2XWKA

Siap r147a mutant in complex with neu5ac
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
309
structure length
309
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLAVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
publication title Tripartite ATP-Independent Periplasmic (Trap) Transporters Use an Arginine-Mediated Selectivity Filter for High Affinity Substrate Binding.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 121
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xwkA00
4PC9A 2XWIA 3GYYA 4MX6A 4N6KA 4P1EA 4N4UA 4P1LA 4MEVA 4OVSA 2ZZXA 4MMPA 4PFBA 4PF8A 4X8RA 2HPGA 2V4CA 2HZKA 4N91A 4P56A 4NQ8A 4OVQA 4X04A 4PBQA 4YZZA 4PAFA 4DI4B 4N17A 4OA4A 4MNCA 4NF0A 4LN5A 2HZLA 4PAKA 3FXBA 3U65A 2CEYA 5I5PA 5CM6A 2PFYA 4O94A 4OANA 4NX1A 4PFIA 4MNPA 4NG7A 4PDHA 4MHFA 2XA5A 4XFEA 4MAGA 3B50A 2XWKA 5IM2A 4PBHA 4N15A 4O8MA 4XEQA 4PCDA 5I7IA 5IZZA 4OVTA 4MIJA 2WYKA 4NN3A 4PF6A 4DI3D 4PAIA 2ZZWA 4PETA 4N8GA 4PE3A 4PFRA 5LTCA 4NGUA 4PGPA 2VPOA 4YICA 4P8BA 2XWVA 4PGNA 2ZZVA 4NHBA 4XF5A 4P47A 4OVPA 2CEXA 4P3LA 4NAPA 4N6DA 4OVRA 4PDDA 4P9KA 4UABA 4MNIA 2XXKA 5IGAA 2WX9A 4MCOA 2XWOA 2VPNA 4N8YA 2WYPA 4O7MA 2PFZA
chains in the Genus database with same CATH superfamily
5JK4A 1NV0A 4EF2A 4OXVA 2QVUA 4PE5B 1B5HA 2XX9A 5DYHA 4AS5A 2AYSA 3W15C 3UGWA 4N6PA 1NV7A 2Y7RA 4PQJA 5I57A 2PYYA 3EHSA 5CBRA 1FPBA 4ZECA 1MY0A 4PAKA 3C4MA 2F7AA 4FECA 4C0RA 1EYIA 4OANA 4N81A 5DVJA 3OO6A 1SW5A 1FBEA 2CMOA 3ILTB 4OZ9A 4GVOA 1MY4A 2Q9TA 4KQPA 4DXBA 3JYRA 1NNKA 2DE4A 4BDMA 5EQ7A 1DTGA 5L8DA 3SERA 3L6HA 4MIJA 4NF4A 3MSTA 1B4ZA 4IY5A 3K1MA 3MQ9A 4IO2A 3ROJA 1FBFA 1O63A 1JP4A 4OETA 2O68A 1JW4A 3PTYA 4JWYA 1FQBA 1MXZA 4ELRA 4F19A 3RPWA 1USYE 3CSBA 1VR5A 4IGRA 2UXAA 2V93A 5KCJB 3SEXA 3TPAA 3O66A 4P9KA 4YB7A 2REJA 2GHBA 3K1NA 1QULA 4MLVA 5AA4A 3IOWA 2AIXA 3H6TA 4NF5A 5I2KB 4K3FA 1ELJA 4N6KA 1LB8A 4O7IA 4OEVA 4NWDA 2OK2A 3SEVA 2IA4A 3SEWA 2PT2A 4N91A 2Q89A 2FYIA 1WODA 4OA4A 4OFOA 1USYH 3ZSFA 4R2BA 1QJMA 4RA1A 5H8HB 3C31A 4RXLA 5CM6A 3RT8A 4O3BA 1XI6A 2FNCA 1IUDA 4MNPA 2XHDA 4YMAA 2LAOA 4TLLB 1NNFA 4RJZA 3RNNA 2F8DA 3O9PA 4H1XA 5HBCA 4HW8A 3G3JA 1UIVA 3SEUA 1INPA 1DSNA 2NXOA 3V5AA 3EHUA 3TCHA 5TP9A 1P1NA 1PDAA 1NL5A 1OQGA 3MZ1A 2ZZWA 2E1SA 4NF6A 3THIA 3RY3A 4MF3A 1RDXA 4F3SA 4NGUA 1B52A 1IEJA 1MQGA 3RTWB 3MBPA 5HM4B 4XF5A 2I48A 3KBRA 3VLWA 3VLVA 4KPTA 2M8CA 4MNIA 4UACA 2WX9A 1NMUA 4DIGA 5FHNA 4C1UA 5AA2A 1B46A 3WAFA 4F3GA 2WEFA 3M3FA 1FQEA 1GTKA 2OLBA 3CSGA 4JSOA 2CZKA 4OTEA 4OFJA 2UVIA 3KN7A 3FJMA 1FPLA 1FQCA 5DEXB 4PFBA 4QHQA 5ET5A 4ONYA 3O6GA 3QSLA 1QVSA 4QF9A 3C9HA 3CFZA 4IO7A 2V3TA 5JEIA 3IJXB 3BFTA 2NOOA 1FTJA 2GH9A 1CNQA 4MFIA 3H03A 5I59B 5J16A 3IFAA 3LV0A 4POWA 4G77A 3DM0A 2O1LA 3GBBA 4I9DA 3O6IA 3PPQA 1S7YA 1I6AA 5KCJA 4PCDA 2HAVA 1AL3A 2HXWA 1KZ8A 1D3KA 1I6BA 4DDDA 4U2RA 4EXLA 3RLFE 3HV1A 5I2KA 1IXIA 1GV8A 5AA1A 2NVUB 3PGFA 2DOJA 4FEDA 3JZJA 2D3IA 1K9YA 2DWJA 5EYFA 1YYZA 1LCFA 2ZYMA 1EU8A 3OENA 1NUWA 2QS3A 4BDOA 1MQJA 1MPCA 4GLIA 3DP8A 4XKNA 2VPNA 1Q35A 1OVTA 5LOMA 4GWXA 1B7UA 2ZYKA 4P1EA 3MWBA 4GL0A 4H0WA 3M3LA 4GF8A 4Q5TA 2HXRA 2A5TB 5KZTA 1MRPA 1J1NA 2HZKA 3OOAA 2PMSA 4YU0A 1RKMA 3PD9A 4PFYA 4WEPA 3G3FA 4LQ5A 4IO6A 3B7DA 5AA3A 3AXFA 4LN5A 1Y4CA 3E79A 3H6WA 1NNTA 3TKDA 4KD5A 5M2VA 3Q26A 3R6UA 4WKMA 2MKZA 4F22A 3IB1A 1IQ7A 3MZBA 3T9XB 3K6VA 3O28A 4GWZA 3KN8A 4R75A 1DK4A 2VHAA 4OVTA 5H8NB 4M4GA 3MW0A 1IMEA 2D21A 2Z22A 3PUZE 1BK4A 3TTKA 4IB2A 1BTJA 4O3AA 5A5LA 2B4MA 4QXDA 3KSJA 2YLNA 4O3CA 2QVRA 3IL1B 3S4UA 3TTLA 4EDPA 4LZ5A 4HE2A 2YJPA 2QL3A 1B9JA 2DSFA 1MY2A 3K01A 3E78A 3FV1A 3M3KA 2Z8DA 3GLBA 5L9OA 4PC9A 4G8HA 4BDRA 1SW4A 1H3DA 1FRPA 4M1VA 3E13X 3G3IA 2ZZXA 2OWTA 1RDZA 2OJTA 1G0HA 1FPIA 3C34A 4G68B 4NMYA 3KZGA 2XD3A 4ELQA 4YZZA 2UYFA 4HXVA 2XXQA 1ZBMA 1H45A 4HCYA 1L5TA 1NH7A 4KYSA 3T1BA 1BLFA 3VFJA 1D4NA 5CMBA 1IMBA 4NE4A 2RF1A 1FTKA 1NV5A 1NV2A 5TPAA 2B3BA 2R71A 2P2AA 3WAEA 2F6GA 3HHFA 4GXSB 3EF7A 1OVBA 1PB8A 3OO9A 3O6HA 1ZLQA 3T9HB 1JETA 4ECFA 3IB0A 1MG1A 4QFOA 1P1QA 1OQHA 1SPIA 1POTA 3EKIA 5ISUA 3LSWA 3V83A 2FIEA 1ZIUA 3MPLA 