2XWXA

Vibrio cholerae colonization factor gbpa crystal structure
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
391
structure length
385
Chain Sequence
HGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVILAVWDVGDTAASFYNVIDVKFDPDWNPAGQIIPSMDLSIGDTVYTRVFDNDGENPAYRTELKIDSETLTKANQWSYALATKINQTQKQQRAGQLNGDQFVPVYGTNPIYLKEGSGLKSVEIGYQIEAPQPEYSLTVSGLAKEYEIGEQPIQLDLTLEAQGEMSAELTVYNHHQKPLASWSQAMTDGELKSITLELSEAKAGHHMLVSRIKDRDGNLQDQQTLDFMLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Vibrio Cholerae Colonization Factor Gbpa Possesses a Modular Structure that Governs Binding to Different Host Surfaces.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Chitin-binding protein
molecule keywords GLCNAC-BINDING PROTEIN A
total genus 86
structure length 385
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03067 LPMO_10 Lytic polysaccharide mono-oxygenase, cellulose-degrading
A PF18416 GbpA_2 N-acetylglucosamine binding protein domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xwxA03
2.70.50.50 Mainly Beta Distorted Sandwich Coagulation Factor XIII; Chain A, domain 1 chitin-binding protein cbp21 2xwxA01
3.30.70.2150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xwxA02
4ALSA 2XWXA 4GBOA 2BENA 4ALCA 5FJQA 5FTZA 4ALQA 2YOYA 5AA7A 4A02A 4OY8A 3UAMA 2BEMA 2YOXA 4ALRA 4ALEA 4OY6A 4OY7A 5IJUA 2LHSA 2YOWA 4ALTA
chains in the Genus database with same CATH superfamily
1BC6A 1G7LB 3KS0J 4HLBA 4I6YA 2NW2A 3DX1A 2AQSA 4RNOA 3T1WA 2ZCKH 2XJKA 2Y2YA 4QJ3B 5GS2H 3PFOA 4X8GA 1YHQS 3H5XA 4NBXB 3I6PA 4A8QA 1B3JA 1GXTA 1KG0A 3GV5B 1FO0H 3CB4A 3GBMH 3WE6A 3QZMA 1NSKL 4AVHA 4JGNA 2IFXA 3FUNA 3FU8A 2NT1A 1RAIB 1RWXB 2AZ1A 2C2OB 4G6AC 3NZ8A 3DX0A 3PV7A 1AHWB 4JHWH 4LLQB 3RZWA 2X4OA 2HMID 3R8YA 4IKAA 2G1HA 4PJ8A 5B8CC 5ETQA 3QHFL 4JRFA 2H32B 4Y4KC 1S0NA 5CD3B 2XRAL 3EO1A 1X3DA 4O02H 2NY3B 1E5CA 3CCES 4RAUB 2JIXB 1VEPA 1E9PB 2HBRB 4PTTA 1RAFB 3CD7A 4PJEB 1NCAL 1Q9KA 2O5XH 4GG6B 4OI1A 1A66A 2EE9A 5TE4L 1UGKA 3H7LA 1ZLWH 3OVAA 2F53A 2NXEA 4JRWA 3Q6GH 3QIWD 4KMLB 5ALBL 1RZMA 1YBTA 1QABA 4DUZF 3O9WC 3QI9D 4PJCB 4MAYA 4FVMA 4J9PA 2ZC4A 2DH3A 1U7LA 2ZICA 1UD8A 3SDCB 1CFSB 1Z5LB 1J1OH 1T2XA 1ZCRA 1FNEA 1SPBP 2WSCC 3QWUA 3H4HA 1UKTA 2CLRA 4J8RA 5KTEL 4ONGH 4DKFH 1S7TB 1A7PL 2BOLA 4U7KA 1F42A 4KFZC 1N6QL 1CSJA 1A6TB 1YY9D 4WHTB 3VU1A 2RACA 2J1WA 5KG6A 1RZJC 4AL5A 2HKFL 2WLKA 2DLIA 1CO1A 2MH4A 4PJDE 5B38A 2AXJA 2W65A 5LAXB 1X5PA 2FZGB 2B2XH 1I4FA 4YHKH 1E50A 2DZEA 3PS6A 4PJ9A 4OX6A 2Z91B 3BGMA 4NUQA 3V5KB 1F5AA 1AJ7H 2BS71 1P1ZA 2OV0A 4HPHA 1JIHA 4MDIB 2PFDA 3LP1B 3Q2SC 2ZWKA 2MKCA 4X4MA 3EH2A 3DM2A 1P6WA 2GSGB 1YNTF 3CLWA 1EK3A 3QZWA 2VXVH 2F9JA 1AC6A 4DJBA 1IR1A 4CDIA 1K5WA 2GY7B 4IKLA 2UZXB 5G4DA 4LRNL 1BBJA 2AQ3A 1BQ5A 5ACZA 4HI1A 2DKMA 4GG8B 2DNZA 2W4PA 4KO7A 3VX0A 3T71A 3CHRA 3WZ0A 1VK3A 2HFFB 4MB3A 2F5BH 4N1HB 4AV5A 5JZ7C 5KVEH 3W9IA 2VR6A 3K5RA 2V3EA 1ONQA 4L05A 4ZFOL 3BO2A 3BB5A 2C3WA 3IFLH 1YQHA 4XO9A 2OMTB 5E2WH 2WINB 4PLKC 5DUMH 3G8TA 5F97E 2PWEA 3HOGA 3M8PB 1FGVH 3EJUA 4Z7QE 1H0DA 4B08A 4RMQA 2OHDA 3J7YI 5IK3B 2HVJB 4R9HA 5ACHA 2K3TA 2D7SA 2QYCA 2WXIA 1X7QB 4L5FH 3EKCA 1JNNL 3W8PA 1E6VB 4ES2A 4WP3A 2K6YA 3R6GB 1NHKL 4FF1A 4U1MA 1MCJA 3ZHNA 2W88A 3FB8A 2XPZA 4OFDA 1GC1C 3ZZPA 1JLGA 3I0SB 2X7LA 1XC9A 2C1EB 2M1KA 1FWPA 3KPPA 2DMKA 5L39A 3UG5A 2HVKB 4N8VA 3TEYA 5E1AA 3CJ3A 3MTKA 3KS0H 4NJ9H 2GY5A 4IRJA 3VH8B 1Y07A 2FH6A 4LSPL 3BQVA 4JY5L 4XZUB 4QHMB 4W9JC 3OVUB 4D9QD 5LG6A 5DHXB 4FQ2H 4K3HA 3FN0L 3RRQA 2HT3C 2PGCA 2WO4A 5F2UA 4N0YH 4YQXL 4D94A 1LO2L 1AE6H 4P04A 2YWYA 4RNHA 3OW2R 3FH8A 4FNIA 1OAUH 3SE9L 1DUZA 1DL7H 2NSBA 3IRCA 1F5WA 1EETB 4XPGL 1OAXH 1QUPA 3CJ5A 1SOQA 1FE8L 1N4XL 3IJYA 4G1MA 4D3CH 3QZLA 3KR3H 1RWKB 3C9NA 4XT1C 4KH1B 2ESVE 3MNZB 5I5MA 1Q86T 3SGKA 3D18B 4JHPB 5CINH 3NCEB 1B2WH 3UC2A 4M6MH 3P9LA 5GGQL 4DF8A 1E4XL 1XCQB 4K2JA 4FNPA 2P49B 5TE7L 1RK0B 5HLFB 1DSYA 1VMBA 4NNYB 1DE4B 1KHWA 3D6GA 3LZLA 4WU7B 1E6OH 4DN4H 4QI8A 3W61A 5DJ8B 1H2VZ 2VQEJ 2F54D 4EPSA 4P9HC 5EEVA 5DJYA 2RBLA 5DD5L 3JV4A 4E42A 2VIRB 2UXFA 1ILSA 1KCRL 1OAKL 2R1XA 1LXNA 5KYWB 2X9ZA 4DR6J 3DDFA 4QLRA 5AWNL 1AQKL 2HLFC 2HWZL 2WAQA 3NEXA 4P48A 4APXB 2XYBA 3MODH 5LSOA 4NO0A 3BAIA 4ZFQA 4DP7X 1OW0C 2M3DA 5DS7A 5K8MA 1NFDE 1RWNB 4EBDA 1C16A 2XMKA 3Q13A 3NFNA 1BA9A 5AVUB 3CDFA 4IKIA 3K5MA 3QORB 2XTSA 2AZAA 2VZTA 5DEZA 1CQMA 3PEJA 4WNSA 4HFWB 1YEKL 1C5CL 4Z95L 5AD0A 2A74C 1XB3A 2C3MA 2HRPL 3O3DA 2SXLA 5E9NA 2H5EA 2PW1B 4DPOA 1G4CA 4ALCA 5I1AB 2K1MA 3C5XA 1MJ7H 3ZNJ1 4DR4F 3NA9L 4X2BA 4PTUB 4CYUB 4DGIH 3DDKA 5JORB 2W2OP 2X9YA 4H5SA 2ZBQA 1X0FA 4CN6A 4HUXB 2BJMH 2R23B 3CN0A 3W63A 3M86A 1SFHA 3IJEA 5AYQA 4IRSB 1B90A 4AT6A 5KN5A 2HQIA 2ZD1A 4S2SB 4RW4B 1GZQB 3CBRA 3GMOB 1JWSA 4NZ6A 2FQQB 3AHPA 1X7VA 3EF7A 3F04A 1VCAA 3OGOE 4UQCA 4DL0C 5I17A 2Z8SA 3V6KA 2OMUB 3EYSH 5CEZL 4DR2J 2C3GA 4LVOP 1YEIH 1VRUA 3DYPA 3FSOA 3BKTA 3V2AR 1AZSA 2CBOA 2CKBA 4OCLC 2LFEA 4WV1A 3OBAA 4L4TA 3V0HA 2B20A 2VC2H 2MKWA 4BSWA 3OB0H 3OR2A 1ZS2A 3NP5A 2VDMH 3QAQA 1KJVB 1MEXH 1I7ZB 3GTVA 2KT2A 3MRMA 3SDAD 5KG0A 2ZUWA 2RQKA 2EC9T 2P5PA 2QZ5A 2Y5TB 3TT3H 1VIXA 4AYBD 3OQRA 