2XWTA

Crystal structure of the tsh receptor in complex with a blocking type tshr autoantibody
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
221
structure length
215
Chain Sequence
b'EVQLVQSGAEVKKPGQSLKISCKASGYSLTDNWIGWVRQKPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSINTAYLQWSSLKASDTAIYYCVGLDWNYNPLRYWGPGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYROID BLOCKING HUMAN AUTOANTIBODY K1-70 HEAVY CHAIN
publication title Crystal Structure of the Tsh Receptor (Tshr) Bound to a Blocking-Type Tshr Autoantibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/immune system
total genus 38
structure length 215
sequence length 221
ec nomenclature
pdb deposition date 2010-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xwtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xwtA01
3MJ7A 4Y2DC 2BHYA 3D0VA 2ORBL 4RAUA 2YD8A 5F70A 4K23L 4Z8FH 1DE4B 3SKUD 1Q0YH 2R1XB 3V6OE 2F54A 4WO4C 1CYGA 4TVSa 2DIBA 4S0SD 5BO1L 5IHUH 3UTTA 4PLOB 1J1XL 2YD3A 4X6FB 4QRPB 1W72A 3BPOC 2EKJA 3NTCL 5D1ZC 4XCCL 5E8DH 2AJVL 1A6TA 4BFIA 5HI3D 2GW5A 2JIXA 3MA9H 1NAMA 3PWUA 3MRJA 3UTZA 3A0OA 4P5TC 1HYSD 4RAVA 4UU9B 1AXSA 4LSRH 3OKNA 2DL9A 3VI3F 1PZ5A 1IQWH 1P5VA 4FQJL 5I17B 4V2CB 4HLZG 4RZCA 3HLAA 4G6FD 3I02A 1FCCA 2FIKA 5ITFB 5HBBA 1JZ4A 5D7JD 3V0WH 2PN5A 1LVEA 5HHOA 4HKJA 2ZPKH 5IT2L 2OTWA 2P48B 4WHYH 5LXGH 2VC2L 3FT3A 1YNLH 4U2YA 4EI5D 4DFHA 1JYVA 1BGXH 4GMSL 5DK2B 3WUZA 2H26B 5HYJD 3BMWA 4YR6B 1YEGH 4HIXH 1GH7A 5BV7H 1UM5L 1L7TH 3QIUC 4GKNB 5IJKC 5BRZB 1J86A 3SJVA 2Q3AA 4CL7A 5ETUA 3ABZA 4QTHB 1QSFB 1B6DA 4OD2B 4P46C 4PV8B 4WI8A 4HBCH 1DSFH 2V2WA 3NCJL 3LPFA 4D9RD 1JUFA 1FGVH 4WFGD 2QHRL 3KPLB 2JK5A 3T1FB 3GI9L 1BOYA 3KPRA 3E8UL 3D18B 1ZVSA 4QXWA 1NCTA 1BBJB 1K4CA 2RQ8A 4LCCB 2FJHA 2W38A 2YPKA 3BDBA 1T04B 4QHKJ 3NBNA 2ESVA 4ZFGH 3SCMD 4PJ9A 4CW1B 4MCYA 1XGYH 4WWKB 4MZ2A 2FWOA 1CF8L 4S1QL 4D0BA 5KVEH 4W6YB 1AQDB 4IOFD 4Z95L 5I6XB 1C5CH 1YY8A 1T0MA 3LS5H 4XBPA 3EZJB 1KC5L 1RZ8A 3U0TB 2PETA 3RZCA 3MUGB 5EU6D 1XIWA 2V5YA 3VFVB 3SKOA 3EO9H 3MLZL 3MRHB 3LKRB 3BDYL 3JV4B 4O58H 3QHFL 5GSRB 1QG3A 2PTVA 2YD2A 4FFWD 1BD2E 1CVSC 2ZOLA 5IWLA 2BCKB 4X6CE 5D4QA 2IF7A 5KVGH 4G8GD 3QZWB 4MNQA 1BZ9A 5TFSH 3MOAH 5IVNA 4I5BA 1EXUA 1Q0XH 4HUKB 4PY8J 4OQ1A 3I50L 5IW1B 4JFFA 2DD8L 3RVTC 1FVEA 3VXME 1U8OA 3U0WL 2MCPH 3DURB 1PGRB 4EUPH 4JGJA 4IRJC 2X7LB 1RJLA 1YPZF 1FVCB 1PQZA 5D1XD 4QRQB 1JGEA 3H3PH 5FYJE 2BSSB 4M43H 2CMRL 4R90L 1VB9A 5JOFA 2IFGA 1S7VA 4HPOH 1MSPA 2BC4B 3C5ZB 3GMQB 1U93A 1VGKA 4JFEB 2V17L 4UMGA 1KYOJ 3F7VB 4U6XB 3P9LB 3SE3C 4HFUL 4FQCL 5FO8A 5C08E 1KLUB 3MRLB 1T7YA 1JE6A 3OKMB 1QYGL 3MRPA 4PR5A 2XKUA 4OCNC 3QUMA 5FM4A 3TLRA 5E8NB 5F6HJ 5E6IA 3AREA 5I30H 4MX7B 5GHWH 4ZD3L 4Q9RL 5GRVK 3MBEA 3PDOB 3VG9C 4WI6A 4QEGA 4V1DB 4J3VA 5DJZA 3Q2CA 5JHLL 5I18H 1QLRA 1X5AA 3DRQB 4CVWA 3FQWB 3MV8B 4UTAH 1KIQA 2MKLC 4YC2C 2FECI 1D9KC 4JY4A 1PYWA 3GSOA 2K7PA 3O6FA 3T77B 5JO5A 3WD5H 5KSAB 3HI6H 4PJDB 4Z5RA 2DTMH 4N8VG 4XWOC 4GW1A 1V3KA 1FHGA 4MCZA 3T0EB 5DQJB 3SO3B 2VR9A 3SDCA 2Z4QA 1A7BA 1T5XB 5AUMA 1GPOH 5EBMB 1QFWI 4XAWH 1NGWA 3FAWA 2PW2A 3L3JA 5D7LE 5C7XH 5DJ2A 4FZEL 1RIHH 4NQUA 4LPWA 4NQCA 3IJYB 3EBAA 3D0LB 4JFOA 1NANH 4HS3A 3BPNC 4OZHF 5ALCL 3S96A 1GGIL 3DXAE 3SDDB 5K9QG 4HKZB 4I2XB 3EYOA 5D1QD 4M4RA 3HNSH 3PP3K 3RY4A 2GAZB 2NY5C 4M7LH 5E5MB 1OAXH 5DQDL 1BMGA 4ZPVB 2PYED 4TULL 4OJFH 4RNRB 4RGMB 5GGRY 1LD9A 1XR8B 3UROR 3BN9D 1HSAA 5L88L 1V5JA 1ZS8A 1OSZB 4JZNB 2GQHA 1I1AD 1DUZB 4YQXH 2B2XL 5DJYA 3DROA 5BZDB 3ARPA 5DS8B 4FQPA 3D3VD 2PYFA 5I0DA 2WBJC 4YHKL 5A2IH 3MNVA 4GXVH 3MCKA 2GK2A 1OGTA 5CFHA 4OV6F 5D2NB 5KJRL 2HFTA 1N2RB 3KDMB 3PHOA 2LVCA 2E27H 4JN2B 5D7JA 3VXSE 4OBSA 5E70A 4WNQB 3CMGA 1RUML 5EIVA 5CUSL 2XQYK 4M61B 4D9QD 4F58L 4MD5B 3F62A 3WN5B 4UZGA 2P49B 4FQLH 1NKOA 4EI5A 1CCZA 3I75B 3WLBA 5KW9L 5JOPE 1G9EA 1IM9B 5FKPA 1YZZA 5IV2A 2F5BL 3RAJL 2EEDA 4YHZH 1JRHH 2UYLA 5J1TC 1BWMA 5GJTH 4MDIA 4JQVA 4KAQL 4JFXA 5FOBA 4MSWA 1P4IH 3WNKA 4LCYB 5SWQB 5CJOH 4FS0A 3QEHA 1NCWL 3FCTB 3L6FA 3B5TA 3MGOA 3CU7A 2YPVL 1BP3B 1I8MB 4WU7B 3UC0L 2WUBH 1F45A 5FGRA 4KTDL 1FNSH 1S9YB 3CMOL 1YQVL 4G8EB 4Z7UF 3P73B 2NTFA 1B0RA 4EN3C 2X89D 3SGDI 2AEWA 2GJZA 5DUPH 4PRIE 4TRPH 4WI5A 2C3GA 2HJFA 1ZT1B 4P5MA 2UVFA 4NZDA 4X99B 5C6WH 5IUSA 2BVYA 2BSRB 3QFDB 1I7RA 5DURD 1CBVL 5ENWA 3FT2B 1OGAE 3QXTA 4U05A 4I3GA 2NY1B 2BNRE 4NDMA 1X44A 3UPRB 5IBUG 3C60C 1VFBB 1WTGT 3KWWB 1EDQA 4UUJA 4GQ9L 1KTLA 3EDFA 2APTA 3TBYB 1EX0A 2EYTA 4OAWA 5EU6A 1OAUL 1PG7X 3QDJB 5D5ME 3SGJC 2P5EE 2CSPA 4MJ6B 3RA7H 1MCKA 3CLFH 4B50A 3D5OF 1KT2A 2AXFA 2BVOA 3QIBD 3OSKA 2EDKA 2NY0C 2XQYG 4G8GA 3ZE0F 3GEWB 1I8IA 1AGCA 2VZTA 3K3QA 4O51B 3TV3H 1A3QA 3O0RL 1YNKL 4OGXH 5F7DB 1J8HE 1EFXB 1JZ3A 2HTLC 4Z7OF 3VWKC 1RHHB 4MXVE 4DJMA 4G6ML 5LBSH 1JPGA 2BX5A 4P9HL 3ISWA 5C0CE 4RDQG 4NQVB 4UNUA 4D0CB 3RP1A 1NCNA 1XCTA 2DS4A 4MD0B 5DD0L 3GSRA 2NLJB 4G8FB 5D1XA 4BFGA 3EYUL 4EUPA 1T0NA 4FTVD 4GH7B 1DQTA 3A6BH 4ZO7A 3HNTL 5E00B 4L9LA 1ZVYA 1LEKB 4KC3B 4EDXA 2VKXA 3IFLL 5EO0A 5K59E 1FC2D 4X7SL 5E1AB 1FGNL 3T08A 2JCCA 1T7ZA 1AGFA 1MCEA 3JWDL 5BZWB 4LASH 1JHKL 