1D9YA 1NFTA 1MH3A 3T93B 1A8EA 4XKRA 2FVZA 2QS2A 1XHYA 4ZEKA 2XXYA 1IXGA 1JQFA 4P47A 2O7IA 2A5TA 1MQDA 5IKBA 3H06B 1FBGA 2X26A 5EHSA 3TQWA 5A5XB 5EQ8A 3LBSA 3ZS6A 2QMXA 3FXUA 1EH3A 4KYDA 1JW5A 1NH8A 4YB5A 4MX6A 2O1MA 5CC2A 4P1LA 3QMFA 4I62A 4LONB 3IOVA 5H8FA 1B0HA 2Y7PA 5FTHA 1FBDA 5DW8A 5IZ3B 2HPGA 2AL5A 5BWJA 1N84A 3CRBA 4ZEFA 3EPEA 3CG3A 1I6QA 4NWCA 4DI4B 4OYVA 2FA7A 4NF0A 1XOCA 1LBZA 1MDP1 5ELVA 4DXUA 1R9LA 3T96B 1IITA 3RPLB 4AB5A 1H44A 3CR9A 3K6XA 1CB6A 1QUIA 2X7PA 1US4A 4GXAA 5FBPA 4KFQA 3QUFA 5I7IA 3TYHA 1M5CA 5I2NB 4GBWA 3KOSA 3U94A 5K2YA 4DZ1A 3W9VA 2DYXA 1UTHB 4Q8RA 4QSDA 4KCCA 4C1TA 1IMFA 1Y4TA 1H76A 2ZNSA 4YICA 4QSEA 3VDFA 2F35A 4POXA 1DPPA 3OXNA 3ODBA 1XT8A 1Y3QA 1LBXA 3H6VA 1JVXA 4LUBA 4G68A 4AS4A 4H8JA 4R9FA 2KQZA 3PMVA 1Y1MA 3W9WA 3A09A 2QS1A 3FD3A 4KYEA 4EQ7A 4JSDA 3TMGA 4MLQA 4H5GA 1R6ZA 1LGBC 5F7VA 4OENA 1FTLA 3TCFA 3VV5A 4PAFA 3IORA 3RTFB 1FJ9A 5H8QA 1JNFA 1Y3PA 1B2HA 1TFDA 3MVXA 1IMAA 4R72A 3B6WA 4F1VA 2HEUA 4F39A 4IO3A 4ZE9A 2FBPA 1AWBA 3ECRA 1SYIA 3QIMA 4PDHA 4F18A 1R1NA 3VE1B 3MZ9A 1Q9DA 3FVOA 3N6UA 3OELA 4LP2B 3ONMA 1LLSA 1LEVA 3B6QA 4XEQA 2REGA 4QRZA 3QUJA 3QYTA 5IZZA 4ZZAA 2XXWA 4XKPA 2HCAA 2I3VA 2RC8A 4YMBA 4X9TA 3RN8A 5A5XA 1TFAA 3M8UA 1MQIA 1ANFA 1MM7A 2XXTA 3IO6A 5KDTA 4NHBA 5CMCA 5I58B 4EQBA 1P1WA 2V84A 4P3LA 4LQ2A 3TUSA 3CHGA 1QKAA 3TAJA 2I0CA 3PD8A 1MY3A 3K00A 2XXXA 3RYDA 4Z7EA 4GX4A 5IAIA 1ZTYA 2I4BA 4ZZEA 5I56B 3VLUA 4IGTA 2DWHA 2XXUA 3D1RA 3FUZA 1NV1A 1WVJA 4U23A 1KWHA 4GWOA 4N07A 4ISUA 4H8IA 2H5YA 4WXJA 3HPIA 5I2NA 3TODA 1DCUA 3Q25A 1B0LA 3FXBA 3MVYA 2OCUA 3KJ7A 1UTHA 1LBCA 2F7BA 2OBGA 3GBAA 1B3LA 3IX1A 4FAJA 2DWAA 1MXYA 1NV3A 1OMPA 2Y5KA 2XXPA 4P11A 1URDA 1S9TA 4U22A 4G8NA 3OO8A 4HE1A 4U4XA 3TCGA 4O8MA 5ET6A 4KXPA 3FATA 2PVUA 4JVCA 1URGA 3G3KA 2ZYNA 4DCXA 3N94A 4RNSA 4IR8A 3KJTA 2VP1A 1TXFA 3E9XA 3LUZA 4FJPA 1FQFA 4BLAA 1NI9A 4N8GA 2O7UA 1IMDA 2F34A 5LTCA 1B4HA 2ZNTA 1FPEA 3FJGA 3QXMA 2O6AA 3PUVE 3O2AA 5FHOA 4ZEBA 4F31B 3TELA 4JXIA 3TZAA 1Y20A 1B6HA 3K4UA 2I6EA 1B3FA 3PMWA 1JVYA 3Q29A 3S9EA 3A3UA 5J1DA 2ANJA 3HCQA 1UIUA 4MEVA 2Q8JA 2VOZA 2OX3A 4MMPA 1Q1KA 2H4IA 4U21A 2RC7A 4PFWA 4L17A 1OLAA 2WKYA 3PPNA 3C33A 3H7MA 4OVQA 2WBDA 1AIVA 3IR1A 2F5XA 4HE0A 3KEIA 5H8HA 4OESA 3ZKLA 4QFPA 1NV4A 1DPEA 1QUKA 3UIFA 1QKBA 5AA2D 1Y3NA 2CZLA 2ESNA 4PTKA 4ZEIA 1FBCA 5CI5A 4PFIA 1KA1A 1IZ1A 4PFTA 3C32A 3FZVA 4E0XA 1A40A 1FBPA 3FJ7A 2V3UA 2R6GE 1OIBA 4KI0E 4FORA 5EQAA 5ESYA 1SW2A 2F3BA 1GGGA 4G4PA 3IFCA 3KFMA 4OWDA 2Q8MA 4OQOA 5L9MA 3USDA 3K02A 1ATGA 4MBPA 3MUQA 4FBPA 1SI1A 4H45A 2XD2A 2ALUA 1SI0A 3JV9A 5AE4A 3C35A 5ITPA 2ZMBA 4EQ9A 2L5VA 5I56A 2DWIA 3T9UA 3OSQA 1MY1A 4PDDA 4F29A 4JWOA 4UABA 3TQLA 4I1DA 1YAEA 4ESWA 3KC1A 3LSLA 1AOVA 3FIRA 4R6YA 2RCBA 2B65A 3U72A 1G0IA 3OEMA 3BIGA 5DEXA 1LCTA 2XXHA 3GZGA 4ESXA 1O64A 3PPPA 4IY6A 2E0SA 1YXIA 3K1PA 3S9NC 4FIMA 5EYHA 4GL8A 5FHMA 2ABHA 5BUUA 4PBQA 4R6HA 4MNCA 2UYEA 3MAMA 2P3NA 3FASA 5I57B 1N7WA 5I59A 4BDLA 4P0IA 1SYHA 4YKPA 3K6WA 4YKKA 4P0GA 4H6DA 4F3BA 4G2ZA 3F11A 2DP8A 3HHGA 1B3GA 1FPKA 1MDQA 3E4RA 1BIYA 5CRYA 5H8SA 4I3EA 3HO7A 2FIXA 4NN3A 2HHMA 2B3FA 1MS7A 4NF4B 1ZMGA 3OD7A 3VVDA 3LUYA 2O51A 1NV6A 4KR5A 4LZ7A 4RYAA 2PX1A 3DELB 3I3VA 3U92A 3UK4A 2Q74A 5B7DA 3FXQA 3PUWE 1MXVA 4QFKA 4R2FA 4DE8A 4RK9A 4AB6A 1Y9UA 3OMBA 4X1BA 5IGAA 3N6TA 3MVZA 2WYPA 1PEBA 3A3CA 1FCKA 4GWWA 4ND9A 1XVYA 3S9MC 4NF5B 1LFGA 1B5JA 2ONKE 4JDFA 5JTYB 2Y7WA 3RT6B 2QMWA 2HFBA 2F6PA 4R73A 1VFDA 3IAZA 2V4CA 4U1ZA 2O84X 1LAGE 3S9LC 4Q0CA 1AMFA 1FBHA 3D4GA 1NKXA 2NUVA 3L6GA 2Z8EA 3U65A 1BP5A 4LZ8A 5I5PA 1R9QA 4O94A 3IOTA 4GWUA 2OZZA 1TT1A 4JVDA 1A55A 4MJOA 2QSXA 3MP6A 3IO4A 4QFLA 1B5IA 3VXBA 4YKJA 4PBHA 1A54A 5H8NA 4ELPA 1NNPA 2KR0A 4OFLA 3SETA 1FPDA 4GFRA 1SD3A 4NF8B 3U8QA 4H5FA 5TP9B 3KG2A 3O29A 3T66A 1SVXB 1A7LA 2GHAA 3RGYA 4NF6B 3VVFA 3FGSA 4THIA 2XXVA 2VPOA 2XX8A 4ZE8A 2XWVA 2QVVA 1LBWA 2ZZVA 2IEEA 2R9JA 4H67A 1NUYA 3MYUA 4PP0A 4X1DA 2Q2AA 2QRYA 3NOHA 4MCOA 1D9VA 2XXIA 1B58A 3GYYA 3TTRA 5AA2B 3CG1A 4QBAA 1N3WA 1MXXA 4FE8A 2KLFA 2DS9A 2P0SA 1LAFE 2D5WA 4E0WA 1YPNA 1B40A 4G61A 4PF8A 