3TBVA 1ACMB 3GSOB 3PHAA 1GXLA 4GKZA 3PEHA 4UTCA 3BN7A 1W15A 1X7SA 3FQRA 1ED3A 4OCRL 5L8KB 2AF6A 2Z34A 3CX5K 2I9TA 4Z7WB 1TZIA 2XKNB 3EHBB 3AXLB 4MAYB 2ZOOA 1JQGA 4XNAA 1E9QB 2E6PA 4F4YA 2Q7YB 1YEHH 4XP1L 5FYJE 4EIUA 4QWWD 1KLFB 4Y9BA 4BUQA 4A7VA 2K8GA 2VLRD 2NX5A 2R2CA 5EO1A 3L5XL 3K91A 5EUOA 2JHSA 1F1GA 4LEEA 1CL7H 1DVFD 3SGEI 1MU2B 3D39A 1OGSA 1A7NL 2QDWA 2I6WA 2ZNXA 2AXFB 1K5NB 5CILH 3DVNA 3WY3A 3ULSB 4YDKH 2B9BA 3MFFB 2EH8L 1G7CB 7FD1A 1IR0A 4NHCL 3NSFA 3LIZH 5BRZB 4LT6A 4X7EC 1S1VA 3PWVA 1UOVA 4RFEA 5T5FH 4DGWC 4DQOH 4G43A 2CWKA 4DNLA 2QVTA 3DI6B 5EU4A 3KXDA 3T9WA 2NYKA 2FGCA 3N44F 2AABH 1UA7A 3HMWH 2XO7A 2QJDA 4TSCL 5HI3D 1N19A 1WBZB 5F3BB 1U0SA 1WUUA 1UHVA 5DS8A 3GYRA 15C8L 3B9KA 5H37H 4UILL 5C2CA 2EDNA 5DZ7A 2JSXA 5L1JA 4IFVA 3PVXA 2JF1A 5JW5B 4I0PB 2Z8RA 3QDJE 2MSTA 5E7FA 1CDBA 2IANB 4PZVA 4W1TA 4QOKE 3G6JA 1W0VB 4GXUN 3UN2A 4AL6A 2V6HA 4PJEE 2XLLA 4AC4A 1S0OA 4ZUWA 3E51A 4YL4A 1DFXA 4MSWA 1YJDC 3HG2A 3SQOP 3CPUA 3DC0A 5CEZE 2UUAJ 4DK6A 1ZA6B 3DV4A 2DYSB 4V19X 3QGIA 3MLSH 4HJTA 1L9RA 3EFOB 4YHLH 4UY8T 3MJ7B 1CTOA 4UT6L 1X4FA 2PD1A 3RAJH 1FJ7A 3JTTB 1S49A 2W2NP 4CUCA 3EDDA 1LP9A 2QSQA 2DR5A 3BP6B 2Z93A 5LO7A 3OR1A 1HHKB 2YWGA 3I6LD 2I9LB 2BW2A 3KPQA 3T6BA 1LQSR 1LTXA 2N7CA 3SCLE 4FNLL 5C7XL 3W9EB 5IHLB 3FUHA 3OZ9H 3JWNE 1KDNA 4I2PA 4AGMA 1HYSB 2TRHA 1R24A 4O51B 3H9SE 4W9FC 4BZ1L 1NCWH 3TN0A 1IVTA 4IS6B 3DSNA 2MZTA 1Y11A 2IQAB 3Q05A 4ZVTB 1UL3A 1XJWB 3PY9A 3WE1A 3NZHL 4B3TJ 2L7EA 4UQTA 1K6QL 4P46A 5F0WA 3MRCB 4ZPTB 5I6LA 1RVFL 1WA0X 2ICWJ 2CJUL 2Y3NA 5GGVY 5D1XE 1G7QB 2WNWA 2NS1B 3EPIA 4ELTA 1PG7X 2COQA 2VXQA 3VFGH 3QT7A 2XFXB 1NDMB 2QSWA 3QA3A 5KT6A 1GS8A 1WTGT 1RHRB 2RILA 3P3UA 3MHZA 1S7HA 1SY6L 4I13B 5IW3A 2PFFB 1JPEA 1OTTC 3SBPA 5CD5C 3HZEA 1TVHB 2Q2LA 4LGSB 3KBFA 2Z65C 4K7PL 2MTLA 2GIQA 4K5SA 4RU2A 2R0ZL 2FEEI 5E33A 2J21A 5DLMH 1MW7A 2D3UA 2ZEJA 2CO4A 3ZE2E 1XZ0A 2XZCL 3MO1A 5JW3H 5ISZE 5E99H 2DJUA 4P2OC 3SCMD 4IGBB 3IAGC 2QGBA 3FJTA 1JDCA 4WNQB 2B56A 1KENL 2OYKA 4W9CC 3FONA 4X6FA 3CSKA 1QSLA 1LEOA 2K45A 2EQDA 4H26B 4KBPA 1CYXA 1N36F 1HESA 3H53A 3NIFF 4M4RA 5HDQL 5GS1B 2ZOLA 2BIMA 3OKDB 1UWEL 4ODSL 3P02A 5GHWL 1RWMB 1W9XA 3EXJA 1FDBA 4XOAA 1D3CA 2GS8A 4IH7A 3TQEA 2P9RA 1HQRA 4WAFA 2B1AH 1Z9SB 1JZGA 2XXFA 4L3NA 1W80A 4W98A 3AS3A 3UNYA 3KK3A 4CMMB 1JOIA 5JDJA 3C2PA 2QMUB 1EMTL 5CJ8A 4E0DA 3W9DA 3BD5A 3VI4B 2CKBH 4RUAA 2WNXA 3J2PA 4NAMA 4NO0B 3ZE1B 4CVXB 1EBAA 3AREB 3U46A 2HQFA 3OPKA 3ALPA 4N56A 3RTVA 5D4LA 3F01A 3FPYA 3GLZA 1WBYB 2CCLA 4EK2A 4H44C 2F58L 2KFYA 4LEXH 1OAKH 2HSIA 2BK8A 2X9WA 3UEZA 4OJ3A 2NDGA 1IBKJ 3JSMB 2G4EA 5J2PA 5DD5H 5EBGA 3BUBA 3UJIH 2BRQA 3HG1B 3IFOB 2YEQA 2NY6D 1XERA 3ZDXF 2HS4A 3CEDA 5CIPA 5E4EC 4N0FA 1NB7A 2J5WA 5LSRA 3V4PB 1F3DH 2IOIA 1OVZA 4OCYH 3MROB 5DFWH 4ILRA 2AXHA 1S9VA 2EIZA 1X9QA 3D9AH 3FT3B 4U6XA 5EOTA 3BYPA 1S5IH 1W2BR 4I85A 3GC3A 2CA9A 1UXWA 1U6ZA 1CULA 3OQ2A 2EFNA 2PMZA 1H15A 2X05A 2VXSL 4XBPB 1R27B 5K9QG 4D3CL 3B5TA 4HEPA 3OQ3B 3FSWA 4V1DE 3MV8D 5DZJA 2CLZB 1VS3A 1RUML 3AU1A 3FRPG 3H8NA 5E8EB 3LYRA 5G2NA 2CZ4A 4TVAB 4UT9L 2XCAA 1G9MC 3KNAA 4I6AA 2W1BA 2DQCH 2XIBA 3TJEH 4KKNA 3BGRA 1OB1B 3K57A 2P8MB 1T20A 1YEDA 4KVNH 1A9BB 5C0GB 3EBHA 1BLNB 4XP9L 5DR5H 4A8SA 3NTCL 3VG0H 4F2RA 2FAUA 4ONHA 3O2VH 3U2JA 4KK5C 2EIEA 5GMDA 1LWFA 2P44B 4JO5A 5DHMC 3ARDD 4BSWB 1LMKA 1GY2A 1Q9WB 2D7PA 2J8UE 3FTVA 4JY5H 4IU3A 4M7LH 4ADIA 4CMHC 1LEKA 1QSEB 2Z31B 4EAEA 4F15B 4HMEA 1O51A 2DWEB 3HBZA 3ETTA 2Q2EB 2FSDA 1S78C 4K0OA 4Q7AA 4RLDA 2EIDA 4FG0A 4HH0A 1FAIL 8ATCB 1LKZA 5GZNA 2HHHF 3DRTB 4UTAA 5IFAL 1ZAXA 4OYOA 4P5RA 2YY3A 1HI0P 2E9RX 3DJTA 2PA8D 1WF0A 1SNRA 3JWNC 4G6JL 3FF7A 4I9WE 1TL1B 4L1LA 1WORA 3SYOA 1AUSL 1JNNH 1RHHB 4PJXB 1H7XA 1MRFL 4W4OA 1MMNA 1HINL 3BAEH 5DD6B 3LKQA 1HDMA 4O2EA 1L3UA 1G6RA 1R89A 4HMDA 3JV6B 1VQOS 3U4EA 1F58H 5EU6E 5AZEL 3QHZH 3DRSA 4GVBA 4LR8A 3MXWL 4NKMB 3C5SB 4PCQA 1N5AA 1HAWA 4P3DB 2A6KA 3VFWB 5T7LB 1RAGB 5GAGI 2J55A 3REVA 2IRYA 5IF0A 4JN2B 3MXVH 5CEXB 1N5YL 4RDQF 4ZPVR 25C8H 2V2WB 4I2QA 1SMDA 4TL4A 2UYLB 3MCLL 3ZTQA 1UEYA 2IANE 3CQQA 4QGTA 1BIHA 4OLYH 3VTMA 4CVZA 2JFDA 4Z7AA 1Y18B 2BNQB 2DH9A 4NN7B 1B0TA 3CFDB 2AKWB 1BEXA 4KK5D 3HC3H 5HHXH 5J13B 3FQ4A 3GSVB 1PEWA 3T8XA 3ULUF 3NAHA 4G1IA 5IM0A 4DV5F 4HV8B 4F7PA 2OLWA 2VDPL 4KT0C 3SQGB 4X62J 5KS9A 4ED1A 3QIPB 4Z77A 1KT2A 2YAPA 4LLUB 2F0CA 4OLUL 4PJ5B 5DO2C 1QM9A 1UPPA 2BQRA 2JCCE 4RBPH 4Y5XB 2WAQD 2ZH1A 3FRPB 1CXKA 3SOBL 3ZE0F 4G1PA 3ISZA 2OD6A 3U7JA 4YMEA 1NIDA 2V5HG 1U6AH 3PHSA 5JIKA 4MA7L 3HCXA 5J6GA 2PABA 3SFGA 5AENA 3FT2B 1KBVA 3QYNA 1R46A 1T83C 5CAYB 1ODAA 2GJPA 4P23D 2WXGA 3RVVC 1WKKA 5DLLA 5I3UB 5GSRB 1QZ1A 4H1LG 3WI9A 5DZLA 3SGDI 3IKCA 3MCMA 1KY6A 5DYOA 3MM6A 4JI6F 3GUFA 3M7OA 3KLFA 2NY6C 3HC0A 5CCKH 1XQIA 3R5BA 1FYHB 1NJIT 1OE2A 2WLIB 4U1SA 5FW7A 4O23A 5HHMD 3OR1B 4P06A 4JCLA 4Q9BA 4U33A 1JWMB 5KVDH 5KT4A 1KCLA 5E00B 2Y7LA 2VD3A 1BZEA 1J9CT 2HX7A 3FUIA 1ZWIA 5L4FA 3CWJA 4XO3A 5JXAL 5EO9B 1ETA1 4NI3A 2E5GA 5B0GA 2GAHC 2RJMA 5HANA 4EI2A 1O6SB 4ENEC 4N5SA 3VCLA 4RW6A 3CSGA 2AXWA 1T7ZA 1YEGL 3Q6GL 2YRZA 4A7UA 2DI8A 2P5EA 3TH3T 2V7NB 1LMIA 3MACL 1LDPL 3BVVA 2ZCZA 4WHCA 3D4YA 5C0JB 2WUCH 5HDBB 2VLLB 