2XWXA

Vibrio cholerae colonization factor gbpa crystal structure
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
391
structure length
385
Chain Sequence
HGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVILAVWDVGDTAASFYNVIDVKFDPDWNPAGQIIPSMDLSIGDTVYTRVFDNDGENPAYRTELKIDSETLTKANQWSYALATKINQTQKQQRAGQLNGDQFVPVYGTNPIYLKEGSGLKSVEIGYQIEAPQPEYSLTVSGLAKEYEIGEQPIQLDLTLEAQGEMSAELTVYNHHQKPLASWSQAMTDGELKSITLELSEAKAGHHMLVSRIKDRDGNLQDQQTLDFMLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLCNAC-BINDING PROTEIN A
publication title The Vibrio Cholerae Colonization Factor Gbpa Possesses a Modular Structure that Governs Binding to Different Host Surfaces.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Chitin-binding protein
total genus 86
structure length 385
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03067 LPMO_10 Lytic polysaccharide mono-oxygenase, cellulose-degrading
A PF18416 GbpA_2 N-acetylglucosamine binding protein domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xwxA03
2.70.50.50 Mainly Beta Distorted Sandwich Coagulation Factor XIII; Chain A, domain 1 chitin-binding protein cbp21 2xwxA01
3.30.70.2150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xwxA02
4ALCA 2YOXA 2BEMA 4ALQA 4A02A 4OY8A 2LHSA 4GBOA 3UAMA 4ALRA 4ALTA 2XWXA 2BENA 4OY6A 5FJQA 5FTZA 4ALEA 5AA7A 2YOYA 4OY7A 2YOWA 4ALSA 5IJUA
chains in the Genus database with same CATH superfamily
1KCRH 2YFNA 3M7OA 4W9DC 5J5EA 4H13C 3S3SA 5A8RA 4XCCH 4I3SL 4PCKA 5M95B 4JVFB 4CTAB 1X5TA 3QSKB 3KHLA 3IWLA 4V1Ak 4X7TA 3T5JA 4DKAA 4CDGC 2C2DA 3ARFD 3QRGL 5CCLA 1BC6A 4OCYH 4KQ4H 4NLWA 4PJ8D 2BSEA 2XWZA 5HI5D 2CMRH 2O1PA 4DJMA 1BBJA 2PP8A 4P4RA 4XXWA 2K8MA 2DPKA 4NRYB 1S9YB 5ISZD 2FZ3B 4N2LA 4E41A 4JO3H 2X09A 1VGKB 3AMKA 4RW9A 5BYQA 2A77L 2AJSH 3S3BB 5KBNC 1YRUA 2DIAA 4QIGA 1JGLL 5EX0A 3QNXB 1TJMA 3QG6A 4ODHH 4OGAD 2ZX9A 3SO5A 4NFDA 3T4AC 5B38A 5L6YL 3GSUB 5GRUH 3LAKA 3O4LD 5DO8A 5EWIH 2GPZA 3BIAX 1G7PB 1P7QB 3CVCA 5C09A 2BOCA 5EU3A 4HS8H 4MCYA 2DEWX 4F3QA 3T2QA 5B8CA 4WI0B 2DHGA 4LFAJ 4TNGA 4DVRL 5DZ9A 1MI5E 1E28A 4G9FA 5EBMB 2CVIA 2YA2A 4A6YL 1KEMH 3I9ZA 3K2UL 4DP2X 4G7YL 2HBRB 3FRPB 3OJ2C 3OKDB 3UJTH 1I8KA 4AYDC 3ATDA 1E65A 4KAQL 3RDTB 2F3JA 3IJSA 5KSBF 2HAFA 3Q6FB 3ULVE 1I75A 1XR9B 1VYAA 1OB1A 2ED8A 2DR5A 4BK5A 4DL3A 2E9ZA 2E6QA 4FLRA 2CG8A 2AXFA 3L3KA 5A2QY 4NNYA 1OY9A 1A0QH 4K71B 1R8HA 1RTDB 3R7BB 3P4UB 4P4KC 5T3XD 4XVJL 1KG0A 2WCGA 4W70A 4CNIB 1N5YL 4AGOA 3V4VB 1UM6L 3HZYA 1HK6A 1CDIA 4EGLA 4Y4KB 1QI5A 4EQ2A 3B8SA 4P2CG 2YEVB 4ALAH 1QSEB 5IJDC 2Q3PA 5JIDA 4NWBA 1AAJA 3NCXA 1RHOA 1U2RA 3E2HB 4ZVEA 2KG0A 2A6KB 2VSKB 3CLFL 2MCPL 1J9SA 3OR6A 1JPFA 2HSIA 1KB5A 3T3ME 5GHWL 4GOJC 2G2ZA 3QCTL 1CJVB 3OM3B 1OIAA 4L5FL 2RT3A 1RAHB 3MEKA 4ZI8A 5T1DH 1L5UA 2R2HB 2KZMA 1FSKC 3DXAE 1RT6B 4M7ZC 2WLKA 4AG4L 5JLZB 1MMNA 5DRNB 3DJTA 3PXJA 3S48A 2XC8A 1A6TB 2HW3A 1E5ZA 1XH3B 1JNHB 3MBXH 3QR1A 4A2MA 3WTUA 4B3MF 5HAOA 1E2ZA 4B7LA 4DN0A 1FSOA 4RUCA 2EIBA 1UACH 3DBXB 3TVKA 4FF1A 1EO5A 3D5OF 1HQRA 4C11B 3HZMB 2BOLA 4A8KA 4G1IA 2QHLA 5D7JC 1KSRA 4UIMA 4HOWA 1S7WA 4FABL 1CIDA 4K3EH 4Y19E 1XF4B 2CKBH 2RQCA 5ADPH 5MENE 1XC9A 3TBVB 5DQHA 1SQGA 3SCMA 3FUHA 3FTXA 2XS7A 3HI1A 4B6ZA 4EEEA 5JQ6H 2BM3A 2FDBP 5T5FA 5KS9B 1KMGA 1G7HA 3E8UH 3LIZA 1Q8LA 4YHHF 2E9TA 2WSCC 2BIQA 1H2UX 3MCLL 1F4XL 2QPSA 4EUPH 5GJSL 4OZLA 3UFCX 3TZZA 1HAUA 3JYCA 1IR2A 2OHDA 1G2EA 4M8QA 2V7NB 1LWHA 5I8CA 3OLBA 5HMZA 2VJ8A 4I2XE 4KUCF 4H88H 3UVJB 3QUXC 2J6EL 1W72B 4WFHE 5GGTH 5AE3A 3BI9X 5IBLC 5K9QG 1PZ2A 2DEYX 5JYLA 5F71A 2K6ZA 4A68A 2NYZA 3N55A 4MVBD 2C1PA 1O8BA 4O44A 5LMUJ 2DQGH 1S7XA 3SE6A 4U31A 2XKNA 5EZLB 2YPVA 5CJOL 2HT4D 4JJHA 2GI0A 4I67A 2ZOLA 3TH3T 4UV4H 3HBGA 1A6VL 4OFKA 1HBMB 4RW4B 3WXVL 3NP5A 5CSBA 4NEZA 4JGJA 2G5BB 4OLYL 4K8RH 3R8BB 3T71A 1FNHA 3KWTA 3EH3B 4Z3JA 4X62J 4OGXL 5IQ7H 3H25A 1MWAL 1KSJB 2KRRA 5C7PA 3JSBA 4ECWA 5ACIA 4X4KA 3DHUA 3FT0A 4P7VA 4XN2A 5J3HD 2LAGB 1UB5A 2VZ3A 4P5TC 4JN1H 4J4PA 3UPAA 2EFQA 4R7NA 5IHHA 4W1TA 2J88L 5C2BH 2PP7A 3C5XA 1WHYA 1FD8A 5IW3A 4JZOB 5CJ8A 2XN1A 4QTHB 4RNOA 2BW2A 2AQ4A 2ZCHH 3VM7A 3RNKA 1J5OH 4DSLA 1M2OA 4K4ZA 1RU2A 2IBOA 4WENB 2XZTB 2HZCA 4M5SA 1LO0H 4NO3A 2X4TB 4NWUL 3AJDA 3MEDA 2WRMA 3MR3A 1G6RL 2I9SA 4R2GC 3WV0A 5FV2A 4ZX3A 3ZMEA 1RJYB 1ZA3A 5CJQL 4F25A 5JPNC 1NBZB 2IQAA 4DXLA 4KKZA 1DAXA 3MROA 4AIXA 4NIKB 5F2UA 4DCJB 3CXDH 3NAAL 5BRZA 2HLFD 3SKUD 3O0LA 4O02A 2B9WA 4B08A 4HLZG 2I7SA 4ZP9A 4ZK7M 4Q9RH 2YQ3A 3QT5A 2FHJA 3W9JA 1Q9KA 4FZ8H 3NIDF 1NGYA 2BIOA 4KDTA 1K6QH 3ILDA 2ESVB 3IVKA 3GLDA 2C3OA 3J7YI 5ACZB 4DR5J 3S5LB 2NY0B 2MCAA 4EI5A 3CE1A 1SVBA 1HI1A 4NO0A 1S1VA 4O3OA 7AT1B 5C3LD 2D7SA 2I69A 2DD8L 5C2CA 3SDXA 4ANKA 4AQ8A 4E0DA 4YEEA 3QJOA 3VW3H 5KFDA 3KK1B 1CS4B 4CDIA 4WK3A 2YN5A 1WK0A 4ED2A 4C3MA 2X6UA 3SY6A 3RZAA 1D7FA 3D25A 4I2QA 1IKWA 1GXTA 1S9WA 1PIEA 4XPGH 1KB9K 2OBGA 2CZ9A 3IE4A 2HHPA 2GT9B 1T5WA 2R0KL 1L7TL 4YBQD 2X70B 3ABGA 3NRQA 2Y36L 5D1ZA 4DKTA 1ZAXA 2CQ2A 2XQYA 4BCXA 2WBJD 1I1AD 1AKJA 1PIFA 5A2LH 4LXFA 3OL7A 1A1NA 1SEQH 4JFXA 1CB4A 3PXHA 4CLPA 5L2KE 3T0EC 4O2CA 3MR5A 4L75A 2XY7A 1PX3A 2IGFH 2W88A 2WWMD 1EX8A 