2XWXA

Vibrio cholerae colonization factor gbpa crystal structure
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
391
structure length
385
Chain Sequence
HGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVILAVWDVGDTAASFYNVIDVKFDPDWNPAGQIIPSMDLSIGDTVYTRVFDNDGENPAYRTELKIDSETLTKANQWSYALATKINQTQKQQRAGQLNGDQFVPVYGTNPIYLKEGSGLKSVEIGYQIEAPQPEYSLTVSGLAKEYEIGEQPIQLDLTLEAQGEMSAELTVYNHHQKPLASWSQAMTDGELKSITLELSEAKAGHHMLVSRIKDRDGNLQDQQTLDFMLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Vibrio Cholerae Colonization Factor Gbpa Possesses a Modular Structure that Governs Binding to Different Host Surfaces.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Chitin-binding protein
molecule keywords GLCNAC-BINDING PROTEIN A
total genus 86
structure length 385
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03067 LPMO_10 Lytic polysaccharide mono-oxygenase, cellulose-degrading
A PF18416 GbpA_2 N-acetylglucosamine binding protein domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xwxA03
2.70.50.50 Mainly Beta Distorted Sandwich Coagulation Factor XIII; Chain A, domain 1 chitin-binding protein cbp21 2xwxA01
3.30.70.2150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xwxA02
2YOWA 2YOXA 2LHSA 2BEMA 5FTZA 4ALEA 4OY6A 4A02A 5FJQA 4GBOA 2YOYA 5AA7A 4ALQA 4ALRA 5IJUA 4ALSA 4OY7A 4ALTA 3UAMA 2BENA 4OY8A 4ALCA 2XWXA
chains in the Genus database with same CATH superfamily
4FQXB 5IQMA 5ETKA 2QMJA 4DUVA 4OJEH 4NIYE 3Q06A 3B7SA 1BG9A 3CHRA 2OZNA 4QRRE 4S2SB 4XCYB 3L6FB 4ZFOL 2UU9F 3NFPA 5DO2C 1RUPH 1DUZB 4CJ0A 1OPOA 4PV9A 3HMJG 1B3TA 3BP7A 3CCHB 4WW2F 2MKYA 3QORC 3O9WA 5ANHA 5CINH 3I85A 1I9RL 1A1OB 1T9UA 2Y06L 2R29H 1LILA 3I74A 5L9DH 3KPRD 1GCFA 5GS1B 2HFUA 2VD3A 4QI3A 3MUJA 4OGAC 1EEZA 1PMYA 3OV6A 4K7QA 4JFPB 2QFJA 3PV8A 4UQ2B 1KELH 4BKLB 1RWMB 3RIAK 1U3HD 4K7PY 4M03A 4NOBA 2DQFB 2QQKL 1OCOB 5C2BH 1YJ7A 1ZIBA 3T5JA 5KFOA 2BANA 4UIMA 4Q0XH 4KNQA 3ZL2A 1VQ7S 4Y5XA 1K8AT 1BZ8A 4RWHA 5EOCH 2OYPA 4LIWA 3MRLB 4PS8A 1DP0A 4DG1A 1JI1A 4R26H 4AUKA 3TJHC 5KVMC 1KJ2H 2BXJA 4OV6F 4XPAL 1F1BB 2P80D 5F0JB 2DICA 4OCMC 3GCXP 3U4EA 4QDGA 4GRWE 2Z30B 2I0XA 3U30B 1SJQA 1SEBA 4B95C 2DRDA 5I76A 2R39A 2DF3A 3RWDB 4XXCA 4ELKB 4Z7QE 2OEKA 1EETB 2CQBA 3I5AA 5EBLB 2DHSA 2A6OA 1SKWA 1JZHA 4KUCD 5AEAA 3U48A 5HHVH 1NL0L 2OW6A 2APFA 3HE6B 4LVHC 1PQZB 2A6JB 3VU2A 1MHHB 2WNKA 1KIRA 3TAMB 1NICA 2FD6H 1GJWA 5F70A 1DBML 3WSQH 1S0MA 1E50A 1CZ8L 1IKWA 2B39A 1IQDA 5DUML 1HHTP 4L4TB 2D3LA 4QPTA 4JZJA 4LL1A 1L9QA 3DX8A 1DQLH 2X05A 2Q1LA 2EE2A 1HI8A 4P9HC 2HLUA 1D9KA 4ANDA 1E2WA 2EH8L 3QZWA 5HROB 5I3UA 1BOGA 1SKRA 4QXTB 3VFWB 4DVBB 2GO8A 2WSCC 1YY8B 2MQPA 2ALAA 3L54A 3QUXB 2HJFB 1YHQS 1OAJA 4U7SA 4HWEL 3ZL1A 2IANA 5J1EA 1A7PL 4U3XA 4OYIA 2MJUA 4MB3A 2GK0B 4B9GA 2LU5A 2VABA 2ZG2A 5F1NB 5FYKU 4KHTH 1JJCB 2XDHA 2JL9A 1M90T 2BVQA 1L3VA 2N7SA 2VR6A 1R3IL 1XAKA 2PUQT 3CXDL 5DM7Q 2XZWA 4A2HA 1JLQB 4JK0D 4ECXA 4YPGA 1GZPA 4HZAA 4Y19B 2WP3T 5JXED 4FQXC 1J5CA 1Y00A 2F8EX 2YAMA 3QNZB 4LCUB 4FVMA 3MRBA 1KQFB 2R7OA 3G6ES 4NNPL 1E5CA 4CO5A 4AWJC 5EEYA 3PFEA 3OF6D 4O02A 5F9AC 4CO3A 4W9FC 4YXKH 3DA0A 1NAMB 2Y7SA 1QM9A 3Q8QB 2X3GA 3C15B 1ZS8B 1K9MT 5EEUA 3AU1B 2F8MA 2HG0A 3KR3H 5DJ6A 3NGTA 3W61A 2FIUA 2R23B 2ZUWA 3BW9A 5JQ6L 2IALA 1UM5H 1PEWA 2Z91A 3MFFA 5I66B 5K9QI 5EBLA 3NS6A 5J2QB 4JFOA 1MFEH 1SJHB 3OZKA 3P4MA 4BHUA 5JZ7D 1FO0L 4ZQKB 1UCTA 4NQXB 5MENE 1JZ2A 4IGBA 3EJAA 2IRUA 4XAKA 4DK5A 3B4DA 4LF9F 2VZVA 4JO4H 2VC0A 4PJEF 3EE3A 1V55B 4OF5A 5DDHA 4P52A 4YDDB 4AQAA 4BUHA 1QBML 1RFDH 3QA3B 4N6RA 2HVHA 5T1LD 4U1IB 5DO8A 2VN4A 1K2DA 1TZ0A 2IFXA 1VZIA 2DWYA 1ZLVK 4NO5B 2DQCL 5F8MA 8AT1B 3I5BA 4AJWA 1DDHA 4N1HB 3G6YA 5IIEB 4ODVL 3ELAT 3HB3B 4OV6A 2H26B 4KJQD 2C2ZB 2DWEA 1EEZB 3CZGA 4HQQH 4BFEA 4RFOH 4PRHB 2QHLA 3MD3A 1QZNA 3GXFA 2QX0A 4ZPTB 5F8JA 3BVNB 2DBBA 3CEDA 2EDOA 5J2NB 1BECA 1OGAE 2BIQA 2JK5A 4IJ3B 4DSIA 1PTZA 1ZZNA 1DJGA 3FO2A 3KHLA 3SE8L 2A77L 5FA3B 3WIVA 4A2LA 2L7EA 5K59F 3BZEB 2XN1A 3GTYX 1JK9A 1NL0H 1SL0A 3B9DA 3UBFA 2IH1A 4TNFA 3NJLA 3W82A 3NJKA 5KZCD 2FJFB 2IGLA 4JO1L 5LNGA 4G72B 2OJEA 3ES6A 5B1BB 4JQXC 3RY6C 4Z7NF 1I9EA 2MJNA 2KB2A 3DM2B 3ZO7A 4K4YA 1VQKS 1UUSA 4GXVH 3V4PA 5IJKA 4Z7VE 4LLMA 4MJ4A 3F7PC 4G8GB 1TL7A 4RWWA 5T41A 5KG3A 5A2QY 1U1NA 5EDWA 1CWVA 3L7UA 5KW9L 5DJAA 3TAQA 4KRWA 3IBFB 4XMKH 4O4YL 3SKJL 3KLGB 3RTQB 4WIQA 2X4RB 3FCBA 1K2DB 1SJ4P 1LD9B 2DITA 1NHUA 1J8HE 2HVBA 5CU5A 2HK3A 5HPOA 4WP3A 2HVEA 3RBGA 2QA1A 5F2FA 1G1CA 3GM0A 2VIHA 3S88H 4TSCH 3VFOA 1TEGA 2G2PA 4F2MA 2AJ1A 4MQ7B 1U9KA 2R42A 4UF4A 1JNRB 1I7UB 4MWFB 3CCRS 1S8DB 4LEXL 2GJ6D 3AB0B 2PD1A 3F84A 3ZGIA 4Y5XB 1K8IA 4XX5A 2WQXA 4FLHA 1E5AA 3DTXB 2CLZB 4FYSA 4KTYA 4NPYA 3WNKA 2O6FA 1KTLB 2CGYA 5DMJB 5GAEU 4TUJA 5KVFE 2CZVC 3V10A 2FBOJ 1JNJA 4J7CA 3ILLA 1KJMB 