4NNPH 5F9JA 3F7RA 1MY5A 2ZJSL 3QISA 3H7LA 5HDQH 3EOTH 1BIHA 2A83A 1WWWX 2EC8A 3GSUB 5AD0B 2DM2A 2R8SH 4HX1A 5EO1B 1Q9KA 1BD2B 3WIFA 5CD3B 1T1ZA 4XVTH 3JV0A 2P7TB 4P2YA 4X6CB 4XP5H 5CILL 4X5XB 1OAKH 3ZKQD 2EEBA 2R0KH 2NXYD 3NZ8A 2YN3A 5BMFL 3QO0B 2VDLL 4X6EB 5DTFB 1Z3GL 4L4TD 3DX7A 4FZ8H 1A02N 1UXSB 3CK0H 4GRLB 2J3SA 4Q6YA 4ELMF 1WEJL 3W5NA 3K2MC 5ERWB 2IFFL 5EU7C 1U8HA 4WCYL 1JMZA 5JW4M 2GTZA 2QSQA 4MAYC 1QSZA 3CAFA 3CUPA 3QAZC 4FQ2L 2JJSA 1NDMB 2CRIA 4NP4H 4ZG1A 5JW4Q 1ROWA 3WBDA 4Z76B 1QBML 4L29B 5C92A 4TUJA 5CEYB 3MROB 2MOVA 2DQEL 1FL6B 3MV7E 4M7ZB 4HUVA 3T2QA 4U1GC 1OW0C 5C08B 3ULUL 2VXUL 2J5LC 1N4XL 5D1QA 5JIHA 3RGVC 3ZTNL 3VGAB 4MWFB 2ITDA 3MV11 2FB4L 2IAMC 3G6AA 2A6KB 1AHWC 1T21A 3WIHH 3KLDA 4I4WA 1I1YB 5AWNH 2PYEA 2CLRB 5LGKA 4KUZL 3FTGB 2E3VA 4NN7B 4Q9QL 4QRTB 1N5AA 5DA4A 3WSQH 1HINH 4LL9A 3S37X 1F13A 2Y36L 4MQTB 3GRWH 1IAOB 2P46B 1R3JB 1XGTB 4JB9H 3U7YH 1I1AA 2BVUA 1MCOL 3FMGH 5CEZH 2I27N 1ZHKB 3KLHC 2VLME 2QQKH 4ZAKB 1DBAH 35C8L 5I66B 4YGVA 5FYJL 4GXUN 5CEZD 4OIAA 3VFNA 1NGZA 5SWZE 3C6LB 4LNRA 4Q9BA 1G1CA 2GFBB 3JV6A 4M62L 2G75B 1MJJA 5BW7A 4FQHB 4QRRE 1CIDA 3P11H 5ICZA 2EH8H 5GISL 5D7LB 4ZPTB 1QQDB 3BAEH 2EDYA 2WM0A 2DDQL 1CLZL 2Y7QB 4TUOA 5IFHL 3QEUA 3P4MA 3DXAB 4J4PC 4PRDB 2LE9A 1UM4H 5JXED 1JYNA 3U7AA 3KYKL 4S1RH 2XWJA 1KLGB 3RWEA 5IIEA 3BH9A 4QGYA 3I3DA 4WHYG 1RSFA 1IFHL 1C16B 2GI7A 1JGDA 4TYUA 4JHWH 3MFGB 2CK0H 4LLUB 5EDXA 3FO1B 5F9WB 3KLAB 2VDPL 2H2PD 5GS0C 4N0UA 3QUYD 3WDIA 5DT1H 3VFOA 2BOCA 1S7RA 2XQBH 4YBQD 4CBPA 2VDMH 4JM2D 3BIKB 1YJDL 5EC2B 5DFWH 4N1CA 2IQ9L 4L3CA 2AJ3A 3HPJB 5DDHA 2SEBB 3RWFB 4E41D 1ZE3C 3CD4A 1QO3B 2CDFA 5MP6H 2FL5B 3AAZA 4P9ML 3QCTH 2WW8A 3EOBA 2KPNA 1XGQB 4OV5B 5DZLA 1EAPA 4P0DA 3QXDA 1FC1A 4HWNA 4IEFB 4GW4B 4B7LA 1H9VA 1MFCH 4Y4FB 1X5ZA 2X4PB 5I1IL 2YXFA 4HG4J 1JNLH 1ZAGA 1D5MA 1CR9L 1FJ1A 4DGIH 4ZQKB 2EZ0D 4RIRA 4EIGB 1KPVB 3ARUA 1MIMH 3GBNH 1WWBX 3DHMA 1U6AH 2MWCA 1TQBB 2PTTB 4U49A 3ARZA 3WFZA 2DQDH 5IG7B 5FYKE 3HZMB 3QIBA 1IC4H 4NKQB 2CO7B 1MH5B 1BZ7B 3UJTL 1Q38A 1XGPA 4M1DL 5FXCH 2DQIL 4KXZH 3V4VH 2ED8A 3V5HB 4LSSL 5IW6B 5CS7A 4U1MB 3N0PB 1OTSC 4LARL 1QSEE 4N9OB 3VXQB 3CFCL 4R4FL 1U8QA 2XRAH 3T4YB 4P2OC 5E2WL 5E99H 5DGQA 1MHHA 4H25B 4K71B 1B88A 1EGJH 2BVQB 3RIFF 4FTVA 4ODXB 4DZ8B 2BNRB 3NGBC 3CZFB 4WDIB 5DQ9B 1IBGH 2VIRB 4PJGF 2OZ4A 2MHAB 3GFUA 4LLAA 3O3BA 4Y2DB 3OBAA 4NJAH 5DWUH 3HZYA 3VRIA 1KCSL 1E27B 3H0TA 2IANE 2E9JA 2EH7H 1F6AA 1PJ9A 4IS6A 5ADPL 1A7PL 1S3KH 4WO4B 1NLBH 5D5MB 4K7FB 1BOGB 2F74B 2P5EB 3M1BB 5CLTA 3DYOA 5DK2A 2YMXH 5HPOA 1N5YL 1WUNT 3BPOB 4NGHH 5D1ZB 3N9GL 2ATPA 2I25N 4ZUSB 4FQIL 2VISB 3WIIL 3U0PA 1NPUA 5M94B 3QYCA 1NSNH 5SX5H 4P5TB 3WDHA 4HKXA 4XP4L 1IVLA 5L2KE 3LS4L 1J8HB 4L4TA 4G43A 3L5XH 4KRPD 4S1SL 5J11C 2YA1A 1PLGH 3LHPH 3RL2B 4PV8A 1CVRA 5I8OH 4JO3H 3SPVA 1RIVL 4XPBH 3FL7A 5EOTA 5C0CB 1AD0A 1BQHG 3BEWA 3E6FB 5B38B 3C6SB 2ZSWA 4OM1L 3X12B 3SDXF 1T1XB 4PGEB 5IVXF 2PF6A 3LEVH 3ZSSA 3L9RA 3IAGC 2ICEB 3G5YA 2FHBA 4JG1L 2HLFC 1OAQL 3L95B 2F5AL 3H8NA 3MLVL 1DP0A 4IRSC 4YBHA 2EIZB 3O6MH 5ALBL 3NIGE 1MHCB 3PE9A 1M71A 5DHYA 5LG1A 1AGEB 4NPYA 3FQUA 1MQ8A 1NBZB 3BH8B 3GMRA 4NRXB 3HC0A 3MRGA 2OTUB 4XPAL 3BPCA 1I1RA 1T2JA 2VZVA 4XPTH 2H32B 4ZOCA 1KEGH 4S2SA 3ZL4L 4X4XA 3QIUB 5IB1B 3K7UA 1OOAA 3BZEB 3P0YL 1W0YT 3C09C 4KHXL 1U3HD 4XH2B 3WIHA 3T2PA 5JHDE 1Z9OA 5ANMA 3D85B 5IF0A 5T33L 4P46B 2C4FT 5FGCE 1D5XB 4ERSL 5LJYH 5ID1B 3WHXA 4D3CH 4XCEA 3MRMA 2AXHA 3STZA 1IL1B 4O5LL 5I71C 3GRWA 4RFOL 4QRUA 5I1DA 1ADQH 4KROD 3FFCD 3NFPB 1RJYA 3PNWB 3QIWA 4A6YB 5DEZA 4J8RA 3VXPB 1I9JL 3ZYZA 4F9PA 3QG6B 2DWEA 2V2XB 3D2UD 5I8EA 2YUZA 1SJVA 1BAFL 4DWHA 1IKFL 3I9GL 3TBSA 5E9DA 4H26B 3P40A 1T1WB 4NQEE 5KANG 3OJ2C 4X8JB 1DL7H 3F5WA 4XNQA 5JXEA 4M9PA 4F2MA 2FGZA 3D6GA 3CH1B 4HUMB 4NWUL 3O8XD 5E94A 4LSUL 4IM8A 2R4RL 4R26H 3U4BL 4APQC 3K8MA 4H88H 2PTUA 4MX7A 3TO2B 2DQFA 4HS6B 4KMTH 4QRSB 4IHOB 4MB5A 4LF3B 4PTUB 3HC3H 1JNHB 4F9LA 1U8LA 2XWBA 1OF2B 2DLGA 3QHZH 4L8BB 3PGFH 2ZUUA 3QUYA 4IRJB 5EU7E 3DRQA 2Z31C 2PR4H 3PV7A 5JTWA 4X7TB 2OR9L 3O2WL 3DMMA 4JM2A 2Q8BH 5EA0H 2J4WH 3M8OH 4NKMB 2VSCA 3GSXB 5SWZB 4GG8B 2DLHA 4R96A 4E41A 2AV7A 4JDZB 2MSPA 3GSNB 5FF6B 3VH8G 1QTYT 1JPFB 4QRRB 2ARJQ 3FO2A 3SKNA 3OKYA 4RMQA 2CQVA 4X5WA 4XNXH 1CDUA 2Y6SC 4Y5YC 3TA3D 4E5XA 5AZEH 5EBLA 1F4XL 1NGQH 2XFXA 4X8XA 5GGQL 3U9PH 4PJXA 4AQ1B 3NA4A 1SY6H 4OZ4A 1YN6B 1G0DA 5J57B 5L2JB 1WCQA 5T1KD 1J5OL 3UBXB 2R29H 5I15L 5CJBA 3TBTA 3FO9B 4YXKH 3UAJC 1MFEL 5TDNB 4N8CH 2P5WD 5FV1L 5LQBH 3VG9B 3H7BA 4HULB 2Z93B 1NH6A 3LV3B 4Y5VA 1G9NH 2Q86B 1A7RL 4YNYB 3S34L 3EO0A 5GGUB 3WFEH 3KPSE 3U4AA 2I26N 3FQXB 4MA7L 4YC2B 5IVZA 1D9KB 4ESKA 3DRTB 1AQKH 4N0CD 3L5WA 3R06B 1DFBH 3ARXA 5H8DA 1H5BA 3GSNL 2EKSA 1VACA 4WHCA 1MPAH 3BT2L 1M7XA 3IU3B 1MFAL 1P7KA 4KKAD 1R5IB 4ZXBD 3RBSA 5I76B 3VA6A 1LP9B 5DEGA 2HMIC 3L5JA 2X4NA 1GAFH 3G6JE 4PGJA 3HB3D 1N2RA 3B2VL 1NEZG 3H9HB 1RK1B 3BPNB 2AV1B 1EGJA 5DD3L 4MJIE 4JANB 4XVUD 3RDTC 1AI1L 1BFOA 4J3XA 6FABH 2NY3D 2NX5A 1M7DA 25C8H 5IR1B 1I9RL 3MREB 5GRZA 3O6LH 4OF0A 1YY9C 3ARRA 4UINH 4P57A 1KIUA 3U79A 1H8NA 3FN9A 3S98A 2X4OA 2R2EB 4G42A 