1MEXL 2EE6A 3GSWA 3WN5A 3NGRA 8AT1B 1T02A 2XZCH 4RBPK 3T3FA 4AX3A 2BNQA 3KYNB 5CO1A 4LP5A 3K71A 1VLYA 1GAFH 4NENA 3CC5A 4GG6A 5KT7A 1D9DA 2C7UA 3NJNA 1F41A 2BM1A 2PW1B 4X4QA 1TU2B 3B3IA 3MHZA 3HPOA 3SDDB 4ZS6C 2ZOFA 1BSIA 4G8EA 1UTDA 4LNRA 4OZ5A 1KIQA 1L7IL 3AS1A 2YZ1A 3C14A 4LSNB 3N0PB 1M71A 3BAWA 3CK0L 4FFZH 1VGYA 3WC2A 5JOEA 2VDPB 1JIHA 1AJWA 3JZYA 3AC0A 1ACZA 1ZS6A 4HHAA 4FVMA 1TK5A 1CICD 2X4RB 4LOFA 2QA4G 3ZKMC 3ZTSA 4ZMLA 3J80U 5IMOB 2VDOL 3MGAA 4DP9X 4GEJA 1YJTA 5RUBA 4RU2A 1D0EA 4PCYA 4HT7A 1ZLUH 3THMH 1NUNB 5D72L 1BP3B 1X5LA 1LXJA 1FCGA 1PJ6A 4IG3A 1RP5A 1R0AA 3TVMD 2YJQA 3BLKA 3BP4B 1F0XA 2J21A 3MV8B 4GKSB 4DGVH 5I42A 1EP4B 4MNGA 2F5AH 1JCVA 1LOUA 4IFVB 3EJQA 3HI5L 3BKMH 4R26L 3HXMA 4D9LL 2KERA 1XGPB 3II1A 2DQFA 4X6EB 5I2IA 2OL3B 1MCWW 2MKCA 1KSGB 2K78A 1R8PA 1JFQH 4RZCA 4AE1A 2C42A 5E8NB 4MFHA 3UDCA 1NCOA 4U6HB 3KXDA 3C5JB 4IG0B 2ZCKL 4KHTH 4NQXB 1AGCB 1LNUB 4FLSA 3BKFA 1SJXA 3ZHNA 1U0SA 5DF0A 4R4BA 4JFDA 4ZOBA 4DPTA 1WA2X 1TEYA 1FBIL 1H6TA 1SJEA 1T1YB 1U3HD 2CLRB 3LHPH 3LKQB 4JFVA 5GS0D 4KJYB 5DLMH 2XNRA 3HE7A 2RF2B 5CHNA 2MOGA 4L8BA 1QTPA 4HUXA 1QTYT 3L4CA 4UQBA 2DHHA 2C9VA 3KUEA 4MAYD 3IJYA 1QFOA 5ABZA 1QR1B 2VFRA 2IWKA 4ECRA 2VCOA 1X9RA 3E3QC 3PWLA 1IGFH 1TZIB 4NEHB 2VLJB 4KKPA 2J76E 3DX2A 3GKWH 1KENH 3LH8A 2MNWA 3I9AA 3I87A 5DD3H 4WJ5B 5E00B 1VBZA 5LGKA 4ZHRA 3S0PA 4QRRB 2C2KB 3E0GA 4I69A 3UD4P 5D6DA 2K0RA 3SHSA 4DO5A 4ZVGA 1RKRA 4JKPL 4L1SA 2W1BA 3AU1B 2MQGA 1HBUA 4L3KA 3PAVA 3ARBD 2DLTA 3FU3A 4Q8BA 4PJFF 1ZVSB 3OTOF 1A3LL 2AABL 2J4WH 3G86A 3SFUA 2IYGA 1C08A 3CHOA 2R56L 4UM9B 1E2VA 4OJFL 2NXYC 4EN3B 3HI6H 3TT1L 4RNRA 3L7OA 2NZIA 4M8LA 2F54D 2Q7NA 4JY5H 4LL4A 4OFYA 1MUJA 4TF4A 4GSQA 5DJ0B 4ZZKA 1ZA6B 3H2LA 3T5HA 2IALB 2IMMA 4IFYA 5IB5B 1WFMA 2J5WA 3DVFA 3FL7A 4ZPWR 1IKFL 4ES2A 2HJLB 4XC3H 1PF3A 1NGZB 1QAXA 1DHMA 4Y4FA 3R18A 5BZWA 4MD0B 3UZQB 3S97C 4PI0A 3P11H 2CAKA 3FQRB 5DEFB 1QQDB 3ETTA 2BKOA 3UAJA 1GHFL 3TM6A 1NCDL 4ZN3A 3KM2A 1ACMB 3BH8A 4F27A 2R4FA 1WWAX 1JKHA 5CEZE 1Y0HA 3ET6A 3CMOL 1YMHB 2GFBA 2V2TB 2K2PA 3D0LA 3BGOP 3GSIA 3WSQH 3ULUF 3Q24A 4NO2A 3RX8A 3S35H 3JTNA 1R8AA 4NS0A 4KKOB 1KFAH 1RT5A 3O6KL 1XSOA 5DO2D 2VDQL 4U7CA 4P5KB 1SF5A 2UUDH 2UZIL 4X9BA 3MR9B 1RU9H 3DVGA 1Y7VA 1LP9A 3QQ4A 3V2AR 2C1OA 2PCXA 3HRZC 1VIXA 4YR6B 2OCJA 3LP0B 3DLEA 1FVQA 2A6JB 1ICTA 4Y2OA 2HHTA 3H42H 3ZT5A 5ID1A 3GJTB 2NW2B 1A9EA 2ADFL 4BQCA 3T0DA 4NLOA 5CS7A 1Q0XL 3DYPA 5FR3A 4BZ2L 4YHPA 4GT7A 1CULA 4DI6A 1YUHB 3OQ2A 5D8JL 1U6AH 1H3DA 3TYTA 2I85A 1S9EA 5AQ0A 3TU6A 1XIQA 1YEKH 4DNLA 1QLFB 1WBYB 4W9FC 5E9DD 2XWBB 4YDVA 2Y3AA 3IU4H 4P73A 4LCCA 4MKMA 3DMMA 2ILZA 4O58H 5TE6L 5DQ9A 5F8HA 5C0DB 3EH4B 1UENA 1QE1A 4PI2A 1I8LC 2A0LC 3ZYZA 2W4DA 5FYJH 4Y2DD 4L3EA 2WLNA 1MIEL 3RY6A 1DTQB 4ZLPA 1QFPA 4AQYJ 3QI9C 4HC1L 5CGMA 4XPHL 4QLWA 4L3CA 1FZJB 4GO6B 3WIIH 1AGEA 1OP5H 3TYGH 3RPIA 1RJJA 2ZOTA 2KZKA 4JJ5B 5BO1H 2D74B 1JGDA 3EVWA 3M8PA 4MBOA 1I7TB 2Z31D 2APWA 1URLA 4QO1A 4UANA 4X6FB 3VWJB 1PKUA 1XTZA 2GMLA 1IC4H 3BD4A 4Y8AA 4XX1G 3IMUA 3US9A 4PPZA 3WTWA 3IM1A 4MMZC 3EE3A 5IVXB 4WYLA 4X4VA 5DZJA 3WEOA 2RTTA 2BK8A 2CK0H 5DFVC 3N85H 5T1LA 2E1CA 3OB0K 2AEIT 4YMEA 2FBOJ 4WI8A 4ED5A 1HQ4A 1S9GB 1JTOA 1Y3JA 4IG0A 1SN5A 4O4GB 4FMRA 5CUSL 2OYKA 3I82A 3SDCB 5GZOD 1Q94B 3ULUH 5LMNF 4QCIA 3MKKA 3V0IA 1ZS8A 4YHLH 3LXUX 4JPKL 2HPOA 2O5XL 4MA3B 5C71A 4JRXE 4Q9QH 3K7UA 2DKOB 1TL4A 4I9WD 3CFEA 3I84A 3PG9A 1FNGB 4DQSA 3PWNA 5TFSH 2KHAA 3SBWC 4QOTA 1J10A 3D52A 4MNQE 5DI8B 3OKMB 5CCGE 1TKWB 1R3HB 4ZTEA 4HGWA 1ZGLP 1WYJA 2DQ6A 3PPSA 4TSAH 4UI2A 5H2BA 3M32B 2PO6C 4MKTA 4IOSD 4JG1H 1LE9B 5IT2H 2X1BA 2ICWA 2W01A 4HTIA 1CC3A 3IMSA 4ID8A 5FYKL 4ZLNA 4HZAA 2J7WA 1KJMA 4YX2L 1OMSA 1FNSH 2OXGB 3PYGA 3DSNB 3T1YF 2OMTB 4GBOA 4DOHE 3O6FC 2CJBA 5EO9B 1D7DA 1WZLA 4OJEH 1KLMA 3DC0A 2R9HD 1IGCL 4NUMA 3ALXA 3T8XA 1PKQE 4PJHE 3IKCA 1F1AA 3RU8H 3RB4A 4NZ8A 4YHML 12E8H 3N50A 2O01C 1CUOA 3K6FA 4FJYA 4YDXA 5E3PA 5CYJA 1BFOA 2B15A 3GBML 1CLOH 4GKOA 1EFQA 5CM1A 4M6NH 5GISH 4IRSB 2HFGL 2CBOA 3MEEB 5EH1A 1J18A 1UOVA 4XNZC 5IBUG 4A7TA 1X4DA 4HUWB 3SCJE 1VQOS 4M7LH 4K5OA 2R0WH 1EHLL 3PP3H 1LLAA 5GMEA 1KN6A 1QUVA 1A3RL 2VFSA 1RIVL 3V7MA 4LVOB 4PP2A 4UQAA 1KBWA 5D1QA 2NOYA 3NRPA 3OC5A 4NP4H 2O30A 2V33A 3B56A 1BM3L 1F60B 2AJ4A 5GGVL 4OM0L 1K2DB 2MNUA 4IKNA 4JV6B 5D2NA 1AY1L 3IWUA 2K06A 1CLZH 4FF3A 5EOCL 4RX4D 3BXNB 3R06B 4RMUA 2JK5B 5DEGA 2HJKB 1SN2A 2XBZA 3BUPA 4LP8A 3DO7A 5IG7B 2OEJA 2OTWA 4TY9A 3U1SL 2VXTH 1MY5A 4LPXA 2WWNA 1PIGA 3HS0C 4EKJA 2VAJA 3IEAA 2V68A 1AH1A 3L4YA 2VABB 3BUQA 4AH2A 1LWCA 3AXMA 4OQJA 3L9BA 3W81A 4Z23A 1ODAA 3G5VA 4PJCB 3RWIA 3U9PL 4YOEA 3W5XA 2BOPA 2I60H 3BPNB 2XA3A 1JK9B 1PEZA 3U0WL 2D3UA 3VHQA 3DUUB 2AYBA 1HNWJ 4PJXE 3TN0C 1KB5L 4JFQB 1EXUA 4HOZA 8FABB 2EVJA 4GC7A 1UETA 2EXSA 4NI2B 3QJZA 3P9WB 4HDIA 4D7VA 3MOBL 4FNSA 5KG0A 2WKGA 4AL5A 1FXLA 4POZC 2X9ZA 2F8EX 2HTKC 2VL1A 3BH9B 3EFOA 2QGEA 3WYRA 5DG8A 2KZBA 5DHYA 2Y06H 5LKNA 3P45B 1T20B 5DHMC 1KIPA 4UTAA 3TJ9A 2EO9A 3G5XB 1VFAA 1EIBA 2BQUA 4XZ4A 3NGKA 2DQCL 4OZ4A 3GYRA 5CF3A 4M5HA 3D39B 5ETRA 4EUPG 2OTJS 3LH9A 3PHQB 3QULB 5C0EA 2ILLA 4LPTA 4YPJA 3FT2B 4ZSOB 1ODUA 4A48A 1HBNB 1U48A 3W57A 