1FQAA 2QPQA 4X8RA 1B51A 4P56A 3ILUB 4BDQA 4NQ8A 4HTGA 5I84A 4N17A 1HSEA 2DDKA 3RUMA 1FJ6A 1N76A 3H6UA 4GOTA 1UTBB 3SESA 1MM6A 1H43A 2PBWA 2VGQA 2RC9A 1NUZA 4QSCA 2Y5LA 4NX1A 1FTOA 4IO5A 1PB7A 2YPNA 4ZEDA 3SKPA 5F1QA 4MAGA 4TOZA 3K2DA 5IM2A 4DLDA 2ONSA 1ZJLA 3CIJA 3QK6A 2WYKA 3V89B 1OLCA 3TTMA 4PAIA 4YB6A 3EN3A 1LSTA 4OHNA 4PETA 2R8TA 3SEYA 3IOUA 1EYJA 1N3XA 3I5OA 1M5BA 2ZNUA 4TQUQ 4PGPA 5JTYA 1XC1A 2QJEA 1B3HA 4TLMB 5HPQA 4GRKA 4NAPA 1DOTA 2DVCA 4OMBA 5TU0A 1TWYA 2XXKA 2H98A 3I6VA 2A5SA 4F3PA 3LC8A 4X48A 4N8YA 3BFUA 2V25A 1EZ9A 4NTLA 1QW0A 2XWIA 2P3VA 3G3HA 4OERA 2CZIA 3B8BA 3UA8A 3B6TA 3MPKA 3LSFB 3BKIB 4N4UA 2AL4A 2UVJA 4OVSA 3U93A 3S2VA 3EHTA 3HN0A 5IZ3A 1I69A 4OEUA 3PPRA 3DLNA 3UORA 4EUOA 2V3QA 1FTAA 2VT5A 3HFUA 4G68C 1HSLA 3BIHA 3QAXA 3FVKA 1YCJA 4XKQA 2DVZA 4NF8A 3PUXE 5DT6A 3RPLA 4PFUA 3KSXA 1B7HA 1US5A 1PC3A 2DXYA 1Z7ME 2QS4A 4JB7A 2UVGA 1ZU0A 2OWSA 2H99A 3DP4A 1PB9A 4XTCQ 3G3GA 4GX6A 3KC0A 1XVXA 3B50A 1O7TA 2XWKA 4EXKA 1QGXA 3KN3A 3N26A 1LFIA 2GFEA 2I3WA 3P7IA 5ITOA 4DCYA 1F9BA 4DI3D 1MH4A 1MPDA 3MVWA 4ZS9A 1Y1ZA 5CMMA 3A29A 4R6KA 1YTVA 4PFRA 1FTMA 2OWZA 3CFLA 3MC2A 3U1OA 4JWXA 5ET8A 3SZPA 3TDJA 4OVPA 3O97A 3Q27A 4U1OA 4EF1A 1RDYA 4F2QA 5L9SA 2B4LA 2Y7KA 3GXAA 1PBQA 1UTBA 1GVCA 4I8CA 4QFNA 2Y84A 3UN6A 1IMCA 3HSTA 2I58A 1YZ0A 1FSAA 5IZ1A 1GR2A 3K6UA 2X7QA 4F1YA 3H4ZA 2HQ0A 1EYKA 3FXRA 1CE2A 1FW0A 3DP6A 4H46A 1MXWA 3VVEA 1B7ZA 4F2OA 3TTNA 4FEBA 2BJJX 4GQOA 3N5LA 4RPNA 1JW1A 4GD5A 4NG7A 5B70A 2F36A 5TPAB 4IO4A 2XA5A 1VDWA 1B32A 4Z0IA 5T3JA 4I3YA 5LDZA 4OVJA 3MJNA 3SDFA 2Q88A 4R9GA 4HCWA 2Z8FA 3H3GA 2PCRA 4U4SA 4PF6A 3IJOB 4PE3A 5ET7A 1Z7NE 4G8MA 2CZHA 3RQTA 3PMXA 1UQWA 1FPGA 2I49A 3Q28A 5I58A 1M5FA 1JEUA 1VFEA 4H65A 3V8XB 2XXRA 1DBZA 4DXCA 2CEXA 4UA8A 1P99A 2GQ1A 4N6DA 1B1HA 4YKIA 4FATA 2JJKA 3IK6B 4MH5A 2GRVA 4KHZE 4KCDA 1LBYA 1A8FA 3CI8A 1MQHA 3E3KA 3UP9A 4LVQA 2XX7A 2VD2A 2H25A 1S50A 3OSRA 1D9QA 4WEDA 2G93A 3FVGA 4Q30B 5H8FB 1M5DA 1POY1 3PV0E 2QFLA 2HAUA 3CFXA 1QUJA 2BJIA 4GX3A 4BDNA 2I0BA 1VSOA 3K0VA 1KA0A 3ZKKA 1IXCA 1P1UA 4I40A 1LBVA 4LATA 3OEKA 2G29A 1XS5A 3EQ1A 5DVIA 3FBPA 1URSA 4JBZA 3KBZA 1LBBA 4ELOA 2FHYA 2VD3A 2F7CA 2RINA 4MHFA 3T22A 4XFEA 1EZPA 2Z23A 1N7XA 3PU5A 2Y7IA 4N15A 3ISPA 1RYOA 3G7WA 2ONRA 1B1XA 5DTBA 3R26A 4NEDA 1PBPA 4XXUA 1P1OA 3FVNA 3CVGA 1EZOA 3LR1A 2NWJA 2UVHA 4GWYA 5CBSA 4ZDMA 3OO7A 5CMKA 3LSXA 2F78A 1HSJA 3C36A 2RCAA 5ICQA 1B3EA 4PGNA 1T0KA 5ICTA 2H9BA 1FQDA 4XIGQ 2RKMA 5DVFA 1SDXA 1LFHA 3PUYE 2DXRA 3MP8A 1B05A 2XWOA 3D4CA 4O7MA 4JVIA 2PFZA 2THIA 1N0TA 1LB9A 2DE2A 3BBRA 2DQVA 1FPFA 3KGCA 4GIZA 1IXHA 3VXCA 2P1SA 1MXUA 2F3DA 4GWSA 3PPOA 4F1UA 1A99A 5EYGA 1AH5A 4X04A 4GBVA 1II5A 3T0JA 4RK2A 5AA4B 1K9ZA 5FTIA 2HZLA 3TFLA 3TEPA 2F97A 2O69A 2CEYA 4HS7A 5H8QB 3MP1A 1LAXA 2PFYA 5F24A 4YAHX 2WBBA 2Q2CA 3FV2A 3R7XA 2W7YA 5EQ9A 1MPBA 1SBPA 1JEVA 2DE3A 4RY1A 2ZXTA 4R74A 3KOTA 1DMBA 2I4CA 5I3SA 1N04A 4LA9A 1NUXA 1IIWA 1M5EA 1SQYA 1ZKBA 4P8BA 1LAHE 4RPOA 5K2XA 5KDTB 3IB2A 1VE4A 1WDNA 1BKAA 1FPJA 3T9VA 2ZYOA 4OVRA 1RYXA 4AQ4A 1SW1A 1DTZA 2PT1A 5EHMA 4N13A
chains in the Genus database with same CATH topology
5JK4A 4PC9A 2XWIA 2P3VA 1NV0A 2CZIA 3B8BA 2QVUA 5J1DA 4N4UA 1FRPA 4MEVA 4AS5A 4M1VA 4OVSA 2ZZXA 2OX3A 4MMPA 1RDZA 5IZ3A 1G0HA 1FPIA 2V3QA 1FTAA 2VT5A 3HFUA 4OVQA 1NV7A 2WBDA 3BIHA 4YZZA 2F5XA 4HXVA 4HE0A 4HCYA 1FPBA 3T1BA 2DVZA 1NV4A 4PAKA 3RPLA 1IMBA 1EYIA 4OANA 4N81A 1NV5A 1NV2A 4PTKA 1FBEA 1FBCA 4PFIA 1KA1A 4GX6A 3KC0A 1FBPA 3B50A 2Q9TA 2XWKA 1QGXA 2DE4A 5EQ7A 5EQAA 5ESYA 2F3BA 3IFCA 1SPIA 3EKIA 2FIEA 4MIJA 2Q8MA 3MSTA 4DI3D 4FBPA 3A29A 4H45A 4PFRA 2FVZA 1FBFA 3ROJA 1JP4A 2OWZA 3PTYA 4F19A 2L5VA 5ET8A 3SZPA 4P47A 4OVPA 4PDDA 1RDYA 4P9KA 4UABA 2B4LA 1FBGA 5EQ8A 3KC1A 4MX6A 1G0IA 4N6KA 3BIGA 1IMCA 4O7IA 4P1LA 3QMFA 1YXIA 1YZ0A 1FSAA 5EYHA 1FBDA 5DW8A 5IZ1A 5IZ3B 2HPGA 4N91A 1EYKA 4PBQA 4DI4B 4OA4A 4H46A 4MNCA 4NF0A 2P3NA 1LBZA 5CM6A 1XI6A 3RPLB 4MNPA 4NG7A 2XA5A 1VDWA 5T3JA 4I3YA 5FBPA 5LDZA 1INPA 1FPKA 5I7IA 4HCWA 4I3EA 2PCRA 4GBWA 2FIXA 4NN3A 2HHMA 4PF6A 3W9VA 2ZZWA 1RDXA 4PE3A 5ET7A 1NV6A 