A;  3KC0 A;  4GWS A;  4OA4 A;  4G61 A;  4MEV A;  3MST A;  4O7M A;  1IMC A;  2P3N A;  1YZ0 A;  1QGX A;  2XWK A;  4JVD A;  4OVS A;  1FJ6 A;  4PF8 A;  2CZH A;  2CEY A;  4XF5 A;  3B50 A;  2R8T A;  1LBY A;  4MNI A;  5ET6 A;  3RPL B;  1VDW A;  5I5P A;  4MMP A;  4DI3 D;  2PFY A;  5T3J A;  2Y5L A;  2XWV A;  1FBC A;  3B8B A;  4F19 A;  1CNQ A;  1K9Y A;  4P47 A;  4PE3 A;  5EQ7 A;  4MHF A;  1NI9 A;  1NV6 A;  3KBZ A;  3A29 A;  4PGP A;  4HE0 A;  3ROJ A;  2DDK A;  4XFE A;  5IZ3 B;  3NOH A;  1YXI A;  2F3D A;  5J1D A;  4NHB A;  1NUY A;  4FBP A;  4PDD A;  2CZK A;  1LEV A;  1XI6 A;  4N4U A;  5ET5 A;  4F1V A;  2L5V A;  4MIJ A;  4PFB A;  5IM2 A;  3T1B A;  5IGA A;  4GBV A;  1FBD A;  4XEQ A;  4LN5 A;  2FHY A;  5IZ3 A;  4N6K A;  1FSA A;  1NUW A;  4JVC A;  1DBZ A;  3U65 A;  1FBF A;  2QVV A;  1EYI A;  1FPE A;  4GWZ A;  4YIC A;  5IZZ A;  4MNC A;  5JK4 A;  2HHM A;  5ET7 A;  2WEF A;  2Y5K A;  4HE2 A;  1NV5 A;  1FPB A;  2OX3 A;  3EKI A;  3IFA A;  4JVI A;  4N8G A;  2XA5 A;  5F24 A;  5I7I A;  4X8R A;  1NV0 A;  1Q9D A;  2HXR A;  1KA1 A;  1NV3 A;  4PBQ A;  4UAB A;  5EQ9 A;  1NUX A;  3E78 A;  5CM6 A;  1RDZ A;  1LBW A;  2Q74 A;  3FXB A;  4P8B A;  2PCR A;  4MX6 A;  4OAN A;  4PET A;  3PTY A;  4OVR A;  1K9Z A;  3KC1 A;  1IMA A;  1IME A;  1BK4 A;  4PAI A;  4PFR A;  4O7I A;  1IMF A;  4GBW A;  4H45 A;  3MYU A;  4N15 A;  4PC9 A;  3SZP A;  5EYG A;  4PFI A;  1INP A;  1FBG A;  4NAP A;  3RYD A;  2VT5 A;  2DVZ A;  2WBB A;  4QXD A;  4PTK A;  2DE3 A;  5DW8 A;  4GWX A;  1KA0 A;  1LBV A;  2FIX A;  4F1U A;  1FPJ A;  1NV4 A;  4X9T A;  1FBH A;  1DK4 A;  1FBP A;  1NUZ A;  2OWZ A;  4N8Y A;  2WBD A;  5ESY A;  5IZ1 A;  1FPK A;  3E79 A;  2CEX A;  4P56 A;  5ET8 A;  4PAK A;  2HZL A;  3W9V A;  2ZZX A;  4O8M A;  4OVT A;  3ISP A;  5LTC A;  2QPQ A;  1RDX A;  2B4M A;  4PAF A;  4MCO A;  4GX3 A;  2V4C A;  4PF6 A;  2VPN A;  1EYK A;  2JJK A;  2ZZW A;  4NX1 A;  4PGN A;  4HE1 A;  3W9W A;  4AS4 A;  4AS5 A;  1YYZ A;  2WX9 A;  4N17 A;  2PFZ A;  4GWW A;  4N81 A;  4HCW A;  2V3Q A;  4N91 A;  4GX6 A;  4NGU A;  1SPI A;  4O94 A;  1FPI A;  4P1E A;  2Q8M A;  1FPF A;  5EQ8 A;  1IMD A;  2WYP A;  2XWI A;  3D1R A;  2MKZ A;  4I40 A;  4NN3 A;  3RPL A;  4OVP A;  3T0J A;  1AWB A;  1FPD A;  1FRP A;  1FTA A;  2B4L A;  2BJI A;  4N6D A;  3LV0 A;  5EYH A;  1FJ9 A;  4KXP A;  4PCD A;  2XXK A;  3FBP A;  2DE4 A;  3CHG A;  1DCU A;  1IMB A;  4X04 A;  4NQ8 A;  2XWO A;  4NF0 A;  4PBH A;  4PDH A;  4NG7 A;  4F18 A;  5J16 A;  1JP4 A;  1NV7 A;  2WYK A;  1G0I A;  2FVZ A;  4GWY A;  4QBA A;  2FBP A;  4YZZ A;  4MNP A;  4P9K A;  2KQZ A;  2HPG A;  3LUZ A;  4MAG A;  5FBP A;  2QFL A;  4HCY A;  1LBX A;  4P3L A;  2Q9T A;  1FPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...