2WXNA 2LTQC 1E4XH 2F7QA 4JKMA 3NJFA 2HWTA 1WNEA 4G3IA 5IEKA 1SFDA 3ARQA 4YL4A 2ZOKB 4KXBA 5LGJB 1CC8A 2CADA 4XP5H 2GMHA 3HF5A 2DLHA 3MRPA 4O9HH 4A7GA 3C5ZC 3QQXA 4WSJA 1DBML 4X83A 3EICA 3BVNA 1M5KC 3O3BB 2PEHA 5F7WC 2BSDA 1BFTA 1JK8A 1Y07A 1RAEB 1L9NA 1LMIA 3GXFA 3OTBA 2IDTA 1A4JB 1C1BA 4YPGB 3M46A 4GRLB 2OK0H 4KKLD 2NX5A 2YPLE 3L95A 3GWJA 4G71B 2WAQD 2XSJA 4EU0A 3MRJA 4YFLF 4V1DD 43C9B 2QV6A 5KFAA 2VDNL 3MM7B 43CAB 3D2UA 1YX2A 3JTSB 5I6XC 1FFPA 5DK2B 1ND0A 3RKPA 2HFFB 4BK5C 5LMNJ 2P49B 3IDYB 2F5BH 4JFFA 1NIEA 4P2RD 2XVGA 4PJGE 5BS0D 2WVTA 5FO8A 2JFKA 5CN1A 3GTTA 2RFXB 3ZHFA 4HJJL 4K7PY 4AVJA 4B3TF 3BP6B 3D48R 4IR9A 2FH8A 2NY4C 2GCYB 5D93C 3TEGA 3EDQB 3MJ6A 3B37A 1CSJA 3HC0A 1IM3B 3MV01 1UA1A 5CBAA 1B0TA 2NY1C 2I5JB 2DITA 5IKCB 4WNQB 3SOBL 2AMUA 1Y5LB 3LKOA 5AZ2L 3BW9A 3AHPA 3R8QA 1DVUA 1A7RL 1S7TA 3BKYH 2E5GA 1MH5A 2XG8A 4JNXA 1FORH 1ZTWA 1O7VA 3LH2S 4HH1A 4W4MA 2WQAA 2E7VA 1JPTL 4R8UA 2E4FA 4OYXA 3OTDA 3QJVB 1WG5A 1EBAA 5D7HA 4HJUA 2IM2A 4S0SD 1UM4H 1Z3GH 2J20A 4RAUB 4QPTA 4NPKA 1SQMA 4XO3A 2AK4E 4ZDHA 3CFTA 4O02L 5E9AA 4ZUSB 5IHUH 1CGSL 3AD9C 4PWKA 4U96A 3GV5B 3PAYA 1A7NH 1X4XA 5F9DC 1WP6A 5C0RL 1VR6A 2FNBA 4YIQA 5FO7B 1A7QH 2X1QA 4Z7WA 3TO2B 1K72A 2LE9A 2XT1B 3EBHA 5DJ6B 5EUOE 5HROA 3WU1A 1TQTA 4FG0A 1BY9A 3FYEB 3HHLB 1GOFA 4ALRA 2P8MA 1K4CA 1B0VA 3A4FA 4PXDA 2C7FA 3CN3A 5ITBH 3IBCB 3D87B 4MS8C 3OHAA 3NUKA 1R31A 2E56A 3TA4D 2YD2A 1CFQA 4M7JH 5F72S 3CFKA 3JVGC 5LXGL 1NINA 1SH0A 4LKCA 3TX8A 4KTEL 2J6SA 2BJ3A 3ATFA 4FA8A 1NKEA 1N32F 4OUUA 4MSWA 3B7SA 1OGAE 5A6IA 1GGBH 1XGQB 1HHGB 5KG2A 2NUTA 2IJFA 3R6LB 1XIWB 3G8SA 4XMTA 2EC2A 5DUPL 4MIWA 1FJGF 2ZP0T 3CH1A 5I74C 5JR1L 2XLIA 2VGLM 3HN8A 3O0RL 1D09B 2DM4A 4U7UD 1EXHA 2APOA 3GWCA 5E6YA 3PIPQ 1EMTH 4GOKC 4AXJA 2W4PA 3CDGA 5FUZH 2XU9A 4V2BA 2J9EA 3O8WA 4PJAB 4BUQA 2AJQA 4MD5B 5ETUA 1BREA 1KPUA 2H32A 4NP9A 4WXOA 1JGEA 3U0PB 1QEXA 2XY2A 2YNFB 2FR4B 2R7QA 1CFBA 4J4PC 4F2MB 1VQSA 2D7OA 4NNPH 1OJ4A 3LS5L 1VAHA 3CSGA 2GV1A 1FEHA 3NCJL 1MREL 2VLKD 2ZJSH 4DFIA 5IQQA 1S77D 1YJRA 4X4XB 5SWSB 5T3ZL 1DUZA 1ETA1 5IMMA 3HLKA 4WO4D 1HEZA 4F7TA 1NB2A 1Q8KA 2VOPA 4Z5RB 2H2SD 1KIRA 1G1CA 2Q3AA 1FN4B 2RALA 5AE1A 2C26A 3G6JA 1I1YB 1BWVA 3MHYA 5GRZA 5IQOA 3MLVL 3HZGA 1F2GA 1R0AL 3BR9A 4PCQA 1W72H 4ZXBD 5EMWA 4PTUA 4NRXA 4PBDA 6PAZA 2XMUA 2GSIA 1XO8A 2BSRB 1RLBA 2LAAA 2XN9D 3LN4A 4NGHH 4Z0XA 1GSKA 3TBSA 4NLQA 4D2NA 5J9PA 4N9GB 1X5FA 2BP5M 4KDTC 3QT2A 3L81A 1WD6A 3VXTB 2M70A 4A8XA 2AKRA 3LEYH 2D3O1 1QAJA 1GGYA 4EI5C 4I5BB 4Q6IB 1YPZB 3KJ4B 4RFEB 4L0YA 5DDQC 1WC3A 1NEZA 2ZG2A 5TDNB 3AG2B 2ICEC 2W38A 3T65B 2OQJA 4ZS7H 2GG1A 1MNNA 2VDKB 1QSFE 1F90L 3FN0L 2UYLA 3MV9D 4FYSA 4M02A 3IFOA 4HULB 2MY7A 3ISND 4I4BA 3WKYA 4N0YH 3CD4A 3S36L 3TYFA 3CDUA 3FAXA 4G7VH 4M9PA 4IKIA 2PMHA 1RSYA 3WX8A 1U1PA 1WWCA 5J1PA 1Q9WB 1FZKB 2HVKB 1EETB 2HNZA 4ONFL 2KVQE 4U7KA 4MB1A 1GMWA 1AS7A 3BAEH 6FDRA 3IRWP 1XMOF 1QLEL 4NZUH 2XG4A 1CT8A 4JO2H 4TXVB 5IW1B 2ZKUA 1KGYE 4FQ1H 4U1NA 4YDIL 5B08A 1W0WA 4HALA 4X5XB 4RKUC 4HI1A 1XVSA 4AUJA 2EP6A 1VCAA 5EG6C 1UWEH 4MX7A 5I6KA 4JUTA 5CQGA 3FONA 3HN3A 3HG1D 1JE6A 3MXVH 4JGMA 4AQ1B 1U26A 3QDME 2DCLA 1TUVA 1TO5A 4GPVA 5EF0A 2V50A 1TTHB 4HACA 4Z6AT 2P6TA 1FNOA 1JLGA 3VFRA 4KGVB 4MYWB 1RT2B 2VU5A 2FO8A 1T9YA 3GR0A 3D05A 1CU4H 1OTTC 2H47C 4M6MH 3ZKXB 2YSSA 3RUGB 4CN4A 4KH0B 1C7SA 2DR8A 3GMMA 4AM0B 4BWWA 1IJFB 2XQYK 3L3HB 3X3FH 1Z5HA 1QBLL 3O11B 2DDQH 4N8CL 3FU0A 4S0TD 4Q4IA 5GS2H 3M2VB 4U8VA 3HAEB 1QVYA 5DDHB 1NZAA 3RIFF 4TS6A 5DJZB 1UWGH 1CXHA 2A9NH 2XYPB 1U1MA 1KBKA 1Q38A 3PW5A 2BCMA 2DJWA 1OANA 3PABB 3IPBA 2DCUB 5D4JA 2HZVA 4QU6A 1KV3A 3QFJE 4YK4B 4K2UL 5KG9A 4K7PX 4ZK8A 5JA8B 2GVZB 1CFVL 2D7MA 3BKJH 3MECB 1RIHL 3Q7JA 3FRUA 3BZEA 1VFUA 1HQEA 4CLTA 3BDXA 2CCLA 5IFMA 3D08A 2W94A 2ALWA 5E9NA 2WBJB 3OR2B 3RU0A 1DZ5A 4GBXD 2COQA 4JI2F 5DD5H 5C0CA 3OKLB 4DEPB 2JJTA 4JFZH 4UDTB 3Q1SH 1A6UH 1C16A 3DX7B 4JY4A 2DH9A 5IQ6A 4OZIA 1FJGJ 1DVFA 5L1LA 5F96H 1CJTB 2VM4A 4CUCA 3K8LA 4JDZB 1HOCA 3L2NA 4Z37A 3HK2A 4HWEL 2XBPA 2WSEC 3NNAA 1PFCA 7TAAA 1M6UA 2ZBPA 4KX8A 5AVWB 1H2VZ 4X4RA 1J8RA 3OMNB 4KK8C 1M2VB 3V4PA 4IRJD 3D6TB 4N8VG 1KCUL 3CU1A 2BVQB 2BV3A 1OCRB 4A63A 4KJIA 2XWEA 1YEHH 1OV8A 4UT9H 5E8EB 5KFCA 4I0PB 1DS6B 3WD5L 2P5WB 3BO2A 2D7NA 3FQWB 2WQUA 4ILDA 2R59A 4BJLA 3QEUB 2E5EA 3U7WL 2GJJA 1F5BA 2ABYA 1I94F 3LV3A 3QFGA 5BMFL 3T9ZA 1SHSA 2CO2A 3PHOB 3KHHA 4AITA 2XIIA 3KK3B 3IYLW 2CIKB 3MBED 1VC6A 3L4WA 1ETJA 2AEOA 5IREA 1N6QB 3APCA 5FA3B 1DDTA 3UP1A 5D0HA 2X5PA 3ECBB 1AC6A 2CNKB 1UQSB 3I6PA 1LEKB 1GC1L 4YSUA 2OAUA 3QIUD 2CDRB 2OD6A 3VFNB 5HMYA 4HZ1A 1PY0A 5KFLA 1HOEA 1OXYA 2GBVA 2IWEA 5EIQA 4LEOA 3U2SB 3PJWA 1VDHA 3VFSA 3MRHB 3QDGE 4ETZA 4F33B 2E1RA 3EYOB 2IBGA 4KOCA 2B3RA 5I17A 3FC8A 3FGVA 5JW3H 2FJHA 1VFBB 5DQDH 3D50A 4AW4A 3BYPA 4HIHA 4FVCA 4O3NA 2HMID 1F6TA 5C5JA 3QUYD 1UWAA 4X9FA 1JZ5A 1ZTTA 3V8OA 2D3NA 1KCVL 2W81C 2KFNA 4K7QA 5KFJA 2HG5B 3CZEA 3LPGA 2MHNA 4MGXA 1DOAB 2V0AA 3D6GA 5CGBA 5GS2D 1BBDL 3NSDA 3HULA 5I6OA 1ZYQA 5F7AA 1HYRC 3F04A 2VR3A 2HS3A 2OYMA 3CDZA 1SOKA 3LEXB 4IGBD 2XYGB 5DJXA 1U3HB 1ETZA 2ZKWA 1GYAA 2IM0A 1SC3B 1PZSA 1LO3L 3BDEA 3WMPA 4BH7B 2DHSA 4WEMB 2W9BB 4WZQA 