2UV3A 1KBGL 1QDUB 3JS9A 2UUBF 4Y5YC 3QUYB 2HK2A 4DJMA 4MFHA 1HW9A 3CN4A 3CNKA 3QH3A 4D9RE 4DV0J 4L4VB 3GR1A 3D0VA 3CZKA 3KPLA 4R8UB 4O0IA 2WLNA 1ZEAL 3BKCH 4ZMOA 4IBYA 5HGUA 4ZLLA 4X4XA 4WF7A 5TE4H 3QUYC 1U92B 2E7VA 2C4XA 1AZCA 3N91A 2CR0A 2OTUB 2X2UA 1DRZA 2YMTA 5K9FA 2FQGA 2X4OA 4DSLA 1C5CH 3GBLA 1J5HA 3HI6L 2AJXH 3IDXL 4EK2A 3VXNA 3CSKA 2VMJA 1KV3A 3BT0A 3WMQA 1R89A 1RTIB 1QSEB 1NOFA 3QDHA 4KI5C 1U8SA 3OX8B 1VQYA 1O7DC 2QSFA 3MXVH 1A2YB 4CSPA 5JXEA 3MRDA 1NBQA 2Z0BA 3S5LB 1FAKT 4XTTA 4FG6D 3N28A 1XTMA 1B4JL 3DIVA 3QHZH 5IT2L 2GEQA 4YQXL 3PHTA 1UM4H 5A2FA 4MCYB 2GTWA 5JMOC 1KGUA 5HHQB 1YVFA 1F5WA 2XZAH 3QHFH 1KEGL 3UJJL 2EIBA 3H42L 1A8ZA 4HS8H 4I9WD 2GJZA 3GG1A 4I4WB 4RE1A 3OQRA 5GADU 1DLFL 4QOTA 4HIQA 4V19J 1YN6B 1CDGA 4X7TB 3QFWA 2Q7AA 1TLMA 5E24E 2IVFB 4JR9H 2VDRL 2DI7A 3VXSE 5K8MA 5IT9U 3VQ2C 5KS9B 4MD4A 3HG1D 5AVRB 3TYFA 3IFOB 5D70L 2E4TA 4XWOC 2ASDA 1TCMA 3CZLA 4DPOA 3CVDA 1DHKA 4HJIA 2MXYA 1JS4A 1OGSA 2X0UA 4PJFF 4MIAA 5T1LB 3LKQA 1ZXQA 1ZD6A 3ZYOA 2DTJA 3CO9A 4MD5A 1ZLUH 2R2BA 3ISNC 4FZVA 3A6CH 2EG2A 4OFDA 3MLRH 2VONA 2QV2A 5I0XA 1BD2D 2RNEA 3FVYA 1OAXL 2XG5A 1REVB 3C5JB 1DO5A 4Y2OA 2E9IA 3DXAA 3CVHB 5DJBA 5DMIL 1MVFA 3CE1A 4ONGH 3RI5F 3UAEA 4HIEB 5DK2B 3GPSA 1AD9A 4S0MA 1SMAA 3HC2A 4FKYA 3PL6A 4M1GL 3ARWA 5AW9B 1K5WA 1WV7T 1P7QA 1Q0YH 2DQEL 3OMAB 4JPWL 4IRJD 3PU7A 5JIKA 3ZZLA 3CFTA 2BHYA 1BPVA 3DURB 4GXUN 1U7LA 3E0GA 3TARA 3B3IA 1S6QB 2Z31B 4W92B 2HT4C 2ZWYA 2RH3A 35C8L 1ZHKA 4H4NA 4Z3FA 3T1YJ 3OR6A 5CKGA 5KSAD 4FHKA 3HHRB 2LP4A 3QWUA 4NZ7A 5D0EA 2EVJA 3IJ8A 1J0IA 3MR9B 4DKEL 1MCPH 3L5HA 3ISND 4Y28C 3SO5A 3KPPA 3TX4A 1JLEA 2O30A 3MRPA 1RHRB 1OL0A 1C12A 1KVIA 2QMKA 2YSSB 1S9XA 4WTZA 5KVDL 4KK5C 2BOAA 1AY1H 1RQ5A 2DKMA 2WBKA 3ESVF 3FQ4A 4LLDB 4EZJA 3U0WH 4LVEA 2Q9OA 3TO4B 2OPRB 2JTYA 2QYGA 1I7RB 1FHTA 5E2UL 3VAGA 1DQQA 3JYBA 4PWFA 4J3TA 4ICXA 1IC5H 4AK2A 5H94B 2HNYA 3FBFA 4RRPM 1M9SA 1MWZA 4CO4A 3TW0A 3MMAB 3SGJC 1Q90A 2IV8A 3HMXA 4MAUL 5F3BA 2LU4A 1QD1A 1O7DE 3O6FB 4QIGA 1IEHA 2RQMA 3TH4T 3H9SA 5EU6A 3ZDWA 2L9NA 4BRVA 4KDWA 2XTSA 4N8CH 5E6RB 3GB7A 4XNUL 3SGDI 3OJDA 1F0LA 4X4ZA 3FH8A 3VG9B 5ABAA 3I82A 4M1DH 4EBCA 1MIEL 2V8PA 1P1TA 2AC0A 4JZOA 4FF4A 1CVJA 1YEFH 4WWKD 2AMUA 1NKGA 5DUBB 5KFGA 5C70A 1FL3A 4ZJ9A 2G3MA 3MLVH 3MRHB 4NRZB 4DL6A 2GIFA 3VI4B 5ESAB 5F7WC 5CCJA 2YFNA 1I1FA 3H8NA 4WNSA 2XV2A 3VG0H 4EPSA 4KH0B 4IO1A 2F7QA 3RB7A 2D4FA 5BRPA 5L6YH 3FF7A 4NZTH 1F11B 2OAUA 1DYZA 1OP3K 4QYOA 5D5MF 4OM1H 3S96A 4JFDD 4F15C 3M05A 1YQ2A 4UQCA 5C2GA 1ITPA 3MJ9A 3L7EA 3CZFA 2FVRA 1TQBC 5LMUF 1PX3A 3IBCB 2H6PB 1RZ8A 1KLFB 1RUMH 2VL4A 1HBOA 2IYIA 3EUDA 3GHPA 3GI9H 4P9HH 1R8HA 1HQEA 1DBAH 1FG2B 1LP9A 3WFEH 3KYMA 4QAWA 2XYPB 5GAGI 1G5AA 4AGPA 2R2TA 2QPSA 3COOA 1AE6L 1SJMA 1BX2B 4P9MH 3HMXL 2J57A 4DGYL 1KBKA 3EOTL 1OSCA 1F6TA 1RUKH 1YQVH 2B0SL 3MMEA 1RYRA 2VG6B 3ZE1E 4AGLA 2Z56B 1L5GB 4DX5A 3UTTE 1WHPA 1I3OB 3CD6S 4M5KA 3R7BB 5IWAF 3AZUA 3P11H 4JI7J 5E8DL 3GE9A 3QG6A 3RTLA 2L41A 2VKRA 5EX0A 5HXMA 3C60C 3N41B 3E8UL 3TV3L 4FNQA 5DQHA 1U1OA 4B3EA 4IS6B 1TAUA 2P5EB 4J3OG 4PEOA 1IAOA 3QNXB 3X1FA 3DGPB 1WCBA 1M1KT 3RUGE 4RW8B 4CWBA 2OMNA 5FFLA 1N5YB 5KSBA 1MPAH 4UDTB 1P4IH 3ZKQD 2CPXA 2OSYA 4JFUA 3T4YB 3I6GB 4P2QD 2AEJA 2FO4B 3N1PC 2ZKXA 4JQIL 5DGQA 4A8XA 1KIUB 2ZXEB 1D5BB 3R7QA 3G6VA 5IUCA 1XD0A 2FIRT 1NBCA 3G5ZB 4MD0A 4PLNC 4K71B 2AJSH 3KPPB 1UPPA 2GIXA 4JRXA 4XNMB 1Y7VA 5T5NF 3AREC 4NCC2 3TYGL 4O44B 3MM5B 4GAJH 4HT1H 2GGPB 3P4MB 4CMMA 3X14B 1SHSA 5EO0A 4E0RA 5DGRA 3VFNB 2IALB 1PZDA 4GG6B 4UOHA 1L3SA 2RILA 1EEQA 3GJFA 2AEIT 4WI3A 5D7JB 1ED3A 4QLWA 2WXNA 5KOMC 3UYPA 1JYWA 2VDNH 2JJ4D 3JSMA 2ENJA 4U1SB 1P7QD 1TCRA 2BOLA 3F41A 4CLWA 3GYGA 1TL1B 4U1HB 3QWRA 3RWEB 1NBEB 1JXDA 2YKKA 1PLCA 4YHHF 2XJKA 4NZUH 2RJZA 1T21B 4JI3F 4M1CD 1MCWM 2H5UA 2VU5A 3BLBA 2BO0A 3O8XA 2H4YB 3U6RA 4J9MA 2KFNA 4X42A 1XSKA 1N12A 1JERA 1DBBH 5JDJA 2A10A 2CQ4A 1RP9A 1GW0A 3M07A 1RULL 4YUEL 3TIEA 1YTYA 1U4BA 5EU4B 2YQ0A 1SH3A 3GI8L 1DSFL 4RAVB 3ZHDA 1CU4H 3G6JE 4FQPA 1CJYA 3FU8A 5E9DD 3PV6A 3V0AC 1UVMA 1ILSA 2Y9HA 2ZAHA 2CRLA 3SDCB 2KFZA 1S7SA 4MK9A 1N6QB 4PR5B 3U1QA 3M30A 2DR5A 1QHQA 3K2UH 4M6NL 4EI0A 4IEFB 3MXWL 1QBLH 4WEMB 3O8WA 5EZIL 3QZOA 4MKMA 4FPRA 1PNCA 2PMHA 3RAQA 5B39A 1VKXA 1H2UX 1SF5A 1SN5A 2I7SA 4CA4A 1IGML 4MIBA 3KLEA 3ABZA 1CL7I 3IFPA 4X7DC 4EUVA 1LO5B 1BWEA 5FK9B 4B9SA 4AG4L 3CJKB 5LMNJ 4TVSa 3L09A 2MHAA 3WY1A 2YPKA 1AQMA 4MAZA 4OFYA 3ZMEA 5KN5B 2DV6A 3VD9A 4JV6B 1FX4A 3B1UA 4ZSOA 5KFJA 3MR6A 4ECNA 1XCXA 2HTKC 2ZKTA 4B3VA 4ZD3H 5CCMA 4EZLA 4LSUH 1C16B 3RX7A 2HAZA 3D28A 2DMCA 1BD2A 2DW5A 3DUUA 2Y3NA 3WOVA 1UJ3C 1HPZB 5ADPL 3SDYL 1A6AB 4B27A 2UY7A 1HNIA 4NA2A 4PJBF 5FTZA 1EIYB 2YUWA 3MGOA 4JHZA 2QHRL 2VC2B 5EFIA 3IDJB 2LQRA 3KGRA 2Q8AL 3WKPA 3B4NA 2KM8B 4XXWC 3HMWL 2XZCH 3P0YH 5DHVA 3W56A 2ACYA 4U7CA 4U7UD 