3OJDB 4WI7A 4IIQA 1WITA 4GMTH 4LDEB 5KG9A 3EJYD 4XXCC 3V6OA 5GGRB 2BY3A 1E28A 1X4YA 1NGPH 5CGMA 1CFTB 2LU7A 4AENB 1ZLWH 3TF7C 4TNVK 5HGAA 4ORGB 2IH1B 3WLWD 3DECA 1JHTA 1CS6A 3SQOH 4N90D 2WBJB 3VJ6A 1B4JL 1IJ9A 1U8KB 3Q5YA 4U6YB 5EZLA 1QOKA 1QSEB 4NOBA 4NUJB 2PO6D 1MHPL 3FQNB 3NABH 4WUKL 4XBGA 3R0MA 3D48R 2C1PA 4ZTPH 5HHME 1CXLA 1FDLH 3HR6A 5EWIH 1NUNB 1P69B 2MQ3A 1QPPA 2HJLB 4WFFD 4CADB 2NY5L 1MRDL 1U92B 3TCLB 3TYGL 4UT7H 1H0DA 3NN8A 5J56B 5IB2B 3PGCA 3S36X 1SEBA 5IOPB 3K4ZA 5JNYA 1DLFH 4I0CC 3MRKA 4G6KH 3CVIL 2P8LA 3KJ6H 5DR5H 2HKFH 1FV1B 1YEFL 1KPRA 3OKOB 4HH9B 1ZLUH 1TCRA 3S35H 3WV0A 4FXKB 4LLYB 4LSVH 3WFHB 1HNGA 1XF5A 1NC2D 1AR1C 5SWSE 1SYSA 2MJWA 3BD5A 3BE1H 4AM0B 4YHNB 1KJMB 1UCTA 3WS6C 2ID5A 1RIUH 4OF8A 2R0LH 2YKLL 4NZTL 1CFSA 3VXTB 5CJQL 3HFMH 4EN3B 2Z0BA 2DAVA 5LWYL 3QG7L 3RZWA 4KKBC 4IRZH 3HPLA 1L7IH 4WI9A 3UDWA 2DF3A 3FFCA 4NKIH 4ORZC 4PRBB 1JNJA 1GZQB 3QULA 2Y23A 3O3DA 1KBGL 1MJ8H 3RTQC 4D0CA 5DEFB 1U8MA 1ADQA 5KZCD 1J9CT 4LK4A 4EXKA 3C60B 1J1OH 4PJ7E 5EZIL 1G6VK 1IKNA 3LD8C 4LQFL 1O7SA 5HY9A 5L6YL 4OT1H 4JM4L 5BCAA 3OXSA 3D2UA 1YPZA 2R0ZH 1ORSA 2XNAA 3W2DL 4CN6A 2PW1A 3RY6C 3B6SB 4MXQD 1H15A 1H3VA 1P84K 5FCUH 1QD0A 2UWEE 5TQ0H 2FD6L 4ELKB 2V7HB 2ZCLL 4G9FE 1ND0B 1S7TA 3O8XA 1L0YA 2WANA 1INQB 1V3JA 1ITCA 5DUML 4OTXL 2X4RA 3PWNA 2NY0B 3VFRB 1VDGA 1R3LB 2BMKA 4F7CB 5C0JB 1J87A 3OMZA 3Q1SL 4HW6A 3OF6A 2DQUH 1A2YA 3OPZH 5IHLB 3IETA 5HGDA 5CBEA 3L3KB 3NCMA 4EZMA 3VWKB 1JNNH 3QUKA 3PDGA 1OSPL 1HH9A 1KCVH 1UCBH 4AMKH 1MI5E 3IDMB 4YDIL 1RUPH 3QEGL 4CVXA 3QDAA 4NIKB 5CEXA 1DBMH 3VXMA 2X70A 1NGXB 4K9EC 1K6QL 4O2CB 4KK6C 1MRCL 3Q6FA 1LO5A 1AD9B 5GRUH 2NW2B 4MAUL 3MX0A 4UDUA 2CXGA 4LRNH 4RX4D 1YMHB 4MD4B 1A1NB 4O2EB 2W65B 3S4SG 3TA3A 1GGBH 2X4QA 2VSDA 3O9WA 4Z7NE 3P9MB 4M6NH 3HRZB 1YMME 4NQEB 3G04B 1A6AA 2EXYD 3S5LA 1F4AA 3IDJB 3L3OA 3V8OA 3VXRE 4ETYA 5LGJA 4Z0BH 2P5WA 1SY6A 5JOEA 3PQYD 5FO7B 4XC1H 3OKEA 5DJXA 3X13A 1JPTH 2X1OA 2ZKHH 2M8XA 3FONA 1NBVL 4TUKH 5CD5C 5DLMH 1CE6A 4NCC2 5DMGC 3P77B 4OZFG 1J1PH 2E6PA 4JVUA 4ODWA 1JFQH 1CT8A 4TN9A 2L0DA 3SOBL 2R56L 2E8ZA 3ZMRA 1EJ6A 3BVNB 4K3JL 1ZSDB 4MAYB 3E1F1 3QAZB 3LOWA 2FX7H 2GHWB 2HVJB 3B5GA 1JIBA 4HMEA 4H0HB 4MDJA 5T1DL 5I16A 4ZXBA 3EHBC 4QT5B 3GUTB 1ZKAA 1UB6B 4H1LH 3BP6B 3PUCA 3W39A 4OLXH 4OI7A 3PV6A 4PLJC 3C9NA 4U1GB 3VWJD 2XXCB 3JZ7A 2XN9D 5D6CB 2J5LB 2OJEA 3RGVB 4U1LB 1IQDA 3MRFA 2IAMB 1AHWB 1YEDA 3DV6B 5CGTA 2VJXA 1OVZA 3CC5A 3ULUF 1JZ7A 2HT2D 1R0AL 1K8IA 5GZND 5TQ2L 2GK0A 1IILE 3Q5OA 5K9JL 5FGBA 3ZHKA 5CIPA 3UTPD 4AIXA 2CUIA 3CSBA 3QH3B 1BPVA 1ES0A 2XZQL 1NGYA 3KPSB 3MJ9L 2IPTL 3TBVA 3I6GB 3VDBA 1N26A 1WF5A 5F1NA 4LRIA 4ISVA 1N64L 4HIHB 2X10A 1XR9B 2GSIB 2OJZL 4P2RD 3LQAH 5E4EC 2FATH 2PO6A 5GGTL 5EFIB 5IKCA 1A6ZB 3AS1A 2D7QA 5IM7A 4H5SB 4Z7UA 1GOGA 2EE9A 3MLWL 5BVJB 1JWUB 2I24N 5DK0B 1EMTL 4NFCA 3EO1A 3DUHA 4HS8L 4OCRL 2ZSVA 1D5BA 4HFWB 5DRNA 5ACZA 4W6WB 4J7RA 3VXSA 2OK0L 1IGYB 4M8QB 3W11C 4U3HA 1TFHA 4MNGA 5E2TH 3DV4B 5C0AD 4P5KB 5DI8A 1KCRH 5LAXA 3HR5B 3GBMH 4YHLL 4H20H 1XF2B 1KPVA 3WEXA 3CPLA 3MQIA 4YZFE 1I1FA 4YX2H 4MQ7B 3KPPA 4KQ4H 1NC2A 2QQLH 1A1OB 4GAYB 3D39E 2HN7B 4Y1AE 1MVFA 1S7WA 4XPFL 2YZ8A 4KTYA 4PP2B 4HIIA 4LHUD 2F19L 1E6JL 1EH9A 1UYWH 2QQNL 2WLZA 5HYFA 1OY3B 2RAMA 3G08B 4XBEL 1OPGL 1RZKC 4RMUA 1RAMA 2J8OA 4PRIA 5KTEH 3FHQA 4PUBH 1K2DA 5CZVH 3AXLA 2Y5TA 1QR1A 2CIKA 2BY2A 4QYOB 1UGNA 1OGAA 1X5IA 1XMWA 5IQ9A 4GUPB 4HUNB 1S7SA 3FB5A 4FABL 1ZLVH 4PS4H 4RWYH 5KSBB 3THMH 5MEOA 1I4FA 2RCSH 5J1SC 4NHCL 5ILTL 4LVEA 4WFHD 3FZUD 2Y06L 3MYJB 4JPIA 32C2A 3FO0L 4HWBL 3T0BA 1W0VB 1JTPA 2EECA 4KVCH 3KPNA 3NFSL 3IGAB 5AZ2H 5GS0L 4HUXB 1EUUA 4OIIL 1U2HA 2N7BA 3N1FC 1G9MC 1I8KB 2PUQT 5DRWA 1OM3L 1RUKH 1ZT7B 3RWGA 1RURL 4CN1A 4FG6D 4J6RH 1P1ZA 3TPKA 2D03L 1JJUA 1UXWA 1LEGB 3PHQB 3GSQB 3O4LD 1MCLA 2HT3C 5A16A 3NACL 2O5ZL 1HHIA 1DLHA 4IMKA 1G7LB 4WU5B 2Y4SA 2ZOKA 5E2UL 4JY5H 4P2OB 4PJ9C 1Q1JH 1R6VA 3MOQA 1CGXA 3MNWB 4TVPH 4OZIF 2Z8WC 1OHQA 4LEXH 4OQTL 4UTBL 3RUGE 5C0CA 3V52L 2ITCA 2P8PB 1KEMH 1BEYH 3ULSA 5H94B 3NGBB 2VDQH 3C6SA 4TVPD 3WKML 4PJ7B 3G9VA 43C9B 3RZCC 4RX4A 1TDQA 1XIWC 4P3WA 1IGFL 2J88L 4G80B 3KPMA 2WLYA 5E03A 4Y16D 4F7PA 3CXHK 5TE4L 2CUHA 2D7MA 4OGAD 2UWEB 2ZUYA 2VC2H 3MBXH 5J13C 4G9FB 4CVUA 5F7EH 1KGCD 3PQYA 2ICES 1AFVL 1XCQB 3CSYA 4AT6B 2Z91A 2VE6B 3VDAA 3PABA 2FRGP 4ZNEE 4DGYL 3LH2L 4ACPA 3IRPX 2IGFH 4YXHH 5J11B 2AQ3A 1D6VH 1UM5H 2X05A 4LIQE 1FNEA 4YDKH 3MLXL 1UH4A 4Y5XA 1MI5B 4KRNA 4H8WC 3WFBL 1QRNE 3TBWA 4MJ5A 4DTGH 1IL1A 3X14B 3PWLB 3BUYB 3VRLF 4WI4A 3W9DA 4EOWL 5JW4R 3BP7B 4R8WH 4LBEB 1JBJA 3NCJH 4XTRC 1SYVA 4GAGH 4DCQB 2VLRE 2Q7NA 4PJ5B 3TH3T 1A7QL 2C3VB 4A6YA 4IRSB 4PD4J 1TTUA 2MTPA 4DQOH 3BQUD 1FYTA 3GHEL 1IGIH 4YHMH 4ODSL 3WJLC 4N68A 4H1LA 1S7QB 3VWJA 4RFEA 4P48A 5D5MF 2C7UB 4N0RA 1AIFB 5D72H 3MV7A 3IDNA 1YMMB 1BF8A 1UACH 5E6IC 3AREC 4NJ9L 1A1MA 4XAKE 3B5HA 4BK5A 3UZQA 3VXRB 1LDSA 3JTTB 3MUZ1 3C09B 4NYLA 1FL5B 1NFIA 3MBEC 4D9LH 1IC7H 4JFYA 5T3ZE 3IU4H 5EU5B 4YFEA 5I9QB 3MLZH 2HKHH 3ETBF 3VFTA 4QHNB 3OX8A 4BSVA 4IOIA 3LQZB 4OCSL 3ZE2F 4DFIA 2DB8A 3FHAA 1AXTL 3BXNB 1M05B 3IJHB 1FFQA 1OD9A 