2YKPA 3C9NA 3QJXA 3LZFL 4RGOL 2D31A 1TVHA 2AK1H 3MXWH 1JXDA 4QHKJ 2YK1H 4DAGH 2YOYA 2E5JA 1U8IA 2Z92B 3HTLX 1XWLA 1PYSB 3ICLA 1TK8A 1HZHL 1RK1A 2JHYA 4K2XA 1E4WL 5L7KA 2CJXB 3CJJA 5FLXU 3VB8A 1CGUA 2XBDA 4F3FB 1CLFA 1Y7PA 3FSOA 3TIEB 3PL6D 3RWDB 4ZD3H 5I0YA 1D6VH 2EABA 1K47A 3M1VA 2CDFB 1XF2B 1AGDB 3K58A 2FJVA 2WLYA 4MJJA 4B41A 3ULVF 3CNKA 5C0JA 2R1YA 2VQ1A 3STLA 2ZUSA 3VXRB 2VO8A 2YBRB 2EXUA 3QWRD 4BUGA 5DRZA 3CVHL 5D7SL 2RAQA 4Y34A 1YJNS 2E9JA 5AXNA 1AUSL 4ES1A 5LNGA 3ARYA 1T4KA 2UP1A 1SUQB 2MB0B 1B4TA 3DOSB 2RU9A 2AXWA 4G7SB 3VXUB 1HNIA 2RQ4A 3MMAA 2G2RB 2X4UA 2BRLA 3MMCA 1LXMA 4WU3A 3ZTNL 5KT4A 2WTRB 4MZ3A 3DMMC 3MAAA 2LFGA 1S5HB 1RUPH 2FX9L 4RGND 3ZKNC 1IEHA 1P1VA 1QSZA 2MZJA 1JUFA 2OZ4L 2DH8A 2YWGA 4ZIVA 2PCPB 3DFEA 1S79A 1GC1C 1U8MA 5E5MB 3Q3GA 3V5KA 3RY6C 5J1NA 4KFZC 4LCIL 5EZIH 4PPTA 4BZYA 3ES6B 3QDJE 3U79A 4LMZA 3A3OB 2M8HA 4B9UA 4PRIE 5CGYC 3H20A 2XQBL 1R5WA 3IMRA 1LO2H 2E27L 3L3GB 1XF3A 3RFZB 1XCTA 1JGVH 1V7ML 2BXZA 3MRRA 4UZCA 1UZDA 3OKOA 5HI3C 1QUNB 3TF4A 4MT1A 1FPTL 2VL5B 5C0BE 3T3PE 4CGTA 1H6FA 5E8OA 3IDXL 3OPZH 3OKNA 1U25A 5B0AA 1FL5A 1T05B 1A8JH 5D71L 4JI2J 5EOQH 2IC2A 3CX5K 3I9GH 4UU9A 3RLSA 5D7KD 4IH5A 1F8TL 1KFSA 4BWMA 3U1LA 3NG8A 4HWZB 3FH5A 3LNGA 1XL4A 3KPRE 1U7LA 2EH8L 2E7HA 4LREA 1AZUA 2WWKT 3MM6B 2OXHA 3VG9C 2WOMB 5HYJE 4H26A 4IIQB 5HVHB 3DDKA 4LSTL 5F0JB 2HAZA 4E9XA 3E6HA 2VG7B 3Q2CA 2XVKA 5EPMB 3VX0A 1F6LL 4QRPD 2GITB 2G2PA 2VBZA 5KZCD 2QIFA 4JM2B 1IKNA 3GUFA 1NCBH 5D78A 3ULVH 5I1GL 4M62L 4HW6A 4MJIB 2BIMA 3T0BA 3MYJB 1UASA 2GIMA 5DJ8B 4N4YB 4QXGH 1I94J 3LKNB 3CDAA 1FHTA 4O3QA 2RB8A 2EDEA 3DDGA 4ODTL 5JW4N 5IK3B 4F7PB 5D6CB 3KLIA 4CLLA 2XPGA 4G43A 5HHOB 2VN3A 2OO4A 2Z2MA 4L5FE 5G0RB 5L8LB 4Q2ZB 1DQML 3ESVF 3GGWA 1UJ3B 5I8KH 4CKVX 2EVFA 2CJYB 4FTVA 3AT1B 1IGYA 4RL1A 4YLQT 4S0HA 4OZFB 2EBGA 4I3GA 2YXWA 4R4FH 4NCGB 4X9GA 2XRAL 3HFMH 1PBYA 2APTA 3BH4A 3WXWH 1BYNA 2VDHA 5KG5A 1SLVA 4P2OB 4KROB 5FDYA 3SMZA 5T5NF 1E8WA 1I9JH 5EX3A 3EYFB 1CDGA 2EICA 2X4OB 4ED6A 2OAAA 1J5EF 2HKHH 4LCWB 3DIFA 5B1AB 1L9RA 4G70B 4JDEA 5KN5B 2DMCA 4KXZH 1NAKH 3L7UA 5I75C 4TVAB 2CKBA 4CH1A 2HPUA 2IV8A 3IB4A 3MMEB 2QDVA 4Y1SA 1IKVB 3QZWB 2AJFE 2YUZA 3DOIA 1F18A 3GBNL 1J1PL 3P2DA 2XTJB 2JH2A 4W4NA 4FKHA 4OLUL 3CHQA 5D2NC 2Q8BH 4E9QA 5A76A 2X0VA 2QKIA 4DH2A 1I9RL 4G5AA 5EEUA 1ZBTA 5CABA 3SDYH 4EUPA 1KJ2B 4XMLH 4DN3L 2DS4A 3RJMB 3IN5A 4QOKB 5FO9A 4HIXL 1HIYA 3E1ZA 3K2KA 2P8PA 4DS4A 4BSJA 4JFTA 4LAQH 5GGTA 3DNCA 4DLGA 1C12A 4KQ3H 3KLFB 5F1NB 5KSBA 1DJXA 5F6IB 4RX6A 2XKUA 1MFDH 1I1AA 2VYRE 3DIDA 2XKSA 4WGWB 3QFDA 1NMBL 4RE1A 2C3UA 2IMOA 2NY6D 3VQTA 1ZT4A 3T0EE 5L8JB 2CKNA 1RSFA 2EKYA 5KFTA 2JLFA 2CA4A 1AR1D 3ZKSD 1KY7A 4OJ3A 1AROP 5DEJA 1RUKH 4C58B 4P23D 3LKRA 1Y18A 4TKTA 1I3RA 1MI5D 3EOTH 5BVJB 3T2NL 5IESH 4K8RA 5ITFB 1B0GB 1A7OH 3D33A 5HHVH 1MU2B 4C0BA 2J7LA 4TU8A 4JHWH 4GO9A 2VDRL 2X05A 5KYXA 3F6JA 5FKPA 4DV1F 3ULVD 1SKRA 1XCWA 3QFWA 2VICA 4OZGE 2G3NA 1WI8A 3ZUNC 2G2OA 3WE1A 3PQYB 3W2WA 3MRMA 2ZHOA 2J12B 5CD4H 2EEFA 2DBJA 1ITCA 5AW8B 1S49A 3DM2A 1HL8A 2XX1A 2GC7C 4XK8C 4AQZA 1XBRA 3ZDYE 4Z3FA 1J5OA 1I31A 4PB0H 4MFBA 3MJ9L 3O3DA 3D28A 4HH9A 4RUHA 1T2JA 4PLJD 5HNOA 2CO3A 3DI3B 4OY7A 2I8EA 4BSVB 4A7SA 1GT8A 3FKUS 2JH3A 2B1AH 3RX9A 4HKZA 3SQOH 4JDVA 5I6LA 2P3YA 5JA9A 5A0YB 1WTFA 3AB4B 3GB7A 4ANUA 3VFUA 4PJ7F 5JHLH 3P5BP 1MCKA 1K1SA 5ETLA 4ZLLA 2FVQA 2J7KA 3ESMA 3FDSA 4S1QH 1EEZA 2VUYA 5F0PB 5HGDB 2FX8H 2HZAA 2V4JA 5F89B 3KYKL 4OZ2A 3DXAD 2C3HA 1SXNA 1AO7A 1GYUA 3DRTA 1DP0A 4ETQB 3TFBA 1RUAL 4HD5A 1RULH 4C56A 4M7LT 1YQHA 1BECA 2KHCA 1KN4H 3HB3D 3WDJA 1IBLF 2QQKH 3GMQB 3EGWB 3T1HF 3LD8C 5JPMA 4P2XA 4FF2A 3T2PA 4A8WA 3V4UH 2DQDH 4HXAH 5HYSA 1BZ9B 3FQUB 4GIPD 4R0EA 1T1WA 1JLFB 2YIHA 5TGBA 1K0VA 3NPSB 3X1BA 2HFEA 2A83B 4X4SA 2CDQA 4Y19D 5FOHA 5MEND 2Y5EA 3LHAA 2IH8A 1EKRA 4GO5X 2CA3A 2CXEA 3L3IA 3VWKB 4KXCA 3RGVD 4Z7OE 4TMPA 3D1OA 2DXDA 1XGUA 2VITB 4MAYA 5I76A 3QUZB 3E3QE 4LBAA 1UVNA 1JHLL 1OW0A 2N0KA 5AW2B 1S1XA 1MY7A 4WFHD 4FYVB 4Q0BA 3L6FB 1X5IA 1X5XA 3C6LD 4U3SA 4PBXA 1JLCA 3Q8EA 5IROA 5SWZB 5HGUA 4IUFA 1JL8A 3D85A 4WIQA 2VMFA 3EHBD 4XMPH 2ZC3A 2FCBA 4WWKD 2APFA 2EDFA 1EZUA 2CQDA 3KJFB 3QR2A 3L1OL 4X4ZA 2QA4S 5JW4M 3W82A 1BVLB 2Y69B 3MNVB 5IB3A 1J1OL 1U8JA 5GS1A 4KMTL 2ZH8A 4D7BA 4R96B 4Y00A 4YN3B 3K59A 3NABH 1IAKA 4JY6A 2VR8A 4UTCA 1VFOA 2MMYA 2APBA 4FFZA 2FJEB 3B4MA 3IFLH 4L29B 3BV8A 5B39B 4JMNA 1HJCA 1Z0MA 4BFKA 1MMDA 5J2MA 1J5EJ 3K0JA 1ZWIA 3W3SA 3H0TB 3U0TA 3JAMY 4V1DB 3V4LA 2BJ7A 2DB1A 4FQIL 3UTQB 4AEHL 1RZ7H 4NN7C 4B9ZA 2P6SA 4IG3B 2OMVA 3GJFB 5H94A 3W1YC 1I8UA 3BQUD 1MWZA 1NGXA 4J9SA 1M7DB 2ZE0A 1ZLSL 5D96C 2F15A 2DHXA 2B5IB 5EC1A 1MXDA 3DOLB 2V5RA 4CZCA 2PNDA 1KJ3L 2FSEB 4ODWA 4RIRA 2FIRT 5C0AB 3RA7L 3VGEA 4KVCL 1UL3A 3CJ3A 1XMWA 3VFMA 1ML0A 3SE9L 4RPFA 1KJVA 4RW6B 1HYSD 4XAWH 3CO9A 3AFLA 3NBNA 2B8QA 3FFDB 4H8QA 5HDQL 4ZW7A 3QZ7A 1O6SB 4IU2B 3ILOA 1OPOA 3VXSA 4DV4F 4I88A 3VE0A 4NMXA 1PZ5A 2DQTL 1EJOL 2X3CA 3F00A 1GYWA 5LGHH 3VI4A 2HSEB 3UTSB 5PCYA 3SIKA 3D3VE 2QL1A 5FPIA 4LLVB 5DRXA 2VB5A 1RWOB 2HN7B 3VGDA 2LA6A 5KBDA 4MCZA 2DIBA 4MMYA 5I5RA 1CBVL 5EUHA 3MUTP 1ZIAA 3WG7B 1IVLA 1TFHA 1LVEA 2QPEB 4BCAA 