1IMFA 2CZHA 4NGUA 1FPGA 2Q74A 4YICA 4XF5A 1LBXA 1DBZA 2CEXA 2GQ1A 4N6DA 4AS4A 4MNIA 5IGAA 2WX9A 2JJKA 2WYPA 2KQZA 2WEFA 4GWWA 1LBYA 3W9WA 2CZKA 1FPLA 1D9QA 4PFBA 5ET5A 2V4CA 2QFLA 2BJIA 4GX3A 4PAFA 1KA0A 4I40A 1FBHA 1LBVA 1FJ9A 3U65A 3FBPA 5I5PA 1IMAA 4O94A 3KBZA 4GWUA 4F1VA 2FHYA 1CNQA 4JVDA 4MJOA 2FBPA 5J16A 1AWBA 3IFAA 4PDHA 3LV0A 4F18A 4MHFA 4XFEA 1Q9DA 4PBHA 1LEVA 4N15A 4XEQA 2KR0A 4PCDA 3ISPA 5IZZA 1FPDA 1KZ8A 4X9TA 4GWYA 2VPOA 2XWVA 1K9YA 2QVVA 1LBWA 2ZZVA 4PGNA 4NHBA 1YYZA 1NUWA 4P3LA 1NUYA 3CHGA 3MYUA 3NOHA 4MCOA 2XWOA 2VPNA 4O7MA 4JVIA 2PFZA 3RYDA 3GYYA 4GWXA 4QBAA 4GX4A 2DE2A 4P1EA 1FPFA 3D1RA 4G61A 1NV1A 2F3DA 2HXRA 4PF8A 4GWSA 4F1UA 2QPQA 4X8RA 2HZKA 5EYGA 4P56A 4NQ8A 4X04A 4GBVA 3T0JA 4N17A 1K9ZA 2DDKA 1FJ6A 1DCUA 4LN5A 2HZLA 3E79A 3FXBA 2CEYA 2PFYA 5F24A 1NUZA 2Y5LA 2WBBA 4NX1A 1NV3A 2Y5KA 2MKZA 4MAGA 5EQ9A 5IM2A 4HE1A 4GWZA 4O8MA 5ET6A 4KXPA 1DK4A 2DE3A 4JVCA 4OVTA 1IMEA 2WYKA 4IR8A 5I3SA 4PAIA 3LUZA 1BK4A 4PETA 1NI9A 2R8TA 4N8GA 1IMDA 1EYJA 1NUXA 5LTCA 5A5LA 2B4MA 1FPEA 4PGPA 4QXDA 4P8BA 2QVRA 1FPJA 4NAPA 4HE2A 4OVRA 2XXKA 3E78A 4N8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PC9 A;  2XWI A;  3GYY A;  4MX6 A;  4N6K A;  4P1E A;  4N4U A;  4P1L A;  4MEV A;  4OVS A;  2ZZX A;  4MMP A;  4PFB A;  4PF8 A;  4X8R A;  2HPG A;  2V4C A;  2HZK A;  4N91 A;  4P56 A;  4NQ8 A;  4OVQ A;  4X04 A;  4PBQ A;  4YZZ A;  4PAF A;  4DI4 B;  4N17 A;  4OA4 A;  4MNC A;  4NF0 A;  4LN5 A;  2HZL A;  4PAK A;  3FXB A;  3U65 A;  2CEY A;  5I5P A;  5CM6 A;  2PFY A;  4O94 A;  4OAN A;  4NX1 A;  4PFI A;  4MNP A;  4NG7 A;  4PDH A;  4MHF A;  2XA5 A;  4XFE A;  4MAG A;  3B50 A;  2XWK A;  5IM2 A;  4PBH A;  4N15 A;  4O8M A;  4XEQ A;  4PCD A;  5I7I A;  5IZZ A;  4OVT A;  4MIJ A;  2WYK A;  4NN3 A;  4PF6 A;  4DI3 D;  4PAI A;  2ZZW A;  4PET A;  4N8G A;  4PE3 A;  4PFR A;  5LTC A;  4NGU A;  4PGP A;  2VPO A;  4YIC A;  4P8B A;  2XWV A;  4PGN A;  2ZZV A;  4NHB A;  4XF5 A;  4P47 A;  4OVP A;  2CEX A;  4P3L A;  4NAP A;  4N6D A;  4OVR A;  4PDD A;  4P9K A;  4UAB A;  4MNI A;  2XXK A;  5IGA A;  2WX9 A;  4MCO A;  2XWO A;  2VPN A;  4N8Y A;  2WYP A;  4O7M A;  2PFZ A; 
#chains in the Genus database with same CATH topology
 5JK4 A;  1NV0 A;  4EF2 A;  4OXV A;  2QVU A;  4PE5 B;  1B5H A;  2XX9 A;  5DYH A;  4AS5 A;  2AYS A;  3W15 C;  3UGW A;  4N6P A;  1NV7 A;  2Y7R A;  4PQJ A;  5I57 A;  2PYY A;  3EHS A;  5CBR A;  1FPB A;  4ZEC A;  1MY0 A;  4PAK A;  3C4M A;  2F7A A;  4FEC A;  4C0R A;  1EYI A;  4OAN A;  4N81 A;  5DVJ A;  3OO6 A;  1SW5 A;  1FBE A;  2CMO A;  3ILT B;  4OZ9 A;  4GVO A;  1MY4 A;  2Q9T A;  4KQP A;  4DXB A;  3JYR A;  1NNK A;  2DE4 A;  4BDM A;  5EQ7 A;  1DTG A;  5L8D A;  3SER A;  3L6H A;  4MIJ A;  4NF4 A;  3MST A;  1B4Z A;  4IY5 A;  3K1M A;  3MQ9 A;  4IO2 A;  3ROJ A;  1FBF A;  1O63 A;  1JP4 A;  4OET A;  2O68 A;  1JW4 A;  3PTY A;  4JWY A;  1FQB A;  1MXZ A;  4ELR A;  4F19 A;  3RPW A;  1USY E;  3CSB A;  1VR5 A;  4IGR A;  2UXA A;  2V93 A;  5KCJ B;  3SEX A;  3TPA A;  3O66 A;  4P9K A;  4YB7 A;  2REJ A;  2GHB A;  3K1N A;  1QUL A;  4MLV A;  5AA4 A;  3IOW A;  2AIX A;  3H6T A;  4NF5 A;  5I2K B;  4K3F A;  1ELJ A;  4N6K A;  1LB8 A;  4O7I A;  4OEV A;  4NWD A;  2OK2 A;  3SEV A;  2IA4 A;  3SEW A;  2PT2 A;  4N91 A;  2Q89 A;  2FYI A;  1WOD A;  4OA4 A;  4OFO A;  1USY H;  3ZSF A;  4R2B A;  1QJM A;  4RA1 A;  5H8H B;  3C31 A;  4RXL A;  5CM6 A;  3RT8 A;  4O3B A;  1XI6 A;  2FNC A;  1IUD A;  4MNP A;  2XHD A;  4YMA A;  2LAO A;  4TLL B;  1NNF A;  4RJZ A;  3RNN A;  2F8D A;  3O9P A;  4H1X A;  5HBC A;  4HW8 A;  3G3J A;  1UIV A;  3SEU A;  1INP A;  1DSN A;  2NXO A;  3V5A A;  3EHU A;  3TCH A;  5TP9 A;  1P1N A;  1PDA A;  1NL5 A;  1OQG A;  3MZ1 A;  2ZZW A;  2E1S A;  4NF6 A;  3THI A;  3RY3 A;  4MF3 A;  1RDX A;  4F3S A;  4NGU A;  1B52 A;  1IEJ A;  1MQG A;  3RTW B;  3MBP A;  5HM4 B;  4XF5 A;  2I48 A;  3KBR A;  3VLW A;  3VLV A;  4KPT A;  2M8C A;  4MNI A;  4UAC A;  2WX9 A;  1NMU A;  4DIG A;  5FHN A;  4C1U A;  5AA2 A;  1B46 A;  3WAF A;  4F3G A;  2WEF A;  3M3F A;  1FQE A;  1GTK A;  2OLB A;  3CSG A;  