3QFJB 4LFBF 3M1OA 4J3BA 2NZ4A 2JSFA 3ZDYB 4H88H 4FJ6A 4WSGA 4YXLL 3QRRA 2NY4C 2DYSB 3GDBA 5IFJB 1FFWB 1P4LA 3C5ZB 2QZQA 4KKNA 3DHWC 5AXNA 2IM0A 1N68A 1KXTB 3KPQA 1AXQA 2NY3C 2IH1B 2F1BA 3MM7A 2A6KA 3KJ6L 3REVB 5LL6d 4K5OA 1AR1D 5DDOC 3MXVL 1R8BA 3WIUA 3ENQA 5D7JD 4Z8FL 4DDFA 2DXEA 1KC8T 4PS3A 4GW5A 4XX1E 4I2QB 4MAUH 4H8UA 1MRDL 1C5BH 2AJUH 3Q43A 3DLKB 5J3HC 2J6EA 1NWOA 1B0GA 2CZ4A 4BSWA 1N54B 3RKDD 5LNDA 1TMMA 1UL3A 4WU3A 3FB8B 2ZH9A 4HZ1A 3FDWA 4PRHE 4DN4H 2ATAA 2R0KH 4B02A 2OMWA 5FCSH 4ADGA 1VCBC 1A5FL 3CDZB 3VVVA 3T08A 5A43C 2W9AA 4XNXL 4BQBA 4HJ0D 4P3WA 4QMEA 1AMYA 3F5WB 4LLDA 3BGFB 1T22B 3DRTB 5DRXB 5BRQA 2CO4A 1N34J 4U1JB 5AAMA 2DY2A 4U6VH 2VKXA 1WDAA 1JKHA 4HJEA 3LKPA 3IKCA 1HBMB 4RAUA 1FNOA 2V8HA 1CFNB 1N18A 3I02A 2BNRD 5FGCE 3BGOP 3RB6A 4FQLL 3FYIB 2NX5E 1G7HA 5EX3A 1YZ6A 3OFHA 3F0NA 1FN4B 3F2LA 5I0YA 5BUAA 3B9KD 3FAXA 2RKIA 4XVTH 5I6XB 2RB8A 5F9LA 1E8XA 4JLRB 3X2QB 2JFDA 3F58L 4JFDA 3BRFA 4Q52A 4DZ8A 2PIIA 1MRCH 2DLIA 2V2ZA 3T5HA 5FYJU 4PJDB 4M8QB 3K2YA 1VQSA 3MCNA 4K4WA 3HVRA 2P7TA 3LB6D 4X6DB 2KT5A 2H3XC 1OHQA 3MM9B 3R5GA 2R7TA 5CA5A 3F58H 1ITBB 2N7BA 2BACA 4BIKA 3TT1L 2XULA 3L4UA 3REVA 1GZPB 1NCTA 4WHYG 5LN4A 2G4EA 2I1RA 5HNOA 3AJ2A 4BC9A 2NREA 3M8QB 4U96A 4NBYB 3SQBB 3GU0A 3RX5A 3EJTA 3ET6A 3VFGH 1WCQA 2EE3A 4NM8H 1ELOA 1X7TA 2WVUA 4IK7A 3QXVA 2R2BB 3UYRH 1VHIA 4OI6A 1P0SE 2GTQA 3T0EC 4B9NA 3V8CA 2AXWA 5FYJD 2FJEB 1YMMB 3RZWA 1D5XB 2FJWA 1U8QA 1V10A 4U6HB 4LZKA 2AJ2A 3QHZL 3QB7C 4JO8A 2YUXA 4A7GF 2VDPB 4WKZB 2UY7B 4HPHA 3QDJA 4JPIB 5ITBL 4AQYJ 1CJKB 2LU1A 1GGBH 3KJFB 1WFMA 2ZJRQ 3RFZB 2HWHA 3MKGA 3RBXA 2DYPA 4F80A 3QFJE 5ABZA 4V1DE 3ZT6A 3MMBB 1DL7L 2WHVA 2XPGB 4WHDA 3OAYK 3RWGA 3T5WA 2DKUA 1V5VA 3DX3A 2V6AA 3MNVA 2Z4QB 3VFSB 1VLOA 4YMEA 1YMMD 1VZHA 1CGSL 3WJJA 1E4WL 5F7KC 2WGNB 3WHE0 2VFVA 4PRPB 1MROB 4KQ3L 3OXSB 4TV3A 2ASJA 1OAUH 3MEDA 4A48A 5IWLA 1Z9SB 1SQMA 2Y0SA 4YR6A 1EX0A 1IBBA 3D12B 3ZY7A 4QZVB 1JLCA 2PR9A 1KS2A 1MSWD 4KQ3H 2VYRE 3O11B 5K8OA 3JVFC 4Y16B 1FO1A 1WBYA 1Z32X 3SDCA 2CQPA 1CGTA 2ORBH 1P84K 2P6SA 2XMKA 4JDZA 3DV6A 2ZOTA 1V3ZA 2VTFA 1SJEB 1PKQE 3GSXB 3VXNB 2K7JA 3KWWA 4GRMB 2YD9A 5DF0A 4H8QA 1H8OA 4BXVA 5M2UA 5B7FA 1MRFH 1CFTA 4NQVB 3QWRD 3GQQA 3ZTCC 2P46B 4Z7IA 4OFQA 5I16B 1IEBA 4QOKB 1NANI 1TLKA 4UT6L 2L7QA 2J8UF 5DEJA 3ZOAA 1NBVL 1TK0A 4F0HA 4CVZA 3CCTA 2DQUL 2F9BT 4UILH 2A2QT 2EFNA 3EOYG 3ZDZE 3ILOA 3VU1A 5HYJD 4KVPA 1Z9OA 3Q8UA 4F36A 1ECYA 3D39A 3ISRA 3MO1B 3NIFB 4ECRA 3EMTA 3CCHA 4TUOB 2HVZA 2OZ4H 3D4CA 2DEXX 1QRND 1OSDA 3E38A 4KJQC 2VGLM 2E1RA 5A8KB 2CGZA 2ZP9A 1XCTA 3FQNA 3IGFA 3NP3A 5B4MD 5LG1A 5BUPA 2ZCHL 3DBXB 1MI5D 4L8DB 5GGRB 5AG9A 5I3PA 3NSYA 3V2UC 1VQ8S 3ML9A 5BW7A 2NY6C 3WL9A 2M83A 3N9GL 4A55A 2C1PA 3C09C 4HT5A 1Z5HA 3IMVA 3H1ZA 5HHOA 1FFRA 3BAXA 4JY5H 4LCIL 2HBZB 2ZBCA 1JGEA 1YEKL 2EZ0D 4Y2DA 5ALCL 4LR8A 4OFYD 3ZX1A 4DLEA 4G6JH 4UOW1 3QIWC 3QWOB 5I30H 1M56B 2FJVA 2HLAA 4JKLA 1SHMA 3EO1A 1GMVA 2HN7A 4C56E 4FBTA 3KXFB 3CD5A 3SDXE 1DBMH 1KCRH 4GSDL 5DK0A 2GKIA 2JC1A 32C2B 2X2YA 1UWGH 1FLRH 2OYMA 4IKKA 4NOFA 5A0YA 4G6AD 3QEUB 1C0UA 3MCSA 3CH1B 1P53A 5DR5H 4BFJA 1NGWB 2Z31D 4U0RC 2ESVA 3VQTA 3PX4A 1R31A 3HC4H 3ULUH 1J1OH 2Y8YA 1BWWA 3X1BA 1MIEH 3CJ4A 4MVBD 5CXPA 2QA2A 3FU9A 4X5XA 5F6HJ 1C1CA 1A7QH 1RURL 2L4OA 4P5TC 2D9OA 4TVPH 2W4DA 4NKMA 3DLKA 3FUYA 4F58L 1A1OA 2HNDB 1P1VA 3QXDB 4W90B 1ZMYA 3E51A 2ZKWA 1BHNA 1OARH 2WYTA 7FD1A 5IM0A 4JHVA 1S1TB 3KGSA 1CXLA 3F12B 5LGHL 1JUFB 1TVHB 1YDLA 3C14B 1SXZA 2WBJB 3DVIA 3LGNA 1LLAA 2G2YA 2J6SA 4OIFA 4G5ZL 2AHOB 3A3YB 2IC3A 1DAXA 4DL7A 1FD2A 4DCOB 4JY4B 4Z7QF 3TYGH 4PJFE 1EO5A 3TEXA 4F37K 3MGOB 4Y2DC 4DQIA 4EQ2A 2R8SH 1KGXA 3BSGA 4Z23A 3KLDA 1IKYB 2VG7B 4UT9L 2FQQB 2V3FA 1Y6KR 1YJWS 3L3KA 5BW7C 3OXSA 3MRIA 2Y36H 3W9EB 3RUBL 3BAEL 5AOJA 3CDCA 3QZWG 1KENH 4CLUA 4P46C 4AL6A 3GMPB 4QRSA 2YN3A 3VGGA 4DKEH 4EBQL 5H37A 5CBAB 1C5CL 1WI8A 2WAQD 2R69A 3RDTC 2GAHC 3BSZL 1HDMA 5D1ZC 2QVKA 4FDWA 5AB2A 2MB0B 3MNZA 2MSTA 3PF2A 3GJFH 2DB1A 4XNAA 2E9ZA 4GRWF 4K59A 4RJVA 3HI9A 4MT1A 1PIGA 2HZCA 2XICA 2CU9A 1JZEA 1U8JA 4U1MA 3O2DA 1PEZA 3IAS9 4OAWA 1F6FB 1IBLF 1IBLJ 4F5CE 5J11B 4KUZH 1P5UA 3TCLB 4KHMA 3KLFB 3MOBH 4Y7OC 4ZOAA 5HHMD 2ZWSA 4BZ2L 2G1HA 4FXLA 2N59A 1U2HA 1JWMB 1QABA 3MLSL 1CQNA 3ETBF 5D4HA 3AJ7A 5F9JA 1NMCC 3O6FA 5BQDA 1CBKA 1SOXA 2CIKA 1S9GB 4NWUL 5EHFA 3HD2A 4RW7A 2YR3A 3NIFE 5H9EJ 3ROOB 4IUFA 4OFIA 1I8KB 1HL5A 3MM6A 3ABKB 4PR5A 3CFKB 2Y2WA 3QDGD 4KXCA 2GJFA 2BVTA 1RJYA 3OKMB 2V9UA 3A67H 3GMMB 3T1FA 3THMH 1CBVL 3GRGA 4HWBL 1HNYA 1V6HA 3FRZA 3SQOP 2N3OA 3U2IA 1T9WA 3TZWA 5AW2B 2FJDB 1HWJA 5DUPL 3HDSA 4L37A 1SY6A 3C9NA 2OUGA 3PO5A 5AWNH 5CLWA 2J7LA 4KJPC 5IB5A 1GT8A 5FDLA 4GS7B 1CFMA 1U1LA 4LRFA 3AQDA 4R2GC 1SOKA 1S78D 2NQ3A 4LHUA 4RIRA 4WFHE 4L3CB 4WJG3 1TKZB 1Q4NX 4BK4A 2XMJA 4QWEA 1CE1L 3IPFA 2NUHA 1OE3A 