4DKFH 3BPLB 3F62A 4JZJA 4MRBA 5L7XL 1PLAA 3EVMA 5FK9B 3ZZ1A 4BFIA 2WJ5A 3BAKA 5CNHA 4N56A 3WDIA 3SPVA 4OLEA 1LWFB 4A7UA 4JL1A 2OSLA 1N4LA 3MPVA 1NLKL 1QRNA 1OM3L 1QTSA 2BDPA 3NDYE 1SH3A 2BHZA 1BD2A 2P24B 3L3OC 5CZXD 5CA5A 2P5EE 2R7TA 3D18B 1JHKH 1RL1A 2YH0A 3O2IA 5JJBA 4OCMC 1AQMA 3T8MA 1TP7A 5JYMA 2WMPB 4WU5B 5DMGD 1MRFH 3P3SA 4LLYB 5L2KD 4G6FD 3D09A 4TUUA 2QVIA 1NC4A 2V6HA 1N59A 2YSTA 1BOGA 1V10A 2HURA 1KQFB 1S48A 5IF0A 4DL5A 4XPFH 2W5PA 3DUSB 4YNYB 5F41A 4ZFOL 4XBPB 5F93C 4C8MA 4FBUA 3P2TA 1PSDA 1U91B 4QU7A 1C0TA 3LRSB 2OPQB 3FB6A 3HZVA 4PRBB 3RVTC 2HHXA 1TZ0A 4TXSA 1W8NA 5TK4A 5A40E 3ZT7A 3WELA 1WG4A 2LA4A 4WU7A 2H1LM 1NSNL 1QBMH 5ACHA 2YX7A 3M30B 4ATWA 2Z1PA 1B7YB 4Z77B 2FWUA 3CSYB 3OD3A 2C9RA 1IBLJ 4TN2A 4MXWL 2W1NA 4C6AA 1BMWA 3HT3A 3SV4A 3D6MB 1IGIL 3T1HJ 5DVKA 3BJ91 5F7NC 3N0AA 5IIEA 3Q06A 3EUNA 3L3JB 3Q2TC 1L9TA 4WZMA 3RTQA 3GSDA 1ZETA 4ANXA 3N1PC 3F0NA 3DI6A 1HSBA 2NNRA 3KMDA 5EU6A 15C8L 3I50L 4E68A 3BEWA 4CO2A 5ANHA 1DN0A 5ALBL 4Z7NB 3EH2A 2YRZA 4NUJB 2V8LA 4CILA 2CQ1A 4GKJJ 2X3AA 3OSPA 1GH8A 1UXWA 2BSSA 1LW2B 4XB3A 1QFUH 4WKZA 4B3OB 2KQNA 2XZQH 4HFWB 3RZWA 4BBWA 5I19L 3C60A 2HCZX 1O6TA 2VQ4A 5E4OA 3F7YA 5EORL 2HVZA 4ZPAA 1AT1B 2HEKA 3PWPB 3HPLB 4WO4B 3PLYA 4G6KH 2WPGA 2G9HB 3A67H 4KRPD 3JV0A 5DA4A 3NP4A 4AY0A 5DJCB 1X6NA 4BEIA 5FB8A 2AEMA 4ECVA 1TFYA 1N6UA 1X7SA 4GS7C 1ACYH 2J8UA 3QXDB 5DK0B 1RZQA 2R2BB 3TFKC 2WLIA 4M5TA 1GZPB 3VRIB 3WY3A 1W7WA 2Y7OA 4A39A 2ORBL 3E8VA 4HJ0C 3H42A 4W9IC 5KYUB 4ZXBB 4QCLA 4C4KT 2VG6B 2VSCA 3UTTB 1GGUA 3ROLA 3VUAA 4R3SA 1U42A 2OX5A 3B2MA 5I6PA 3WNIA 4DWIA 3FU7A 3BT0A 3PWUB 3QUHA 3LOUA 4NCC1 5IM7A 4Y1AA 1N0VC 5E6IB 1U8PB 5SX5H 5C7XL 4KKCD 4X66J 4Y16D 5K9OB 3CCHA 1MAKA 2GEEA 4EO5A 4AWJC 4Z76B 3DDIA 4UAOC 1S7SA 4N8VA 1YK9A 3SODB 4UZUA 5AB9A 4OV5B 3I0SA 4ZPTA 4ZVSB 2J5LC 2VONA 3MBWA 1A4KB 3AQYA 3O8XC 1D9AA 4NRTA 1YMMB 5KJRL 2IF7A 3E2EA 2AGQA 1VBYA 4PJHF 5JO5B 1KTBA 1QUPA 1UM5L 5E8PB 4XVUC 2MHAA 2BKPA 5E7FA 2RMLA 1WFUA 3GIZL 5BZXA 2R23B 2KXNB 4TNWF 2JCCB 5LXYA 1T89A 3Q1EA 3TP2A 4LHUB 3T6XA 5KJ7E 4TPRH 1YYCA 2DYPB 1ZHLA 2X4QA 1ZGLM 2Y0SD 1WKLA 4IU3A 4FFVD 3U02A 1T0NA 4LSRH 4ODUB 1QLRA 1QTMA 4MDJA 4DV4J 4C4UA 4NYLA 1MFAH 3A4DA 4WHYG 3WTYA 1G87A 3EOAB 3FOMB 3RKDD 3UL4A 5I66A 2DEJA 3ARUA 1WC5A 2XEXA 3RB6A 4OQTH 2BSTA 3LB6C 3EJUA 1H3PH 4W9JC 4ERDA 4TVPL 4EBQH 3BDBA 3EJSA 4Y5VA 2HWIA 3OGCA 3DYAA 3EDJA 1KOHA 5F3BA 1M4KA 1J0ZA 1HCYA 2ZKHL 2FZGB 5F8NA 1FH5L 4F58L 4OGYH 3ZYIA 3AMLA 4MJ5A 4YHKL 4YUEL 5AVYB 5GRVL 2VJUA 1MF2L 3FB7A 3WFBH 4NXKA 2OEKA 1CZ8H 5I3UA 1OAKH 3HKFA 1FJ1A 3U46B 3NGTA 4ZN1A 1YEIL 3LTOA 2MKKA 1NM4A 3P49B 4RFNC 5FYKE 1R27B 1QSLA 1S6QB 3UZVB 4KNTA 1I1FA 5LNDA 3AA9A 5FDWA 5CEZD 5KFPA 4YS2A 4UT4A 4QWWD 4OCYL 3WHXB 4PJXF 3QORA 5K59F 1HWIA 2D1CA 3J2PA 2VV5A 1GAOA 3QIBA 4I1RA 3I96A 2CD0A 5E5LA 2EVZA 3U36B 1JYNA 3VH8B 3N1FC 1TV6A 3CDCA 4F7EA 5AYUH 3CXFA 3IU3A 4NQQA 5AVUB 3VNZA 2BOBB 5IMLB 5EEYA 5HLFA 3SEOA 2ADIA 3FHEA 3SYZA 2H6UA 2X6MA 5DGQA 2XB2D 3DX6A 2XMVA 3DOMB 4JG0H 3E01B 4LQ3A 3KXFB 1S57A 4XWGH 2CBPA 4DG1A 5C09E 2VR6A 4HKJA 4XNMB 5GRUL 5HDWA 5DVPA 3L7EA 2A74B 4L9LC 3MLYH 4G9FE 2Y07L 3ETOA 1MJJA 3FB5A 2PTTA 5PAZA 3IBFB 3TNVA 2DB8A 5KFOA 4PQUB 4HV8B 5KG3A 1C7TA 4LFHD 4TYUA 1MNUL 4NEYA 2GK2A 3OKKB 4I3RL 3FUKA 4IRZL 5IFAL 4GSDH 4WGVB 4KXDA 3GLEA 1W0YT 4DPUA 5KVGE 4DX7A 2OKMA 3QJQB 5GGRY 1BZEA 1R3JA 3L9RB 1RHHB 4K50A 1FCCA 1HMVA 2G2NA 3I75B 5TARB 2D7TH 2LLZA 4YUDA 1V3ZA 4L1BA 3VD3A 4NQVA 2HT2C 4OI1A 3FT1A 4TU7A 1LWRA 4NLAA 1G6RB 1LK2B 4LL9A 4ACPA 1A64A 1AG0A 1E3ZA 1NIAA 1OARL 1OLZA 2YEQA 1F6AB 1IAIM 1R24A 4H0IA 4QYAA 3EOBA 1N6QH 2QLWA 3M8RA 4PAAA 4ALAL 3CWGA 1MLBA 1X4YA 3TEYA 1F9HA 2KRBA 1ZHKB 5L39A 1YKWA 1NK9A 2OW6A 4IDJH 4U6XB 4I85A 1ZM9A 4YHIB 3W5MA 1J0KA 2AEFA 1IR0A 1I1CA 4HAKA 5A7EA 1FWLA 3TVZA 1CFTA 1U47A 3MLWL 4PJGF 4L9DA 4WP3A 1KYOK 3KPLB 4J3XA 3OSNA 1A1OA 2E5HA 3Q0HA 3KLSA 1QO3B 2EDDA 3MURP 2PPFA 1D5MB 1N36J 1KYDA 1PLCA 4I18B 4B50A 1WSRA 2KLRA 3TA3B 1S5IL 1OP3K 4X80L 2Y22A 3HVAA 3MBXL 4UT7H 4XC1L 4MA7L 5JXEA 4FP8H 2Z30B 1YN7B 3JBG7 1AD0B 4JRXD 2ZE2A 1RZKH 2GY7B 4B0MM 1E0OB 1E9OA 5J57B 4J9KA 5FLVA 4F4YA 4K7FB 1TJHH 1GJWA 1RPQA 4MNQD 4B5ZA 3MLTA 1KVKA 2IGTA 2K7QA 3G7TA 4H1LB 3R7SB 4KPYA 1J05A 3FO0H 3GBEA 2VDLL 4K3EL 4P5RA 3CN1A 1EO8H 3IAQA 1F4WL 5F0MB 5CCKL 2XPYA 4M5MA 1JJUA 2NNAA 5CU9A 4DFHA 1FRGL 4X2UA 3WBZA 5GAHU 1P84K 1CTMA 3F84A 3IRXB 3NJJA 1JZGA 3QCVH 5GRVK 1CXEA 3AJ1A 4ZTPH 1BVOA 4IIZA 1DQJB 4AEIL 1E6JL 3SQBB 1PYTA 5BRPA 3CTRA 4WIIA 2W0FA 2NREA 3D3BJ 1GJIA 1SJRA 5GADU 3RWJA 3JUAA 3EYVB 4ISVA 2DQGL 3GLZA 2MXYA 3KLGB 1SQFA 2FC8A 4PWWA 1JNRB 3P9LB 3KBFA 4HA1A 3LN5B 2BSCA 4UOZA 1AQDB 1KACB 4BDPA 4NNXA 3F7VA 4PJEB 5DJDB 5GSVB 1B4JL 3HE6D 5KSAB 2JJVA 1D9KD 3FT3B 4QXUH 4CKQA 2W0KA 3E8OA 2U1AA 1SY6H 2CPZA 4K8RL 1P5UB 2JKIS 2XG5B 4ENED 5HI7A 2OTLS 5D1XC 3O3UN 3M9OB 4CTAA 3DJRA 1IC5L 5IQ7L 2JI2A 4HCRL 3STZA 4S1DC 2ZYRA 4JFWA 4Z3GA 3JWNE 4DU7A 3NK4A 2VWEC 1WA0X 1SUJA 2J1ZA 4YB1P 4ALAC 1OKEA 3RHWK 3BJYA 3ENEA 1Z1WA 1P4UA 3V0FA 4AC2A 5L88L 4FHBD 3BR8A 1JRHI 1UP1A 3BPCA 2APXA 3RJOA 2DH2A 2CO7B 1S9YA 4YZFE 4C83B 3KPQB 4YSQA 4MQSB 1EEUA 3TQEA 3EDDA 1FFRA 1VGKA 2YXLA 