2F18A 3ML9A 4BJLA 3UAMA 2ZKMX 2ZOUA 5IGXH 2A73A 2DXEA 4YDNA 5C6TL 4DGYH 2XTJP 2CM5A 4YN3B 1EHXA 4Z3EA 5D2LF 4PLJD 3ARWA 4WWOA 1EH9A 1YY8A 3GBNH 4FZ8L 1FESA 2FYYA 3PAVA 5KS9F 5IB4B 1PJ7A 3MLRL 1J5IA 4R8UA 1NBCA 3D4JA 5LGHL 1NGYB 2FRGP 1HOCA 1B6DA 2WOBA 3VYPA 5F8GA 3ZDZF 1RTJA 5JVHQ 1WDTA 4TY9A 2KZWA 4HKXB 4EN2A 5KANI 2DMCA 3EYVB 3GF8A 3BFOA 1S9YB 2GC4C 5KS9E 1LVEA 3FRUB 1B7YB 3ZZ0A 1JPSH 3VGFA 1KB9J 4Q0BB 3FBKA 4HWZB 4BFNA 3I6LE 3STLA 3NIGB 3QUHA 1OGPA 3ZNUA 4A8OA 2B6AA 2KYXA 1JRHH 2ZKHL 4JV2A 1QZNA 3NJHA 3X3GL 1UM4H 2HRUA 4WNQA 1SXLA 3ARDA 4KGLA 3BVDB 3OT9A 4PJFE 1X4XA 1JK8B 4Z6AT 2FNWA 1AXTH 4J12A 3G04A 1LWJA 1F3JA 4U6YA 4JO3L 3WMQA 1EAPB 3KMDA 2V2VA 4QIFA 4OI0A 5L2JA 1U8KA 3B54A 1FLTX 2QHRL 4ENED 1QX1A 1T1XB 4Y8AA 3AT1B 3IE9A 3MU3A 3E8UH 2BXZA 1ZRUA 2Y0SA 3N5AA 4POZC 4PJ6A 4TSBL 5DC0A 5E5MB 5AEAA 2GW5A 1J8HE 2MPAH 1YJWS 5HVWA 2IV8A 1JVOA 2HVDA 2YQ0A 1QW8A 1ZSDB 2VMDA 3EGSA 1G6BA 2VH7A 1AW0A 1J12A 2F8OA 1I6JA 1QAJA 5EHHA 4O4YH 4JQXC 2ZWPA 3QDJD 2UZYB 5MEOA 3O6KL 4QKTA 3W0WB 4NYLA 4MRCA 3QLHA 1RMFL 3CCVS 2V9TA 4QAMB 4B5QA 4KK9C 2WVBA 1A4JA 1QI4A 4Z18A 2UUAF 2KZKA 2LXIA 1SN0A 2I85A 3W2VB 3IDIB 1SXNA 2XTJE 1QLFA 2DLFH 1WZ1H 3BHBB 3LXUX 4XNMB 4P4KB 5F7AA 1JNRB 2C9AA 4IHBA 3ZMEA 3HG0A 1AP2B 1AACA 3HCVB 5D1XB 4M5LA 2AKRA 3N6YA 7FABH 1NGPH 3ETMA 5E0OA 1Z9LA 2X4NB 4J3TA 4DP9X 2G5BA 3PJNA 3GLJA 4JI3F 1A4KA 1PYSB 4KXDA 2EI5A 5C6WH 1I9RL 5DT1H 5BPPA 4NQVB 1JZ2A 1PLGH 4LL4A 2EDKA 3DKHA 1QTSA 3DUSA 2WQSA 1U3HD 4GAYA 4UAHA 2JDJA 3IPFA 3B9AA 4E9RA 2OSQA 2X0UA 4IMKC 4DDFA 1IGCL 5BV7B 3S3BB 3D6HB 7FABL 1CU4L 5EGYA 2X70A 5JOEA 3CDGA 1ZS6A 5DJ2B 4RQQB 1UB5A 5T41A 4G71B 2F8VA 4BZ2A 1P27B 3KDNA 3A8IA 3HE6A 4FFWD 1NJ9B 4KHTL 3FO0H 4OIFA 2A6MA 5DG7A 3ZTDC 2QPDB 3QUMH 2ITDA 1FVCB 5I0WA 2YMOA 1ZHLB 2EDDA 2HVBA 3K0JA 3RPKA 1UZ6F 2X41A 2B9WA 5CEZD 1Q9WA 3T8MA 2P24B 2ZAGA 4PJGA 3HKZA 3A8JA 1YJ9S 1S10A 3STZA 3BP7A 2IAAC 5KVFH 4WZQA 1R3HA 4YVUA 1FZMA 1YYML 3MM8A 2V17L 4P5TC 1P4BL 3WNMA 3DK0A 3VAIA 2DNNA 3K72A 3K6FA 2CKNA 4KY2A 9PCYA 2EH7L 5DZNA 3FU5A 2XY6A 4NT6A 1WE5A 1JKHB 1TU0B 1I7TB 2VERN 2H48B 4UF7C 4NUJB 1NGWA 4JP8A 4XWGH 5B4MC 4USKA 4WF7A 2ADIA 4HPYH 1B0IA 3EOTL 3LQZA 3QGVA 4WK0B 4XRCB 2QN6B 3F58H 2R1WA 3BQUC 2R4RH 3HNSL 4JFXB 4RSYA 4X6DA 5BQ7B 1HXKA 1G7MA 2UUDH 1AKJA 4WWID 3CDAA 4OJHA 4MKTA 1S3RA 2LA4A 4C4UA 1EJOH 4J23A 3SKMA 4FKEA 1UKSA 2H7WA 2EABA 4KI5D 2B51A 2YKMB 4MJID 4N0UE 3HN5A 3QUZC 3TNMA 5KFDA 1OK8A 1QPXA 2GK0B 2V2WA 4FYYB 1QPPA 1LNQA 4EMZA 1W0WB 4POUB 3L3GB 5DQDL 5FV1L 5J11B 2IHR1 5C24A 3LKOA 3P11L 4H13C 4KZDL 4ALEA 3H5YA 4JI1J 5EIIA 4MAUL 1MWQA 1FZJB 2FQGA 3O4LB 1XGPA 4RGOH 5F7MC 4M5DA 3FTGB 4LKCA 1T89C 1AANA 2KLRA 1KN4H 3OAZK 4FYSA 4ODHH 4ZOSA 3D34A 3EXLA 3VFVB 2IGFH 3FCVA 1I9IL 4Z77B 3OC8A 1B4TA 2Y9RT 4FTVB 2HJLB 4UB0H 4KU1A 1VGKB 4RNFA 3B7SA 3K7RA 5B1CA 4J6RH 1TUVA 2LU1A 2B5JB 1KNZA 3M2UB 3CE1A 5GZND 1YEGH 2WVSA 1SMOA 3QWQB 4MFHA 4OSUH 4CW1A 4Z7NF 1OOAA 1EKSA 3B4DA 2X38A 5FX3A 4DL7A 1U3YA 1JZ4A 1XDTT 2DJMA 3EMTA 3WUWA 4APQD 4HC1L 3S01A 4PUBL 1DEEA 3HRZB 4N7TA 2V67A 1EJ6A 1XGUB 5M7QA 4O44A 3AS2A 4RFOL 4P57A 4TLTA 2OMYB 3DHWC 4WFAQ 4HZAA 2JC0A 2L7JA 2OMWA 3EH5B 1KB3A 4IOSD 2VDLB 5AW6B 2E7LA 2HFEB 1R0AA 1SYSB 4FS0A 3ZYOA 3HHDA 3ILJA 1T80A 2DQTH 3OB8A 3OPZL 4DO6A 3S35H 4ZK7M 3I50H 4DL2A 4FQLL 4QRQA 4Y1AB 1RTDB 3C6UB 1Z0NA 1NBYB 3DMMC 3FSIA 5EU7C 4H4MA 2DEXX 3DRQB 1QVOA 4JG0H 3T0VA 1P5UA 2DTSA 1JDDA 2CRYA 1ZM9A 2I07A 4FQLH 5E5NA 4LCIH 3ILQC 3KLQA 1UVMA 3CJJA 4NUGH 4MA7H 3HJVA 1OQ6A 4PV8B 3BREA 2YGOA 3I6KA 5JMRA 4I69A 4ELMA 1CG9A 5HI7A 4ZS6D 1ANUA 2QR0B 2OX5A 4AMKL 4YPGA 1JNLL 3GWCA 3C75A 1HZHH 3BZEB 3KBEA 4OZFH 4Y00A 2P4AB 2R15A 3O4OB 3BYYA 3S3CB 2NLJB 3LNGA 3DO7A 3HZ3A 4TXVB 5G5DA 3JV0A 3P2DA 4BLGA 2B4CH 5E6YA 4PR5B 4X7TB 3X12A 4I7FB 4YHNB 5LOQA 5ETRA 3GTNA 2H1PH 4X4ZA 4ZMNA 3QEQB 2B9EA 2H9ZA 4QHUA 3MURP 4FKYA 5J1EA 2QPEB 3ZE2F 3GMRA 3IDNB 2LVCA 4HXBH 2OZ4A 1FFNB 2OL3L 3QDJA 4XNXL 4E9XA 1K8DB 1S8DB 1N5YH 4F7EB 2UXCJ 4RZCA 1A8ZA 2K70A 3OKLA 3GM8A 3OJ2C 3DGGB 1B3TA 4MYTA 4OIBA 2G2OA 3QC5X 1WIUA 2W9DL 3IRZA 3MXWH 4LFAF 3IJHB 1YC7A 2EDYA 1V3JA 5JHMA 1DLOA 3D0VB 3MRLA 3DLHA 3LO3A 3C6LA 2VFRA 5F9OL 3WIVA 5IHUL 2BXYA 1T4KB 3INUH 2Q7NA 3C09B 2R3VA 3WDOA 3D25A 1WF5A 2V69A 4A68A 7FDRA 2M7SA 5ESAA 1Q0XH 5I30H 3L15A 4OM0L 3WEMA 1RT1B 3MRPB 2ICWB 3NT0A 1LO0H 3RL1B 2Q6WB 2Z0GA 1D9DA 1A6TA 4WHTA 1BCIA 5SV4A 2HURA 1JZDC 2JJTA 1UVJA 4M1DL 3UYOD 4PWDB 3MEEB 5B1JA 3EAKA 4ZFZA 1R1CA 1JYXA 1EAQA 2OKQA 1T0NB 3H9SA 1V3ZA 5JXEC 1E4WH 2BX5A 3TTSA 3Q5YA 1IM4A 2GSIA 5LCVH 4TSAH 1BYPA 1XHHA 2C8NA 3W5NA 1FRGH 1WITA 2H2SC 4FAAB 1LWEA 1XH0A 3IDIA 1IAOA 5EV7A 4EFAC 4JFWA 4QPTA 2YKKA 4JV0A 2AJXH 5AOLA 1MNUL 5C0CD 4LQFH 1WWHA 2DGXA 3A3NB 5ABZA 3QPQC 5D1XA 2VDKB 5E9DE 1INEH 4JHUA 5FECB 3ROOA 4M1KA 3RUGF 3FCTA 1ZT4B 1ORSA 1R3LB 3EJYC 5C07D 3ETBF 3S8GB 5J2NB 1EJFA 4HS6B 3ZTOA 3OHMB 3GJEB 4M8LA 1M6OB 3IAPA 3HHSA 2WJ5A 4V2BA 1V05A 2EO1A 4G80B 3FH7A 2O4EA 4DV3F 1S99A 4G3YL 3OUYB 1FNHA 4YB5A 1TK0A 2VOPA 4CADA 2C2ZB 1XCXA 3EGNA 2W8CA 1OP9A 2K8QA 3I3EA 2NY5C 5CN2A 4ABVA 3R27A 2WYHA 5C5JA 2VLKA 4ZX4A 1JMTA 1D6EA 1YCSA 1NCDL 2B0SH 2BIOA 4ZODA 3WJLA 4IOBA 