2HRPH 3C08L 4JO3L 4NN7C 1R0CB 3C6SA 3CFCH 1AZRA 5BO0D 3DPDA 2R59A 3E1F1 3U4BL 1KSJB 2YX7A 4QJ4B 3IGUA 3IWXA 4NN5B 2KUTA 2IPTL 4YSTA 5EGYA 2LOEA 4JI1J 4CLPA 4L74A 3VWKB 4LAQH 5CZVL 2WXHA 1IVTA 3U7YH 1TNNA 2BQRA 5FO8B 4PSPA 1QFWM 2QQQA 2Z4TA 3IWLA 1S12A 2KU7A 1AZUA 5EMVA 1FRGH 4XP4L 2HVKA 3TUZC 3T3MB 2KZZA 3KLIA 3IFLH 5FECB 3R27A 1UYWL 4ELKA 1H6TA 4HG4J 2EXSA 1OY6A 1YNTF 1IJNA 1IBMJ 3HI1B 4CO0A 1TDQA 3AY2A 3CDZA 2XWZA 2WLKA 4IIQC 2ARWA 5IVZB 2YAFA 4QF1B 3TVKA 4PRDB 3A4AA 3TEGA 1YVLA 1C9SA 4NQCB 1Y18A 3L15A 2V67A 4YR3A 4PYDA 2UZIH 4JDTH 1S4FA 2W80C 1TIUA 5A3IC 2BP5M 5CJ8A 5EEVA 2CQHA 1KSHB 3K57A 1BYNA 3BMWA 3L1GA 1I1YB 4Z76B 4KMTL 2V50A 1NK6A 4BYHA 4X9HA 3SDCD 4R0LC 4Y5YA 4GBOA 1XF4B 1MFAH 2R1XA 3RZCB 4PJ9A 3PLYA 4OX9F 4QKTA 2IPUK 4GKNA 6FABL 1TQUA 3LRHA 2CXEA 1OOWA 2BZCA 1RJZB 3OR1A 1ULVA 3EDRB 4KHXL 1RU9H 2ZYHA 1F02I 3Q8FA 3MQIA 5JUEL 4AYFA 1KLFA 4KKAC 3SO3B 1MREH 3MAAB 4OUUB 4PJEE 2F7PA 2RSQA 4YE0A 5I75B 2V2VA 4IBTA 3DRPA 2XZCL 3P0YL 4XC3L 4EZMA 4JPKH 5D4IA 4HXBL 3CIZA 3HAEG 4TY8A 5E00B 1DE4A 2DGTA 1LWHA 4UUJB 1KCVL 4ES3A 3FU5A 2FH6A 2AYMA 4HXBH 2BJML 2AJFE 1UJ3B 2AMGA 5ACFA 3Q2SC 4DL2A 3DI3B 3U2SB 2Y5EA 5A8RA 1PAUB 2QTVA 1A3QA 1N33J 1FXDA 3NH7L 2XHNA 5I9QB 1LQ9A 2RUSA 4RSVA 1UB6B 3GYRA 1DVSA 4JV8B 1CQYA 3BEVB 2XFGB 1AG0A 3QSKB 3JV6B 3EJRA 3ILQC 4OZGB 1HEZA 4LCWD 4JI6J 3VXOB 4NC1E 3OHMB 4AUUA 5IWAJ 2UYLB 3KYOB 5EU5B 5IP4A 5MLCV 4JI7F 3IXQA 4DAGL 2WWOA 1A6WH 1X4GA 3MLYH 1Y3JA 4MJ5A 2R8JA 5AKSA 4K5SA 3FU3A 3INUL 4PHXA 4EIUA 2QPDB 4APQD 5CR8A 3EW3B 4B97A 2OMVA 1I8UA 4TQEH 1VKXB 3KPMB 1OLLA 1TPXC 2HHWA 2BCKB 1DARA 2EH8H 1M71B 3EJPA 3ZDYF 4JGNA 2MZSA 4RUBA 2OPPB 5EWIH 2Z35A 3FT4A 3CSBA 3VXUA 3TO2B 2ESVD 2IBKA 3HE7B 1CD0A 1BXAA 3VI3A 4OGYH 3ULVE 3LXUX 4B9IA 3GILA 4XOAA 2DLFH 3MUMP 1DY3A 4PLOB 1E9OA 3W1YC 4ICLA 4EISB 1KGJA 1XAUA 3OW2R 2FB4L 1P7KB 1T3FA 3WIHH 3FFIA 4L9DA 2AEPH 1PZAA 4QCIB 4G9DB 3ZBMA 2QELA 4E9TA 1YWXA 1B4TA 3ELQA 5E9DE 5C0RL 5IOKA 1KB3A 3M4XA 2QYCA 5DDPC 4PWKA 2OGUA 1ASOA 2JLGA 1XNRJ 5C0BA 3GIKA 1R5WA 1KTCA 4X6FA 4KDVA 2GVYA 2XQBL 1J8RA 1WC7A 3BH8A 3BT2H 4G3YL 3X11B 4RMUA 3V0HA 1ZYQA 3EHBC 3K5SA 5TQ0L 4FXGA 2O6DA 5DK2A 4MDJB 3B5HA 1HWHB 2MPAL 3FB7A 4RPFA 1HHHA 2I07A 1IGFH 1CLFA 3RNQB 1I8MA 1N5TA 5FWRA 2WOYA 4BJLA 1P4BL 5BXFA 4USKA 4HUWB 1JGLH 4YXKL 2YD4A 4GEIA 5DFWH 5KG9A 2R4RL 3NCXA 1X5JA 2VE6B 1X5YA 4YJZL 4AMKL 4NM8L 2OMTB 2QIFA 1X9MA 4YFLI 1LOUA 3THVA 2J0SD 1ZLDA 4LRIC 3U1MA 4I3RL 3CCMS 4GKSB 2AJVH 2QSVA 4HWNA 4P5SA 5IHUL 1DLOA 3U0WL 3GSXA 7AT1B 3RTVA 3TO4C 4MMXC 2OKMA 2AX1A 2OFGX 3KK1B 2VZOA 2IIHA 1CTOA 4DR1F 3W9JA 2P80A 4HV8B 1HOEA 1TTFA 3Q2WA 3WHXB 3MNMA 4D0DA 3EYQD 3LKQB 3LANA 2EKSB 5HVFA 1SRDA 1R3HA 1AANA 1BZ9B 3U36A 5LMNF 4DFKA 4ZVQB 4Q0BB 4ZS7H 4XBGB 3SDDD 4BDVA 3MNVB 3VFSA 3QWNA 3AT1B 2Z92B 4X50A 3FB5A 3TTYA 1L5GA 2BWIA 5F0WA 1JSYA 3DV4B 3MREB 1KPRA 4YE4H 1SJ1A 2EC9T 3UI3A 1CN4A 2NZ9C 2EDMA 1PJ5A 5TD4A 3DOLB 3G96A 3WNIA 3CXHK 4YC2B 4CU7A 4LF8F 1QD0A 1EHNA 1Q8BA 1NOLA 4Q5VA 1JE6A 5JPNB 1H3XA 4YY3J 5AQ0A 1VPOH 4LP8A 4MDJA 3Q6FB 4M02A 4K8RH 4OJAA 3T8XA 3DKDA 3ULSB 1XWLA 2RDJA 2VQEJ 3DCAA 3AB2B 3MRBB 3S5LG 3WTVA 5JVGQ 3NG5A 3NYKA 4DKFH 4KKZA 1H8SA 5B3JF 5C09A 4QYOB 3GO1L 3JWNH 2NZCA 1ASQA 4PGDA 1QAIA 5PAZA 2AF6A 5K33A 3SYZA 3QR2A 1QTNB 3LIUA 2ADFH 3DOIA 4FCHA 4P2AA 3VCLB 4NUQA 3PV7A 4I64A 1CL7H 1KN4H 1F4WH 2X9WA 1KT2A 3HR5A 4FFZA 1SBBA 5CP7A 5E8NB 1JLFA 1KDNA 2AQRA 2IBZY 1SJRA 1XERA 2G9OA 2CZNA 3DLGA 4TTDD 2MKSA 3IR7B 4ICLB 4JNXA 4AGMA 1Z3GL 4JYAF 1A6UH 1WT5C 2TRHA 3VI3B 3JTNA 3BSCA 4YEEA 2XWTB 3UTSB 3I32A 3MLWH 2NY5C 1S5IL 4P59H 4FFYH 3UTOA 3HHLA 4QRPB 3QH3B 4WFFD 5JA8B 2RACA 4ECWA 5CIPH 3HZYB 2A0LD 4NUJB 4OV5A 3UDVA 3O6FC 4CC0A 3N6MA 3N43B 4MQ7A 1IAIL 1HIMH 1XWVA 1G7HB 3NGRA 3V6ZB 3KW7A 2Q6CA 3DDFA 3G71S 1NK5A 1T0TV 2VR4A 1RJCA 2XBZA 2I9LA 3FPYA 3QUGA 4KI5E 5HI4C 4CBPA 3NJMA 5FDWB 3F00A 1AHWA 2G0JA 5DWUL 4O3PA 1MWAB 1AZBA 2LMIA 1DBKL 1ZZFA 3QWOA 2MFNA 1RT7A 4ELME 2JC0A 3DRRB 3WTSA 1EFQA 3SDDB 5TJWK 4J3XA 3UTQA 5FYLD 4LHQB 3QUZD 4WJ5B 4Z3IA 1NPJA 4RQQB 3IF1A 2GTZA 3G6AA 5GGTA 3ZDZB 1UWGL 5D1QE 2NCKL 4OMFG 4YBHA 5G5DB 2FNBA 3DM2A 2IRYA 1OALA 3PFUA 3MF5A 1Q16B 4EDWH 3OHXC 4KMLB 1P2CA 1U8OB 1CYGA 2XA3A 3DURA 2B9WA 2HJKA 4DQAA 3PE9A 5BMFL 1YNKL 4JZNB 5FYKE 1KMGA 2WPGA 5L8LB 4ZLPA 5ANMA 4F1SA 4O2EA 1EHXA 1OGTA 3ATAA 3H2QA 3R18A 5B38G 1QAYA 2VODA 4HD9A 4HFWA 4JVUA 4BZ2H 4GG8B 1IKVA 3QT8A 3EBIA 1QI4A 3T65A 3D39B 1F13A 5ACMA 5B1JC 4KSEB 5SWSA 1AYEA 3GG0A 1JDCA 1OTSC 4DGWC 3C2SA 3VRLE 1BJ1H 1WA1X 1RL1A 5DS8B 3UROR 2CNKB 3TA2A 1KY7A 1XBDA 5F8LA 1KBPA 3ARBC 4DH2A 4JHAH 3IMUA 1OWXA 4QW8A 1NKEA 5HHVL 3D09A 4TRPH 3I87A 4U7UK 1EAPA 1A6WL 2X2JA 4MXQD 4RGOH 1M1XB 1WRFA 3F7LA 1MRCL 3L2LA 4JJ5A 4TSAL 4ANVA 4UILL 2FGWH 3NGBC 3U7YL 3QIUD 5EEWA 1PFCA 4PRIA 2K2PA 2HMID 1NK0A 2WW8A 3VM7A 