2CIIB 1F8TL 1RUQL 5I71B 3ZDXF 4KI5F 4A2LA 4JR9L 3O6FC 4O00A 2P47B 3S37L 2FGWH 2HRPL 2CGRH 2YPLD 3KJ4C 1EK3A 1I85A 1Z5LA 1AO7D 3G5ZA 5HHVH 3SDCC 3KS0H 5IMMB 3W0WE 1DZBA 3E6HB 4YDJA 3HZVA 3IYLW 4X9HA 2VWEE 1F3JB 1HXMA 1MCWM 1NLDL 4GAFB 3LKPA 2EDTA 1WTLA 5CMAA 2AJXH 4M5YH 1CGWA 4POUB 3WO3B 5DMJB 4JKMA 3GNML 1NQBA 4KGLA 1MFBL 2BVPB 5H37H 4R90H 1MVUA 2AW2A 4XB8A 3IXTA 5C0AA 2CLVA 4QXTB 5FK9B 1FVDA 4ZO8A 4YO0B 3VI4E 4APQB 5I1LA 5EBGA 1WBYA 5TDNA 1DEEA 2VL5B 1MREH 5HI3C 4UAOC 1QYGH 2BP3A 3WXWL 3AGVA 3FB6A 4XPHH 4CNIB 3A6CH 1XF4B 4OLVH 2HFFB 2ZG1A 2Z93A 3V6FB 1HYSC 5GZOD 5C9JB 2WMPA 5FHBL 4ZD3H 1QFUH 5FA4A 3WUWG 5C8JB 4LHUA 2Z35B 4UQ3B 3FQXA 2Z31B 4HK3N 1C1EH 1BIIA 1JPSL 3NA9L 3VFWB 2AGJH 1PSKL 3HC4L 1JPST 2KUTA 3C8KA 1BQLL 1BVLB 2YC1B 3KYNB 5D7JC 1U0QA 2EDOA 1NCAL 4NQDE 3REVA 3WS3A 1UVQA 3VD5A 1HILB 1R5IA 4PRHD 4Y5YB 3OB0H 3CLEH 4ZO6A 1QPXA 4LHQB 4EI5C 4LPCA 4J12A 4R97C 5I8CB 3OR7A 5CZKA 4KJYB 1PKQA 1JWSA 3BFOA 4P2QB 3TEUA 4AEEA 5KVDH 1KENH 1FNLA 4JFED 1BVKA 4NT6A 4UDTA 4JQVC 4YE4L 3MUJA 2J6EH 5EN2A 2FYYB 3D25B 4GKZB 4HUWB 1ZHNB 4YHOL 2A6DB 1YDPA 5DRZB 5HJ3A 1FFNB 4CDHA 3PGDA 5GGVH 1IGML 4XPGL 5BV7C 1LO3L 3DBXA 1NL0L 3GJFB 5SV3A 1NJ9B 3D39B 3UTQB 4GBXD 2R69H 5K9KB 3T8XB 5LGHL 1M6OB 2HH0L 3O4LA 5ITBH 4JY6B 3QUZB 4UNVA 1IE5A 2P24A 2RFXA 4XCNA 5DMIH 5F96H 5HDBE 2A73A 4FRWA 3U36B 4OLZL 2EXWD 3QO1A 5H2BB 1H3PL 4FMKA 1QA9B 3IFNH 4IOFC 3ARTA 1NCBL 1MLCA 3RDTB 3D9AL 3GMNB 2HJLA 5CSGA 1YYML 2R23B 5D70H 2F54E 5IFJB 4I0KA 3U1SL 4BSWB 2DI8A 3J8F7 3C5JA 4Y16A 4GT7A 3KAAA 1HKLH 3PWVA 3TPUA 5E6ZA 2IANA 1P4LA 4FFWC 3SE8H 4X9GA 4JFHD 4M3KB 3Q5TA 5TGBA 4KJPC 1I3RA 5JIKA 5F7WC 1U8JB 1RZFH 5TDOA 2F9BT 1H8OA 4QXGL 3N85H 4ONFL 2AS5M 4XP9H 4BFBD 2AEQH 2F5BH 1DANU 4UIMA 2VH5L 2HWZH 1DQDH 5IB4A 3PIQA 5B4MD 1RZ7H 3DUSA 4NZRH 5J8OA 1LWRA 1JGUH 5KSVA 5L2KA 4C55A 1D3CA 1AJ7L 1AXIB 3DGGB 4NCC1 4PRNB 1F4WL 2XV6B 2W9EH 3VXUD 5D1XC 3TT1L 4EEEA 5D9SB 5MEQB 5HHOE 2V7NA 1CZ8H 1LP9F 1UFUA 4I0PD 4XCFH 3GMLB 4P3CL 2AVGA 3RUGB 3WNNA 4L9LC 2Q1EA 2Q76A 4HT1L 1X9QA 1R5VA 1LGVA 2OBGA 1T22B 4HK0A 2IC2A 3CFDA 3BQUA 5B39G 1OP3K 4HCRA 5ACLA 1CBVH 1P2CB 2EICA 2DQJL 1I9EA 2X9WA 1U9KA 4YHIA 3LIZL 2X42A 3VDCA 3BX7C 3C8DA 3FFDA 1ULVA 1KB5B 1WIOA 1YYLL 2X41A 4U1IB 3NPZB 2VLLA 3AROA 3SJVE 2CDEB 5HHPB 4X98A 3SE9L 2DQCH 3RFZC 2HLAA 3BESR 4MNHA 1FLRL 1OAUH 5HD8D 5FFLA 3KPTA 2GY7B 4X0KB 1GGCL 2YUXA 3KPRE 4AH2A 4PJAF 3QR2A 4YXLL 3V4UH 4NO2B 5JHDA 3C2AH 2DKUA 1KSRA 3MUY1 1N8ZB 1B90A 2PXYD 3P3YA 3F7PC 5IMKB 4DGVL 1CL7L 4ZTOH 3ARDD 2AI0H 1QRNB 2YPLA 4R9HA 3GK8L 1AO7A 2JJSC 5FB8B 1CD0A 3RTQB 1FL3A 5TE6L 4DN4H 1WGOA 3FB8A 2DWDA 4FP8H 1S9XB 3RIFK 2VRAA 1EEYA 2IALB 3ECBB 3LD8B 2VLRB 5BQ7B 3ARSA 4AEIH 12E8H 5C0DA 4HXAL 1KB5L 1I75A 3GJEB 2XA8L 4JGUA 3EYUH 5D1QC 2VMFA 1YMHA 3QXAA 4GKSA 3GIZL 1I9IL 3D69A 5DMKB 1V05A 3WFCH 4PJFA 4ZYKB 5CZXD 5JUEL 1J0IA 4FQQB 5FYJU 1QHOA 2BJMH 2DIAA 1N6QH 1WBXB 1TJHL 4MNQE 2E9BA 1F4YL 4X7SH 1FGNH 1F90L 1OWWA 2FBJL 3F7QA 3QDJD 4OZGA 4PB9L 2YD1A 1FZJA 1CLYH 2WUCH 4JRYD 1TJIL 5BJTB 4PGCB 4LIQL 4H0IA 4O2FB 5IEKA 1I1AC 4NWTL 4NC1C 2DQGL 5TF1L 1CGSL 4LLDA 1TXKA 2D31B 4GJTB 4PRPB 4YJZL 5C0RL 5CILH 2DJUA 4XHJD 2MMXA 5E2VH 2AK1L 2DLEA 1MNUH 1RZIB 4Z7VF 2KL6A 5BW7C 4M6OL 3W0WB 2P8MA 5DD1H 5IMOA 4OLWL 4UV7L 4Z7QE 4OGZA 2DL2A 3BMVA 1UM6L 2Q7YA 2RBLA 4PRHA 1MCSA 1FFPB 4XP1H 5HHXL 3NIGF 1NMBL 3KS0J 4FFVC 1KG0B 5J06A 2W0FB 4LP4A 5E5UB 4I18A 1ZA3B 1S7UA 5T3ZL 1LO2L 1MFDH 1Y18A 5IB5B 5J7CC 2XG4A 3CVHB 5I1CL 3FQTA 4JDTL 1IAIM 4RDQF 2HG5B 1ZWIA 3V5KB 1LO4H 2YBRB 1P53A 3GHBH 5CSBA 2H41A 3ZKMD 3LY6A 2XZAH 3ULUH 4YK4C 3MLRL 1HE7A 4ODUB 2J6EA 2ADFH 4WIQA 3DWTA 4CU6A 2Y1VA 5HI4D 1MCPL 1HK6A 2FB4H 5EO9A 1WZ1L 5IBTH 3ULUD 4GBXA 4HHAA 4K9EL 2HA1A 4WWID 3OHXB 5F3BA 1IT9L 1ZHBB 3TJEH 1I7TA 2FJFA 43CAB 4LEOA 3HI1A 1A7OH 4K55A 3QPXH 1TTGA 1AY1L 2AJYH 2J8UF 2FR4A 1IEBA 2Y36H 2WP3O 4G7YL 5KSUB 5C0FB 1MCOH 2CUMA 2ZCHL 3GGWB 2J8HA 4WW2F 1OAZL 2HFEB 3INUH 2CJUH 2J2ZA 4QCIA 4NQDB 4I3SL 4I9WD 1MRFH 2DJSA 1FRGH 2VUOA 3DX6B 4EI6B 5ESVB 1H3WM 4NQXB 1NCCH 3G6JA 4XNYL 1N7MH 5C6TH 1CK0H 3CVHL 4JFPA 3I3EA 5I1GH 2A2QT 2IG2H 4HFWA 1QVOA 2Z8VC 2XTJD 2BNUA 4JDVA 4MJIA 2DM7A 3MRDA 1BX2B 4RISH 4AIZA 2ICCA 3KGRA 1G7MA 2Y9RT 2XA3A 1YEHL 5DD6B 4YWGL 4CGTA 1G6RB 1RK0B 4K3EL 5F3HB 3UYRL 1RU9L 1G7HB 3QIBC 1SEQL 1C5DA 5K9OA 3FAXA 3B9EA 1A6VL 1JHLH 2YA2A 1N3NA 1B0GB 5DO2D 1AKJB 5MERB 4XP6H 2FX9L 3OR6A 4FFZL 1WC7A 2OSLB 3IFPB 1CFNB 3ZT5A 3MRBA 1O7VA 5DVOA 4NKDA 1KELL 4F3FB 2BSTA 1QBLL 4TPRH 4G9DA 1EO8H 4OUOA 5E4EB 1ZMYA 3EAKA 1F3RB 5D71H 3RKPA 3VXUA 4YIQB 4I0PA 2DBLL 4LP5A 5EB9A 5E7FA 5EZJA 4HV8B 4OF7A 1Y6MR 3MJ7B 3O6KH 1YJDH 3D0VB 4OUUA 4RAUB 5A2JH 3C6LD 4MQXD 1G6RL 3DETD 5HYJE 3G6DL 2F54B 3RVUD 3UTTB 2VN7A 3U4EA 4UBDD 1W72B 2EYRA 1VGEH 1EEZA 3BRFA 2UZXB 3PL6D 2DI7A 1A6TB 1RZGA 1N59A 4BFIB 1UH2A 2JIXB 3PWUB 1NAMB 1FORL 4LPXA 1X5JA 2NXYC 3MRJB 3UTZB 3QFJD 4OD3L 4N1HB 2YWZA 5JIPA 2Z92A 4RAVB 5E08H 1AXSB 1TENA 4JKWA 4D9RE 5E7BA 5J1AA 3LN4A 2EDFA 3OKNB 2X4SB 5SWSA 5F1KC 3NPSC 3ROOA 1TZGH 1ACYH 1PZ5B 2RJMA 4U0QB 4L9DA 4RZCB 3HLAB 3UEZA 2MQ0A 3V79C 3I02B 2PXYA 4X80H 