1UCBH 4EZMA 3BCFA 4RNMA 1CC3A 4K9EL 3ULVE 5DT1L 1IL1A 4LSDA 3DX9B 3H85A 4JBSA 1ZE3H 2IWEA 4PLNC 2KERA 4JY6A 3D1MC 3JQJA 5D77A 3WFBL 5LN4A 2BYCA 3P0YH 3STZB 1G7HA 1WZAA 5EO0A 5HAOA 4ODWB 4FYTA 1AQHA 2Y1JA 3L95A 3B6BA 2BMBA 1N2RA 3PDNA 1KSHB 2BJ8A 1E90A 4X65F 4Z1PA 2H8PA 3ECBA 2CDEB 1F1DA 4UQAA 1WEYA 3SCJE 4JKWA 2LLZA 4RBTA 4K4YA 3NG5A 4IIQB 1FVEB 3ES6A 3R7SB 1KN2L 2GHWB 2Q79A 5KW9L 4NXKA 2AMGA 2VQTA 4PRIE 3SIKA 2KO1A 4BHUI 1VRQC 4PEOA 1UXSA 5K8OA 4B7LA 2OD4A 4MD0B 2MZQA 1XWVA 2NNAA 4Q52A 2Q8AL 3NGSA 2AQ2A 4NLXA 4MFBA 2QLYA 1BWWA 4HGKC 1VBYA 3MM7B 3I02B 4U7UK 2DF3A 2P3YA 2J56A 1BD2A 3PABA 3UPAA 1MVUB 1FFOA 3VXOA 1NSAA 1U02A 2J8OA 3LVEA 4H2CA 1X5JA 2R0ZH 2YN5A 1MJUH 5I16B 1E4JA 1ZEAL 1AXTL 1I8IA 3AS1A 3PNWB 1DQQA 4RMRA 4Q6IC 4BEIA 1NL0L 5AG8A 1OSCA 3OXLA 4LRCA 1U8LA 2FJWA 1CQKA 3MRGB 4JFTA 2CBPA 1A7RL 1BMZA 1SXZA 2LE9A 3AS0A 4GBXA 4FVCA 4LCCB 5EOCJ 1B6UA 3VD9A 1YYLH 4ESKA 4QT5B 3QAUA 3M30B 1P2CB 3GI9H 5F0MB 5F88A 1JFQH 5IB2A 3RKPA 4AYFA 4KGMA 2OAUA 2BDNH 4MK8A 2XY1A 5FYKU 1BQKA 3IDXH 1NKCA 3PYFA 4YK4C 4DPBX 5C9JA 4N41A 4JRYB 1S6QA 3UH8A 3A4EA 4I3RH 2VLRB 4KDTA 1A4AA 1AJWA 1QSYA 3LNDA 1JLFA 2AAVA 3FB6A 3QWPA 4ZVSB 3NCJH 4ODVH 3GKWL 2GFBB 3VXQB 3CSBA 4LB8A 3OZ9L 3EOYG 4FQQA 5D7EA 3H4BA 1QD1A 3TYGL 2R7OA 3BQ1A 1T03A 3T3PB 3HRZA 4GRWH 3RGVC 3ABMB 4CBZA 1N5VA 4HX1A 4WGWB 4P75A 4NRYA 3AFLA 5B39G 1NMEB 1AS7A 4HDIA 4RE1A 1VQMS 1S7TA 2A0LC 2OELA 2ZKYA 5IROA 3F73A 3QPXH 4GUOA 1I94F 1XNRF 4J28A 3ZW3A 5IT2H 2NXYB 2Q1EA 4NPKA 3GHEH 4WTWA 1RK8A 2MY8A 3FHEA 2GI7A 4I6WA 3AQDA 1JXLA 4CKQA 4N2BA 1MJJB 1X4DA 4UT6H 3L4VA 2QRRA 2ZOWA 4JO4L 4DEUA 1QLNA 4J5OA 1FT3A 3W56A 3MLSL 4GKJF 3OD3A 4QZVB 2CGYA 3SD5A 2O67A 1CFTB 1EDHA 5EU6A 1HR0J 2X4UA 3ESVF 4XC1H 4QOTA 1GAOA 1ADQA 4XMPH 5HP1A 4GI8A 3D7PA 4H5SB 2ZWSA 3RNKB 5GJSL 4PW3A 4JQVC 4N4YB 2R23A 3LTOA 1HNWF 1FBIH 3CLFH 4QRPD 1UZGA 5FM4A 4NO3A 2KZZA 4WDIA 3OR6B 4KXCA 2LU5A 5DJAB 1R3NA 3PWPE 2YD9A 1X5MA 4GP8B 3M7FB 4DUYF 4A6YB 1U1LA 4NFDA 5KG9A 2DPJA 1YG9A 2FT6A 4ZO8A 4DTGH 2OMUA 1FDNA 3EJMA 5K33A 1QFUH 1FCGA 2CIKB 1N64H 5ALCL 1AZSB 4BDVA 4RW4A 2CKBB 1QR1A 2VUKA 3OKOA 1N26A 2WYIA 4X9FA 3MOAL 2FVPA 2VDRB 4M8QB 4D8PB 5HYJE 4LGPB 4MK7A 5ETOA 5C42A 4ZW5A 1O6XA 3BWAB 1VYAA 4OH2A 3QG7L 4M5GA 2CNNB 2WTFA 3UBGA 4H8VA 4IO1A 4FA8A 4KDTC 3ECUA 3O9WB 1NFIB 3PJSB 4G9FA 4OZHA 3RWIA 3RKDC 1U0HB 1RQ5A 3HFZB 2ZZNA 4HJ1A 1RT5B 2GUOA 2QBWA 3NCCB 2OSWA 5EEUA 2EFOA 4KTEH 5KOMC 3MLPA 2AYGA 2VDNB 1CQNA 3HNTL 3K4AA 4F04B 4N24A 4XMVA 2XPYA 5K9JL 3DYOA 1GC1L 2PE8A 3FRZA 2MQPA 2J12B 1SDDB 1F00I 2XPGA 2VH5L 3SY6A 1FF2A 1WBXA 4QEGA 4QRUA 2F6AA 4U1MB 4W4NA 1GOGA 1X9MA 2L8AA 4MB5A 3EOAB 5C2GA 2V9WA 2ARJA 3ESMA 5EO1B 4YFDB 2X1GA 1HL4A 4G82A 1REGX 4XPCA 2IPTL 2HTKC 2WXRA 1TTRA 4HWEL 4XPAH 5KFFA 3O2WH 2EC9U 4Y1SA 4JO2L 1KV7A 1NHVA 5KFXA 5FA4A 2V0AA 2VDML 2ILLA 3I9ZA 3QZOA 1EZLA 5D5ME 5CP3A 2WINA 4USIA 2EE6A 4K7PY 5JDSB 3N43B 4FXKA 1FAIH 1M2VA 2EEFA 3SBRA 2KJVA 2KXFA 1F4AA 4OLEA 2WVTA 3FULA 1H0DB 2YKPA 2Z2MA 1J8HB 5F70A 3TUIC 2BWQA 2DDQL 1OANA 1PZSA 4I0CC 4XPAL 3ET6A 4LVNB 4QTIH 3V5RA 5C0AE 1IC7L 1T21B 1U8OB 3EYSL 4N2FA 4TUOA 2RTTA 1F1BB 4BE6A 1HQEA 2ZE2B 3ARRA 2XNQA 2FB0A 2PI4A 1G3OA 5DZ9A 1Z7JA 1GS6X 1CDCA 3VGEA 1ZS8A 2WRMA 1SOXA 3KG5A 2MQGA 1CC8A 3BH9B 3O2VL 3TA3C 1AOZA 1GS7A 4GSDH 2EIJB 5JHDA 5LN8A 3T04D 2FJAB 3AXMA 3UE2A 5HGDA 3GO1L 1I3OB 3HVAA 5L88L 4A8WA 5JIQA 3LPEA 2JQZA 4QYOA 1VF5C 5LBVA 1A3ZA 1QW9A 1RJYB 4M4PA 4JS7A 3P4NA 5IUSA 1KEGL 4OY8A 1VOMA 5CA5A 4UT9H 5I28A 3QXUA 2GKIA 4IQHA 3TNVA 1DQKA 4YHOH 4PLJC 4J1UA 1NDGB 2AQQA 2HUEA 5J8OA 1APSA 1R5VB 5DGRA 2CXKA 1V55B 3JV4B 3KPLB 5TQ2H 2MYFA 2KLTA 1I82A 3DX4A 4AYEC 1T3OA 4YXLH 3QJUB 1VJSA 3R1HA 4D9RE 4UV4H 3KWVA 2P9CA 2OL3A 2YUVA 3DHPA 2FNBA 3FB7A 3I56S 2VA3A 4NASA 1U8NB 4IRJD 4H1LH 1VQ7S 3TBBA 1TFHA 1G7HB 5L2KB 3MODL 4JQIA 4ZMZA 1ITBB 4Y2DB 1U3HB 5ICZB 1GXEA 1EETA 3V4VH 4JFFA 1CFQB 3VWJC 1YY9C 4PI2A 4X0KB 3LWLA 1KCRH 1MHHA 5FKPB 3WLBB 5J2MA 2UWEB 3RZCC 3TN0D 2CDEA 4LSRH 2SEBA 3VU2A 4YEFA 5I73C 5E23A 3GJFB 3ZUCA 2JJSC 5ID1A 4Y2CA 2EDXA 4ZAKD 5I5IA 4DAGH 1E6OL 4DN4L 2QFPA 2X4PA 5LGYA 2EUVA 1AGFA 1REVB 2B7CB 3WC2A 1LV5A 3TYFA 1O5JA 2KT6A 5TE7H 1YDPB 2CKBL 1YEWA 2XV2A 4GXVH 2D3JA 5HVGA 3KLHC 4TULL 4CILA 2XFXA 5HBBA 2H65B 1G7IB 3S5LG 1O0PA 2JXMA 4E8UA 1SM3L 3TZZA 1BM7A 1R8CA 4J3OH 1HMVA 4QRBA 1KHVA 2NZ9C 1WHWA 2TSBA 1HBUB 4EU0A 3S37X 3PCOB 2WLLB 4DT2A 1RKJA 5DMGC 1FIGH 1F6FB 2DY2A 4XHJC 3NFNB 3PP4H 1DQQB 1KTKE 1EIBA 4MJKA 1RP8A 3L5WA 2NNRA 3EXCX 4N9OB 1NCCH 5LJ5Y 3D39D 3UTTE 4PWWA 35C8L 4FZEH 5D7IE 3NDZE 5KYYB 2IQ9H 3ASWA 1NPNA 3NJJA 1CXLA 4YUEH 3US9A 2YS4A 4LF3A 1LWRA 4ODUB 1P2CA 4IRZL 5L4MA 4YL9A 5HP5A 4ZVQB 3H20A 4M03A 4RGMC 3G6XA 1P1VA 3FW6A 2V5YA 2IPKA 2XIIA 1M05B 2NXZB 4F15C 3HG3A 5HVFA 2J1XA 4GRMB 3HKWA 3D2WA 5IBTL 3N50A 5F41A 4UMGA 2DDQH 4DV0J 1FG9C 5F9LA 1SMAA 3QJVB 1JLFB 1LQ9A 1A14L 3AG3B 4GAGH 3EUNA 2NSMA 3WY1A 2FJFA 5E1HB 3C2SA 2YD4A 5A1AA 3MOJB 1NCUA 3U2SA 2ZHOA 3PYEA 3NCXA 5DU7A 3V0WL 1D5BA 1T03B 1DBBH 2H47C 3AY2A 1KLFA 3UBXA 3WJJC 1M5KC 1L9QA 3GS7A 3LEXA 4N90D 5DMIH 3MEDB 2QX0A 4JFEE 3TBWB 2DBBA 5I6NA 5F6IC 4WJG3 5DLGA 4ECWA 3UZQB 3K8WA 3KKFA 3PHEA 3K6OA 