3QXUA 2KJWA 4M8RA 4M4PA 2YGQA 4M1CC 5F7DB 1MWQA 4NASA 3PR5B 4LNRB 5DC2A 2KZMA 2Y3AA 1SVDA 3BGUA 4P73A 1RTHA 3QORD 3GK8L 2GJRA 1R8PA 1OYEA 1AZVA 2WKOA 3CV5A 3ZPDA 3BUBA 5AVYB 4ENED 4ZFGL 2C3VA 1A6UL 2AK4B 4XGZA 1JNHA 4HBQA 3ZN6A 2DNOA 3DNCA 4PJGE 5KFDA 5JA9A 1K1SA 1UEMA 1LFPA 3QIDA 2LQ8A 4ZMZA 3C15A 3NJNA 4MTMA 1VQNS 3BYRA 4R90H 2X53A 4WUUA 3IFPB 1FLTX 4CYUB 2OXHA 5MAOA 1XHHA 4R8WH 4PUOB 2GBUA 2XGPA 5C07D 1EVUA 2BM3A 2XIBA 1L9SA 2FWLB 5I66A 3DMMA 3IFLL 4DP7X 4F91B 4V19X 1BXUA 5IHZB 3NJVA 4CVZB 3OX8A 2XCMC 3UTSA 4LDCA 4RLDA 2HRGA 1XSIA 3M1VA 5L2KA 1DL7H 4CAGA 5AE3A 1JGDA 3HC0A 4ZNEA 5I1JL 2AKRA 1OANA 4E41E 3E6FB 1DTUA 3KH4A 1HMVA 3D3CJ 3EF4A 3D5MA 5JNYB 3FEXB 3VSUA 2VO8A 5HSPA 2QDWA 1I5OB 5ECJE 3OHBA 4M1KA 1PLAA 5EZPA 2PW1A 1T21A 2XNQA 3HZEA 3G6JA 5EOCJ 4TVPD 3MTRA 2NY5H 3EGZA 1LFWA 5KYNA 5MERA 5EOQL 1MVUA 3OHXB 1PY9A 3H98A 1KJMA 1U6AL 3C75A 4RDQF 3H20A 3WFZA 5TDNA 3PNWB 2NLJA 4M8QA 3HHLD 4Y1AE 4NPYB 2BNRB 3LV3B 5BRZE 2J8UB 3LGMA 3E3QE 4LLYB 4WKRA 3SQOH 5CN1A 3VGBA 5C1MB 2VDQH 4PJBE 1QVOA 5D3GB 3CXFA 2JIXA 3FBCA 5KJRH 4PG5A 5CCKL 3DSNB 1DVFA 4DFHA 1AB8A 3SZ6A 1LVEA 4CYUA 1RZ7L 3MNZB 3FZUC 1SPBP 2NXJA 4LJMA 2IVYA 4AEFA 1J0JA 3OKLB 1BM3H 5F6IB 5I15H 2BJMH 5HD8D 5CBAA 1PCXA 3U4KA 5I5IA 2AJZB 2WWMD 1S9VB 4I0KA 1A14H 3K59A 5HJ3A 3MPYA 3F5WA 4UNVA 4TOYL 3RBEA 1L0PA 5I1HL 3NFSL 2PPDA 5IG7A 1BMZA 1E4XL 3BGRA 4HT7A 4USIA 3PAYA 5E6ID 2CHZA 2Y3YA 2YPLE 3OG6B 3HA0A 3CDWA 3MXWH 3RW7A 1X5FA 5EULV 4QTHA 2KLRA 2FLOA 4NENA 1DZ5A 2BVYA 3BVTA 2AABL 1HQUA 5C42A 1YITS 2ROXA 4YHHJ 1KGWA 3KYKL 2VC1A 5I6MA 4GQ9H 4WZ9A 2MQ0A 3H3KA 4JV2A 4LP4A 3K46A 4KHTL 2JDJA 4FNLH 1QVFR 2XN9E 1AZNA 3RHWK 2B51A 5KT4A 2YXVA 2V3EA 4BKLA 2CQDA 2V3DA 2EFOA 5DI8A 1QVGR 3MNDA 4B08A 4ZMTA 4RZKA 4XP9L 1B9KA 1TTAA 2EDWA 2VDQB 3CJ0A 2YC1B 2YXFA 3LW5C 4PLKC 2QFIA 3C3LA 2P9RA 3GXIA 3OBAA 3GSRA 2XQ0A 3ARVA 5LAXA 4PW3A 2OMZB 2HQCA 2OJZL 1FA0A 3IMBA 1KLMA 4X4TA 1TENA 3QZLA 1UZ6F 3QCUH 3L3OC 4R4FH 5L4FA 3UEQA 2P24B 2XFXA 3VTAA 2ZSWA 3ARGC 4Z95H 4LQ9A 3ZHKA 5CSZB 1OY9A 2BJEA 5D0RA 4YHIB 4EEYA 4RQQA 1H6FA 1X4YA 4OJFH 3LA0A 2APXA 2R2CA 5A0YB 5FOBB 1NJIT 2A74C 1NUDA 3BH4A 3OTCA 4ZITA 5C0BB 1BQNB 4M7ZC 3HS0B 2C42A 1BVNT 3GFHA 1S9VA 2RHQB 2BSSA 3I75A 4XCNA 3RL1A 3SOTA 4X6BB 2YPVL 2Z8VC 3BGFA 4L9LB 1RB0A 4OYAA 2EWHA 3SXLA 2D2CC 1H3PL 2Z57B 4HT1L 4GOKC 2DH8A 5C0CA 3HFML 1HXYB 3F44A 2NY1C 3A0OA 5DUBA 3RVXC 4MXWH 4JFWA 1U2RA 3MA7B 2QLJB 1M05A 2ATKA 5FFOA 4YSAA 4Y3CA 1L7IH 1WP6A 4ZSOB 4NLWA 3UMNA 5FYKD 2DRAA 2LE9A 2FJHB 4OY7A 1RWOB 3JZYA 1AOHA 4BDVB 4NCGB 5D6GA 1V3JA 4K3JL 3W0WE 4OJHA 3V6ZA 2CJBA 2CGRH 2D7TH 2XTJP 1YA5A 2AGJL 3VX0A 2R4FA 3IRXB 4TYBA 4CDIA 1FE4A 1TMCB 3CK0H 2C1EB 4GC6A 3OHXA 3D2WA 3ZYZA 2Y23A 2HH0H 3GLDA 3FRUB 3QPXL 4Y2KA 2JEFA 2X89A 2BNRE 2BOCA 2Z0UA 4JOUA 2M26A 5C08D 1KCWA 4CM2A 4OB5H 1UWEL 4ZOBA 2DL9A 2N01B 1HXMB 3T0WA 4YDKL 5I8KL 1YQHA 2I25N 1CGUA 2IAJB 5AVUB 3QSIA 4PGCA 2NXUA 2HZAA 3GFYA 3QUXC 2OS7A 1IL1B 3P9LA 5L7XH 3VWJB 2VLLA 2OI2A 2JXMA 1HQRA 1TJIH 2VSDA 4P0DA 2H4WB 4BWUA 4R2GD 4JDZB 1NM2A 4I8DA 1X0FA 4LF6J 1FD8A 2XX1A 4YSOA 4Z7OB 1AXTL 1T0PB 5IHZA 4PJ7B 5FYLL 2R51A 1X4AA 2PFFB 4ZBJA 4ZMMA 4DEZA 5DZPA 1DSYA 3FB7B 4JZJB 2CFXA 2XTJB 4PUOA 2OTPA 2AQSA 3VH8G 1JGUL 1IQDB 3MRRA 3MRQA 2NY1B 4LXFA 4PS7A 4AEEA 1L9MA 2CALA 2VLJB 2H6UA 4FN0A 3F7RA 1BIIB 4LLUB 4EUPG 1NCLA 1AG6A 2C3PA 4ZVPB 1GC1C 4PJFB 5HP1B 3L4ZA 3QIBC 4R4BA 1U26A 2GVDA 4HKZA 4OUOA 2O5DA 4XN8A 2X4SA 4MJ2A 4GRWH 3O3BB 2RHEA 1X9RA 1P27B 3UOAB 3IDIA 3VVWA 1ANUA 3VALA 4LESA 3FCGA 1WD8A 4X7SH 1AGBB 5D7LA 3LH2H 3EH3B 1NA8A 1HHGB 4F3MA 5E6ZA 3UTPE 4N8PA 4NQCE 1EAQA 4WUUD 1A6ZA 4OF8A 4TXSA 5E2WL 3O1LA 2LLNA 5E8PB 4DR2J 1T2QL 3PWPB 4HUXB 5C8JA 4GW4B 4OBRA 3IRPX 4ILMA 2F74A 1FZKB 4G8EB 1GTEA 1HI0P 2A9NL 5B1KA 3RBSA 2BE2B 1FA4A 3CJ3A 3MURP 1T1WA 2B9XA 4MMZB 4C3MA 5K8NA 5HO4A 2E5GA 3QG6B 1J5OL 1CIDA 4F27A 4FG0A 2V4QA 3R8YA 3QO1A 2OI9C 4YIQA 4TUKH 2IA6A 4MQXC 3HKWA 2VG6A 2DQDL 4XP5L 1ZAXA 1ZDSA 1A1MA 4GRLD 5FA4A 2I85A 3HBGA 5IV4A 1KUMA 1D9KD 4CKQA 5ID1B 3T5KA 5KG9B 1PAMA 3K6SA 3QS2A 3U2SA 4S2SA 4XCYA 5F7YC 4FF2A 3QO9A 1U1QA 1N6VA 1SCJB 2SEBB 3O0LA 3HNSL 2Y1VA 1U3HA 1UZGA 3BN3B 1ADWA 1LQSR 2IAND 3WTXA 3W66A 2OP4L 2XN9D 2LCWA 4X6EB 2QKIB 1E5UI 4LMQI 3RWCB 4IRCA 1KXQE 1KD1T 1SM3H 4S1DC 2AJUL 2YAPA 4A2FA 1FRKA 4EYHB 4KKCC 2LLGA 5D1QC 3UCRA 5A6MA 4GIOA 4NRUA 4OX9J 3HP6A 3LKPB 5M95B 1KIUA 3KPSD 4GC7A 2FLPA 2OIHA 4OL8A 4ZX5A 3UO1L 2XXCB 5DZNA 2XHWA 3O3UN 1UJ6A 1C08A 3NT0A 1O0PA 1KDIA 3POTB 3Q13A 4YEFA 4IJTA 3PJLA 3QDGB 2ZZTA 5EZOL 6AT1B 3X3GH 1NFDA 1YLXA 1E9OB 3E2HB 5FUOL 4PJHE 4TUJB 5L7KA 4RA0C 3NCJH 2ALYB 2LABA 5D15A 3GMOB 2I9SA 1EWHA 3KS0H 1MNUH 3J81Y 1H0DA 4X5RA 4XPTH 2AJQA 3K5MA 4ALSA 5K9OB 2W38A 4YSQA 4MNGE 4HVZA 4NWUH 3T0XA 2WQAA 3PX0A 5I17B 4H1LB 4EF3A 2FATL 2BP8A 1TZGH 1OY8A 3B54A 