1RUAL 2FIKB 2EDJA 3C87A 4K3DL 1FFOA 4KJQD 1SJHA 5E8OA 5TPWL 3ARDA 5I1HL 3ZDZF 3N06B 5HHOB 4HKJB 4P3DA 2OTWB 1N0XH 1HH6A 1YUHA 2ARJA 3OB0K 2NMSA 3FT3B 5L0QC 1LO0L 2VITA 4OCYH 5EU6E 5AYUL 5T1MA 4QWWD 3TWCH 5CAYB 1T03L 3CFCH 1IC5L 1W72L 5INCA 4WV1A 1INDH 5E2WH 2VQUA 4I48A 5GPRA 1NAML 1NCDL 2W60A 5FIEA 3U46A 4G8GE 4RGOH 1ZK9A 4PPTA 4Y4FD 3OKLA 3U2SA 3SJVB 4GRMA 1KCSH 5JOPD 5ETUB 2Y25A 1KTKE 4JRYA 5I74C 1CFBA 2V2WB 4Y0GA 1JUFB 1ZLSH 5DHVH 3QI9A 1GC1H 3K8LA 4I3RL 3KPRB 2Q20A 3VG0L 3MACH 1ZVSB 1K4CB 2FJHB 1K8DA 2YPKB 4FQIH 4O4YL 2ESVB 4LU5H 4PJ9B 1Q94A 4MCYB 3IF1A 3BGMA 2FWOB 3QZWG 3TNMA 3O2DH 3QIWC 4XP4H 4D0BB 5J9PA 5C2UB 1Y6NR 1L9NA 4PJ8D 5I2IA 3BP7A 4F9PC 4KRLB 1YY8B 1T0MB 3E2HC 2JCCE 4XBPB 1RZ8B 3RZCB 4OGYH 5FKAA 4DW2L 3GKWH 1HNFA 1XIWB 2VZ1A 5KSBF 3SKOB 1CDIA 4LSTL 4QOKD 2OP4H 1G9ML 3H3BC 5JXEC 2YSSA 4YBLC 2ZOLB 5CJ8A 1EERB 1RI8A 4UB0L 5HYSA 4Y2DD 2NNAA 5J13B 1HOCA 1A3RH 1AE6H 1C7SA 2IBZX 4MNQB 1BZ9B 1LK2A 4OFYD 3T2NL 1YEIH 3K2UH 5FDWA 4I5BB 3TESA 2GY5A 1EXUB 2VAJA 4BK4A 2VDRL 4JFFB 4F9LC 2H2PC 1FVEB 1U8OB 1RMFL 4F7MA 3F7YA 3K4DA 5JORA 3QUYC 3VMNA 4U1JB 3KNBA 2GTWA 1EFQA 2I5YH 4KHXH 2ADJA 4X9IA 1LNUA 1RJLB 4YBQC 3DMMC 4JM2C 4CVZA 1PQZB 1ORQA 1DR9A 3GM8A 3X3FL 1JGEB 2IADA 1CL7I 4NZUH 4U6VL 5JOFB 1S7VB 1HSBA 4KI5D 1U93B 1VGKB 4O5LH 1EHLL 1Z9MA 4KV5F 5FO8B 3HUJA 5C0BD 4Y4KD 3IAPA 4K7PH 1C12A 3MRPB 2X4TA 3DVFA 4PJEA 4PR5B 2FX8H 3PP4L 3QUMB 2NZIA 1EUTA 2PYEE 5E6IB 3AREB 4X6BA 2EZ0C 4KQ3L 3X17A 1S8DA 1JGVH 3NCCB 1JCKA 4MYWB 4WHTA 1DBJH 3MBEB 2V2TA 4HJGA 1UEYA 4LQ1A 4QXTA 5DJZB 5SX4I 2F53D 4NO3A 4WTWA 4Y5VC 3RVVD 4NC1E 1KJ3L 4H8WL 1QLRB 4JO1L 2KZWA 2VL5A 4PREA 1KIQB 4HQQL 5C0IA 1BVZA 3QQ3A 3D3VE 1PYWB 3GSOB 3O6FB 4LKCA 3RGHA 1TNNA 5JO5B 1H5BC 3KJ4B 4PY7A 4Z5RB 4S10A 1ZA6A 5C8JA 1D5IH 3FOMA 2VLJD 4GW1B 4MCZB 2C3HA 4Z7WF 3FRUA 3V7MA 3MOBH 3SDCB 2Z4QB 5AUMB 1JMXA 2ZUWA 4MA8H 1NGWB 3L3JB 2PW2B 4M6AA 4NUGH 1Q72H 3I2CL 1KCUL 5DJ2B 4G3YL 4D9QE 3IXAA 4KTEL 4JFOB 3QUML 2F8XC 4HS3B 3S96B 1TZHA 5MEPA 5GS1A 1HEZA 1ZXQA 5CHNA 3NAAL 2CO6B 2E9WA 4QXUL 3EYOB 1T6WA 4UOJA 4ZFFA 4Z7NF 1PW3A 5EUOE 4JFZH 4MHHI 1FNGA 2XG5A 4GXUM 3MR9A 4EDWL 4KJYA 5JDSA 1QNZH 2VDKH 1WJ3A 1JI2A 2WIMA 1LD9B 4IIQC 4I8DA 3I85A 4JHZA 3EOYG 1HSAB 3UZVB 2D7NA 3PL6A 1ZS8B 1VESA 5E8PA 1JWMA 1F4XH 3FN0H 4HUWA 4K8RH 4UAOB 3KXFA 4UIKL 4YH6A 3QFJA 4PJBF 3HI5L 4N0UE 4Q6IC 3NOIA 5I15H 4K8RD 3DROB 5DJYB 5T1LD 3GJFA 4KRPC 2PYFB 5BS0D 1CE1L 4Y1AA 3MNVB 3MCKB 1OGTB 2V6HA 4L8CA 4QLRA 2AEPL 1ZTXL 1A7RH 4JKPH 4NM8H 3PHOB 5LCVL 5D7JB 3MLUL 1YEEL 1UWEL 3QDMA 2UZIL 4G6AC 4EI5B 4BM7A 3WLBB 4Z8FL 4R97B 1REIA 1NC4D 4HSQA 5DRXA 3U48A 1Q0YL 4LLVA 4OZIA 3PDDA 4PV9A 5FKPB 5IV2B 5IHUL 2UYLB 4MDIB 4JFXB 3STBA 5E8DL 5FOBB 3B2VH 4MSWB 4RGND 2NY2D 2VB5A 1AI1H 3QEHB 5ICXA 3LSOB 3TIEA 1U8NA 2CPCA 3L6FB 3MGOB 5BV7B 1NMAH 5I0ZA 3EDJA 3MRQA 5I1EH 4LSRL 1U8JA 2NTFB 3B2UD 1B0RB 3QJHA 5I8KH 2GJZB 4GRWF 1IQWL 5E8EA 3CDGA 3RRQA 2HJFB 2EEAA 1PVHA 3IKKA 5DHVA 3UDWC 1I7RB 4KROC 5ENWB 1JZ5A 3V0WL 4FTVE 2ZPKL 2JKXA 5FGSA 1GXEA 4NDMB 5LXGL 4MA1C 1ETZA 3W82A 7FABL 5D9SA 1QKZH 4PJ8A 3C5SA 1YNLL 1IKNC 4UUJB 1KTLB 1OB1A 1B4JH 3O2DA 4DOHE 1UA6H 5GRYA 2EYTB 1BGXL 4OAWB 3BRGC 5EU6B 3RWDA 3SEPA 2OX5A 4HGKC 4NQTA 1J18A 1YEGL 4HIXL 4C59B 4QOKA 3OXRA 5BV7L 1KPUA 4GW5A 1KT2B 1L7TL 3B8YA 2AXFB 2BVOB 5BXFA 3O8XC 2VDNL 3O81A 1GYAA 1UEMA 4G8GB 4YZFF 1I8IB 3MLTA 2ADIA 4L4TE 4HBCL 3BZDA 3QCUH 2YD7A 2HVKA 3T09A 3QNXA 2Q8AH 2X44D 5JQHC 4PP1D 2VNCA 4NBXB 1JPGB 3CSGA 5J6GA 4UNTA 2BOBA 1QBAA 2ATKA 4ZFGL 1QACA 1XCTB 2P44B 3H2WA 1WT5A 5KS9A 1XGYL 3GSRB 4LGPB 5D1XB 4EUPB 5IP4A 1PX4A 1T0NB 2YUVA 5J6HA 5ISZD 5KVEL 4L9LB 1C5CL 3LEXA 4EDXB 3LS5L 5EO0B 4X4MA 1EV2E 3HE6D 4ZS7L 1QSED 3ZHDA 2JCCB 1AGFB 5IK3A 5T5NF 3EO9L 3TA3C 5C0BA 5EC1A 1DN2A 1P6FA 4MLIA 4O58L 4Y4KA 3O9WC 2YD5A 4E0RA 3HS0A 2NCMA 5F9JB 4N0YH 4NO0D 5DJ0A 2IJ0C 2A83B 1UG9A 2K9UA 4HX1B 1Q9KB 3TVMD 3WIFB 3BZ4A 1T1ZB 5KVGL 3W9EA 2NY4C 2NYYD 3G5XA 2EIDA 5IMLB 3PP3H 4LPUA 5ANME 3NZ8B 2C4XA 4C4KT 1Q0XL 2F53A 2R2HA 4PJHF 3DX7B 5DJDA 5F6IC 4KK8D 2MCPL 3ZSTA 2JJUA 3GB7A 1G9NC 1SBSH 1MLBA 3IDGA 5DUMH 4N0CC 3T0AA 5CEZE 1U8HB 5GJSH 5F9OH 2GTZB 3CUPB 3H3PL 3ARBD 3DARA 2VLJA 3V0VA 3DI3B 2XPGA 4M43L 4HPOL 3MZTA 1CQKA 4KKAC 4ZXBC 3RPIA 1DQJB 4TUJB 4NRYA 3CIQA 3HB3C 4XT1C 4BUHA 2AABH 3N1MC 4U1KA 4XMLH 4XVUC 4HF5H 3BKMH 2QSCL 5D1QB 1JK8A 4D94A 4U1HA 2ITDB 2CRMA 3C8HA 5F9AC 3G6AB 3MRRA 4GO6B 1T21B 5I30L 1CIUA 4DKAA 4HC1A 5GHWL 4I4WB 2PYEB 1KOAA 1KLFA 4XXDA 2E7HA 2K7QA 2LV4A 4PY8I 3RPKA 3EJYC 3PWJA 3T3ME 5T5FH 1N5AB 3K81A 4C56D 4OCXL 4NQSA 3EOAA 5CWSA 5I18L 3EYVA 3UCRA 5J3HD 1I1AB 3O3AB 4UTAL 4GG6F 5IHZA 4DUXA 5T1LA 3WLWC 4TNVF 1G84A 5EULV 4RQQA 4UILL 3WD5L 3WNPA 4YGVB 5BS0A 3HI6L 3RJDA 2DIJA 3VFNB 2DTML 1NGZB 4Z77A 3EJJX 3AM8A 4LNRB 5DVKA 4E41E 2PO6C 3JV6B 1GPOL 3JSSA 3LZFH 4XAWL 1MJJB 5ICZB 1A6UH 2A6JA 1YEKH 4IDLA 4TUOB 1G0YR 5C0GA 2HFGL 3QEUB 4UI2A 4XC3H 3SOBH 4PJXE 3P4MB 3DX8A 5F6HI 3HNSL 1CU4H 1NC4A 3RNKA 1SJEA 2OCFD 4HMDA 4M7LL 3EJZD 4TSAH 1OAXL 4LAQH 1L4IA 2VQ1A 5ESVA 2I60L 5T1DH 3RWEB 2X1QA 3KG5A 4YPGA 4BH7A 5IIEB 1YN7A 4OJFL 3BH9B 4LOUD 