4JSO A;  2CZK A;  4OTE A;  4OFJ A;  2UVI A;  3KN7 A;  3FJM A;  1FPL A;  1FQC A;  5DEX B;  4PFB A;  4QHQ A;  5ET5 A;  4ONY A;  3O6G A;  3QSL A;  1QVS A;  4QF9 A;  3C9H A;  3CFZ A;  4IO7 A;  2V3T A;  5JEI A;  3IJX B;  3BFT A;  2NOO A;  1FTJ A;  2GH9 A;  1CNQ A;  4MFI A;  3H03 A;  5I59 B;  5J16 A;  3IFA A;  3LV0 A;  4POW A;  4G77 A;  3DM0 A;  2O1L A;  3GBB A;  4I9D A;  3O6I A;  3PPQ A;  1S7Y A;  1I6A A;  5KCJ A;  4PCD A;  2HAV A;  1AL3 A;  2HXW A;  1KZ8 A;  1D3K A;  1I6B A;  4DDD A;  4U2R A;  4EXL A;  3RLF E;  3HV1 A;  5I2K A;  1IXI A;  1GV8 A;  5AA1 A;  2NVU B;  3PGF A;  2DOJ A;  4FED A;  3JZJ A;  2D3I A;  1K9Y A;  2DWJ A;  5EYF A;  1YYZ A;  1LCF A;  2ZYM A;  1EU8 A;  3OEN A;  1NUW A;  2QS3 A;  4BDO A;  1MQJ A;  1MPC A;  4GLI A;  3DP8 A;  4XKN A;  2VPN A;  1Q35 A;  1OVT A;  5LOM A;  4GWX A;  1B7U A;  2ZYK A;  4P1E A;  3MWB A;  4GL0 A;  4H0W A;  3M3L A;  4GF8 A;  4Q5T A;  2HXR A;  2A5T B;  5KZT A;  1MRP A;  1J1N A;  2HZK A;  3OOA A;  2PMS A;  4YU0 A;  1RKM A;  3PD9 A;  4PFY A;  4WEP A;  3G3F A;  4LQ5 A;  4IO6 A;  3B7D A;  5AA3 A;  3AXF A;  4LN5 A;  1Y4C A;  3E79 A;  3H6W A;  1NNT A;  3TKD A;  4KD5 A;  5M2V A;  3Q26 A;  3R6U A;  4WKM A;  2MKZ A;  4F22 A;  3IB1 A;  1IQ7 A;  3MZB A;  3T9X B;  3K6V A;  3O28 A;  4GWZ A;  3KN8 A;  4R75 A;  1DK4 A;  2VHA A;  4OVT A;  5H8N B;  4M4G A;  3MW0 A;  1IME A;  2D21 A;  2Z22 A;  3PUZ E;  1BK4 A;  3TTK A;  4IB2 A;  1BTJ A;  4O3A A;  5A5L A;  2B4M A;  4QXD A;  3KSJ A;  2YLN A;  4O3C A;  2QVR A;  3IL1 B;  3S4U A;  3TTL A;  4EDP A;  4LZ5 A;  4HE2 A;  2YJP A;  2QL3 A;  1B9J A;  2DSF A;  1MY2 A;  3K01 A;  3E78 A;  3FV1 A;  3M3K A;  2Z8D A;  3GLB A;  5L9O A;  4PC9 A;  4G8H A;  4BDR A;  1SW4 A;  1H3D A;  1FRP A;  4M1V A;  3E13 X;  3G3I A;  2ZZX A;  2OWT A;  1RDZ A;  2OJT A;  1G0H A;  1FPI A;  3C34 A;  4G68 B;  4NMY A;  3KZG A;  2XD3 A;  4ELQ A;  4YZZ A;  2UYF A;  4HXV A;  2XXQ A;  1ZBM A;  1H45 A;  4HCY A;  1L5T A;  1NH7 A;  4KYS A;  3T1B A;  1BLF A;  3VFJ A;  1D4N A;  5CMB A;  1IMB A;  4NE4 A;  2RF1 A;  1FTK A;  1NV5 A;  1NV2 A;  5TPA A;  2B3B A;  2R71 A;  2P2A A;  3WAE A;  2F6G A;  3HHF A;  4GXS B;  3EF7 A;  1OVB A;  1PB8 A;  3OO9 A;  3O6H A;  1ZLQ A;  3T9H B;  1JET A;  4ECF A;  3IB0 A;  1MG1 A;  4QFO A;  1P1Q A;  1OQH A;  1SPI A;  1POT A;  3EKI A;  5ISU A;  3LSW A;  3V83 A;  2FIE A;  1ZIU A;  3MPL A;  1D9Y A;  1NFT A;  1MH3 A;  3T93 B;  1A8E A;  4XKR A;  2FVZ A;  2QS2 A;  1XHY A;  4ZEK A;  2XXY A;  1IXG A;  1JQF A;  4P47 A;  2O7I A;  2A5T A;  1MQD A;  5IKB A;  3H06 B;  1FBG A;  2X26 A;  5EHS A;  3TQW A;  5A5X B;  5EQ8 A;  3LBS A;  3ZS6 A;  2QMX A;  3FXU A;  1EH3 A;  4KYD A;  1JW5 A;  1NH8 A;  4YB5 A;  4MX6 A;  2O1M A;  5CC2 A;  4P1L A;  3QMF A;  4I62 A;  4LON B;  3IOV A;  5H8F A;  1B0H A;  2Y7P A;  5FTH A;  1FBD A;  5DW8 A;  5IZ3 B;  2HPG A;  2AL5 A;  5BWJ A;  1N84 A;  3CRB A;  4ZEF A;  3EPE A;  3CG3 A;  1I6Q A;  4NWC A;  4DI4 B;  4OYV A;  2FA7 A;  4NF0 A;  1XOC A;  1LBZ A;  1MDP 1;  5ELV A;  4DXU A;  1R9L A;  3T96 B;  1IIT A;  3RPL B;  4AB5 A;  1H44 A;  3CR9 A;  3K6X A;  1CB6 A;  1QUI A;  2X7P A;  1US4 A;  4GXA A;  5FBP A;  4KFQ A;  3QUF A;  5I7I A;  3TYH A;  1M5C A;  5I2N B;  4GBW A;  3KOS A;  3U94 A;  5K2Y A;  4DZ1 A;  3W9V A;  2DYX A;  1UTH B;  4Q8R A;  4QSD A;  4KCC A;  4C1T A;  1IMF A;  1Y4T A;  1H76 A;  2ZNS A;  4YIC A;  4QSE A;  3VDF A;  2F35 A;  4POX A;  1DPP A;  3OXN A;  3ODB A;  1XT8 A;  1Y3Q A;  1LBX A;  3H6V A;  1JVX A;  4LUB A;  4G68 A;  4AS4 A;  4H8J A;  4R9F A;  2KQZ A;  3PMV A;  1Y1M A;  3W9W A;  3A09 A;  2QS1 A;  3FD3 A;  4KYE A;  4EQ7 A;  4JSD A;  3TMG A;  4MLQ A;  4H5G A;  1R6Z A;  1LGB C;  5F7V A;  4OEN A;  1FTL A;  3TCF A;  3VV5 A;  4PAF A;  3IOR A;  3RTF B;  1FJ9 A;  5H8Q A;  1JNF A;  1Y3P A;  1B2H A;  1TFD A;  3MVX A;  1IMA A;  4R72 A;  3B6W A;  4F1V A;  2HEU A;  4F39 A;  4IO3 A;  4ZE9 A;  2FBP A;  1AWB A;  3ECR A;  1SYI A;  3QIM A;  4PDH A;  4F18 A;  1R1N A;  3VE1 B;  3MZ9 A;  1Q9D A;  3FVO A;  3N6U A;  3OEL A;  4LP2 B;  3ONM A;  1LLS A;  1LEV A;  3B6Q A;  4XEQ A;  