2PN5A 4IR1A 4ZMAT 2X3AA 3NKYA 1IAMA 4JG0L 4BH8B 4H4OB 5CYMB 4LF4J 2GK2A 5HGHB 4WNJA 2A6KB 1U8CB 2MNJB 2YEVB 5DQJB 5A2JH 1Q1KA 3EXYA 4G71B 2VITB 1ACZA 4J12A 4ODXA 4XMPH 3I75B 3JWDH 4JREB 4XCNB 5AOZA 1HNVB 7FABL 2OX5B 5FKPA 1NCNA 3BDBA 3LEXA 1X5HA 4NERA 2V2QA 2WK4A 2OJZH 2WXPA 2E7LA 4ID5B 1MFBH 3G7TA 1W9XA 4USJC 2VXSH 3EGSA 4P46B 1O7VA 4PHZA 4Y4KB 4LL4A 2D0FA 1FK9A 5CEXB 1RT5A 2GSIB 3KLKA 3BDEA 1XL4A 2EDLA 3UBXI 4ZFFB 2WY3B 3Q01A 2UZYA 4UTBA 4MJKA 4OZ3A 4EDXA 3SEOA 2L7JA 4FA7B 3T6QC 1A7OH 2W91A 3DUSB 2BS8A 2NXZB 4DUYJ 1M7DB 1NJ9A 3MUY1 1RU1A 5F0MB 1VOMA 2ZBPA 3STZA 1XCQB 2HWZH 1OP4A 3KZ8A 2B4VA 3L1EA 4G1IA 2HTLD 4DR5J 2XMWA 1J8KA 3FFOA 1I1RA 2NY5L 2YC1A 3P5BP 1F4XH 5FDLB 1K4CA 3PM9A 1N32F 4TNOA 2AP6A 5C0IB 1ACYH 1TAQA 2J7WA 4NI2A 3G4SS 1II4E 1ZEAH 1Y6MR 1S1VA 5AOIA 1OAZH 4AUJA 2P6TA 1RHUB 1QUNB 4FQIH 3ARTA 1ACYL 4XBGA 1T9VA 5D1ZI 2ZJPQ 3UNGC 3CNQP 2JKTM 4GKJF 2ZP8A 3EVWA 1ZSHA 3QSYB 2H1LM 4ANWA 2VDOL 3EGVA 3AADB 4CU8A 1K3IA 4NEZA 2M2BA 1UXLA 4G1PA 3SE3C 3GQCA 1SC4B 3QEUA 1C0UB 1IGJB 5F9OL 2EUXA 5IT0A 5AW8B 3E01A 1GMUA 4NDMB 1X5TA 4C3LA 1CIUA 1RADB 2EC0A 1A4BA 3LS4L 3WEOA 5B4MC 2ZX6A 4YHZL 2ZEJA 1PS3A 3L3HB 4LOEA 1GZHA 3KJ4C 1BJMA 2F6AA 3TOQA 3TBVB 5LXVA 3KL5A 5I19L 1MFAL 4KX8A 2B14A 3WI9A 3KLHD 3CUPA 4HCIA 3UIYA 3FMGL 4RU9A 4L3EA 1FRXA 3QULA 4DP9X 3DSNA 3RWCA 5GS0L 5EF2A 1VRTB 4PRBB 2HQIA 4LBEB 1IC4H 3WGVB 2WMPB 1S9YB 3VXRE 4JI6F 4YFLF 2CPZA 1Q8MA 3MKKA 3OL6A 1W0WA 5GGRA 4PJ7E 1SXAA 4P3CH 1GAOA 4KXZH 2HRYA 4ZUTB 3DWTA 3IR5B 1GTFA 3VWKD 4HWZA 2CBMA 1DSFH 1YEWA 2R2HB 4M43H 5ICZB 1RTZA 4YO0A 5RUBA 4F3FA 2ITFA 4KO9A 3OGCA 2G2NA 3US5A 2MQLA 4Y19A 3B2MA 3I9AA 4XN7A 4LK4A 1I8AA 2VWEC 4J3OD 2F8OA 4Z7OE 2FL5A 3UTSE 3VJ6B 3L16A 2OZ4L 3SHSA 4WFZA 4MMZA 3TEYA 1XB8A 4ZNEE 5IEKB 2YXWA 4X0KA 4K3DH 3NBPB 4PBWD 3SE8H 3VD1A 2L9DA 1VBYA 1ASPA 1KCRL 3C5SB 1U3YA 1AMXA 4JEGB 4R97C 4C54A 2B8QA 1VS3A 3G08A 1N0XL 2VPWB 3BEWA 4OVVA 2P1YA 5AOKA 3LNGA 1ORSB 1DFBL 1I7ZA 1X4DA 5IW1B 2NXEA 2X38A 3NJJA 4JUTA 8PAZA 1S7XA 3SYQA 4LF8J 2R5OA 1X9UA 3N0AA 3VGFA 4NDMA 3S34H 3GJEA 5ALCH 4NXMF 3MRMA 5DR5L 3KK3B 4DP6X 2DH9A 1IGJA 2HX8A 1E28A 3TCXA 3ZL4L 2ITEA 4IIQB 4AEHH 1BQSA 3KJ4B 4U0QB 3GSNB 4ZX4A 1ZA1B 1Z9NA 2FJGA 3MMCB 2CIKB 1NUFA 2EXYC 4DL3A 3V2AR 3TI0A 3BZQA 2HHTA 2FJAB 4E9SA 3BO2A 4NKQB 1CQKA 2UYLA 3KYOA 5D93B 5EU5A 1Z2ZA 5D72H 3Q44A 4JN1L 4L3NA 1JNHB 5HDQL 4CH7A 2JCWA 2CDFA 2YNGB 3CD4A 3GMQA 4HXAL 3SYPA 3TPUA 1NXIA 4ZUSB 3N4WA 5D2LE 3O3AA 5CZVH 4MNHB 1LW2B 5HAOA 4TYAA 1RAGB 1UC6A 2R0ZL 1NJXA 3IU4L 4S1QH 4NN5C 5TK4A 2UWEB 2RRNA 3I3DA 1PLBA 4IMKC 1FG2A 3LJ3A 1FJGF 3PO4A 3CSPA 1U49A 1MCDA 1HBOB 2NY2C 3OB8A 3GLJA 4OHYA 4HOZA 1XGQB 3P77B 5DJXB 4RA3A 3PWJA 3FQNB 4GQRA 5DUJA 3W0WD 3DRPB 5F3TA 2X5PA 1FT0A 3RBZA 4HTJA 1ZHLA 3RR8A 3LEVH 1RZIA 5SX4H 1PCSA 2A7BA 1HJCA 4JFPA 3OZLA 2DKSA 1EANA 4DSFA 5CWSB 3NP4A 3J7YI 2O6EA 3AXLA 1G2EA 1W15A 1EP4A 3U1NA 5J2NA 2YQ2A 2X10A 4QJ3B 4DQOL 3AY0A 2DH3A 2MY8A 1UA0A 4IU3A 4LSRH 3W5MA 2Y36L 2B1HH 5JOPD 4PR6A 2MTAA 5BYSA 4ED6A 1LWCA 4XTRC 5KVDH 1RZFH 3MLSH 3AXKA 3OJMB 4C48A 4EO8A 3V4LA 1H38A 3MXHP 1ULRA 4GMSH 3U0TB 3OUYB 2AK4E 2HFEA 3MGTB 1A21A 3P3RA 4P99A 5EC1B 2FJBB 1DQDL 2N1KA 1D9DA 2PMWA 4ZAKB 3T2NL 3H9SD 5EU6D 1NGWA 1Z5YD 4G8FB 4U2YA 3VI3E 1WG1A 1H74A 3G5WA 4WP9A 3V0WH 1G5GA 4GKKF 1IV8A 2FATH 4IRSA 3RAXA 4QRPE 3IBOA 3HI5H 2R7XA 1E27B 3NA9H 2A6IB 2X87A 2ROEA 3AT9A 2ADGB 1QA9A 1GX5A 2AJZA 5SV3A 2ACMA 2ASYA 3W5XA 1UACH 5HP1A 3QA3A 4L3KA 1OGAD 2UZPA 4XNDA 5TB5B 3CQPA 3UDWC 2IC2A 3X13A 5IW6B 5KYUA 3B7UX 4YC2C 3RGHA 4QD2E 4C3KA 3T71A 1KJ3L 4JPQA 5E2TL 4UQGA 2FVSA 1MN9A 2SXLA 2IADA 1HNZJ 3CC1A 3VG0L 5JW5A 2VIRB 5LLIC 3T0EB 4B5ZA 3MRMB 1QFWI 1ZWIB 3CK0L 4TPRH 1B0PA 1DR9A 1FV1B 2B6AA 1GYUA 1OB1B 1NIDA 4C98A 1XIWD 4YR2A 3G04B 1W2IA 4J9VA 3PJXA 5A3ID 3C6UA 5A2KH 1XH3B 4GBXB 4S0SD 3QNZA 2F54D 2E3VA 2ZAGA 4DP5X 4WK1A 2OMBA 4I0PC 1N36J 4LLQA 1PILA 5HPMB 3HVDA 3R7NB 1WC1A 4MXWL 2VDKH 1R17A 2B7BB 1I94J 1AD0B 2NUPB 2I9TB 1F5AA 1DN0B 4OD2A 4FTVE 2EICA 4K8RA 4HGMA 1ETZA 3V5KB 4CMHC 3QGIA 1FPTL 3LKSB 2A2DA 4J6RL 3O3EA 1KBVA 4U7KA 2NR6C 4ORGA 3B9KC 2VDOH 1UA7A 2MGZA 2FT8A 3MYJB 3ATEA 3Q89A 2AWZA 3M1BB 3MLTB 1CDCA 3S3DB 3CDGA 4ECYA 1NCJA 4AYMC 4NZDA 2N4IA 2PCFA 3WFDL 1ZE3H 4XT1C 2DH2A 3G6JF 1XV8A 4BRJA 3HLUA 1CO1A 3GMRA 2C26A 3UDCA 5ETQA 4Y9EA 3U7WL 1BF5A 3IDIB 4CSTA 5MENB 2NTFB 4JFFB 2OP4H 3HHNB 2C7UA 3EHBB 4WFGD 3GMLA 1NDKA 5HD8C 3OR2B 4HS3B 4WKZA 2VISA 3NPSC 5HYFA 2ZJSH 2ZZUT 4MAIA 12E8L 4KK5D 4S11A 4BUGA 4DOHE 2ZUQC 4E9RA 3FCWA 3RWGB 3GIJA 3DOMB 1R3LB 5JW3L 2F19L 2QMWA 3WN5A 3OTTA 2O5ZH 5T3ZL 3GYXB 5G4DA 1S0VA 3PDOB 3GHEH 4HIXH 2W2OP 2HKAA 3UDEA 2G3ZA 5KTEH 5HDWA 1QNZH 4DFIA 3B4MA 3MX0A 4PPDA 2Y1JA 4ETYA 2CMRL 1S72S 2R8GA 2N3JA 2ZH8A 2R7SA 4FPIA 2WOMB 1N64L 4DL4A 2EEAA 2R8HA 3VAMA 3RBQA 4MMXB 4XAWH 2CKWA 