1KN4H 3OQ3B 3DSFH 4XMPH 3SBWA 1JGDB 3UTSD 3DO7A 2W92A 4YK4B 1J10A 3EZ8A 4FQ1H 4YQXL 3DVGA 4ODHH 1RZJH 2C9AA 4N0UB 3KYOA 4ALAH 3L3DA 1CDHA 4PJIF 3VFOB 2BOCB 1S7RB 4GXVL 4MJ2A 5K9JH 5TQ2H 4TSBH 4N8VA 4W70A 4L8SA 4L3CB 2AJ3B 5DDHB 5DURB 3P2TA 2E27L 2YS4A 3R8BB 1WICA 3BHBA 2CDFB 3AAZB 5IGXH 2V5MA 2VABA 3VI3E 3EOBB 2MKWA 1S9KC 1EAPB 4FQLL 1I3GH 1MCBA 2YD4A 3QXDB 4U6TA 4MAYD 4V2BA 2APBA 3DTXA 3NZHH 1D5MB 5DFVC 5EOCH 1GRWA 5EU3A 1FJ1B 4YHZL 4MXQC 4RIRB 3IS1X 5GJTL 3MLWH 4MMZC 4NHUA 5DVNA 1P4IL 1T5WA 2CKBH 1EMTH 4HS8H 3QIBB 5CJOL 4JO2H 1A7NH 3VI4F 3PHSA 5F89A 1A0QH 2WUBL 2IAMD 1U95A 1XGPB 4Z0XA 1FNSL 3UYPA 4FXGA 4UT9H 3MRCA 1QRKA 1TZIA 4UOW0 3IB4A 1MCFA 1CFVH 5DUPL 2D3VA 5A2FA 3QWOA 3F6LA 4ENED 4TRPL 3BP4A 1UWGH 5IROA 2MFNA 2M26A 4IMKC 5K33A 2X4SA 3O45A 3SN6N 1Y0LA 4JO4H 2D9CA 1U8QB 5HSFA 1MHHB 4Z18A 1EO7A 1G7QA 2LU4A 2Y07H 1PDKA 4FTVB 5ISZA 2D0HA 4PJAA 3A67H 3HE7A 8CGTA 1MEXL 2H1PH 3L3IA 3VA2C 5H35A 3O3BB 4G5ZH 3VRIB 3ELAT 3HE6A 3HZYB 3F12A 3DYMA 4NNYA 3H0TB 4DOHB 1F6AB 4IS6B 3RA7L 3CLFL 4ZO9A 1KTDA 5A1AA 2EXYC 4NO0A 5E5RB 4XX1E 5B38G 2OLDA 3TVMA 3B9KD 4U6HB 4UQ2A 2O5XL 3DIFA 3VFUA 2ATPB 5TE7H 2E9IA 2XY2A 3MLSL 4Y4HD 3U0PB 5F44A 1CFQA 2HT4D 3TV3L 1WBZA 2NXYB 4N9GA 4OGXL 3IDYC 4NHCH 1HQRA 4F15C 4HKXB 1VENA 4HEME 4L4TB 4G43B 2XYCA 3NIFF 3NPSB 5HVWA 5LBSL 2ZUQC 4RBPK 1J12A 3I6LD 1VFAA 1BF2A 1FE8H 3NCEB 4Y5XC 3FFCE 5EOTB 3SPVB 4F8TA 1PG7H 4MQSB 1AD0B 3SKJH 1HHHA 2OZ4L 3BEWB 1Z9SA 2ZSWB 3HG1D 4HJJH 1F2XK 3QUXD 1HHKA 3A6BL 3ARBA 4JJ5A 1ZANH 2B8OT 3L9RB 4CMHC 3G5YB 3QQ9D 2D03H 4OI8A 4BH8A 1IAKA 1BJ8A 5L0QB 1CI5A 5GRXG 1A9EA 2O5ZH 1YPZE 1M71B 3RIAF 5DHYB 1FZKA 3JV5A 5FYLH 4LASL 3FQUB 4NPYB 3GMRB 2LQRA 4NNPL 3GO1L 3HC0B 3VWJC 3HAEH 3MRGB 3LN5A 3BPCB 1IAIH 2FCBA 5E4IA 5HDQL 4ZUVB 4Z7VA 3EOTL 4PGZA 5FYLD 4S2SB 2R8SL 4HD9A 4ETQA 2XIDA 1G7IA 4X4XB 2XZZA 4XVTL 5I1AA 2UV3A 1VHPA 1KACB 3OGCA 1OAKL 1A5FH 2R0KL 4U1SB 5GZNC 1OTUC 1F6FB 5ANMB 5IF0B 3B4NA 4C56A 5I74B 1E4XH 4FZ8L 3GSWA 2NY7L 3CK0L 3QCVH 4NOFA 4PYHA 1RY7B 3WHXB 4XCEB 2G9HA 3MRMB 1R3HA 4AZ8A 1G1YA 3H9SD 4OF6A 1S9WA 3STZB 3GIVA 1HHJA 4QRUB 5I1DB 2B5IC 5AG9A 1SBBA 1RJYB 4U1JA 1ONQA 1G7JA 2EDLA 1I85C 2WIIA 3CFJA 3QIWB 3OAUH 4NP4L 3VCLA 1XH3A 4J8RB 3QDGD 5A3ID 3NMEA 1ZOXA 1ZGLM 4XNUH 2XWTA 3E2HB 1P5UA 2IWGA 3LQAC 2DWEB 4TSCH 3L7EA 5I8EB 4DVBA 1FIGH 3S3SA 3JBG7 2VLKD 3TBSB 1R3IL 2J8UA 1KTRL 5E9DB 1EAJA 3ESVF 5KBNC 4POZC 3F5WB 4XNQB 4K2UH 3WJLA 4F2MB 4YBLB 3VE0A 3WIHL 1AR2A 1OAYH 5CJXA 3LB6D 1V7NH 2P5WE 4WW2A 4PRAA 1X7QA 4OZHE 5E94B 4L8DA 3JWOL 1KIPA 4X7DC 3T3PE 4L1HA 2DQFB 3UTSA 3WSQL 3GRWL 4WTXA 4JB9L 1X5KA 1HCFX 3U7YL 4NBZB 1U8LB 2CRYA 2XWBB 3FMGL 5CEZL 4U7KA 3WFDH 2B0SH 3RQ3A 2LFGA 2QQKL 4NJ9H 3QUYB 1DBAL 5FDYA 3UBXG 3EDEA 3DMMB 4JM2B 2BNQD 1UC6A 4R96B 2AKRA 1JI1A 4E41B 5CCKH 3P11L 2EH8L 2AV7B 4CU8A 2ICWA 4NFDA 3CCHA 2XKNB 1NBQA 3FO2B 3SKNB 2COQA 4X5WB 3VFMA 3WL9A 4E5XB 5EBLB 3S37H 2H3NA 1U3ZA 2XFXB 4PJXB 1UM4L 3MO1A 3VRJA 4OZ4B 2APWA 2BK8A 3TIDA 4FFYH 4HBQA 3T65A 4S1RL 3TBTB 2IBGA 2MCG1 4PJ5D 3FZUC 3STLA 4PGBA 2W07A 3AMKA 2H8PA 4EBQH 4X6DA 3H7BB 1J05B 3HZKA 3MODH 2QSVA 4JHWL 1S9VA 4OCMC 2CK0L 2JB6B 4Y5VB 3EO0B 2CKBA 4IDJL 5JLZA 3MV9D 1RJZA 4FG6C 5JXAH 1MCRA 5IVZB 5C2BH 2G60H 1MF2L 2XQBL 3L5WB 4N90E 3TZVD 2VDML 4LGRB 2EC9U 4NO5A 3R4DA 1T2QH 3RWHA 1H5BB 3ALPA 1J0JA 2EKSB 1TVHA 1VACB 2E7LA 3WXWH 2AXGA 1P7KB 2ENSA 4Z7UE 5MP6L 3EW3B 5DEGB 2X4NB 3QCTL 4ZDHA 2L7JA 4WFFE 2LAAA 3GMMA 3PJSA 4DN3H 2ICWJ 3BISA 1JPSH 1K9TA 2YD9A 1BFOB 1MFCL 4XMKH 2NX5B 1M7DB 4LVHC 1NANI 1OARH 2RR3A 1JNLL 3HRPA 4OFVA 4LKXA 4MNGE 3LPGA 4DGIL 1T83A 1FCGA 4Y16C 4P57B 3DUUA 1P7QD 5JW3H 2ED7A 1MIML 4LNVA 2X4OB 3VD9A 4G42B 4JLRA 1U6AL 4OGAC 1EJOH 4IIQB 5HYJA 1E4KA 2DQDL 4ZOBA 5KG9B 4EJ1C 4L3ED 4E9LA 4ZFOB 3B9KA 1QFWM 1KJVA 1E28B 4Y4HA 2DQHL 3N1PC 1EZVX 4QHMB 2D2OA 2AK4D 4O9HL 3JVGA 4Q6IB 3MPCA 4F37K 4LSPH 3LSOA 5FUOH 3CFEA 1E4JA 2VQTA 5HGAB 3V4VL 1NMCC 2AP2A 1CICD 4KRPB 5L9DH 1JHTB 3CFKA 2A38A 4YHOH 3VJ6B 3HMWH 5EZLB 4AEFA 2XRAL 4JG0H 5E99L 4GRWH 3Q3GA 4XBGB 3IDXL 4Z7OE 2C1PB 1EGJL 1XZ0A 3HG1A 3TO4D 5I19H 3SCMA 1QLEH 5B21A 4QO1A 1H0DB 3NN8B 3ZDYE 3PGCB 4NJAL 5DWUL 4DAGH 3U82B 1SEBB 2EH7L 4KK9C 3VXOB 3BQUC 3QPQD 2D7TH 1S3KL 1EEQA 3FRPG 3T0WA 5JNYB 2Z9TA 4POYA 1NLBL 3MRKB 2FEEL 2P8LB 1Y6KR 1B3JA 1X4ZA 3DX9A 1R24A 2YMXL 4ODVH 4NGHL 1KPRB 1TCRB 2Y6SD 1IEAA 5I1JH 5C3LD 1JRHI 4TOYH 5DGRA 5J89A 2AJSH 4P2QD 1MCIA 1XF5B 1TETH 5IFAH 1SYSB 1NSNL 4F7EA 4YDVA 2G5RA 3AU1A 1CFSB 1W2KT 3L5XL 4XZUA 3RVXD 3LHPL 4M5ZH 5I8OL 3H9SA 4JO3L 2GJ6D 3HPLB 4XPBL 3AB0C 3LCYA 3KPQA 4NM4H 4KROB 2E8YA 4TNWF 3FFCB 4WRLA 5AEAA 4QXGH 3QULB 2R9HD 3O3DB 1XGUA 3U9UA 4ELME 3D87B 1U8MB 4MA1B 2BFVH 3HMXH 3QDGA 3UPAA 4WTZG 3V7AE 1B2WH 3QUZD 5HY9B 3O6ML 4KWUA 4CKVX 4R7DA 3OXSB 3D2UB 1YPZB 2WWKT 1ORSB 2XNAB 1A9BA 5GQBA 2O5YH 3LEYH 4PJCF 2PW1B 5EZOH 2VLKA 1DANT 5IEHA 1H15B 3ES6A 1MJUH 4BZ1H 1KEGL 3MC0A 1LDPH 2H9GA 4MB4A 2QKIB 4OLYH 1S7TB 4HT1H 3O8XB 3QNYA 4UT6H 3RDTD 3PQYE 1KV3A 2X4RB 3PWNB 2BMKB 4XVSH 4ODTL 4JN1H 3RWJA 1MCCA 1U3JA 1A2YB 4OD1L 3IETB 5IMLA 1F42A 1TQCC 5HGDB 5CBEB 4D3CL 2FSEA 4Y2OA 3QUKB 3BO8A 