1IWGA 1GH8A 4RRPA 4FQXB 5FWRA 4Q7DA 5FS5A 3RWFB 1IKFL 3CCUS 1BVZA 3GYXB 4R5TA 1RJLB 3RUGE 1NUEA 2XV0A 4PS3A 2DQEL 4TOYH 2DQJL 3BWSA 4XIUA 3B7YA 4UU9A 3B7RL 5D4JA 5FUCC 5BRZA 3VAHA 3PQYA 5FYKH 1H72C 3EO9H 1MLAA 1URNA 1ZA3B 4KTEL 3L5JA 2YNGB 4MRBA 5J2QA 3MRNA 2XMAA 3FL7A 2BFVL 4ALQA 3MMCA 1NCOA 4O3RA 3OJDB 4EJ1C 2FBJL 1O5DT 4FYXB 1BZDA 2BSSB 3ELAT 3EH4B 2BSTB 3PFUA 4R4FL 2WWNA 2F74A 4LRNH 4U49A 4OD3L 5C0BB 3GILA 4RDBA 1ID5I 2G5RA 4MB1A 4OF3A 5I19L 1Y1DA 2ZITA 1KVIA 9RUBA 2H0FA 2EC0A 3P4OB 3BT0A 2ATPB 5E8OB 3JTSB 4UZCA 1MU2A 1T89A 3GBEA 2NZCA 1SXCA 2JQMA 2R2HB 3L4BC 4N8OA 2PYFB 3LXCA 2PNDA 2VN7A 2DH2A 1ZETA 1K5NA 4Q2ZA 3UTOA 2DLGA 1PKQA 1ITCA 4UV7H 1D5IH 5GS0L 4TYAA 1NFDA 3VZIA 5HHMB 4BWTA 3L4ZA 3RVWD 3AW5A 2CQ3A 2WBKA 4OFIA 4QJ4B 4OYBA 3ARFD 4Z2XA 1NGZA 3AQXA 5CSBA 3D0LA 1G43A 3Q48A 4QYZK 2NQPA 4Y4KA 3UTTB 4XGZA 3MM5A 4L9LC 3T4AA 3E3QC 1SF5A 4KHRA 2FUQA 4FQJL 3KCWA 4XMPL 1JBJA 2FEEL 2M26A 1EGJA 1M7DB 1R5WB 1U92A 4GO6B 1HI6B 1RFDH 3X13B 4RCAA 2ZNYA 2CUIA 5LT5A 3MDJA 4EEYA 1PQZA 2OSLA 3BWUC 4X9HA 4PJ8B 4IU2A 4Z8FH 3WHXA 2AK4A 2CCVA 2E86A 2OZ4H 2E5HA 3CJQA 3P3TA 5DQJA 5C0AD 1K9MT 3K7UA 4IMLA 1K4CB 4F9LC 3GTYX 1PCSA 3J80U 5GS2D 4PMEA 1KB5L 4FLQA 3QPXL 2JEFA 5HNPA 3DGDA 3RBQA 3LZQA 3DU5A 3M1CA 4NRXB 1L0PA 4PG2C 3JUZA 1JV5A 3WNJA 4YE4H 4ER8A 1HNXJ 4WVRA 4C8KA 2FLNA 2JV6A 2CNZA 4BRVA 5GAEU 1AROP 1G1XA 1Y18A 1X5SA 1L7IL 3OD2A 2CHDA 2OULB 2R42A 1AFVL 1KBWA 2DLTA 4YGAB 5IMOB 5ETPA 3ZC4A 3OHXA 4MMOA 2AJSL 3IMVA 1GW6A 1DVSA 4TUOB 1Q16B 4IBYA 1XR8A 2WHOA 3S88H 4PG7A 4BH7B 2NUPA 3WENA 5E94B 4C56B 1OYDA 3MOZA 3ZDZE 1CE6B 1CYGA 4C8YA 4YBLB 3COOA 3ZE0E 3MO1B 4E5XG 5CWSB 3N4WA 5K8NA 2BMKA 2ZX5A 4ZCKA 2BOBA 3S2AA 1XMQF 2ZXDA 3GIZH 2Z4QB 4JPKL 1JV2A 1VGEH 5I1IH 4E36A 2CAJA 5D7KE 2W4CA 2R56H 1WCBB 3MUY1 4F33B 3FEXB 2YAFA 3C60B 1N0LA 4JQIH 3VGGA 2AVFA 2NX5E 5J12C 1IAMA 5HHOB 3NJGA 3I82A 3EDKA 4ZW3A 3UC0H 2YKLL 5DFVD 2J25A 4FPIA 5TH2B 3Q89A 1RZJL 3RVUD 3L95X 4YHZH 3LH2S 3UJTH 3TZXA 3M6UA 5D5MB 1LK3L 1UW4A 3UG3A 3X3FL 4HJIA 2HGMA 1YNTB 5FUZL 1CR9L 3EUUA 4WTOB 4Y0GA 5C08A 2M8HA 1JCVA 2PPFA 3BGAA 3QO1B 2NDFA 3EG9B 2IGTA 1DTQA 2E4TA 3D3VA 2ZOMA 3DNCA 4I67A 2AEPL 2CWXA 5EC1A 1VB9A 1OB0A 5J2MB 1Q72L 1LFPA 2CUHA 2HFFA 2QVFB 3VI4E 3BEVA 4HBCH 1HZHL 3NSXA 4XBGB 5SWSB 3UTSB 2Z2ZA 4FXDA 5ID1B 2XMMA 2ADJB 1SBSH 5FXCH 4L2YA 3W1ZA 5BVPL 1N5YA 1FA4A 1HNIA 3T1HJ 3DMJA 2BSRA 4QOKA 2CQGA 1FV1A 4N3TA 2HP4A 1L3TA 4ANXA 3SJVD 1AR1C 4K4XA 4P49A 5AKSA 5HXMA 4CMMA 3IS9A 1X4AA 2C3YA 5IK3A 2UY7A 3MREB 4GIAA 1AZBA 3I87A 1ZHNA 1N59B 3GXFA 3HUJF 3L4TA 2VDRL 4JI7J 2EK1A 1QATA 4F7CB 4MA8H 2V33A 4OJ1A 1WT5C 1DDHA 4M6NL 1EFXD 5AOMA 1VACB 3GGWB 4U3XA 2NR6A 3ARVA 2Z7UA 3FSYA 1B2WL 4MYWB 2ZUAA 5I4MA 3BEWB 2F7PA 1HH4D 1RT4A 1HE7A 1TZGH 4ACTA 2AT1B 4POYA 4GS7C 4NRTA 3O6LH 2EZ0D 3VB8A 4FFWC 3SOTA 4E5XB 4PJFF 3KCPB 3DLKA 2DHAA 4F7TA 1HHQA 1W72L 4L4VA 1M05A 1N7MH 2DWEA 3SPVA 5IW1A 3QDMA 1QWNA 1JZ7A 3KXFD 3R3TA 4JI8F 3ERXA 4V1DB 3CFKB 3BZDA 3ZN6A 5T33L 4FQ2L 1NDPA 1FJ1B 1Y00A 1E6JL 5KFAA 3ZO7A 1CLZL 4A7TA 3G87A 3WQPA 1XXFC 4BC7A 4IKKA 4Y4FD 2X1PA 4NCGA 1FXRA 5ILTL 4MJIB 3AAWB 1QDUB 1NK8A 1IM3D 1U24A 3SKJH 1OM9A 1PZ5A 4LLMB 3U9PL 1O6TA 3IJYB 2W0LA 4WUUA 4XPEA 1BG9A 4OFYA 1T20B 4DZ8B 1YEEL 5C0GA 4NQEE 1E3XA 4L73A 3VTAA 1X5AA 5B1BB 3RB0A 1EAOA 2WIMA 1FT8A 2CQDA 4WWKD 2VZOA 2ASJA 5DJCB 3VD0A 5IQNA 5ITHA 1JLEB 4QRRD 4GSQA 3U79A 4HULB 3QJPA 3UPRB 1N6UA 2RNEA 4LZKA 5FLUA 4EZJA 4FNRA 3WSQL 3CK0L 2AKRB 1J5DA 4JFDA 4FTVD 1EB0A 3HSJA 2M8XA 4UM8B 2W80C 4NC1C 1AH1A 1BXNA 1PVHA 4DQIA 2DQUL 3MEGA 4XWGL 2NY0C 4FP9A 1BVLA 4ZITA 1FO1A 1K72A 1M6UA 3B9EA 3BO4A 4NQVA 4TUJA 3ENVA 2MCPH 3CLEL 3RPIB 2BJ1A 2XG8A 4P2YA 5EBMA 4FXWA 4YY3F 1E6JH 4DQPA 3UTPD 2DHGA 1RHMB 3E01B 2F7IA 3HLUA 5BXIA 2BOPA 1RHFA 2GVYA 4P9HL 4YBQC 5I6MA 5ERWA 1UB5B 1IQZA 2UXBF 2FL5A 2VICA 3OTEA 4EMDA 1AGCA 3VSQA 3GSUB 1X5TA 1XH3B 3MYZA 2CPJA 4BSVB 2TSAA 4FI8A 2M8DB 1F0XA 1JGUH 4TVPE 3ZY7A 3DLEA 3RZCA 4K4SA 4PQUB 1IEAA 4I2XB 2DIAA 1VRSA 5CHNA 2EC2A 1SL2A 4DG1B 2NRDA 2ASDA 2VDQL 2A6JA 3O6FC 1FYTB 4KHTH 3VFOB 4OJYA 4JZOA 2G4BA 3HUJA 1RTHA 4CVZB 1H9VA 4QIRA 1TQWA 3U25A 5DQEA 1JF5A 2V34A 4M6NH 1HL9A 3U02A 1ET8A 2WVVB 4BZ1A 2WNKA 2Y24A 5IFJA 3AD7C 5I42B 4R2GC 5EN2B 3SODB 3LHPL 5EX0A 3T5HA 2WQWA 1E3ZA 5KYXA 1QUNA 4N86A 4KRLB 2GC7C 1MSPA 3QJTB 2DM4A 2VO8A 4JFOB 4JDVA 2A3TA 2YSSA 3D09A 3K0WA 4FMVA 4HEPG 3I4HX 2WYZA 4KJWC 3I9IA 3RIAK 3ZQ9A 3TAQA 4NZFA 2F5GA 4F5CA 5BS0D 1GJIA 5CD4H 1YN6A 1MZZA 2DNLA 2AJ3A 3CC1A 3IBEA 4ICLB 4DCOB 5K9KA 1IN0A 2R2UA 1IBKF 2OSXA 3T6QC 3UX9B 1FGNH 4OI4A 5J6GB 2ZIDA 4NMXA 4M5ZH 2YK1H 5K20B 4DKFL 4A4JA 3PDOB 4HBCL 2XWEA 1TKZA 1IGJB 2E27H 4JJ5A 3HT0A 3GDBA 5E24E 5A6LA 1HKFA 1BOGB 3DJSA 4HAFA 1P9MC 4PUBH 3U6XS 1ZVNA 3WLWD 1A7OH 1AUDA 1QO3A 1LW2A 1BMGA 2VR3A 2F61A 3NZ8B 4PJDB 2YXLA 2XSJA 4R8UB 2Y7MA 2O5ZL 1VISA 2XC9A 3VG9C 1YPZA 4MXWL 2W07B 4UAOC 2X9XA 4D0BA 1E6YA 3TVMA 4O4YL 2Z6FA 5C24B 2E29A 4UDUB 1HOCB 3SV3A 3UP6A 4ZT1A 3GJSB 1HHGA 2WXFA 2D3OR 1BIIA 3DMMB 3GFXA 4Y5XC 2ICCA 4RAUA 5TB5B 3KLVA 1FE0A 4E41E 3G6VA 2NREA 4O3SA 5E51A 2HHVA 4X5WB 4IR9A 3AVEA 3LAMA 4DFIA 2GJ6A 4PJEA 2AJ0A 1RIVH 3DI2B 2BW4A 2VAJA 