2WW4A 4N2KA 4QIWD 4GO8A 3RA7L 3ZDXB 4UYPA 5HVGA 4FYYB 2F4VJ 4B9UA 5JORA 4JQXA 2IAJA 1OQOA 2R7EB 3L9RB 2D7SA 3LQVA 4W98A 5G55A 5I1IH 1E3FA 4L8SB 3T9WA 3H9SE 2PYEA 1J88A 5EU6E 2DEJA 3QARA 4EKJA 3QQ9C 1NCCL 2W59A 5SWSB 3UD4P 4JV5J 3DJZA 4X5XB 1B0RB 1WC4A 3NRBA 3JYTA 2ZE0A 1AO7B 1E6OL 1IKVB 2ASLA 2FHOB 1ZVNA 3C60D 1F1DA 4DPAX 1IKWB 2H9GB 4K9EH 4FADA 1FRHA 3NFPB 2CPIA 4QIFA 1RT6B 2DNLA 1CFSB 3Q9PA 3VA6A 2NYKA 1UVNA 2K9FB 3HHMA 2EIZA 1TKTA 1V3MA 3PY9A 1QLFB 4LF2A 1B7FA 2WAQA 4JANA 4UAOB 4A37A 1HHIB 2JVRA 3FFIB 5B38A 5AL0A 2EDYA 2YBGA 3GSWB 3IDGA 3I4HX 5HDQH 1I9IL 4AXJA 1TQSA 1MJUH 2BSRB 4TVUA 4AKPA 3QRLA 4C8YA 4ZFGH 5CEZL 1X4BA 4PJAA 2HFGL 1AW0A 5GGRY 3LKRB 3ARDA 4HJGA 3B5GA 4N90D 5GGTH 3TNNB 1X60A 4DSJA 2YKMA 3WL9B 2E74C 3AS0A 3FB6B 2Q5BA 3WY4A 3E01B 2AJ3B 3QP3A 1SJVA 5GGUA 1OHZA 5K9OA 3FCUB 2Q87A 2IG2H 1AQ8A 1OPGL 3IVKA 3WKNA 5D5MB 4PGZA 1BY9A 1D6EB 3EFFB 4QRTA 2K7KA 4F4KA 3GCWP 5EG6C 1MW1A 5CF3A 3AQOA 3B56A 2I7OA 2Z31C 4JDTL 5DD6A 1A6PA 1FUNA 3EYSL 4KJWD 3D0GE 4P3DB 1FRLA 1JFQL 1OV8A 1TO5A 4YSEA 2IBGA 1BOYA 3FO9A 4IFVA 4WXOA 5BS0B 3GKWL 2PFDA 1BBDL 3WXWL 2FJFA 3WLWD 1BQHA 3DMJA 3BD4A 4LRDA 4N2OA 4NGHH 1FT8A 3GDCA 1THAA 1JNNL 2G0KA 2I60L 4OKVB 4X9GA 2Y5TA 1CLYL 5ERWB 5IM7B 4YXHH 3R7SB 1UB6A 5GJSL 3W5ZA 2A73B 5I71C 2LQ9A 1KVJA 1GS8A 1T1ZA 2CYYA 2YRZA 4LU5L 1JNNH 1FZJA 3DLJA 2XKNB 3MV9D 1N33F 2CO2A 2ZWLT 4NI6A 3N44B 1QBMH 1RFDL 2H0PA 3QQXA 1GXEA 2K9UA 3FQWA 5CHNB 3UE2A 4WW1A 2X1FA 2WLHA 3MNWB 5KSBE 1K4DB 2WB4A 3PWPD 4FNSA 3L45A 3RGVC 4CSZA 1KGCE 4PCSA 2W9CA 4HL9A 1QQDA 4QTHB 2OL3L 4UZSA 3I56S 1FBIH 3DLEB 4PRAA 4WI5A 2MZJA 4TSBL 4FZEL 2I5YL 1ODUA 5DD5H 3BJLA 1DQMH 2JKXA 4OZNA 2HQDA 4G8IB 1V27A 1FQ9C 3RA7H 4P74A 9CGTA 1NZAA 4TKTA 2H54B 1LEOA 3HE6D 4YHYB 1L0QA 4KV8A 2WVCA 3FU7B 3KMDA 3BAIA 1RP5A 2M2DA 3RWFA 3SCMA 1YIJS 1B64A 1QFWL 5HY9A 1WICA 4WFED 1GPOL 3DOLA 3NCMA 3R5JB 1TJIL 1R75A 1MELA 3APMA 4L23A 4NLUA 2BOBB 3SPVB 4UQTA 1G9HA 4EKXA 4N4YB 1CBVH 5E95B 5JDSB 3CX5J 3KPTA 4XIUA 4U3HA 4OLUL 4F7EA 1DVUA 1E4WH 4MD0B 1LEKA 4IEFA 1BREA 4K3DL 1LWJA 2J8UA 3T0EE 2VBWA 4LSLB 3MJ8A 2OSLB 1U8WA 1T20A 3CDFA 2FTRA 1SQGA 2VMDA 3FTSA 1TV6B 3H9SB 5EU6B 2KPNA 4IH5A 3UN2A 2AV7A 3DX2A 4Q4EA 2BMKB 2LA4A 3NG8A 5LN8A 2MQ3A 1M7IA 4HK0B 1FAIL 2UUBJ 5I1DA 4AL8C 1MNUL 1UVQA 3PQYD 1BVOA 2DPJA 1XNQJ 3A5VA 5FECA 3V6DB 2E7BA 4KOCA 1QFHA 5BYQA 5HATA 3UDWA 4KGLA 2YEZA 2W07B 4WNQB 4LF5F 2AQPA 4ALEA 2VR9A 3HJEA 3NSJA 5L6YL 3OFGA 1P69B 1TCRB 3BP5B 3EJZC 2OMTA 4J8RB 1A7NL 4YO0B 3RGVA 3PJSA 5E6IC 3HZMA 3IEAA 3VMNA 43C9A 5IVNA 3QQNA 2QKIA 2W4PA 3R4DA 5E1HB 3ARDC 4OI8A 5I3UB 3S4SG 4I6AA 2KM8C 1ZAGA 3FFCE 3V6KA 4J4PC 5ESVA 5C25A 4JLRA 4MZIA 4QY8B 4UU9B 4ES1A 2IY5B 5E1GA 1L9NA 3ETSA 5JW5B 1TKZA 2XX0A 3K6IA 3LN4A 2VXQA 4Y4KD 5JHDB 3GF8A 2W9DL 4H26B 4ZFFA 1RXOB 4UOW0 3FKBA 1W72H 3LZNA 4N1EA 4QOKD 1P4UA 3P4NA 4NWTL 5A2LH 4EO5A 1RVFL 2FLMA 3MI7X 2J1XA 2J8OA 1JGLL 3OWEA 3JUYA 3CMES 5J9PB 4X99A 2VR8A 3FUMA 2EDFA 4ZHRA 1X8DA 4Q0BA 4DFJA 3HLAB 1XGZA 1T1XA 2V2XB 3KPOA 3KYLA 3E1ZA 3W11D 2CHNA 3BHBB 4OLZH 4JI3J 3DHMA 1RQ0A 2E27L 2E56A 4APXB 4LSNA 1G7IA 4C8KA 1X6LA 4P4RA 2X1XR 3O4LB 3E2EA 1EMTL 4C56D 3NWRA 4FD0A 2BQ3A 2CDEB 1HESA 3TC9A 1GY2A 1PBYA 3J81j 1G7PB 3TQ1A 1M1GA 3CHSA 2BMKA 3O4OB 4KI5D 5EORL 1I3RA 1BQXA 4LSTL 3W2VA 2JHVA 1NANH 3V81A 4U33A 2F7RA 2D7MA 4UDTA 4GKSA 2AZUA 5J1SC 4K7FA 3LDBC 1WAPA 4JM2D 4AH2A 1W8OA 4C83B 2J88H 3QRFM 1FZMB 2XVKA 1XMOJ 3MA7A 3I3EA 3REWA 8CGTA 4UTBH 5I2IA 2CO7A 1DSWA 1N0LA 1EDHA 4MA1C 5E8EA 1VFJA 1BQHG 3IK2A 1ET7A 4UNIA 1T7PA 5C3TA 1JLFB 3QWQB 4LPUA 5I23A 3JB9k 2LLZA 3QJFA 2W7AA 3M6VA 5TK2A 4KGZB 1M5SA 2APVA 4C4KT 5HJYA 2PO4A 4H54A 2XS2A 4WWOA 3B2XA 4QRQA 3ISWA 4NO2B 4MAKA 4GG8A 2HBQB 3V0IA 4RGOL 3ZQXA 4FYTA 6FD1A 3L7EB 4N25A 4BCZA 5DS2A 1BX2A 4AGQA 4KO0B 2BSEA 2RE1A 1IKYA 1ORQA 2F5BL 1I1AC 1Q1JL 1ZPLA 2BVOA 5IMMB 1FNMA 3OL8A 5DJXA 4OZJA 4KOBA 2DCUB 2FYVA 4X5WB 1A4JA 1A64A 1R43A 3FONA 1T7WA 5AZ2H 3K89A 3U27A 3V0EA 5HBMA 5E00A 3DLLQ 5F1KC 1CULB 1NMBH 1G7QB 3JAMY 1A6AA 1CT8A 1ICEB 1X4HA 4K9EC 3D05A 1U8PA 3KM2A 4RMRA 1EKRA 3VQ1C 2X88A 1T1ZB 2WP3O 1VFOA 1GKOA 4HHGA 4ZFOA 3CC7S 2VPYB 3BPNB 1S3KH 4PLJC 3KBFA 5D71H 1BQLH 2W0PA 2YWFA 1MHEB 2DYPD 3ZJAA 5HHOD 1OXYA 1UOLA 1N70A 3OL2A 1QSFD 4AW4A 1E6YB 1REVA 1XQIA 4DF8A 1IEAA 3CIQA 3ZTDC 1F6AA 2BNQD 5T5FA 5FHAH 3WN5C 5B7MA 2VHGA 3HIZA 5K20B 5GRYA 4EMZA 4POYA 4G6JL 1MI5A 4LN0A 3QWPA 4KFBA 1GZHC 4IRJC 1SVZA 3MCKB 2W9DH 3MRCA 3PL6C 4PP2B 4YPJA 3W5YA 2UVRA 5GSRB 1TJGH 2R1YA 1YUKB 4JN2B 4QXGL 3BVUA 1BEYL 4MJIA 1KZQA 3VXRB 4DN0A 1NCBL 1DO6A 3TOPA 5C7PA 1B4JH 4LKCA 5D6CB 3QUZB 5M7QA 1T1YB 1NAKH 1TPXB 1FJ1A 3KW8A 5J13C 3V79C 1D5ZA 3QIWB 1HBNA 5E3PA 2EKJA 5JHDE 2PI4A 2ZUYA 2MNWA 2R0LH 4EUPA 4L75A 4QQBA 2PMZD 3I2CL 5EC2A 1KF9B 3X3FL 1ETA1 3TZVD 3W2WA 3O5TB 3DPBB 5KS9F 1T1XB 2V2XA 