5CINL 4XNZC 1HH9B 5DD5H 5GZOC 1N6VA 1WFTA 4HPYH 3OAZH 4CVXB 3SDAD 1ADQL 5CEXB 1BQHA 1GJIA 3VXMB 4CN4A 2X70B 2BNQA 3OZ9H 4N5EC 3AVEA 5HHNA 3PWPD 1S5HA 5GIRA 2FEDC 1MJ7L 3Q6FB 2X5PA 1LO5B 3EFDH 4UDUB 4GQPH 4XI5D 1FYTE 4GLRH 3HCVA 1DQJA 1NFDF 3TA3B 2X6MA 5D2LA 2XN9E 2X4QB 3O9WB 4Z7WA 5DHXB 4KDWA 1DL7L 3JTSA 2XZCH 1LEIA 1A6AB 1UADC 2XKSA 2DQTH 4NC0B 2D0FA 3S5LB 4I18C 2R1WA 4L5FH 1MWAH 3L3OB 4X5LA 5LGJB 3CX5J 2P5WB 4R26L 1AC6A 2NY4B 4AYFA 3OKEB 5DJXB 1AP2A 4YAQA 2H6PA 3X13B 1KB5H 2B1AH 2DBJA 2P45B 4HMCA 1TPXC 4NRZA 3UTPE 4JHAH 3FONB 5GGVY 3IJSA 3HC3L 3SGEH 2LU3A 1M4KA 1RPQA 5F6IB 3QHZL 3QEQD 3SHSA 1XGRB 2OL3H 1JL8A 3PGFL 3MV9A 1CE6B 3HA0A 4GBXC 1WQVT 4RMWA 3TNNA 1MQKH 3O3AA 1D6EA 2PR4L 4ODWB 3TZVA 1CT8B 2Q8BL 3BKYL 4N0FA 5CP7A 5EA0L 2J4WL 3W81A 3M8OL 1IGCH 3QJFA 4P2RE 2C3XA 3D3VA 4PJBA 1F5WA 4MDJB 1OP5K 3IVKA 5I16B 1EZVY 4ZXBB 1NAKL 4NWTH 1C5BH 4LCIH 2EXWC 1EEUA 1DUYA 2LVEA 3T0XA 1IM3A 4XNXL 3W39B 4G7VH 2JCCF 5AZEL 4YPJA 3PV6B 1NGQL 3C9NB 3U9PL 3CFBA 4Y19D 2OJEB 4JPKH 5D7IF 1ZHLA 1SY6L 1IQDB 1IMHC 3MRFB 2R29L 1CXHA 2PCPA 4YXKL 5C0AE 5J4MA 5FUCE 1YEDB 3ZTJG 4N8CL 1P7QA 3UJIH 3CC5B 3EYSH 3WJJA 5LQBL 2IBBA 3MJ8A 5EUOA 4L3EA 3P4OA 1K8IB 1DDHA 2GK0B 2R4SH 1OWRM 3BUTA 3VW3H 2J7LA 4G6JH 5ESAA 5CIPB 3HHRB 3FB7A 3WFEL 1ES0B 3U7WH 3E3QE 2AK4A 1QP1A 1NGYB 4PG9A 4WUUD 1ACZA 3WNMA 2GITA 1JF1A 3TBVB 1AQKL 1CICA 5F1NB 5I1CH 2NZ9D 1DFBL 4IBLT 4ONHA 4ISVB 2B4CH 3BZFA 4K94L 1UKQA 2X89A 1MPAL 4JFDD 2PO6B 5IKCB 1IGTA 3ULVH 5IM7B 3TO4A 3VH8A 1WZKA 4Z7UB 5F97E 4I0PC 1II4E 4PRPD 1NEUA 2A0LD 3LN9A 5E24E 3ULVD 5EBWA 3EO1B 2ZSVB 1D5BB 4IMLA 5DRNB 6FABL 1FPTH 5ACZB 1PKQE 3VXSB 25C8L 5D2NC 2QL1A 3VFSA 2APFA 1L0QA 2NXZD 3RU8H 1EVUA 4G7YH 4N5UA 3V4PL 4WFHE 1K85A 4MNGB 2AJUH 3RWIA 1OT1A 4PJGE 5DI8B 4GMTL 5LAXB 4I3SH 3WEXB 3LRHA 3CPLB 1I1FB 4YHPB 3QXVA 1NGPL 3BSZH 1LK3H 4XNYH 3V6BR 3KPPB 4OZFH 4R3SA 5C0ND 1NC2B 2YD6A 3CVHH 3HAEG 5HD8C 2R1YA 1S7WB 1GGUA 1A3LH 1OQOA 5ID0A 1BLNA 4HIIB 3A6OA 3O4LE 3T4AA 2HTKC 4OLUH 4DVRH 1SM3H 4KPHL 4Y8AA 3SQOL 5TDPA 2ZWLT 1RU9H 2GJ6A 2W9DH 4LLQA 4XGZA 2PXYC 4G8IA 3ARGD 3NABL 4R7NA 3EDDA 4ZTPL 4M02A 4PRIB 5F1IA 3ARDC 5EWIL 1K2DB 1TIUA 1NBYA 4YEFA 3AXLB 2Y5TB 3R1GH 1QR1B 4JQXA 5KZCB 1NEZA 1UB5A 4TVPE 5JR1L 1HI6B 4HIJA 2CIKB 1OGAB 5DUBA 3KHOA 5IQ9B 1KELH 1S7SB 3FB5B 4ZS6D 2OQJA 4P23D 1OD7A 4OI9A 3HMXA 4PGDA 4HAGA 5MEOB 1DLFL 5D7KD 4WV1C 1I4FB 4G6KL 4BQ9A 2C3WA 1NUGA 3MRIA 3KJ6L 4QHLA 5DR5L 2HKFL 4JPIB 5DJCA 32C2B 2OI9C 2DBLH 1DQMH 1FFRA 1NFKA 4W6XB 3S35L 5CZXC 1DQLH 3OGOE 3KPNB 4LSVL 1OCWL 4J3SA 5CBAA 3BW9A 4S1DC 3BE1L 5DRWB 4U6HA 3RWGB 4RCAA 1RIUL 1ED3A 2R0LL 1YQ2A 1AC0A 1P1ZB 3HFML 1BFVL 2X4UA 1UXWB 2X1PA 1FN4A 3QI9C 2A77H 5A16B 1JZ8A 4JCMA 4OKDA 1HHIB 3S36H 1DLHB 3IDIA 2GUOA 2VDOH 4KXZI 1L7IL 5EORH 2ZOKB 3SDAA 1ZVHA 5JPNA 3SE4A 3QQ4A 4NKIL 2JTDA 3IKCA 4XHJC 2Q87A 4PJHA 1MJ8L 3PWPA 1I7UA 3U6RA 2ITCB 3OKKA 3EYFA 1C08A 4NCDA 3ULSB 1J1OL 1P7HL 4OT1L 4BJLA 2PKDA 2R0ZL 5FECA 3NCYP 1RULH 4ZNCD 1HXYA 3KPMB 1QFOA 3LVEA 4XWGH 5FCUL 2ZZUT 4F7PB 2O93L 3VGHA 1FAKT 1HWGB 1S5IL 1CDYA 2FEEI 3CDCA 4ZUVA 2QR0A 3PQYB 1X4XA 1KB9K 1MWAA 2DQUL 3CSYB 3IDYB 4F15B 3OPZL 2Z91B 3PABB 5GRJH 1BWWA 3UTTD 4U1SA 3MGTA 5HI4C 3QEQA 1JNNL 4WVRA 3P30H 1JF5A 1KCVL 1UCBL 4AMKL 3ULUC 1A6PA 1RUPL 4L4VD 4WEBH 2O26U 1FNEB 3OKDA 5C07D 2JIXD 4Y5XB 1DBML 2OL3A 5IBLC 5C3TA 4MJ5B 2YPLE 3TBWB 3W9DB 1AO7E 5CGYD 1GCFA 3BPLC 4ZMAT 2KH2B 2YK1H 1U41A 5DJ8A 4CMHB 4LHJB 1NDGA 5GRUL 1SYVB 4GG6A 4LRNL 3P4NB 2X9XA 1VEMA 1FYTB 3Q6GH 1GGBL 4H1LB 4M6NL 4YUEL 4Y19A 3VWJB 4RFEB 2VYRE 5ESQA 5IESH 1H3TA 4PJFE 3MV7B 3IDNB 2XTJC 5C09D 1A1MB 4Z0BL 2W9LA 2Y5EA 4XC1L 4NYLB 4OZGE 1NFIB 1PY4A 4PLKD 2VXQH 2YOCA 4JFYB 4FQXD 1WAAF 2ZKHL 4UV4H 2ERJC 3ZKND 3GI8H 3VFTB 3I3BA 4TUKL 3Q48A 5GGSA 3OX8B 4BSVB 1KCLA 3LDBC 4IOIB 4OB5H 5DO2C 5DLML 2GCYA 4WUUA 5L7XH 4UB0H 1J1PL 5IJVA 1JFQL 2UY6A 4ZUTA 2B5IB 3HNVH 2NPLX 4PTTA 1Z5LB 4A6YL 3G5ZB 4JFDA 4WEMB 2F8VA 4WGVB 4E42A 1ITBB 2VDRH 1MFNA 4B0MM 2JB5H 4YDJB 3HZVB 4JRXD 3SDYH 4NFBA 1J7VR 4PJIA 5DYOA 4A2MA 4PRHE 1HXMB 3LKPB 2ESVD 3MLYH 4OLXL 2OMNA 3S4SA 5GS1C 5CMAB 2XKNA 3AS2A 5GSVB 4MQXC 1EHNA 3DETC 4KY1H 4X4YA 1MVUB 4JFEE 1IZKA 3EFFA 3IXTB 5C0AB 2CLVB 1I7ZA 3LRSA 4F57H 2VAAA 1FVDB 4UBDC 3RZCD 4Y7MA 2A9MH 2FDBP 5I1LB 3PL6C 1WBYB 5FV2A 1DEEB 2A9NH 3REWA 2EDHA 2JJVA 3FB6B 1J05A 5FHAH 1GHFH 2LABA 4KKLD 4ZUWA 3OAZK 2JB6A 4LCUA 3VGGA 4OZFA 4OKVA 5FA4B 4LHUB 2BHUA 4F8QA 4OCWH 1BIIB 4OF3A 3G5VB 5E95B 3RX5A 4DK3A 3TFKC 2ZNWA 3LQAL 3ARGA 1MAJA 1HZHH 3MXWH 2YWYA 3C8KB 4KJQC 4JFFD 4M93C 4HGMA 2P4AB 3GZKA 5FAAA 3L1OH 3REVB 3WS3B 1UVQB 2W0KA 4TQEH 15C8L 4HIEA 3DVNA 1CWVA 2UZYB 2XACC 2O61A 2B7DT 3OR7B 4F33A 1PKQB 4P23A 1JWSB 4QWWC 4Z78A 3TP4A 2OS7A 1WFOA 4XTRD 4F7TA 5E2TL 2IQAA 2FO4A 3UO1H 1BVKB 4NT6B 1KCRL 4UDTB 4G3YH 4JFHE 5EN2B 4HDIA 4MXWL 4OF5A 1WLHA 3GBML 4H20L 1YDPB 3C08H 5HJ3B 3QXWA 3PGDB 1ZEAH 4YX2L 2V5TA 1BFSA 2DYPD 4QXUH 2QQLL 2C1OA 3DBXB 5B22A 4ZFOA 3UP1A 1JVKA 3P0VH 5T5NG 3CDFA 4QHMA 4DKFH 3IAQA 2BXZA 1CGUA 1UYWL 2QADD 4Q6IA 2A6IA 3O4LB 1W8NA 1P84J 2A1WH 1U8PA 5DK3A 2Q6WA 4KZDH 1GC1C 2P24B 3VXUE 3LKSA 