4JQIL 3B2PA 3LD8B 4OUUA 4OX7A 2BQUA 2AJ4A 5D93C 2XBTA 2V4LA 3K6SB 2CPZA 1KQSR 1BVKB 1U4FA 5KSBA 3QO9A 4AE1A 3Q8FA 2VITB 3CIZA 4NXNF 1ZAWA 2QIFA 3QIUC 4E98A 3DPBA 1JRHL 2ZKHH 5TTRA 1FNFA 1UM5L 1GJUA 4G6KL 4DVBA 4CH0S 4IBZA 4G43B 3CMOL 4H7VA 4GC7A 3C5ZA 3WTYA 1TETL 2FYYB 4GRLD 4BK4A 3GB7A 3UBFA 1MNEA 1KB9K 1W8EA 5BUGA 4EOWL 4X65J 4NZUH 1ACYL 2LMIA 2H32H 1TPXB 4U1IB 4UOGA 5LXYA 4IOSA 6FD1A 3QUXA 3VD7A 2ITEA 1N88A 1L7IH 4O4GA 4YLBA 2J6TA 2R7XA 4K8RD 3JZ7A 3BPNB 4EVNA 3WTWA 5F3HB 4BH8B 4IBQA 1SL0A 4PJHB 5C0BE 4AI7A 1CGVA 1IFHL 2YD8A 2Z7WA 1TJMA 4YDLC 4AIZB 5DWUL 2DWYA 2P28B 4JDZA 3HD1A 4XPTL 3U9UB 3HE7D 4Y2AA 4X80L 2A2QT 2Y1YA 2ILZA 5IV3A 4ZSOE 3RDTB 2FHFA 3MACH 3ZK0A 3H2PA 2XTJB 2ADJA 3H7BB 1PSKH 3TO4C 4BQBA 4M5SA 4HLZG 4ATWA 4ONOA 3HC2A 3SCIE 1ZDSA 3MLTB 4G3IA 3WG7B 3JUYA 3ISNC 4K94C 4JPWH 2GO9A 4KJWD 5BR8F 2P46B 2O1AA 5A2JH 3QUML 4AG4L 1L3KA 4U1NA 3ETBJ 4BGLA 3K1DA 3MRJB 2ODIA 4HJJL 1QBAA 4WYWA 4JI7F 1QAWA 1N59A 2JELH 5MEND 4Y2DD 1R8PA 3HIZA 3MUUA 4X4XB 3PJLA 5FCUL 5DHYA 1TJHL 3CCQS 3UP1A 3KL5A 3Q7JA 3UCZP 3DSNB 3K4ZA 1ZTXL 3K3QA 1CBVL 2DYRB 1QSFD 4ECRA 5JIDA 3DGGA 3FYIB 3BP4B 4NQTA 3U36B 2EFGA 4GG6F 1MG3C 4WWPA 5CS7A 2PCXA 2W81C 3ATAA 4ZS6C 2OEJA 2Z92A 1PZ3A 1QWHA 4RUHA 4E41B 3BPCB 2HJFB 2ICEA 3RRHA 3EYFA 1PNCA 1Z9NA 2OLDA 3V4UH 4BFBD 5DDPC 4JZJC 4UOJA 3QA3B 3R1GH 4HS3A 4PB9L 1P53A 4B9PA 5FF6B 3D25B 3QWRA 1SBRA 4B7IA 1TVRB 2M2DA 5HGBA 5DA4A 5AB0A 3FFCA 2NY5L 1JWUA 2VDPH 3MRPA 2W60B 3NJXA 4M43L 4DK3A 3N01A 4XI5C 4LOUC 1A6LA 4B3SF 3HC3L 5HHXL 4P71A 1EPFA 1T3FB 4HQQH 2ZKTA 4WSGA 3RFZC 1T0NA 1H73A 1RBOB 2DTJA 4C3LA 3QCUH 4HUWB 5BV7H 3IDYC 3PDDA 2WVUA 4R8WH 3JWDH 3WEXA 2ZKUA 4QXGH 3TL5A 2ITDB 5FFGA 2AEOA 3QNZA 3U0PA 2VG5B 4ATNA 1NAMA 4C59B 4TNWF 3V7AE 1QHOA 2QHRH 1FKOB 1KIQB 3QFHA 1HL8A 3ZZLA 5I76A 5IWLA 2KBGA 3AB0B 3S3JA 4QWAA 3QHZL 3NCMA 5HTSA 3TONA 4Q97A 2FX7L 4AQEA 4NQUA 2VZ9A 3BSOA 4G8IA 4FF4A 1IBGH 5CZVH 1SN5A 2CLVB 1INQB 5ACFA 4WWSA 4A55A 2QEXS 1MWAA 5JIHA 3VI3B 2O6CA 4UDTB 1HARA 3Q86A 1ORQA 3A0OA 3DI3B 1YZ6A 5HBMB 4WXWA 4I48B 2E9GA 1F97A 3MRBB 1HPZA 4M7JH 2GQHA 2NTFB 1TKWB 1OHQA 4LHUD 4NPYA 1LE9A 4HIIB 1IAIM 1TJGL 2AI0H 1J88A 3LKNB 5GRJH 4NO5A 2GBAA 4CVUA 1MFDL 4RWXA 1G7MB 3REWB 1RK7A 4ZYKA 3H0PA 4Q2LA 1G1CA 4B5EA 3MR6A 4PRIB 5D2NE 4YHHF 4NPOA 4M7LL 4ZPWR 2NY3C 3LP2A 2HWHA 1WPCA 4KI5C 3GBNL 4FZ8H 4UTBL 1KBRA 4MH8A 4PRNB 1VDGA 3VFPA 2AJFE 3O45A 4TQRA 2QG9B 3MBEB 1RL1A 3VF0B 4PGEA 2A6JB 5E8DL 1X4GA 5HROB 4GC6A 1MOEA 3ATBA 3JT2A 4LEBA 1KTDB 2E8ZA 2VW4A 1FFQA 3IP0A 2YBRB 4CO4A 2Z56B 1EERB 3QUYB 1UWXH 5GGSB 2XG4A 1I3UA 1HEZB 1LEGB 2R4FA 4AYDC 2W2PP 1A9EA 1UCTA 1OGAA 1EEYA 1NC4A 1JXKA 2ADGB 2HTLD 2VXSH 2XN2A 3W82A 4JDVB 4JFOA 4WW2C 3QAEA 2HJLA 2HW3A 2WSDA 2GEQA 1VQSA 1FC2D 2QSTA 3ASNB 2WMPA 4JFEA 5HVHB 3FQKA 1AR1D 3VFMB 3VRIA 3S8FB 1SB6A 1FC1A 3QQCD 5HK4A 1Q1JH 2ISDA 1HQ4A 1VRTA 1MNNA 2E7CA 2YBGA 3JVFC 3QW9A 4EO8A 2HVIA 3Q8CA 3E6HB 2MZ1A 3RUGA 1XGTB 4RFNC 4QMEA 3PDOA 4V11A 2IMMA 3L7EB 5EU3B 1U58A 1H3UA 2CZVC 2X2IA 3PR4A 1G9ML 3BH7B 1F60B 1GAFL 3DHJA 1IVZA 4Y9FA 4ECVA 4GT7A 2K7KA 4WU2A 1NBEB 5F7DB 4L8BB 4XMZA 4YX2L 5IZ7A 1D9KB 3UTPE 4HSAC 3TM6A 3DRRA 5INDB 1PG7L 4LBIA 1ZD6A 2DWXA 5I6OA 3MJ9H 4U1HA 5TE6H 5LVEA 1ZM2A 5H4YA 2CDFB 4G42B 1FFSB 1TMQA 1GGBH 2JTDA 4PGJA 4UV4L 3VXMB 4B3OB 3F84A 2DGQA 1X44A 3GSDA 3PX4A 3ZT5A 2QV4A 1DJYA 1JN6B 3HNVH 1MLBA 2BRRH 3G6DH 2L4OA 1SHXA 2X09A 4ODSH 4F3OA 4I7ZC 3NJVA 3V5DA 3P69A 5KSAB 3IJHA 4G72B 3K6SA 4Q0XL 3EM1A 1MCSA 1BQSA 5ETNA 3LEVH 3KL3A 4CMHB 4NWTL 1Z2LA 2UZXA 4FMKA 2GIYA 2YNHB 3BSGA 2AV1A 4B9ZA 1XR9A 2VC2B 1XQ4A 3FT9A 4X6BB 2UV3A 4B53A 2APBA 5BS0A 4ZUUB 4S0HA 1EARA 4KV8B 2JHWA 3UNGC 4HUVB 4DSIA 4WV1C 2XWJA 1EP4A 1UVLA 2IDFA 4OR1A 4ZP8A 4C58B 2DGTA 3PL6B 1ZANL 2JKTM 1R47A 3SYQA 1OM3H 1U8PB 4XAWH 5CBEB 4USMA 3MRHA 1XB8A 1LO4L 3EJCA 3K6NA 4D0DB 1YMHB 4QCIA 1UFUA 1OF2A 4N0CD 4L8CA 2VLKD 1HXMB 1T6BX 3IDJA 3VFGL 3ZYIA 4DFHA 1ELOA 1CGUA 4PJIA 1FRKA 2LU2A 5IT9Y 2C7UA 2NYYD 2P5EE 2J4WL 4UOZA 1HHHB 3LH8A 3P49B 2DHXA 4FZVA 4NLPA 2ZDOA 2BY2A 2A6IB 1X31C 5LWYL 3AAZA 2FC9A 2D3VA 4GRWF 3VACA 1GNKA 2FJUB 3LGHA 1TTFA 2LV4A 2X6CA 3EZ8A 5KFPA 3H42L 4JR9L 4M00A 2H51B 4U67Q 5JW5A 1BVOA 5DA0B 4NYZA 4NN7C 2K6ZA 3T0XA 1EHWA 3RL1A 3IM9A 3H56A 2H0PA 5BV7L 2V2ZA 4B50A 4DKDC 2OYPA 2DQCL 5I71C 1UEVA 4PRPD 4LOFA 3HMXA 2JHVA 1RU9L 2CA3A 4K2UH 4FE9A 2RH3A 2PT0A 3FQXA 4M43H 2G2NA 4WE1A 2DAVA 5BYQA 4MJ2A 2Q76A 3BUYA 2AJQA 3RB5A 1PX4A 2OSRA 1I8UA 3SE8H 1ULRA 4EI6A 3FQTB 3TWCH 2BOCB 4Y5VB 4UBDC 4HS8L 3TPUB 2R29A 3O3BA 4JCWA 1AIFB 4MCZB 2Z93B 4X98B 4GJTB 2ZBIA 2X6VA 4FKKA 1IE5A 3KPRE 4ICWA 4Y34A 1HWWA 1ZT4A 4C4KO 3G82A 4HIJA 2P1YA 4BQ6A 3M8SA 3HE7A 5DJXA 5EBWB 3R18A 1EBPA 3VWJB 3HFKA 4TQSA 4EZ9A 4NJAL 5I5JA 5L7XL 3DGPA 1CLVA 3L9ZA 1RUAL 3D0AA 4M1GH 1G9EA 5A8RB 3C6LD 1FNXH 1N4LA 4A8FA 2X3AA 3TZVB 1TJHH 4CC0A 1HHJA 4KX8A 1COBA 1RZPA 4RA3A 4YSOA 5GJTH 2CRIA 3MRCA 5C08E 1VJQA 3NIDF 2HUHA 5DJ8A 3BH4A 4AQ1A 1SC6A 1S6PB 4KBIA 1AQMA 4LNVA 1QAXA 3RWEA 2ZKWA 2HNDB 2J7KA 2MKHA 1D5ZB 2ZVIA 2W8LA 3VXTA 2Y1ZA 4FL4C 1M9WA 2X1BA 3BPSP 5HP1B 2YWWA 3M1VB 3UTQB 3GKZA 3OAYK 1SQEA 3KXFB 3N9GH 3VGHA 3N44B 1GTFA 2ZH5A 5L2JB 5IT2L 