3CVIH 2NXZB 1U02A 4OTXL 4KI5E 3QNXA 1HFEL 4JFYB 1WC4A 3FQLA 5BRZE 2IY5B 1CBKA 3N5AA 1INDL 4L4TD 1KEGH 1P7QA 2R7SA 4PG2A 4G8FB 4QAWA 4WI0A 1AZBA 4EDWH 4R0JA 4XZUB 1XMQF 5EBMA 5IMKB 4UBDC 4AKQA 1EB0A 1X4BA 5AW5B 4YGVA 3O5TB 1KNZA 3I6SA 4YHOH 5E5UB 3NTCL 3UJIH 1BPVA 3FRPA 3OKDA 4YSCA 2L41A 1K6QL 1Q8IA 4NN5B 4ZNEA 1G7LB 4CT9A 3C3LA 5AZEL 3SDXE 1HL4A 3FCTB 2O5ZH 4WK4B 1KBPA 2D69A 1XR9A 3DCAA 3ZZTA 3T9WA 2JB5L 4ZX4A 4N2BA 1LKZA 1AXTL 1UZ8B 2IANE 2O4EA 2NY2C 4QRPB 4NWTL 1RTDA 2IOOA 4NLDA 4N5SA 3TNNB 5KZCB 3Q23A 1XCXA 2V2XA 3M8OH 3H4BA 1JZ6A 1APSA 3WKMH 2QGBA 4RW7A 2XTLA 3VZHA 4Y4KA 5KSUB 3IJ8A 1EJFA 4KJQD 3HEIB 2NUHA 3F8UB 2EG1A 2MRYA 2WXMA 2A6KA 3RW7A 4FFYL 4L05A 3WFDH 4MAUH 1YWXA 1A5FH 4ZCLA 1CJVA 2BNQE 3SSGA 4GG6E 1NPRA 1BIHA 3KEHA 4OYOA 3BZ4A 2DTSA 3BH6B 1SBSH 1RT6A 1GAFL 5JLZA 1SC4B 2WINB 4K8RC 4NPYA 2YPLD 4DLEA 2ZSVA 4M00A 4OI7A 1GVIA 4CVUA 1TJGL 1XH3A 4TL4A 4EYHB 4CC4A 4FQCL 5B1JA 1M57B 3TZVD 2AJVL 2ZXEB 3IKKA 3KG5A 3PX0A 4FQ2H 3LCYA 1KDJA 5H9FK 1MELA 1M6OB 2L04A 5KYNA 4C11A 3GTNA 3DPBB 1N5AB 3LJ3A 4DPBX 4XB8A 2CYYA 2LMIA 4P46B 2AKWB 3M8QB 2WXQA 5T3ZE 1XF4A 1U8NB 1EX0A 3RVXC 3TBVA 1HQUB 1AP2B 3WUWG 3VQ1C 4PG8A 2IC3A 4TU9A 1HXMB 5KS9A 3L08A 3CUNA 1AJ7H 5FGSA 2L9WA 1UFUA 2ITCB 4FXKB 5GAGU 3BQ0A 3OAWA 1UZHA 1UA0A 1KJ2H 3P4NA 2BS8A 5DFWH 2OMBA 1G7MB 2V7NA 3ARDC 2XWYA 4XO0A 3T04D 4K3DH 3UVJA 4X6CB 1W72A 4MNGE 1WTLA 1F58H 3IFNL 3V0VB 2J1YA 4CC1A 4IS6B 1TR0A 2BVZA 1RFDH 4IK7A 2Z6FA 1B2WH 1EV2E 3FMGH 1UH2A 3MUGA 4H2CA 2CJUL 1KKHA 2J5AA 2HWZH 3BKML 3K1DA 1AXQA 1CDBA 1WIUA 3FHQA 1TTRA 4WUKH 3VYPA 1EQMA 1T7PA 3EGZA 5JPMC 4AVHA 2AK4D 4A04A 4P23B 2FL5B 3GHBH 2G5BA 4J39A 1OAXH 1ACXA 1UWXH 2FLMA 3MI6A 5DS1A 1MI5B 3OXGA 3UP6A 4J9OA 4IEFA 3FO2B 1GXLA 3JUZA 1AZCA 4YDKH 3DTDA 1HU8A 1F4YL 3P0GB 2D7PA 2WVVB 3F58L 3H6JA 3QIWA 5IQNA 2B9BA 1UAWA 4RMSA 4LLUB 2CHZA 1KHVA 3MODH 3GHEL 2ASYA 3PDDA 5A3ID 1IGTB 2NXNA 8ATCB 4FG6C 1DUYB 1X5MA 4JZOA 1OW0C 2UUTA 4J7CA 1S3KH 4YWGL 3FBEA 1HX0A 4PRHA 2CO1A 2ATKA 2UVEA 3ATEA 5EMYA 2W9CB 1F11A 3GKWL 1R75A 5DFAA 2X4TA 5IROC 2OUGA 3SBRA 4WFGE 2ZHBA 1WZ1H 3TO4A 4I1NB 4K23H 4M6OL 3QRPA 1NBZA 4NAMA 2YGOA 5GZND 4OJGA 3FUNA 4J8RA 1FZMA 5GS1C 1RZMA 4O5LH 2IM3A 3GYXB 1NLDH 3DGPB 1EIYB 4J5OA 2BYCA 1B3IA 4ZP6A 2CRLA 4JO4L 1NPNA 2Y3YA 2GO8A 2NT0A 2EE0A 3RZCB 2ESVA 4JI8F 2J1KA 3QUYA 3HI6L 4JFHE 2PXYB 5GGVY 3S5LA 5ACZA 1BQHB 2NNCA 2EIEA 3HB3B 4HHGA 5ICXB 3PJNA 4PS8A 4ERSL 1TVBB 4TL5A 4JVWA 2MKYA 4W93A 1JZEA 4HK0A 5DT1L 4FQHB 5E41A 2BRKA 1C4CA 3RG6A 5LSLA 4DV2J 4XC3L 1CS4A 2WO2B 2R4RL 1S6NA 2B4PA 3VQSA 2RD5C 3EF4A 3QC6X 2FGOA 3HJVA 4L1TA 1UA6H 3M2UB 2GT9A 5C0IB 4HU2A 2BP8B 2VQEF 2VSMB 2VF3A 1NBVH 2RBLA 4FFWD 4OY9A 3A8KA 6CGTA 2MZ1A 1NMAH 5TF1L 3AUWB 3OAZH 4IDKB 4YR3A 1NFAA 4I89A 5TE7L 4P57B 1V3LA 2ERJC 4Y5YA 3H54A 5HDBE 4TNOA 1EXGA 4O3PA 3WHIA 4NQDB 4HEMA 3S34H 4E9WA 3ZL2A 3PDOA 2BW4A 3CDBA 1B88A 2RMNA 3ZR5A 3C6LB 2HG4A 1NC2A 1X5JA 4LBEA 4NB7A 3WC0A 1IMHC 5H9EJ 1MHPH 1LP9E 1S6PA 5FOBB 3NGBC 2F8OA 3GSNB 4DUWA 4LKXB 1SJHB 3CCTA 1TU2A 2R4SL 3CZGA 3O2VH 2BUNA 3SDDA 1VQ9S 2KJWA 4OUOA 4U0QB 4YDNA 4UZBA 4XHJC 5DC2A 2A5UA 4HLJA 2M0GB 5E8FA 3RIAK 3IBWA 2X7LB 5DSCB 3MCNA 1RLDA 2BE2B 2KTQA 5K9JL 2C3PA 2GIFA 3TJAA 1QSFD 3D9AH 5DZAA 1Z7JA 3AXKA 4E5XG 1J27A 2O26U 3B7UX 2FVNA 4UT9A 1MCNA 1U6AL 4LFHG 2XGQA 3TA1A 1OEZW 2A73B 2X4RA 1MWOA 2ZCLH 3GPEA 1E4JA 5DHVB 4JQIH 2R29H 3T1WA 4GRSA 1TELA 5GMKa 4E2FB 3FQXB 1T0MA 1UGNA 1XGYH 2KPWA 1BHGA 1J1XH 3INUH 4NJ9H 5AAWC 3UJJH 3IR5B 2NCEA 4AI7A 2IADB 2YOCA 5FYJL 4IBYA 1P7BA 4IQHA 3VAMA 1OT4A 3MV8A 2B0SL 1KQGB 1M1XB 1IEBA 4MKVA 2P7TB 4GOSA 2KZ1B 4GYBA 4N68A 5HJBA 3OXLA 5AG8A 1Z9OA 3L4UA 4FX5A 2W9LA 4X6EA 3ZT6A 4MH8A 4A7VA 1DSFH 3QDMD 4ZVPB 2HGMA 3SCIE 4JREB 1VKXB 3W60A 2LU4A 1JZHA 2YKKA 3OF6A 1HKLL 4U6HA 1I6JA 1E8ZA 3N85L 4NQXA 1LNUA 1IKXB 3EO1B 2A6IA 3L7FB 4WUUE 2IVFB 5HY9B 3S2AA 3RTQC 3MJ8B 3VFWB 4CRJA 3H40A 1WTBA 4HUVA 2CLRA 2NTFB 3LKQA 5C0GB 3RJDA 3OAUH 3QRBA 3QUMB 2AQTA 4KJYA 3UBXG 1YLXA 1IFGA 3M17B 3DRRA 5B3SB 2QSTA 1Y10A 2EFNA 2RF2A 1QDUB 3MDFA 5D4NA 4R7XA 3H9SB 4GKLA 2ZPKH 3B4NA 3FU8A 1WIOA 3T3PF 3Q8YA 4AXIA 3PKMA 3AY2A 2WCSA 2K7PA 3QFJD 4YHNB 1H2TZ 1I53A 2VLJA 1ILSA 1RVFH 5DURD 1U6FA 3SZ2A 3H5SA 4FE9A 4J3OC 1PJ7A 5KAKA 1QVGR 3ARTA 1VJSA 4UM8B 5E00A 3R7NB 2ED9A 5T1JA 4U1JA 3E9UA 4TQPA 3UD5A 1L0XA 1T3FB 3FT9A 4XPCA 2FB4L 3TI0A 4Y4HD 1L0PA 3L2MA 5IBTH 3AU1A 1SF3A 5L2KB 1NTDA 4L37B 3GSQB 5EHFA 1C1CA 4XDCA 3H4DA 2C28A 1YG0A 3LAFA 2H41A 4P9MH 1BXNA 3GXNA 3NGDA 3OW2R 4TY8A 2ZBQA 4ES9A 2BEMA 3CSFA 2BERA 3JVFC 2V2QA 2V6AA 3F41A 2AJZA 1SB6A 2CZVC 3KJVB 1IFHH 1CLOL 4JHVA 1WUZA 1OO0B 3GV8B 4M6NL 4ZMYA 2FYVA 3EDFA 5DJ0A 5F8IA 2UY7B 2NR0A 1MCEA 4K5RA 4JI8J 2WYTA 4UMGA 2KYXA 2BENA 3QUKA 4CA4A 3BZQA 1Q90A 4M7LL 4OFDA 2JCCF 4I3SH 4ACTA 2OW7A 3FEYB 1S7VB 4XVSL 4ZPVR 4MMXB 1W2KT 1CO1A 3EZUA 3ZW3A 2GAZA 2CRMA 4CSSA 2JHWA 2TAAA 3FQRA 5DEFA 3SSQA 1SM3L 2UUDK 3MM5A 2FWOA 1AZVA 3KH3A 5D2NE 2YX4A 5EOTB 2ZUAA 4TUOB 5AUMB 2VH5H 5E5NA 3VGAC 1FIEA 4FQXB 1T89C 4ADIA 4PXBA 4UZGA 3KLHC 2VQEJ 2H0JA 1DFXA 3IDMA 2UZXB 3IPEA 3WN6A 4J5VA 3T1AA 3IJ9A 1M1HA 1XSJA 2A77H 5EWEA 2B43A 3QDGD 1FERA 4OT1L 4YS4A 1JGLH 