1S7XA 2RFXB 4PUBL 3O2VH 4XCNB 2A73B 5CZVL 4PJDF 2FZ3B 2IPKA 3QO1B 4PJ8C 1MLCB 1T3FA 2OXHA 4EVNA 5D2NE 4PS4L 4RWYL 4LVHB 5MHSD 3VXNA 4XRCA 2QEJA 5IQ7H 3C5JB 4Y16B 2V9QA 1NUDA 3VXOA 2N1KA 4NQCD 3PWVB 3C2SA 4KVCL 3TPUB 2IANB 1P4LB 4BZYA 2FBOJ 3VFGL 5AZ2L 5TGBB 5FYKL 1I3RB 2JELL 4OIBA 4WFED 3X3GH 4KKCD 1VPOH 3DPBA 4QY8A 5TDOB 1WIUA 4J2XA 3H9ZA 1RUKL 5DJAA 2AEIT 4J6RL 3TCXA 1HIMH 4XHQA 4BQ8A 4UIMB 1U3HA 2QQQA 2QJDA 1NMCB 5IB4B 3PIQB 3NIDF 3DUSB 1K5NA 2ZCKH 4NNXA 5F7FA 2EDWA 5I1KH 5KSVB 4L4VA 3ZE1F 1K4DA 5C07A 5L2KB 4JY5L 1Q1JL 1WT5C 4KUCF 4TVPL 1FH5H 3DJ9A 4RFNC 4W4OC 3FT4A 4LEXL 2V7NB 4JPWH 1KEML 1BEYL 4BKLB 2VDQL 3BJ91 1EO5A 2Q76B 2YEZA 3BJLA 1R5VB 4KI5C 1A6WL 3VGEA 4HK0B 3RNQA 3MMEB 3CFDB 3VFPA 3BQUB 3UJJH 3KHQA 1GGYA 2IH3A 4Y4KC 4YHIB 4K7PY 4JHBA 3FFDB 1SHMA 3MRNA 2EYSA 1INEH 1XF3A 3WXVH 7FABH 4JPVH 4MS8D 5C09A 3WO4C 2JJTA 3MBXL 3L7FA 4KRMB 4YDLC 2VLLB 5F7EL 1J0ZA 3WE6A 2H45A 4X98B 3QDJE 2HLAB 2QKIA 3QXUA 4MNHB 4FQXA 3EKCA 1Q9WA 4HXBH 4JRYE 1L6ZA 4MGXA 2XOTA 2B20A 3RVVC 2IGFL 4YXHL 4PB0H 4AH2B 1D6VL 4NN6C 5JHDB 2L4OA 4PBXA 4YDKL 1FNAA 1PY9A 4JZJA 4GS7C 4M7KH 2VDNH 5FGCB 3AB0B 4HGWA 3H42H 1JYXA 4DTGL 2NY6C 4MHHG 3MXVH 4M1CD 2YPLB 4R8WL 1AO7B 1FL3B 5EIIA 5HGBA 3QA3A 3FB8B 4GAGL 2DWDB 4X7FC 1TJGH 4HCRL 1EEYB 2HRLA 4HWEH 5IB3A 4CU7A 4JRXA 4LCWD 3QRFM 4DQOL 4JZOA 1IGIL 4GSDH 4YHML 3ARFD 5C0DB 4RRPG 1AGBA 3B43A 4C58B 3EUUA 3BD3A 3TN0D 5D72L 2VWEC 3QXAB 4GKSB 3D69B 1VKXB 1UACL 4PJFB 4AG4H 5F7NC 4M48L 4BQBA 1JV5A 1KIRA 5T1KA 4ZS7H 4D9LL 1IC7L 3BEVA 4OZGB 3IU4L 3LQMA 4M3JA 1FZJB 2HKHL 2ZG3A 4OZHA 3LKOA 4O02H 4DKDC 3SGKA 2P1YA 4R2GD 1TQCB 5IEKB 5TH2A 3ULUE 5CSZA 4XNZB 4KJPD 4K8RC 4LLDB 5J12C 1XGRA 5CJ5A 4XVJH 1LMKA 4HUUA 2FGWL 2CGRL 3P9WB 5CKAA 4Y88A 1CG9A 5HHVL 3AM8C 2AXJA 3LKQA 1VADA 3FKUS 3RBGA 4KHTH 2P8MB 5IMOB 1UZ8A 4ZSOA 4I9WE 1F58H 1BBDH 5T3XH 3HUJE 2Q7YB 4PRHB 2F58L 1MIEH 2AJXL 4M5YL 4S11A 3CXDH 4PJEE 3RIAK 5T3XD 4FNLH 2XTJE 3AY4A 2M2DA 3TYFA 4I18B 1FAIH 1QFWH 3QDHA 1S7UB 3MCLH 1WZMA 1Y18B 3ARWA 3OB8A 3FQTB 3SBWC 4DKEH 5F88A 2GYSA 1ZWIB 1Z9LA 1L0XA 3WCYA 4D0DA 1MREL 4RGNC 2B1HL 2NY2C 1TPXB 5A2LH 2DLIA 2DYPA 3BKJH 4X6CF 2QSCH 2C5DC 5JW5A 4XPHL 2DRUA 3A6CL 3ILPA 4OLVL 4XNMA 1KN2H 3GMPA 5EO9B 7CGTA 5ADOH 1P4BL 4GBXB 4HHAB 1QFUL 5F3BB 4JVWA 3B2UC 1QZ1A 3L3HA 1C1EL 1I7TB 2FJFB 2AGJL 1R3KA 5MEND 1KULA 4LEOB 2VZOA 1T89A 3HI1B 2DLFL 1RFDL 4L8SC 4OCXH 5AAMA 2UUDK 2FR4B 4Q58C 1IEBB 5CLWA 5D7SH 2XXMB 2VXVL 1WWAX 1W0WA 4HZLA 3BWAA 1KNOA 1Z6JT 4QCIB 2JLLA 4AK1A 4UILH 4XCYB 3CLEL 3ARVA 4JQIH 1XAUA 4P4KD 5KVMC 1YC8A 3G6JB 1DVFD 4LLWA 4JFPB 5KVDL 1KENL 3HKFA 1QVOB 3UXFA 3V6ZB 2BNUB 4JDVB 1YNTA 4MJIB 3MRDB 3T1WA 4AIZB 2LTQC 3MNZA 3B3IA 1G7MB 3BYYA 4QTIH 2J6EL 1S78D 4OSUL 5EOQH 2HFGH 1OP3H 2NR6D 5GGVL 3MGAA 3F58H 1C5DB 2VXSL 3KXFE 5K9OB 5HVFB 3T3PF 3QFJE 1N3NB 1UJ3A 1E4WL 4YHPA 1J0HA 2I60H 2HAZA 1MHEB 2R69L 3OR6B 1WC7B 3RWCA 1V7MH 3DNKA 3WUWA 1QLFA 5D6DA 3WHE1 5KVFH 4OM0H 5ITBL 5JIIA 1U2CA 3MRBB 3CXHJ 1CXIA 5IROC 4RWHA 5HHQA 4NKDB 4PP1C 2C26A 5D8JH 2BSTB 4G9DB 1MUJA 2VL4A 1CGYA 4YFDB 5DMIL 5F96L 3GMOA 3VXUB 4KK5D 5BVPL 3TT3H 3QDME 4QHUA 3L3GA 2VXTH 4I0PB 4I77H 5B8CA 1KYOK 4HH8A 4W68A 3IFNL 5EZJB 3SGDH 1ZGLA 3HE7C 2GT9A 5HHMB 5HGHA 3BKCL 4M7JH 4OUUB 1I8LC 3HE6C 5D70L 3P4LA 4M1GH 4R4NC 1HI6A 4OZIE 1E6OH 3DHJA 3V9FA 1VERA 1FO0H 1HKLL 3M17A 5C0EA 4OLEA 2CDGA 3TGXA 2FJGA 4J1UA 1GIGH 3U4EB 3SE8L 5KN5A 1U91A 2EYRB 1EEZB 1YEJH 3F8UB 1HHGA 3TVMC 1RZGB 1N59B 2NYYC 1RZFL 4FFVD 4HKBA 4LSQH 4AL8L 4TTDD 4PJCA 4GAJH 3N85L 1KJ2H 1CLOH 4XP9L 5FO9A 3CZJA 2AEQL 4NZJA 2ORBH 2Z92B 2YUWA 2HWZL 1DQDL 4K23H 5J1AB 1QFPA 3LN4B 1U8IB 1RZ7L 5SWSB 4NZRL 4X83A 8FABA 4KK8C 3ROOB 1FLTX 1JGUL 3CGTA 5BO1H 4BQ6A 1J1XH 2VZSA 1GZPA 1QUNA 2PXYB 1TTFA 1U58A 4P4RB 3SY0A 3N1QC 2UVEA 3NTCH 1FFOB 2W9EL 1SJHB 4MMXC 4XCCH 5DJ6A 5E8OB 4K3HA 2AJVH 3ARDB 2G5BA 1LE9A 1CZ8L 4XCFL 3ARBC 4AQOA 4P3DB 1VFOA 1YUHB 1HH6B 2ARJB 3W5MA 2A74A 3ZHLA 1A47A 2ADGA 1ODAA 2VITB 2WQ8A 4LDOB 4R0LA 4LCWA 3VRLE 3ZYOA 4ELMA 2XICA 5T1MB 1WCBB 1PKOA 2F8OA 3OWEA 3ARFA 4WV1B 5INCB 4FQJH 5F1SA 1A14L 4QOKE 3MLPA 3TN0A 1A22B 4I48B 2OI9B 3B83A 2W60B 4J3TA 3IRZA 3EIFA 4RAHA 3U46B 1MEXH 4HJ0D 5IT2H 3OKLB 3U2SB 2DQCL 2VR4A 1NFDA 4GRMB 1CD1A 3NFNA 4PFEA 1CDCA 1MCWW 4JRYB 4GMSH 5J3HC 3QI9B 3V4UL 3C2AL 1T7WA 1T4KA 4QRPD 2O5XH 1EIBA 1K8DB 3O11A 5KS9E 2V9TA 4ZTOL 3MLSH 2AI0L 1Q94B 4M4PA 3IF1B 3S97C 3ZE2E 3BGMB 3TJHD 1Q9LA 3TNMB 4DN4L 1G0XA 3JWNC 4QF1A 5DSCA 5J9PB 4FP8L 4NSKA 4NKOA 3ZDXE 4KI5E 5I2IB 4X4ME 5HVHC 3CJJA 2R2CA 1LE5A 3MA7A 4RA0C 1DQQA 4AEIL 12E8L 5C0BE 3ZDYF 5FKAB 5B39A 2QHRH 5KOVC 1UZ6E 3PF2A 3GI9H 3E8UH 5HPMA 4U3CA 3P4NA 2OZ4H 3UPCA 1MAML 5JZ7D 3WFCL 3EJZC 3J7HA 2YSSB 1CXKA 1UQSA 5CJXC 2XN9A 3QNZA 4WW2C 2BJML 4LOUC 5HYSB 1N6QL 4BZ2L 1CF8H 2NNAB 4S1QH 1HOCB 3O41A 2MQCA 3MFFA 1TVDA 1W8OA 4Z95H 1LK2B 3JUZA 3RL1A 1QEWA 3ROLA 1CLYL 1OTTD 2F53E 2GSGA 2WUCL 5D7IA 5FDWB 4KZEL 4ONGL 3GO1H 1KC5H 2GJJA 1YECL 3VGFA 1D5ZA 1X6NA 1FZOA 3BDYH 3KR3L 3WKNA 5F7YC 4F7MB 1CDJA 3F7YB 4C83A 5JORB 3QHFH 3KNBB 4BQCA 2GTWB 2NW3A 4FXLA 1M1SA 1D7FA 2ADJB 2D4FA 3EGSA 1LNUB 5MENA