4K5OA 3U1MA 1WC4A 2MB0B 1QQDB 3J80Y 4L29A 4UNIA 3MV8A 3T5KA 2BUNA 1YEHL 3TYGH 3VXSE 3O3DB 1WFJA 3TO4D 5JW4R 4CO5A 3TIDA 5ID0B 2X6BA 1BAFL 2XZCH 4G9DB 5I1DA 5JHDB 1J5HA 2I1RA 1N48A 1ORQB 4JKLA 4QRPA 4OFVA 3QYYA 2NYIA 3KUEA 4X50A 1K4DB 3HR6A 2WNGA 4NQEB 3TVMD 3S96A 1FNOA 4B96A 2ORBH 3NK3A 4CL7A 3V6DA 3F7YA 2NY0B 1B4JH 2QGDA 3P4NB 3TBYB 1RT6B 4DSFA 5EF0A 4DSJA 3ULVF 3IDUA 4BHUA 3BRDA 1JZFA 3IDXL 4K5NA 2ZXAA 5A0YA 3DRYA 3ZTRA 4I56A 1N52B 3QMQA 4FF2A 3KWTA 1CDJA 1XCWA 3PACA 4WI0B 2LVWA 5F7BA 1M42A 2CE6A 4TLRA 4LF9J 3BCDA 4BFIA 4G5ZH 1XIWA 4OX9F 3DX2A 2HGLA 3BD3A 2X51A 2GVDA 5HDRA 2QTVA 5EB9A 1VPOH 3F6LA 4EKJA 5E3AA 4C8ZA 3PTWA 2WLYA 2CO7A 1CGSL 3TV3L 2WVFA 5J1NA 5K9FA 4JI6J 3O41A 1RIVL 4JV5F 2KM8B 4Z7IA 1QKZH 4PG2A 1T5KA 5I74C 3P3RA 3V0EA 2J43A 3IMBA 3OAZH 3A12A 1B9KA 3G9AB 4OLPA 5KUKA 2ADGA 1T11A 4KQZA 3IGAA 1T7VA 4UOQA 1FL5B 3VXPA 2XZZA 2HIYA 3HZVB 4W6YB 4QHNA 4F9LA 1RQ0A 4CT8A 5JPMC 4WU5B 3SBQA 2ESVA 4YDDB 5KFQA 3CF5Q 4W93A 1UURA 4EDWH 2VDHA 1KTBA 4PIRF 2YBVA 1KLUB 4K3DL 2P52A 3PV6A 1I9EA 5DO8A 3MZIA 5SX5K 1T1YA 2BSCA 3T4YB 5JNYB 3U6RA 5KOWA 3QBTB 4MNHB 1U58B 1TTUA 4F0MA 8AT1B 4AL8L 3FBQA 5IQ6A 3DETD 5E8EA 5E5RB 4MNQE 3LV3B 5SWQA 1LQBC 4BIKA 4K23L 5GGUA 1R34A 2GB2A 4LCCC 2BABA 2PXYC 1GKEA 1BPLB 3KNBB 5CSGA 4QNPF 4TL5A 4HJ0C 3UTTD 5JXSA 2QGCA 4HISA 1UZHA 3K1KC 4NQQA 4KSEB 5LGJA 1AIZA 4YDIL 3GLAA 5IREA 4U1JA 5AWNH 2CQPA 1LM8V 4JHBA 4AYGA 2UUCJ 3O8XA 1FK9B 3I3DA 4CU7A 3RB6A 1DEDA 1PW3A 1WZLA 1N18A 3P0VL 2WW4A 4ZUTB 1DCLA 4L1SA 5HHNA 4ERSH 5HHQA 3PWUB 5A2KH 4NLOA 3VW3L 2ZUYA 2I60L 4MTMA 3QT6A 2HHTA 2VQ1B 2MZJA 2J8SA 4DQQA 2VDMB 4X5RA 4QXUH 4LSLB 1SQFA 2VASA 5I6KA 1H6TA 1KLGB 4M6ML 1JJ4A 1JPGB 5ECGA 3UEQA 3RBEA 3WKQA 3T2NH 3LIZL 2XNRA 2LHSA 1MY5A 3VD5A 2ADFH 2AV1B 3PRZA 1P6TA 1MAML 4ZO6A 3CDZA 2DMHA 2ALYB 1ZE3C 1ADQL 2WN2A 1FG2A 3QIBC 1IKNC 1VFMA 3MOQA 4YSCA 1XGPB 5K59E 2ZUVA 1QR1B 2IH8A 43CAB 1MCEA 2R7TA 2LR4A 3CHSA 4ZOBA 3BPOC 4N0YL 5IVNA 4ZMWA 1FFGB 1N8ZA 3UD5A 2XYGB 3KMQA 1JLBB 3GMPA 4FMFA 2BKPA 4ZFOB 5DRNA 2H0JA 1KIRB 2YC1B 5HI4C 5T3ZH 5DD0H 2ZHAA 5E6SB 1VFAB 4F5CE 4WI4A 2ZUQB 4Y4HB 2M70A 3ZSTA 1K2DA 4BFJA 5BRZD 3ARBC 4PVMA 4P3CL 3OL2A 1LWHA 3PR5B 2XMVA 2EDHA 5BOPA 1Q9OA 1I1GA 3BUDA 4XOCA 5I1CH 4OAWA 2WGXA 4DPCX 3SDCA 5ACGA 3SYCA 3N5BA 1TEFA 1E7VA 3RY4A 4EIGB 4LRIC 5EDSA 1VK8A 3TJHC 2EE2A 1Q0XL 4X6CF 3AROA 1CGTA 5SX4I 5I30L 4J4PD 3OLEA 1R31A 4YSQA 2WTRB 3K5SA 4QRUB 1ZV2A 1BF2A 5EWIL 2R8SH 4ERDA 5HHOD 2VA2A 3TFBA 2YR3A 4PKDB 4XMUA 1MI5E 4HWBL 2XWRA 1OPOA 3MBXL 1FNGA 5TDNB 3RJQB 3H25A 1YUKB 1S57A 5I1CL 1YEIL 1WEZA 4OI8A 1MFAL 2V9UA 2VISB 4IEFA 4XXWC 2PO6C 2BVUA 1EAYC 5E41A 4DL5A 5ACIA 1MFCL 4WU3A 3BGFA 2TRYA 1N68A 4OYIA 5AOIA 3RG1C 3S3PA 3TH2T 3CVIL 5T1LA 4MYPA 3D69A 1CLZH 2DN7A 1I1AA 5DUBA 1I7RB 5FCSH 4X8JB 3VFUB 3KJQB 2Q0ZX 2MY7A 3L1OL 1EEZB 1IQDB 2AEIT 3QIBD 4JM2D 3OZKA 4KKOB 4G1EB 5EUKA 3UTSD 5I74B 1HE8A 3WNKA 3KL0A 2KRRA 2WWOA 2AW2A 3KLAB 5KVMC 4JFQA 3X13A 4LARH 4H0GA 3IBWA 5A7BA 1QEWA 3CH1B 4OU3A 4XAKD 1PS3A 2KN4A 1MHHB 5FKPA 4PG5A 3E3XA 4WW2F 1KQGB 1A47A 3N1QC 1PZBA 3CFBB 1N3NB 1UC6A 2RH0A 3SFUA 5E6RB 3BQUD 3SBWC 2XLIA 4EISA 1KYOK 3BGMB 4I18B 2ED9A 1HNZF 4X8CA 2ATKA 3VRJA 2CHXA 3BPLC 2ZZMA 1XO8A 5EN1A 2YPLA 2AJYL 2FY8A 3KWWB 1SLUA 5MP6H 4Z0XA 2D7MA 1NCLA 2Y0BB 5ETTA 4W70A 3ZE1F 2KKHA 3ZQWA 1HBMA 3WTTA 5JYLA 4Z5RB 5EN3A 2QTWA 1VQ8S 1E6VA 1BBJB 2ROGA 4RX6A 3HI9A 1JX4A 4Q56A 2WWKT 4WI8A 2XQYK 5C9KA 3E2HB 1N12A 3AOBA 2F53D 3SDAC 3KGSA 3DTUB 4JV8B 1MN9A 1RT1A 1HFEL 1J0YA 4G11A 1WF2A 2XWYA 4G8FB 4QI3A 1UJ6A 4G5AA 3MFHA 5KFLA 3KYNB 1HSAA 4NWUH 2XWXA 3BVNB 3IMWA 2WP3T 3SCMB 5LXVA 5E1AB 3V0VB 3L1FA 3DRSB 4UOFA 1CR9H 1Z0MA 2E66A 3RW6A 1Q1PA 3PW2A 1N67A 5C3LD 2LU4A 4OF0A 1KDJA 3EYQC 2JVRA 2VLKE 1YDPA 1T22B 5IY5B 4FYDA 4WFFE 5D2NC 4OHXA 3DDGA 4WFEE 3TR5A 3CH8A 4HF5H 2EACA 2O5XL 5JQ6L 2NY2C 2PXYB 3H54A 4OZ4B 1QR4A 2EDEA 1FVSA 2IGFL 3N42B 3RU8H 3UXFA 3D2TA 4YSSA 4GAAA 5LHDA 2E47A 5E08H 4ZIVA 3GK8H 4WWKB 5GGVH 2A9CA 5DJ6B 3L3HB 2W7OA 3CXHJ 4YBQD 3FFOA 2XQCA 2UP1A 1QBMH 1UA3A 3FH5A 4N2HA 1YNLL 3KVPA 5E4OA 4AXIA 3OXSA 3AU0A 3Q2CA 3RWJA 1Y0HA 3AB4B 4AXWB 5L4JA 3DV6A 4Y1TA 2FVRA 3TBWA 2EAEA 5ECJE 1KPVB 5CJQH 4RBPK 3ZO9A 1ICTA 2WBJB 4LHUB 2Y9HA 1I7UA 4OGYH 5E7OB 4R5VA 1QTMA 1H7WA 2XDHA 1L6PA 1FT0A 2ZKXA 5A6MA 2ZYRA 1J5OH 2X1QA 1D5XB 1ZM4A 3WMSA 5GAHU 2V8VA 4AKOA 2KLSA 2H5UA 2IDLA 1QFWI 2AVGA 3MRNB 3NQIA 2ORBL 5TPWL 2HIQA 4EYHB 1FGVL 3FOLA 4R0LB 4P3CH 5E8FA 2GG1A 2PTVA 4PJEF 2W9BB 3BLKA 1K1QA 5E2WL 3RWGA 3SI8A 1U30A 4HLZH 2AITA 4YE4L 5CBAA 2JJ4D 3IFLL 4ALSA 2VXUL 1UG9A 4PJXA 4HUUB 4CAGA 2OIHA 2LQJA 3PIOQ 4NLHA 3LDBB 4ZMYA 5GQBA 1HNVB 3IG1A 1FO0A 4JFZH 2IAMC 1VACA 4JYAJ 3HI1B 4K7FA 4M29A 3LN5B 4NM4L 1Y6MR 3VJ6A 5E80A 3I5AA 3WX4A 3HT3A 4DV6J 3WNNA 4RGMB 3FOMA 3Q6FB 1GL4B 3ZDYE 5DVMA 2OZ4L 1DJIA 2PF6A 4XNQA 4I2QB 3EO0B 4FG2A 1JE6A 2XMTA 1RA6A 3H7HB 2LLLA 1DJHA 4A66A 5HHNB 2M88A 2HS0A 1P9MA 1NIEA 2VMEA 2C3OA 3TAMB 1D2PA 5D2NA 5GZOD 1BECA 3KGRA 5ETVA 3EJTA 2APSA 5E2UL 3W3SA 3FSVA 4LSLA 1TEYA 4F7PB 4ELUA 1U8HB 3ZE0B 3NRPA 2HQDA 2NPIA 4PXDA 5CKGA 4N68A 3P0VH 4JFPB 1U8LB 1E8XA 1ZV9A 3ULHA 4Y5XA 5GS0H 2IY5B 1S7VA 2VLJD 4CH1A 