2REG A;  4QRZ A;  3QUJ A;  3QYT A;  5IZZ A;  4ZZA A;  2XXW A;  4XKP A;  2HCA A;  2I3V A;  2RC8 A;  4YMB A;  4X9T A;  3RN8 A;  5A5X A;  1TFA A;  3M8U A;  1MQI A;  1ANF A;  1MM7 A;  2XXT A;  3IO6 A;  5KDT A;  4NHB A;  5CMC A;  5I58 B;  4EQB A;  1P1W A;  2V84 A;  4P3L A;  4LQ2 A;  3TUS A;  3CHG A;  1QKA A;  3TAJ A;  2I0C A;  3PD8 A;  1MY3 A;  3K00 A;  2XXX A;  3RYD A;  4Z7E A;  4GX4 A;  5IAI A;  1ZTY A;  2I4B A;  4ZZE A;  5I56 B;  3VLU A;  4IGT A;  2DWH A;  2XXU A;  3D1R A;  3FUZ A;  1NV1 A;  1WVJ A;  4U23 A;  1KWH A;  4GWO A;  4N07 A;  4ISU A;  4H8I A;  2H5Y A;  4WXJ A;  3HPI A;  5I2N A;  3TOD A;  1DCU A;  3Q25 A;  1B0L A;  3FXB A;  3MVY A;  2OCU A;  3KJ7 A;  1UTH A;  1LBC A;  2F7B A;  2OBG A;  3GBA A;  1B3L A;  3IX1 A;  4FAJ A;  2DWA A;  1MXY A;  1NV3 A;  1OMP A;  2Y5K A;  2XXP A;  4P11 A;  1URD A;  1S9T A;  4U22 A;  4G8N A;  3OO8 A;  4HE1 A;  4U4X A;  3TCG A;  4O8M A;  5ET6 A;  4KXP A;  3FAT A;  2PVU A;  4JVC A;  1URG A;  3G3K A;  2ZYN A;  4DCX A;  3N94 A;  4RNS A;  4IR8 A;  3KJT A;  2VP1 A;  1TXF A;  3E9X A;  3LUZ A;  4FJP A;  1FQF A;  4BLA A;  1NI9 A;  4N8G A;  2O7U A;  1IMD A;  2F34 A;  5LTC A;  1B4H A;  2ZNT A;  1FPE A;  3FJG A;  3QXM A;  2O6A A;  3PUV E;  3O2A A;  5FHO A;  4ZEB A;  4F31 B;  3TEL A;  4JXI A;  3TZA A;  1Y20 A;  1B6H A;  3K4U A;  2I6E A;  1B3F A;  3PMW A;  1JVY A;  3Q29 A;  3S9E A;  3A3U A;  5J1D A;  2ANJ A;  3HCQ A;  1UIU A;  4MEV A;  2Q8J A;  2VOZ A;  2OX3 A;  4MMP A;  1Q1K A;  2H4I A;  4U21 A;  2RC7 A;  4PFW A;  4L17 A;  1OLA A;  2WKY A;  3PPN A;  3C33 A;  3H7M A;  4OVQ A;  2WBD A;  1AIV A;  3IR1 A;  2F5X A;  4HE0 A;  3KEI A;  5H8H A;  4OES A;  3ZKL A;  4QFP A;  1NV4 A;  1DPE A;  1QUK A;  3UIF A;  1QKB A;  5AA2 D;  1Y3N A;  2CZL A;  2ESN A;  4PTK A;  4ZEI A;  1FBC A;  5CI5 A;  4PFI A;  1KA1 A;  1IZ1 A;  4PFT A;  3C32 A;  3FZV A;  4E0X A;  1A40 A;  1FBP A;  3FJ7 A;  2V3U A;  2R6G E;  1OIB A;  4KI0 E;  4FOR A;  5EQA A;  5ESY A;  1SW2 A;  2F3B A;  1GGG A;  4G4P A;  3IFC A;  3KFM A;  4OWD A;  2Q8M A;  4OQO A;  5L9M A;  3USD A;  3K02 A;  1ATG A;  4MBP A;  3MUQ A;  4FBP A;  1SI1 A;  4H45 A;  2XD2 A;  2ALU A;  1SI0 A;  3JV9 A;  5AE4 A;  3C35 A;  5ITP A;  2ZMB A;  4EQ9 A;  2L5V A;  5I56 A;  2DWI A;  3T9U A;  3OSQ A;  1MY1 A;  4PDD A;  4F29 A;  4JWO A;  4UAB A;  3TQL A;  4I1D A;  1YAE A;  4ESW A;  3KC1 A;  3LSL A;  1AOV A;  3FIR A;  4R6Y A;  2RCB A;  2B65 A;  3U72 A;  1G0I A;  3OEM A;  3BIG A;  5DEX A;  1LCT A;  2XXH A;  3GZG A;  4ESX A;  1O64 A;  3PPP A;  4IY6 A;  2E0S A;  1YXI A;  3K1P A;  3S9N C;  4FIM A;  5EYH A;  4GL8 A;  5FHM A;  2ABH A;  5BUU A;  4PBQ A;  4R6H A;  4MNC A;  2UYE A;  3MAM A;  2P3N A;  3FAS A;  5I57 B;  1N7W A;  5I59 A;  4BDL A;  4P0I A;  1SYH A;  4YKP A;  3K6W A;  4YKK A;  4P0G A;  4H6D A;  4F3B A;  4G2Z A;  3F11 A;  2DP8 A;  3HHG A;  1B3G A;  1FPK A;  1MDQ A;  3E4R A;  1BIY A;  5CRY A;  5H8S A;  4I3E A;  3HO7 A;  2FIX A;  4NN3 A;  2HHM A;  2B3F A;  1MS7 A;  4NF4 B;  1ZMG A;  3OD7 A;  3VVD A;  3LUY A;  2O51 A;  1NV6 A;  4KR5 A;  4LZ7 A;  4RYA A;  2PX1 A;  3DEL B;  3I3V A;  3U92 A;  3UK4 A;  2Q74 A;  5B7D A;  3FXQ A;  3PUW E;  1MXV A;  4QFK A;  4R2F A;  4DE8 A;  4RK9 A;  4AB6 A;  1Y9U A;  3OMB A;  4X1B A;  5IGA A;  3N6T A;  3MVZ A;  2WYP A;  1PEB A;  3A3C A;  1FCK A;  4GWW A;  4ND9 A;  1XVY A;  3S9M C;  4NF5 B;  1LFG A;  1B5J A;  2ONK E;  4JDF A;  5JTY B;  2Y7W A;  3RT6 B;  2QMW A;  2HFB A;  2F6P A;  4R73 A;  1VFD A;  3IAZ A;  2V4C A;  4U1Z A;  2O84 X;  1LAG E;  3S9L C;  4Q0C A;  1AMF A;  1FBH A;  3D4G A;  1NKX A;  2NUV A;  3L6G A;  2Z8E A;  3U65 A;  1BP5 A;  4LZ8 A;  5I5P A;  1R9Q A;  4O94 A;  3IOT A;  4GWU A;  2OZZ A;  1TT1 A;  4JVD A;  1A55 A;  4MJO A;  2QSX A;  3MP6 A;  3IO4 A;  4QFL A;  1B5I A;  3VXB A;  4YKJ A;  4PBH A;  1A54 A;  5H8N A;  4ELP A;  1NNP A;  2KR0 A;  4OFL A;  3SET A;  1FPD A;  4GFR A;  1SD3 A;  4NF8 B;  3U8Q A;  4H5F A;  5TP9 B;  3KG2 A;  3O29 A;  3T66 A;  1SVX B;  1A7L A;  2GHA A;  3RGY A;  4NF6 B;  3VVF A;  3FGS A;  4THI A;  2XXV A;  2VPO A;  2XX8 A;  4ZE8 A;  2XWV