4KRPB 1KSPA 3GI8L 3ROOB 5L6YH 2V9QA 1HL5A 3VFGL 4YR6A 2MQOA 4CM0A 4QHMB 4NO5B 2LQ8A 4KKBD 5HJ3A 3MLXH 1IKOP 4GLRI 2EC9T 4DVRH 4Y5VC 3OJUA 5C24A 4A6YH 4C8XA 2C4FU 5LCVH 2H5JB 1RJCA 4G7YH 4FQPA 4IBUA 2UUBJ 3R1LA 4UINL 4ZPVB 1S7RB 1E27B 2ZUUA 4KAQH 3GFUA 2AZUA 3AB0C 4GAYB 1OP5K 3W7BA 1QLFA 1WBYA 4BK4A 2DGSA 1QVOB 2XV3A 2XWBA 1NOAA 3VCLB 2IFXA 2Z4PA 5I3PA 2Y06L 1K4DB 1EDYA 1TYEB 1RZ8A 2OPRB 1U2CA 4A8QA 4CO0A 4M03A 1I7ZB 3EJMA 1OY6A 1KTVA 2VQTA 3L5XH 1AC0A 3LH2L 4XVJH 2VB6A 1YY9C 4P4KD 2XWJB 2NY3C 1DL7L 2QGFB 4DZ8A 3OV7A 3DX3A 3HO1A 3MUUA 5LAPA 2O61B 1GGTA 3JV5A 5EFIB 4R7VA 1DBJL 1E4XL 2LU1A 2OCFD 2WAHA 1PG7L 2MCPH 3CLFH 1UA3A 3E3XA 4WW1B 1I7TA 5GHWH 5AD0A 3AQOA 1WS7A 1EHAA 3QCTH 4X6FA 3VWJA 4R6UA 3FNKA 2NSXA 4L5FH 1NPKA 1NJZA 2ATPB 3VRJA 4B53A 4OZGF 3CD5A 4ZMNA 2GTWB 5ETVA 1U2HA 4FYTA 4AG4H 1UEUA 2NR6A 3FFCB 3QO1B 4JHAL 2AZ3A 2FJWA 1K5WA 1NKGA 3DXAA 4USJC 2Z2LA 3DX4A 1TPXB 3NZHH 5ERWB 3WGVB 1MAML 3ZDYF 4AGNA 2W91A 2HVEA 5KUKA 3SDCA 4AMKL 4EBDA 7CGTA 2A7BA 4OI9A 1NIFA 1BMGA 2Z0GA 4F4XA 4RBPH 1OTUC 1FNGA 5CYQB 4FQJL 5DI8A 4DZBB 4Z7CA 4MQ7A 4NAQA 1OK8A 1R3HA 3QDJD 4U1GC 1EAJA 4PRID 2EC9U 3M32A 2PGCA 1SYSA 1JXGA 2DNKA 5TD4A 3MCLH 1F4XH 4YE0A 4YO0B 5GJSH 5I0WA 2JTDA 1LE9A 1RTIB 4ZAKB 1RHQB 2FVPA 3EDEA 5C0BD 3FN3A 1OSDA 2CQ4A 2J6EH 3IS0X 5EO9A 4I2XA 4OSUL 3RL1B 3WJJA 3PP3K 4URTB 1FT3A 3CCSS 3IRCA 3ARWA 4LR9A 5IBLD 1TTUA 3QARA 5F0LB 4B3RF 1MHHB 5LO7A 3CCMS 5MEQA 2KB2A 3T2OA 3B6BA 3BKYL 5BZZA 5LB1A 4C97A 1HNFA 3KPRD 1A6VH 4IRSA 3O2DL 4CWBA 5KFSA 4WNSA 5IWAJ 3JXOA 2VMJA 3B7RL 4Z7OF 4YHYC 4LRCA 4OLYH 5JXEC 4HUWA 5HYJD 5L46A 2B8PA 4L72B 5KFEA 5EZJA 3DTXB 3EGDA 2JL9A 2J71A 3NCYS 4OGXH 1MWAH 2A6OA 1K8DB 1XHHA 4NE9C 3ZVVA 3ULSA 2DVIA 1FA4A 1PYWB 4N2DA 1FESA 2C2NA 3KNBA 4Z7WE 2DICA 3A4AA 3GMNA 1UKUA 1XNQJ 2DI7A 3THTA 2BLFA 3SBMA 5EBGA 4PSPA 2J2ZB 1D5XB 4NQCB 2IWGA 4K4YA 2UU9J 2G0LA 2J6TA 4ZFGL 5TQ2L 1Q95G 2MJNA 2UUAJ 3BGFC 3BQUA 1GW0A 4IKLA 4OLVH 3BXNA 2JK5A 4ODBD 3M6DA 4TLKA 3GP9A 5IG7A 2OEMA 4NWUH 3QPXL 5CP7B 4YAQA 1S1WA 4FI6A 1G6RH 4XCNB 5ESAB 1ASOA 3CN0A 5DRKA 2M8DB 3PZPA 2N7YA 3N01A 4G2AA 4PVLA 4R2GD 5CJQH 3V4VL 5K9KA 4PJCA 2H5UA 1BMQB 1I8AA 2CDEB 2Y5QA 4XN9A 1FRLA 3WS6A 1GGBL 2E9GA 5IQLA 2WZPD 5CZVL 3C8DA 1JK9A 3NAAH 5FJQA 1NCLA 2L3MA 1JPEA 3D4ZA 3DUUA 2QQNL 1G9ML 1NCAL 1RMFL 2CIIA 2GQCA 1E7UA 2FEEL 3UNGC 5TK2A 1P27B 4AKOA 4ZMZA 3KOAA 1BFSA 4NI2A 1GY2A 3PX4A 3MRDB 3UAEA 5BW7C 1JGUL 4N5UA 2G30A 2HRPL 3TEZA 3CFMA 3UMTA 3PNIA 1MCHA 1NXIA 2Y1ZA 2HRHA 3BH9A 2F63A 2DD8H 1JWMA 5CMAB 1RZIA 5EULV 1BYOA 5FUZL 5I28A 3PREA 4DQRA 1D5BB 1FVEA 1T20A 2WLHA 2DGTA 3QS3A 4ZVOB 1FFNB 5GGSY 4MAHA 3G5XA 5DUBA 1CGTA 2WYIA 1DJIA 3EM1A 5HHME 2SEBB 4KH9A 3QXUA 2BJ9A 5E3RA 4FTDA 1KYUA 1PLGH 2R0KH 1L7TH 1KNOA 2CCVA 3ARGB 1TYJA 1UVMA 3PHQA 4XIUA 5CZXA 2GJRA 5EC2B 1HBNA 3QEGL 4OI6A 2N7CA 3FQNA 4BD4A 3TBWB 4WI9A 4X6DB 3MF5A 1DRZA 5DC0A 3AWGA 3G6JE 2IHR1 2QSFA 1PAMA 3F7PC 5IVZB 1FA0A 1FHGA 4EK2A 1MEXH 1A2YA 3T0ED 5LGJA 1F3JB 3V6OA 4NT6B 4HJ1A 3ZE0E 1RJZA 1GL4B 2E5LF 4FXTA 4ZCKA 5G55A 3NP3A 1IARB 3TJEL 4KFMA 1RA7A 1W72L 1PMYA 1XD1A 4JW3A 4K07A 3NMRA 5JQIB 4PG2C 3OMZA 4BCZA 3I5BA 1BXXA 1UVQB 3CH8A 2WXHA 4M3JA 2JXMA 1L7IH 2VZOA 4ZS6D 4LP4A 4Y8DC 3UDEA 1L9MA 3UDWA 1G84A 2YH1A 5DM6Q 5K8NA 3ME0A 4PJ7A 3RDTC 3MM7A 43CAA 3JTSA 4JRLA 3HNVL 1DVSA 1OGTB 5DK2A 4G6AD 3L3CA 2HFFA 2Y1YA 4DZ6A 2ZWPA 5B0DA 3ZHDA 1R3LB 1S9XB 3PGCB 3V55A 2DPJA 4FXDA 2UUCF 1ZLWK 4LNVA 2RFXA 3LOWA 2VDOH 4K71C 3WY2A 3ZKMD 4IOIB 3ZQXA 1KCWA 5AAPA 3CJTA 4FS1A 3WUWA 1LO4L 2YEZA 5D72H 4PRDB 4Y4KC 5GGSB 2BS71 1NU4A 1I4FB 5KG7A 2R7WA 2ZX5A 1O9VA 3E2HC 3BAEL 3GMRA 2FEEI 3QHFL 2I5JA 4OV1A 5IKCA 1JNJA 4X64F 1JWUB 4NPJA 3U4AA 5JW4R 1G9MC 2JHUA 3FUIA 2X1OA 4QTFA 5D4HA 4Q97A 4Y5XB 4HUUA 4Q6YA 4R26H 5GGUB 2X4NB 2XLLA 4JFOB 4D9LH 3BF4A 2A9CA 3QMQA 2CZ4A 4PYAA 3W9IA 1JYVA 2WXPA 3K4ZA 1XQIA 5JZ7C 1J12A 1MROA 4MKYA 2ZAIA 1CYGA 4EVNA 4DX5A 1UXSB 2ZJRQ 4PJDB 4RAUA 2ZCKH 4NCBA 1U58A 3OR7B 5J6SA 1I82A 5GAEU 4KKRA 4L4TB 4ZUSA 3GSVA 4KV5E 2QFIA 3A47A 2LW3A 3ARVA 1MJUL 4IBSA 3S36X 3G82A 4NUGL 3VACA 4C8OA 1UJ4A 3ADAC 1FT8A 3GLJA 5HD8D 5DJ6A 4OIIL 4GSUA 1D2PA 4AIOA 1QW9A 1H38A 2R8GA 1M5VC 4HBQA 4A67A 3OAYK 4Y3CA 3LXCA 2WB1D 4JG9A 2YNIB 4YR2A 4RQQB 1KT2B 3BGUA 2Z58B 4L48A 2XN0A 2CZNA 2OR9L 3AG3B 2Y3NA 1YEGL 4LLWB 3U4BH 4BHUI 1N9PA 4JKPH 4ZFFA 4O51A 1XGQA 4PBWD 5MEOB 1TXKA 5FWQA 2BXWA 1XIWA 5C0CE 2TSAA 1A3LH 2AABH 3EJTA 5KTEL 1ZD6A 1IC1A 2Y0SA 2DK2A 3UI3A 1FI8C 2R56H 4OZIE 3A6CL 4OJFH 5J12B 3JYBA 4JFZL 3TT1H 4G82A 4KUZL 1IWGA 1UUNA 3GMOB 4DHVA 2NXYD 4QXVA 2H9GB 5TE4L 1TKXB 2OMWB 2J1XA 3G04B 2VIRB 4PJAA 2CDGB 2O3DA 4PJ6A 5BV7B 4NLRA 3W2VB 4F57L 2CUMA 1KPRB 1HWLA 2H3XC 2CXKA 3TZVB 3TESA 3PX6A 5THWA 2YNFA 4OCNC 1FRIA 1T22B 3IM8A 1NIDA 4N87A 1G94A 5F9WB 3V81A 3QP3A 2EC0A 1XCQA 2P42B 2VDPL 2Q87A 4PTTA 1E42A 3V0WL 2BA9A 1GHFH 1GK8A 5IC6B 1NCDH 2GJFA 2ZM6F 3TUPA 1PSKL 2HK3A 3W38A 2AQ2A 2EILB 5SWSA 2OPSB 1W8OA 4N0UB 4HFUH 5I1HL 1COBA 1D2OA 1TQSA 3CMOH 2IJRA 1E2WA 2N4IA 3IDNB 1WEYA 5CYMB 5I15L 5F88A 4U2ZA 1VOMA 4P2SA 1ZK5A 5G4NA 1FN4A 1IXKA 1I1YA 4KR0B 4OI2A 1YY8A 2M3DA 4PVBA 1YEWA 1T66C 2ZH6A 3O6KH 2VDQH 3R0MA 1S1TA 