1K4CA 1IKWB 3WN5A 4FLRA 4DZ8A 1F6TA 43CAA 4KAQH 3HI5H 3HPLA 2HLFD 1DBAH 1PC4A 1UJ4A 2B4PA 2OPPA 3CDBA 3OR2B 3KHQA 4LLVB 1AHKA 5C2BH 2D8KA 4UTBA 3IAS9 2HT3D 4XNDA 4OYPA 1NUNB 1J1OL 4LHUG 2RCSL 1GHFL 2LT9A 3QG6A 4J6IA 4J4PC 1YECH 2XETA 3DVFA 3OKKB 1D7FA 2VDOB 1GYUA 3F05A 3PL6C 2W2QP 3FBEA 1JZ3A 4Y4KB 3UTTA 2J20A 3H59A 5EIQA 4JPSA 3FQRB 2G9HA 1R6YA 4U1SB 2BFVH 3NGDA 3CXFA 2IH3B 4L9LB 3AUWB 3CSPA 4YS4A 1EO8L 2IV9A 5IHZA 2G2YA 1WI8A 1ZJBA 4Y9GA 3TIEA 3LOUA 3UDCA 1A5FH 5GIRB 1CJTA 4HAGA 1T9YA 2LU3A 1A65A 5DFTA 4PBVC 5DMKA 5F3ZA 5ETUB 3T77B 3KH4A 5BJRA 4I5BA 3ARQA 2CYYA 5D2LB 3LSOA 1RBLA 3HB3D 5HJ3B 3MFFA 5E4IA 3K74B 2Q43A 4ID5B 2IADA 4JHWL 4KNUA 1G5AA 2AJUL 2IGLA 5CLTA 3O6FA 4HKBB 1C1BB 2E1PA 4NNXA 3GBML 2X4UB 2P5WE 2DGVA 2N7YA 4EUVA 4DSKA 1VHFA 3TA4D 3T5GB 1MHCA 3Q1EA 2KHAA 4NZTL 1OPGH 5CGYD 4Y7MA 4J2XA 3NSCA 5IXUA 3OVBA 1LO4H 2D0HA 2EXUA 1DHKA 1L5GB 4MZ3A 3QR1A 1QTPA 1C0TB 5AL0A 3SD2A 3NY0A 2LEAA 2FCBA 2VTFA 3LNIA 4PY7B 1KJ2B 3KW7A 4OKDA 2R9HD 1ZANH 5IBTH 3SN6N 3MX0A 5ESQA 2YD0A 2QMXA 4D0CB 5BRZE 5KAQF 2HHSA 3KLGB 2IANA 5KG9B 1PYTA 3SO3B 1HHIA 1CE6A 3BP5A 4A2FA 3SPCA 3UN5A 3LWMA 4WEUD 4Z76B 3D3VB 1CI5A 1SC4B 4ZPCA 2BOBB 4U96A 3GFZA 4CGTA 3G6JF 5HYJB 3RL2B 1UADC 3ESNA 4FQXC 4TF4A 3TA0A 2VQEF 5L1KA 3SDCC 3R06B 1JZJA 2GIFA 3EPGA 2OX5B 1S7SB 3CULA 2ITCA 1EX8A 1QNZH 1RADB 2Y1RI 4ZOEA 3ASOB 4B9TA 5CCHE 5HHOA 4QIVA 1HNYA 4KKRA 2V2TA 4OZHB 3M88A 4G9FB 4YE0A 3FZUC 4P2AA 1WHVA 3OLBA 3UTZA 5L9DL 4H4NA 2C3VB 3T0EC 5JZ7D 1AKPA 1KVJA 4DEPC 4KY1H 4YSDA 1JHTA 3WU1A 4AJWA 1BWVA 2ACMA 5DRXA 3VVTA 1PG7H 1WG5A 1UH4A 2XPGB 4E41D 4LSNA 4DAGL 2GHPA 3CFCH 1UWBA 3CVBA 4NYLB 8FABA 2VUGA 2J0QD 1IJEB 1UWGH 4J27A 2E9TA 1RUAH 3CN1A 5F0UA 4PRDB 3T0WA 1X6LA 2BRKA 4GUPA 1KKHA 4NX9A 1RXLA 4XBGA 5ACJA 1KN6A 3TX4A 2H5IB 3KOAA 3S36H 1V54B 1XBWA 1AP2A 1UJ3A 3HCVA 4MDJA 2MZSA 5GGTH 4LJMA 5FJ4A 5E8NB 1H3VA 3TJ9A 3QXVA 4UW2A 1WT5A 3L3KB 1OAQL 4I87A 3QR0A 2HMIC 3TCLA 2QO3A 2V94A 1EO5A 3C6SB 3PUCA 4NC1E 5E6UB 5C0ND 2EE0A 3ZKNC 1YSOA 2FVNA 3QJXA 4NA2A 1TDQA 4GAYB 1DQAA 3E3QE 2WLZA 1RU2A 3P4UB 2V9QA 3T3FA 3IXTA 1RUKH 3N43F 4WWKA 3KLSA 1TELA 5DJ6A 3FQUA 5D71H 1TUGB 3Q23A 4Z7VB 4HT7A 1RU9H 2ZXCA 4K2UL 4I2PB 4NN6C 3FS9A 2HKEA 4NXNJ 4CLFA 3AUVA 1CJKA 5IJVB 3GO1H 3CBKB 2E5IA 3LEYH 5JHDD 3J81Y 4EKXA 5C0EA 5JR1L 3W0WD 2C3UA 2VL5A 2KPNA 5I1KH 2VZ3A 2AQPA 3HZYA 4BRJA 1PIGA 4QTHB 4CJ0A 4J9RA 2BCKA 5AL8A 1IRAY 3ARYA 1KCVH 2EYSB 4MZIA 4OY7A 4URTB 2WCPA 2IYIA 5GS3A 1RHJB 2QGFB 3IVKA 3GNML 1DO5A 4P72A 4YHML 2QYGA 1NDMA 3QIUD 2PPAA 2VM4A 3RJMB 3Q8QB 1DS6B 5ICXB 2ZXBA 3D4GA 2X1XR 1BGXT 1LO5A 2PW2A 3W9DB 4G6JH 1BEYH 3C8KA 4DR3F 5JO5B 4X64J 3KWMA 4OYXA 1JJUA 1ZOXA 1HHSA 3QUZA 4F24A 4WIQA 3TUPA 5CZVL 1C08A 1W6LA 1AD9A 1JLQB 3OUYA 3QQ9C 5IWAJ 1DJGA 2ZOFA 3T09A 1U2YA 3BSCA 4ECUA 1CFQA 1R3JA 4NIYE 5F1IB 2DIVA 1A3RL 2A9AA 5I1GL 4O2CA 4IO9Q 4Q9CA 5F7HA 3PG9A 5AE2A 4OCWH 1OT2A 3FKBA 1SF3A 2BPBA 5DJCA 2K06A 2YKMA 2YUWA 5DQ9B 2VLJE 2VR4A 4GOJC 2WB4A 3JSYA 4M4RB 1IILE 5FO9A 5I1KL 1TQVA 4XNQB 4KO9A 4DP8X 3M8ZA 3GIVB 4JKMA 4KVNL 1UOKA 1TAUA 1FYTA 3HNTH 3OLDA 4JFDB 5AB9A 3GR1A 5HMWA 5HVGB 1TTBA 3QVAA 4IH5A 2PSZA 2RR3A 3KLIB 1IAKB 1TQBC 5KSBF 4MS8D 2R2SA 3CFNA 2N1KA 1EXUB 4LCWD 5KBPA 4TUJB 2MNUA 3PYCA 3UAJA 1NUGA 1V9OA 4B9UA 4V19J 2BRRL 2FWOA 2LHAA 3DSFL 4HJEA 1N0XH 3MR9B 2OPQB 3UERA 4IIQA 4N77A 3ZHDA 2CPFA 4PB0H 1SL1A 5BOJA 1DZBA 1E40A 3CFEB 5MEPB 4CO1A 4BQ8A 1VESA 2YQ2A 1NCIA 3GMNA 4UIMA 2VG6A 3VGAB 5IOKA 1YN6B 4Q6KA 3V4UL 2KU7A 1DQDL 1D9KD 1QFUL 4KKPA 4LLYA 5ALCH 4N2GA 3GZKA 5GGTL 3RWHA 5MERA 4KX7A 5EZJA 4F9PA 4CO0A 4KYZA 4K4VA 5BJTB 3AMKA 4NI2A 4P2RB 1QRNB 1S5HB 4BUGA 4CSZA 4L3EB 3SSRA 1MKFA 1ZXQA 3O6FD 4N2MA 1MCIA 5C86A 3BYRA 4QJ5B 3Q8PB 3JTOA 1M4KA 4AEHH 4L1DA 2OTWA 3WFCH 4FXGA 3EYOB 1L4IA 5FFLA 3ISWA 4PJDA 2BHUA 3Q8SB 2M5YA 1N56A 4YSEA 3NN8B 4JN1L 4WKZB 3GONA 3U4AA 4EEEA 4XPFL 3AB2B 3RYMA 1M5PC 4NCBA 1FL6B 2GIXA 3HK2A 1KTJA 3GMLA 3L8QA 1NLBH 3VE0A 2W25A 4DV3J 4O2EB 1BZ7B 1R17A 2FLBT 3IGUA 2NCKL 5GSVB 1WELA 2GJ6B 2B4OA 1NO8A 4GKSA 5GHWH 4S0MA 2W7AA 1GIGH 1ZAVA 1GZPA 3QQDB 4UNVA 2DQMA 5H94B 1PKQE 3NQKA 5K1NA 3AGWA 5TF0A 3REWA 4GS7B 1DJ0A 3G6ES 2ITFA 3BGOP 1YI2S 4JN2A 1LEKB 4ZPDA 1U6BA 3IJ9A 4LDCA 1XNQJ 3L3DB 4I77H 3NOIA 4Z7WF 4ZJ9A 5DLML 3NCJL 4JRLA 4ODVL 4Y88A 1R0AH 3CDYA 4Y65A 3ITHB 5IHBA 5EEYA 4J7CA 1Q0YH 2ZPKL 2DQHL 2YBRA 4K7PH 3WDHA 1L5GA 3LZPA 4I3RL 2X6MA 4GRLC 4L1TA 1C0TA 3UG4A 2KRBA 2P47B 2KI2A 5DRWA 5K39A 5ESQB 3QDJB 1ACYH 3M8QA 1HDMB 1S77D 1EQMA 4M7JL 1EHAA 4YXKL 4Z7YA 5L1IA 2XBPA 4NFBA 5T3XH 4QF1B 3BZ4A 5IR1A 2MKSA 1NKGA 3VAEA 4EQ2A 1QASA 1DN0B 2VE6A 3VFMA 5DZAA 2A6KB 5T7LA 1J87A 1RVFH 5D7JD 5DS1A 4OZGA 1WI6A 4A2LA 4UI2A 3RL2A 4DGUA 5IJKA 4J2QA 1WH0A 5IF0B 3UJJL 4B9IA 1EZZB 3BSAA 3LGNA 1U95A 1YN7B 3P1VA 5A2CA 4IIQC 3PJXA 4JOUA 3TEXA 1KEMH 2B5IC 2QT6A 4YHPA 5EZIH 2DR7A 1U2HA 4U0RB 3SBMA 1KR4A 2H54B 3TGXA 5AVXB 4DZDA 3SQOH 4Z0BH 5KBLA 3T6ZA 5J9PB 5FFOA 4KV5E 4BUHA 2MRYA 3L45A 2GTWB 4PJAF 4QXGL 4LLAA 3K8LA 1EO8H 4OQTA 1RZFL 4U1NB 7PCYA 2RGSA 3U30B 3ECWA 5DMJB 2J73A 2CPHA 4B9CA 1JHTB 5HYFA 1DVYA 1U36A 5AOKA 1IC4L 3CX2A 2BWDA 2O5ZH 4LSNB 4OQ1A 4NENB 1GTHA 1U33A 4JI0J 4G8GB