A;  2QVV A;  1LBW A;  2ZZV A;  2IEE A;  2R9J A;  4H67 A;  1NUY A;  3MYU A;  4PP0 A;  4X1D A;  2Q2A A;  2QRY A;  3NOH A;  4MCO A;  1D9V A;  2XXI A;  1B58 A;  3GYY A;  3TTR A;  5AA2 B;  3CG1 A;  4QBA A;  1N3W A;  1MXX A;  4FE8 A;  2KLF A;  2DS9 A;  2P0S A;  1LAF E;  2D5W A;  4E0W A;  1YPN A;  1B40 A;  4G61 A;  4PF8 A;  1FQA A;  2QPQ A;  4X8R A;  1B51 A;  4P56 A;  3ILU B;  4BDQ A;  4NQ8 A;  4HTG A;  5I84 A;  4N17 A;  1HSE A;  2DDK A;  3RUM A;  1FJ6 A;  1N76 A;  3H6U A;  4GOT A;  1UTB B;  3SES A;  1MM6 A;  1H43 A;  2PBW A;  2VGQ A;  2RC9 A;  1NUZ A;  4QSC A;  2Y5L A;  4NX1 A;  1FTO A;  4IO5 A;  1PB7 A;  2YPN A;  4ZED A;  3SKP A;  5F1Q A;  4MAG A;  4TOZ A;  3K2D A;  5IM2 A;  4DLD A;  2ONS A;  1ZJL A;  3CIJ A;  3QK6 A;  2WYK A;  3V89 B;  1OLC A;  3TTM A;  4PAI A;  4YB6 A;  3EN3 A;  1LST A;  4OHN A;  4PET A;  2R8T A;  3SEY A;  3IOU A;  1EYJ A;  1N3X A;  3I5O A;  1M5B A;  2ZNU A;  4TQU Q;  4PGP A;  5JTY A;  1XC1 A;  2QJE A;  1B3H A;  4TLM B;  5HPQ A;  4GRK A;  4NAP A;  1DOT A;  2DVC A;  4OMB A;  5TU0 A;  1TWY A;  2XXK A;  2H98 A;  3I6V A;  2A5S A;  4F3P A;  3LC8 A;  4X48 A;  4N8Y A;  3BFU A;  2V25 A;  1EZ9 A;  4NTL A;  1QW0 A;  2XWI A;  2P3V A;  3G3H A;  4OER A;  2CZI A;  3B8B A;  3UA8 A;  3B6T A;  3MPK A;  3LSF B;  3BKI B;  4N4U A;  2AL4 A;  2UVJ A;  4OVS A;  3U93 A;  3S2V A;  3EHT A;  3HN0 A;  5IZ3 A;  1I69 A;  4OEU A;  3PPR A;  3DLN A;  3UOR A;  4EUO A;  2V3Q A;  1FTA A;  2VT5 A;  3HFU A;  4G68 C;  1HSL A;  3BIH A;  3QAX A;  3FVK A;  1YCJ A;  4XKQ A;  2DVZ A;  4NF8 A;  3PUX E;  5DT6 A;  3RPL A;  4PFU A;  3KSX A;  1B7H A;  1US5 A;  1PC3 A;  2DXY A;  1Z7M E;  2QS4 A;  4JB7 A;  2UVG A;  1ZU0 A;  2OWS A;  2H99 A;  3DP4 A;  1PB9 A;  4XTC Q;  3G3G A;  4GX6 A;  3KC0 A;  1XVX A;  3B50 A;  1O7T A;  2XWK A;  4EXK A;  1QGX A;  3KN3 A;  3N26 A;  1LFI A;  2GFE A;  2I3W A;  3P7I A;  5ITO A;  4DCY A;  1F9B A;  4DI3 D;  1MH4 A;  1MPD A;  3MVW A;  4ZS9 A;  1Y1Z A;  5CMM A;  3A29 A;  4R6K A;  1YTV A;  4PFR A;  1FTM A;  2OWZ A;  3CFL A;  3MC2 A;  3U1O A;  4JWX A;  5ET8 A;  3SZP A;  3TDJ A;  4OVP A;  3O97 A;  3Q27 A;  4U1O A;  4EF1 A;  1RDY A;  4F2Q A;  5L9S A;  2B4L A;  2Y7K A;  3GXA A;  1PBQ A;  1UTB A;  1GVC A;  4I8C A;  4QFN A;  2Y84 A;  3UN6 A;  1IMC A;  3HST A;  2I58 A;  1YZ0 A;  1FSA A;  5IZ1 A;  1GR2 A;  3K6U A;  2X7Q A;  4F1Y A;  3H4Z A;  2HQ0 A;  1EYK A;  3FXR A;  1CE2 A;  1FW0 A;  3DP6 A;  4H46 A;  1MXW A;  3VVE A;  1B7Z A;  4F2O A;  3TTN A;  4FEB A;  2BJJ X;  4GQO A;  3N5L A;  4RPN A;  1JW1 A;  4GD5 A;  4NG7 A;  5B70 A;  2F36 A;  5TPA B;  4IO4 A;  2XA5 A;  1VDW A;  1B32 A;  4Z0I A;  5T3J A;  4I3Y A;  5LDZ A;  4OVJ A;  3MJN A;  3SDF A;  2Q88 A;  4R9G A;  4HCW A;  2Z8F A;  3H3G A;  2PCR A;  4U4S A;  4PF6 A;  3IJO B;  4PE3 A;  5ET7 A;  1Z7N E;  4G8M A;  2CZH A;  3RQT A;  3PMX A;  1UQW A;  1FPG A;  2I49 A;  3Q28 A;  5I58 A;  1M5F A;  1JEU A;  1VFE A;  4H65 A;  3V8X B;  2XXR A;  1DBZ A;  4DXC A;  2CEX A;  4UA8 A;  1P99 A;  2GQ1 A;  4N6D A;  1B1H A;  4YKI A;  4FAT A;  2JJK A;  3IK6 B;  4MH5 A;  2GRV A;  4KHZ E;  4KCD A;  1LBY A;  1A8F A;  3CI8 A;  1MQH A;  3E3K A;  3UP9 A;  4LVQ A;  2XX7 A;  2VD2 A;  2H25 A;  1S50 A;  3OSR A;  1D9Q A;  4WED A;  2G93 A;  3FVG A;  4Q30 B;  5H8F B;  1M5D A;  1POY 1;  3PV0 E;  2QFL A;  2HAU A;  3CFX A;  1QUJ A;  2BJI A;  4GX3 A;  4BDN A;  2I0B A;  1VSO A;  3K0V A;  1KA0 A;  3ZKK A;  1IXC A;  1P1U A;  4I40 A;  1LBV A;  4LAT A;  3OEK A;  2G29 A;  1XS5 A;  3EQ1 A;  5DVI A;  3FBP A;  1URS A;  4JBZ A;  3KBZ A;  1LBB A;  4ELO A;  2FHY A;  2VD3 A;  2F7C A;  2RIN A;  4MHF A;  3T22 A;  4XFE A;  1EZP A;  2Z23 A;  1N7X A;  3PU5 A;  2Y7I A;  4N15 A;  3ISP A;  1RYO A;  3G7W A;  2ONR A;  1B1X A;  5DTB A;  3R26 A;  4NED A;  1PBP A;  4XXU A;  1P1O A;  3FVN A;  3CVG A;  1EZO A;  3LR1 A;  2NWJ A;  2UVH A;  4GWY A;  5CBS A;  4ZDM A;  3OO7 A;  5CMK A;  3LSX A;  2F78 A;  1HSJ A;  3C36 A;  2RCA A;  5ICQ A;  1B3E A;  4PGN A;  1T0K A;  5ICT A;  2H9B A;  1FQD A;  4XIG Q;  2RKM A;  5DVF A;  1SDX A;  1LFH A;  3PUY E;  2DXR A;  3MP8 