1OAQL 2E7BA 2UZIH 1P4LB 3GIVB 2GABA 4P8QA 4UOW1 3QRFM 3Q8UA 4X4OA 1C0UB 4XVTL 2G1HA 2BSRA 4FCAA 1WS8A 1CE6A 3D3VD 4IJTA 4PREA 4ZO8A 2VH7A 2XHCA 1X5PA 1H6UA 1U93A 4DP4X 4N9GA 1QWNA 2EE2A 2QSVA 3MM9B 2NYYC 5C86A 5GAHI 2HLTA 4P59L 3JTBA 1Q0XH 2OL3L 5L9DL 1W91A 4BZ2H 1ZXKA 2XYHB 2NY0C 4I5BA 3QQDB 4Q6IA 3UR3C 5DQJA 1WACA 4MQTB 4W9HC 5ACFA 5D8JH 5KVDH 2AV7B 2ZOMA 1GTNA 1UWFA 3L54A 3IN0A 4NLHA 3T65A 2F18A 2JJWA 2WZ6A 2ZXDA 4G8GB 4E5XA 4U67Q 3GEFA 5CEYA 5IJKC 5KUMA 1QHQA 1UPMB 5GADI 1YSJA 1NHVA 2NT1A 2CRZA 4OD3L 5TE6H 3R4RA 1VQKS 2P5ED 2BY1A 5E24E 2OSXA 3MU3A 1FKOB 5EUOB 1L0QA 1S6UA 1EETA 2UUCJ 35C8H 3O9WB 1Y1DA 2Z35B 1MIEH 1ZSHA 4ONGH 5CINH 4IBZA 1GCFA 4HC1H 1IE5A 4XPHH 2AK1L 1RUMH 3QI9D 2PD1A 4DAGL 1UW9A 4HJSA 2J73A 4X64J 4L4VA 2L9DA 5A16B 1NANI 3VG0L 1OSCA 5FC9A 4HSCX 4V19X 3BGRA 4YJZL 2WYHA 3VU2A 5J89A 3SDDC 2EI5A 4OQTA 3GM0A 1DLFL 4TVPE 4JGNA 4DUVA 3CDYA 4BS2A 2BCKB 1WWBX 3VXMA 5DFVD 1OP9A 3JQJA 1D5IL 4NZTL 2ADGB 2X6BA 2VBYA 5JMOC 2A9AA 2WVSA 4JKKA 1MCPL 4OR1A 4F7CA 5F7HA 4E0RB 1RT2A 4KK6D 2IH3B 3IDJA 5MEPA 3QE5A 5CJXC 1PILA 1M1KT 3TUIC 4YSOA 3RUGA 3ILEA 4JPKH 2O5XH 4DFPA 3H3PH 3UBXA 2O6CA 2EE3A 1X3DA 4B9JA 1Z2ZA 3O11A 1LEIB 3G5YB 4IBVA 2A4EA 4NC1C 2FEDC 2IPKA 3P4MA 3NJVA 1IBBA 5DDHA 2LLGA 1QY7A 1WCQA 7PCYA 1U21A 3QR0A 1W16A 2GW8A 5DUJA 3V5DA 4AMWA 3LP2B 1XX9C 4MNQA 2Q3ZA 3B2UC 3PABA 3Q8QB 2UV3A 3B1UA 5M2PA 4Y2MA 2I07A 2PO6D 5FYKH 2ALYB 3CDEA 2D3LA 4YX2H 5J4MA 3ZQWA 3T5KA 4QXWA 2YBVA 3CJSA 3H2VE 2XZAL 3WBDA 3MECA 4PABA 1EZSA 3T0XA 1DBBL 4ORGA 4DGYL 2YNGA 3H0PA 2C9XA 4KGMA 5C25B 5KT6A 3ZRCC 4KO0B 3O6FD 3H98A 3JSSA 2V7HB 1IGCH 2DR7A 1VACB 4HMDA 2PWEA 2VPYB 5JNYB 1ORSB 4YHMH 3U6XA 3DJSA 1NCCL 1S78C 3GBMH 2V8HA 1EJ8A 1P5VA 3DX7A 1Q1JL 1E43A 4XNQB 5F3FA 3O81A 3HBQA 4JDZA 5K39B 4M48H 4D9QE 3QNYA 2V69A 3V5HB 2YWHA 4QAMB 2V63A 2F7PA 4MMOA 1EHLH 3ITHB 1A3RH 4C7QA 2DMHA 1RIVH 3RWEB 1OQXA 1T3OA 1ULVA 3S8GB 4LGSB 2BVQA 3D0VA 1YJ7A 3KPSE 4GRWB 3EGSA 4HIJB 4GUPB 4DPOA 4RWXA 2OM5A 4I0PA 2EXYC 3RWCA 2P5WA 5D1XE 1BM3H 3FQWA 2H0FA 5GGVH 3BYTA 4HIQA 3QEUA 4BK8A 1ZGLB 4PRAA 3X1GA 1AY1H 3RIFK 3IMTA 5DHVH 2VWEE 3PHOA 5JOFB 2J8OA 5EOCH 3CIZA 4CLZA 3KK3A 1RP9A 4WHDA 1CQYA 3ZZZA 1U9KA 4B9GA 2XO6A 1FYTA 4QYOA 5I16A 5E2QA 1N6QA 1XF5A 4TLTA 3PUUA 1RU1A 1XR8B 2M52A 3KGSA 1UQSA 3MAWA 1GGIH 4PJ9B 4XBEL 5IC4B 5I8EB 3VFNA 5G2NA 5B7WA 4LCVA 2YD5A 3KK2A 2KT6A 1ID5I 3PAUA 3A3NB 3U9PH 1F2QA 4LFBF 3NS6A 3DLGB 4U8YA 4FTVE 3MRHA 1HHIB 1UW4A 2PEBA 2HFZA 3U0WH 3PWVB 4MWFA 2WXGA 4GINA 3AY4A 2Q1LA 1IEAB 1KB5H 1VFBA 4EN3C 1R89A 5GAGI 4R4FL 5FECA 5IB1B 4PY8J 3KDMA 1JPGB 5IJVB 3NCEB 3HUJB 5F8QC 3MOBH 2CR3A 2HG5A 5IB2B 5F21B 3HR5B 4POZD 2DNMA 1AFVL 2YMXH 3IGKA 1E5AA 2HTKD 3OD2A 1TT6A 1RBAA 4GQQA 4NQEA 1VADA 1MXGA 2HIYA 4YZFF 5TH2B 1R7IA 1S4EA 1XEZA 4ZVTB 3LZNA 4B60A 3TPKA 1S9FA 3LRKA 5FYKD 2DQCH 4BH7A 3FEZA 3UG4A 4Q9BA 3ZKQD 4RNNA 4GKNB 1MCJA 1FE4A 2IAMB 2BP0B 3BEVA 4X0KA 4EYIB 2Q8BL 2Z57B 4PBVC 5FCUL 3SBQA 4M1KA 3WE6A 5IGXL 3W66A 4J2QA 1WCBA 5HJDA 4DV0F 3CX2A 4XMLL 4ITSA 5DURB 1AD9A 1SDAB 4NCC2 4R97B 4E41D 1FL3B 3RWFB 2XUWA 5KSBE 3BUDA 4XPTL 3TWZA 4GAGL 4F3FA 3C5ZD 1HNGA 3TIEA 2QL5B 3HMXA 3FO9A 3GNML 3O3AA 3SDXF 3VFVA 1Q78A 2EXWC 5ESQB 5DMKB 3M6VA 3B9KB 5C09D 5CD3A 2RGSA 4FPIA 4ES3A 3VXRA 4G9FD 2ATAA 4OB5L 5IM0A 3VMNA 2YWWA 2VDNH 3R5GA 1SY6A 5AKSA 3ARXA 4K4SA 1A7OL 3O6ML 5HHVL 3VXUA 2FYYB 3UC0L 2HFNA 3SDEA 4FCHA 1ICEB 2ZUVA 1YEDA 2PWDA 2WTRA 3N9GL 2CGYA 4YL9A 3BWUC 1ZM4A 3EZ5A 4BQ9A 3A8JA 2UV8G 1E5YA 4XCYB 2XJKA 5E5MA 1OO2A 2IDCA 5KFZA 3TBTB 3K7RA 4UQ3B 1J8HB 2NY4D 2XFXA 1UEYA 1FG2B 4TUKL 3KWXA 2X3BA 3PDNA 3I2CL 1UVIA 1EJ6A 2BFGA 2NY1D 1QUNA 5D6GA 5AZ2H 3R5DA 3VWJC 5DG9A 2B1AL 3SKNB 5HGBA 3QJSB 1A7RH 1EGJL 3NFNB 2K1RA 4B0MB 2MYFA 2XCPA 3RVVD 1KELL 4JPIA 1F13A 3IGAA 3C6SB 5IVNA 1JPTH 4ZMMA 1HXYA 3QDGB 5IV3A 4J1UA 3U4EA 3RP1A 4ZMOA 2WIIB 5LXRA 1AO7E 4HWZA 4XN7A 4B5EA 1AXIB 2W2NP 4KVNH 2IDQA 1F2HA 4GQ9L 4HF5H 3SDCC 5AFAA 2EW9A 4HGMA 3E6FB 4Y88A 1F1GA 4YC2B 1RZGB 4AC4A 3SDAA 3MM6A 3UN2A 1Q9LA 4JLRB 2AYGA 2AK4A 2I9LB 2WOMA 1IC7L 5HVHA 1KXQA 1JN6B 5C0RH 3AA8A 3ZRFC 1LK3H 1L3NA 2DQDL 3TEWA 4PP1D 3GMPB 3HFFA 1Z2KA 2YUVA 5EPMA 3P40A 3QJHA 2GITA 4XMKL 2LEBA 5JDJA 4EZ9A 3BLBA 3X14B 1H8LA 2NTSP 4JM2A 3SCMD 5KFIA 5DZNA 2YR3A 1KC8T 1UFKA 1A3ZA 1CF1A 4MJIA 4KKNA 2YD4A 2FTRA 5DJ8A 4EISB 3I85A 4R5XA 5BOPA 4N8NA 5LXGH 2X4PA 5IK3A 3AZUA 1I85A 1VCTA 4KTEH 3LKPB 4BKLB 5HHPA 4JYAF 3WJJC 2XFGB 4ZFOB 3IA0A 1UKSA 1SXCA 1GOHA 2J6UA 3LTVA 4PB9L 4HG4K 3UROR 1DY3A 2LQ9A 1UJ3A 1OGAA 4FNQA 1X0FA 2BEFA 2F61A 3OG6B 5DUPH 4E9LA 4LFBJ 3RVUC 5JR1H 4ALEA 3HD2A 3AOBA 3IXAA 2IAJA 4NCGA 1KBBA 3EGNA 4IRSC 3O0RH 2ZM6J 3OLIA 4KK9C 1JZIA 4P2OA 3TL5A 3BSAA 3CZNA 5HGAB 3CCRS 1YAZA 4UUWA 3VDCA 2X4OA 4KX9A 3QXTA 3PIOQ 2P26A 2DLFL 1FSTA 4LCWA 4APQB 4LLQB 4MA1B 4I1PA 4WW2B 4LVOC 2CFXA 2YKQA 4HL9A 1N10A 3ZX1A 1R3NA 3G6VA 2MTPA 1QA9B 4K4WA 3S6CA 4B3VA 1T5KA 3O2WL 2UXCF 1SJFA 3QZWA 3LS5H 4J4PD 2PABA 3CD0A 3LP2A 2GJ6E 3NCJH 4LCUB 3RYMA 1MREH 3IFPB 2WQ8A 1CJKB 3T77B 3U83A 5BXFB 3UPRA 4XOCA 2WCXA 1BDYA 5J13B 3B34A 5HVGB 4JI5F 5I1AB 1KJ2A 5IR1B 1EEYB 2CGZA 3DX8B 4G1MA 3VD1A 5K5YA 1YA5A 4QOKA 3W64A 5ITHA 4DR2F