A;  1B05 A;  2XWO A;  3D4C A;  4O7M A;  4JVI A;  2PFZ A;  2THI A;  1N0T A;  1LB9 A;  2DE2 A;  3BBR A;  2DQV A;  1FPF A;  3KGC A;  4GIZ A;  1IXH A;  3VXC A;  2P1S A;  1MXU A;  2F3D A;  4GWS A;  3PPO A;  4F1U A;  1A99 A;  5EYG A;  1AH5 A;  4X04 A;  4GBV A;  1II5 A;  3T0J A;  4RK2 A;  5AA4 B;  1K9Z A;  5FTI A;  2HZL A;  3TFL A;  3TEP A;  2F97 A;  2O69 A;  2CEY A;  4HS7 A;  5H8Q B;  3MP1 A;  1LAX A;  2PFY A;  5F24 A;  4YAH X;  2WBB A;  2Q2C A;  3FV2 A;  3R7X A;  2W7Y A;  5EQ9 A;  1MPB A;  1SBP A;  1JEV A;  2DE3 A;  4RY1 A;  2ZXT A;  4R74 A;  3KOT A;  1DMB A;  2I4C A;  5I3S A;  1N04 A;  4LA9 A;  1NUX A;  1IIW A;  1M5E A;  1SQY A;  1ZKB A;  4P8B A;  1LAH E;  4RPO A;  5K2X A;  5KDT B;  3IB2 A;  1VE4 A;  1WDN A;  1BKA A;  1FPJ A;  3T9V A;  2ZYO A;  4OVR A;  1RYX A;  4AQ4 A;  1SW1 A;  1DTZ A;  2PT1 A;  5EHM A;  4N13 A; 
#chains in the Genus database with same CATH homology
 5JK4 A;  4PC9 A;  2XWI A;  2P3V A;  1NV0 A;  2CZI A;  3B8B A;  2QVU A;  5J1D A;  4N4U A;  1FRP A;  4MEV A;  4AS5 A;  4M1V A;  4OVS A;  2ZZX A;  2OX3 A;  4MMP A;  1RDZ A;  5IZ3 A;  1G0H A;  1FPI A;  2V3Q A;  1FTA A;  2VT5 A;  3HFU A;  4OVQ A;  1NV7 A;  2WBD A;  3BIH A;  4YZZ A;  2F5X A;  4HXV A;  4HE0 A;  4HCY A;  1FPB A;  3T1B A;  2DVZ A;  1NV4 A;  4PAK A;  3RPL A;  1IMB A;  1EYI A;  4OAN A;  4N81 A;  1NV5 A;  1NV2 A;  4PTK A;  1FBE A;  1FBC A;  4PFI A;  1KA1 A;  4GX6 A;  3KC0 A;  1FBP A;  3B50 A;  2Q9T A;  2XWK A;  1QGX A;  2DE4 A;  5EQ7 A;  5EQA A;  5ESY A;  2F3B A;  3IFC A;  1SPI A;  3EKI A;  2FIE A;  4MIJ A;  2Q8M A;  3MST A;  4DI3 D;  4FBP A;  3A29 A;  4H45 A;  4PFR A;  2FVZ A;  1FBF A;  3ROJ A;  1JP4 A;  2OWZ A;  3PTY A;  4F19 A;  2L5V A;  5ET8 A;  3SZP A;  4P47 A;  4OVP A;  4PDD A;  1RDY A;  4P9K A;  4UAB A;  2B4L A;  1FBG A;  5EQ8 A;  3KC1 A;  4MX6 A;  1G0I A;  4N6K A;  3BIG A;  1IMC A;  4O7I A;  4P1L A;  3QMF A;  1YXI A;  1YZ0 A;  1FSA A;  5EYH A;  1FBD A;  5DW8 A;  5IZ1 A;  5IZ3 B;  2HPG A;  4N91 A;  1EYK A;  4PBQ A;  4DI4 B;  4OA4 A;  4H46 A;  4MNC A;  4NF0 A;  2P3N A;  1LBZ A;  5CM6 A;  1XI6 A;  3RPL B;  4MNP A;  4NG7 A;  2XA5 A;  1VDW A;  5T3J A;  4I3Y A;  5FBP A;  5LDZ A;  1INP A;  1FPK A;  5I7I A;  4HCW A;  4I3E A;  2PCR A;  4GBW A;  2FIX A;  4NN3 A;  2HHM A;  4PF6 A;  3W9V A;  2ZZW A;  1RDX A;  4PE3 A;  5ET7 A;  1NV6 A;  1IMF A;  2CZH A;  4NGU A;  1FPG A;  2Q74 A;  4YIC A;  4XF5 A;  1LBX A;  1DBZ A;  2CEX A;  2GQ1 A;  4N6D A;  4AS4 A;  4MNI A;  5IGA A;  2WX9 A;  2JJK A;  2WYP A;  2KQZ A;  2WEF A;  4GWW A;  1LBY A;  3W9W A;  2CZK A;  1FPL A;  1D9Q A;  4PFB A;  5ET5 A;  2V4C A;  2QFL A;  2BJI A;  4GX3 A;  4PAF A;  1KA0 A;  4I40 A;  1FBH A;  1LBV A;  1FJ9 A;  3U65 A;  3FBP A;  5I5P A;  1IMA A;  4O94 A;  3KBZ A;  4GWU A;  4F1V A;  2FHY A;  1CNQ A;  4JVD A;  4MJO A;  2FBP A;  5J16 A;  1AWB A;  3IFA A;  4PDH A;  3LV0 A;  4F18 A;  4MHF A;  4XFE A;  1Q9D A;  4PBH A;  1LEV A;  4N15 A;  4XEQ A;  2KR0 A;  4PCD A;  3ISP A;  5IZZ A;  1FPD A;  1KZ8 A;  4X9T A;  4GWY A;  2VPO A;  2XWV A;  1K9Y A;  2QVV A;  1LBW A;  2ZZV A;  4PGN A;  4NHB A;  1YYZ A;  1NUW A;  4P3L A;  1NUY A;  3CHG A;  3MYU A;  3NOH A;  4MCO A;  2XWO A;  2VPN A;  4O7M A;  4JVI A;  2PFZ A;  3RYD A;  3GYY A;  4GWX A;  4QBA A;  4GX4 A;  2DE2 A;  4P1E A;  1FPF A;  3D1R A;  4G61 A;  1NV1 A;  2F3D A;  2HXR A;  4PF8 A;  4GWS A;  4F1U A;  2QPQ A;  4X8R A;  2HZK A;  5EYG A;  4P56 A;  4NQ8 A;  4X04 A;  4GBV A;  3T0J A;  4N17 A;  1K9Z A;  2DDK A;  1FJ6 A;  1DCU A;  4LN5 A;  2HZL A;  3E79 A;  3FXB A;  2CEY A;  2PFY A;  5F24 A;  1NUZ A;  2Y5L A;  2WBB A;  4NX1 A;  1NV3 A;  2Y5K A;  2MKZ A;  4MAG A;  5EQ9 A;  5IM2 A;  4HE1 A;  4GWZ A;  4O8M A;  5ET6 A;  4KXP A;  1DK4 A;  2DE3 A;  4JVC A;  4OVT A;  1IME A;  2WYK A;  4IR8 A;  5I3S A;  4PAI A;  3LUZ A;  1BK4 A;  4PET A;  1NI9 A;  2R8T A;  4N8G A;  1IMD A;  1EYJ A;  1NUX A;  5LTC A;  5A5L A;  2B4M A;  1FPE A;  4PGP A;  4QXD A;  4P8B A;  2QVR A;  1FPJ A;  4NAP A;  4HE2 A;  4OVR A;  2XXK A;  3E78 A;  4N8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...