3LQMA 2NR6A 1WC0A 3BGLA 3J27A 1M5PC 2XACC 1T03H 1WSVA 4OI9A 1KFSA 4X83A 2LGNA 2CPYA 5G4OA 2BVOB 5IMMA 3WJMA 1OW0A 3RP1A 2FBJL 4GO5X 4L3FA 3WKMH 1KCVH 4NXNF 3PIQA 3UP1A 4XVJL 2GMLA 4WPAA 4XVSH 4LBIA 4P5TB 3HXMA 3HJFA 1GVIA 1UPMB 3L4BC 3BH8B 4FI8A 2NZIA 3IJSA 4E98A 3MECA 5IB2A 4W81A 5GS1C 4CVXB 3C87A 3TR5A 2VQFJ 3E8VA 2X4PB 3LGHA 2J3SA 2RQKA 3AB0C 4MNQE 3N0VA 1J8HA 3IAGC 3QQDA 1LWXA 5EN2B 3TURA 4BHQA 2DQHH 1IEBB 1MUJA 2EEXA 2J2ZA 4QOKA 2B4OA 3QLHA 3J81U 1NK8A 5I18L 1DQKA 2FK9A 4LCWE 1OF2B 3IE4A 3H0PA 1MCOL 1CFTB 1UVQB 3H9YA 4NQVA 5HVGB 1LM8V 3TBVA 4FQHA 2HH0L 3IDMA 3QPXH 4PB9H 2Z93A 3VH8A 4AUYA 1FNGA 3SCKE 3M9MB 1L0YA 5A7BA 4OF3A 3ZZOA 2OULB 1Z9LA 4HH0A 2HKFL 2XIIA 2W1BA 3UC0H 2XZQL 2JEGA 5CUSH 4PQUB 4JBSA 2DM7A 4ZK7M 2LHAA 3P0GB 1T8EA 4TSAH 4NZJA 5ECGA 4W9EC 2R1YB 4G42B 2OKQA 3RVUD 5JXEC 5LCVA 4CC1A 2HMIB 4UANA 4RGMC 2CQ3A 2F5AL 4IYQA 1MN7A 2ZUSA 1IGCH 4PJDE 4TVPE 2M70A 2BNQB 4PRPA 1MROA 5EEZA 2UXDJ 4OQJA 4K8RL 4OJ3A 5GAHI 2APOA 2IHR1 3D52A 5CILH 4ZW7A 2VZ9A 1G0YR 2XETA 4LHUG 4WJKB 1GOFA 3HUJA 3HSZA 2H5EA 1WFNA 2QLYA 2E59A 3ECVA 3BCFA 2K3TA 1YQVL 4HKXA 5JZ7C 3PCYA 1YKWA 3V5HA 1JHTB 1HE7A 4EE2A 3QXAA 2FJXA 3HE7C 3RFZC 4TUUA 4LPCA 3P8BB 2A38A 4P23A 1YBUA 4O2FA 3F05A 2UXBJ 3PGFL 1G4MA 2CG4A 2BY1A 4NLDA 5KVEH 4L8CB 4F2RA 3EBAA 3L5XL 5FYJL 2XLJA 1EARA 1RTDA 4V2BA 3QJRB 4LASH 4JJ5B 3EIIA 2GQ2A 2ZHBA 4WEEA 2YQ1A 4G6AC 3JSBA 5LBGA 2OMUB 4JRYE 2D4DA 1R24B 3AG4B 2ZX9A 2HUEA 1ZJBA 4PTUB 3HZVB 3JXAA 4ZOEA 4YAQA 5T3ZE 4YPGB 4AVKA 1FVSA 2X51A 4A8YA 2HFFB 4O00A 1OPZA 4CNZA 2P24A 1RVFH 2OX5A 2XVGA 3OKMA 4P2CG 5C24B 1K4DA 2DQ6A 1MCJA 4P5TD 3CJ8A 3D85B 3AM8C 3CF5Q 1FERA 1GOHA 1NZRA 4GBXD 4BZ1H 4DV1J 3C19A 3CN1A 2GV1A 4KKAD 2HHVA 1LNUA 1QO3A 5F1IB 3FO9B 3D2UA 4ECZA 5BV7H 5K5YA 3RWJA 2XLIA 1HWUA 3L5WB 3MZIA 1TOXA 1IM9B 3QR1A 5F72S 2B8OT 2A9ML 1JF5A 1H3PH 3N0PB 3FQUB 1FL6A 2RAMA 2WVFA 5HK4A 3C6LA 4TN2A 3S6EA 1Q81T 1P2CB 3AC0A 3IP0A 1H0DB 1M71A 1FFNB 3P9WB 5DG7A 4KROC 3EG9B 3UAJC 1LWEB 2DISA 1IKFH 5LQBL 2CG8A 3ITHB 2AJXL 5KT5A 1LK5A 2E9BA 3UP6A 2BOBA 2OO4A 4A38A 3I02B 3V8OA 2CUHA 3FO0H 3P3TA 2PLTA 4WFHD 1N7MH 1TU2A 3C8DA 4F2ME 1I7RA 5BOPA 5IY5B 1JF1B 3WG7B 1GDFA 2G9HA 4OSUL 2V8DA 4J9KA 3KXFA 4ZTPL 5ETRA 3V6OC 3FB6A 2HVKB 4AL8L 2XT1B 1RAFB 1UETA 3DXAE 4PV8B 5IBTH 4DV4F 4OJ1A 2AEPL 4Y1SA 2CADA 1U1PA 2YK1H 1CD8A 2B20A 2D31B 3EZ8A 4OQTA 4NE9C 2J5AA 4LVNC 4OZ4A 3CDEA 2W7PA 2H8PB 5KFUA 4CRJA 4ZVFA 4M7LT 2C1PB 3DMMD 2CJYB 1JHLH 2ZSWB 5TF1L 4DAGH 2WN3A 1AO7D 1C0TB 3MWBA 3MFIA 1F56A 4EEEA 2YRPA 4LIQL 2OPQA 3U1SL 1EJOL 2WHOA 4TU7A 4LFCJ 4XRCB 2IC3B 4M8VA 3AU1A 4J39A 2E9TA 3BSHA 3A4FA 3MOQA 1AJWA 1IWGA 1APSA 2NLJB 3PP3H 4NAMA 2Z7WA 1JUFA 2B5IB 1R6YA 2IWEA 4ZI8A 1WEXA 2GFFA 4B3OA 1N5SA 4J8RA 5J0BA 4OZGF 2CQ0A 3MPWA 4R7NB 4BA0A 4PKDB 3GXTA 3T09A 5FLUA 4PU2A 2MCAA 1JCKA 1UA6L 1WKJA 2BJ1A 4ID8A 4O0NA 3OR1B 5HYSB 3ZSTA 3VFMB 3F85A 2M8DB 3DU5A 2ZKMX 4ZJOA 5I6NA 3MR7A 2JV6A 1CICC 3BQUA 5D4JA 2AJVL 4HFWB 1OKEA 2EECA 3F7VA 1FORL 4RL1A 2FHKA 4G6FD 5D55A 4GP8B 4GI8A 5C8JB 5H1SV 1YBAA 2V4JA 1WT5A 3KJQB 1GKEA 3W65A 5IMKA 3M2RA 3NCRA 1PJ7A 3PG2A 3MV7D 4Z9KB 3EYSH 3WUWB 5E0FA 5JXAH 4QHKJ 5CZXC 4XO4A 5KFCA 3NZ8A 3UG3A 4AY0A 2X1GA 3IFOA 5SX4I 4GT7A 2N0MA 4Y2DB 5CLXA 3SBWC 1N0VC 3IDGB 2YKAA 4Y2NA 4LCWA 4B6ZA 4RRPA 4UQDA 5J12C 4OFPA 2PP8A 3U7AA 2OLDA 2VQ1B 4NHCL 1N36F 3M8PA 1QUPA 1LK3L 1N34F 2H2SD 1ZETA 4NQUA 5F93C 3DLQR 4DW2L 2ATPA 2EIJB 3ASOB 5DJ6B 3QQ4A 4S0TD 4FXVA 2C3VB 4XGZB 3GI8H 4RFNB 2FZCB 4U67Q 5AAWA 3ZVVA 5IHBA 3BX7C 1CJUA 2E7HA 4UZGA 3MAWA 2J88L 1KACB 2B08A 4KKRA 5CU9A 2APBA 5J1TC 1NFKA 3VXMB 2UVVA 2NXZD 2FRGP 4EQ3A 4GQZA 1U0HA 2X1PA 1B4SA 2J9DA 3NP5A 1ES0A 3CC5A 3N50A 2O5XH 2VNCA 2YPVA 1A02N 3KK1A 3NOCA 1CD1B 1UM4L 4AIOA 1HTYA 3SGDH 4O51A 5IFJA 2EH7H 3NGDA 2X1WL 4EN3B 2RVJA 1U48A 1J9RA 3C5SA 4XZUB 5CD3B 1TEFA 1M1SA 2G75B 2J5LB 2NSQA 1IBGL 3CZSA 4J27A 4FFTA 1KWKA 1HW8A 1U09A 2KO1A 4MTPA 4OZHE 4UT4A 1XNRF 5GJTH 2YD0A 1YN7A 5E6UB 2QFPA 3F73A 5JLZA 5AW5B 3K91A 3IWNC 1MQKL 2B2XL 2IADB 5FGRA 1IC1A 3VFPA 4HIHB 2D73A 4L4TA 4BINA 4DJBA 1VC5A 1XMBA 1TQTA 4FFYL 5CM1A 3DSFL 4CLFA 4EVNA 5LAPA 3B82A 1INDH 3DYOA 1DJHA 5A1AA 4AQ1A 4A7VA 1JYVA 2C2MB 4J37A 1UT2A 1A1NA 1LK2A 4Z7WF 1J5IA 2NY4B 4HPYH 3BKYL 3TNNA 4IKJA 3IWVA 4KY1H 2AXGA 3SDAB 2BM0A 3LWLA 3BO4A 1VQMS 5IVOA 1LO4H 5I1LB 1EQMA 3II3A 1Q7YT 2FTAA 4BFOA 1NB7A 4AIXA 5A8WA 2NYHA 2QVTA 4D0CA 4I67A 4R4NC 1YBTA 3L3HA 4X4RA 5GGVH 5KYYA 2OEJA 1SYSA 1I1AA 2X4RA 1FFOB 2EYRA 4FKEA 4AMXA 2VDIA 4OYWA 4C0BA 2AQ4A 4NP4L 1N19A 4JDVA 4G7RB 1Z9MA 2MKKA 4JI0J 3I6LD 5BVPL 4I1RA 2U2FA 2WXOA 4NN7B 4QPEA 4UV4L 4Q97A 1S5ZA 1F4XL 1AO7A 4KI1A 1G6RA 4PJXB 1HAUA 5AYUL 1RT3A 5ENWA 1MW0A 3CX5K 1YNKH 3EO0B 4YGVB 1YC7A 2YNIB 5HVHA 1VC0A 1FRJA 1S59A 1NGYB 4MX7B 1BQMB 4R96B 1MFMA 1I9IH 5C7ZA 1VQ6S 4PXDA 1ZSDA 4ZKAA 1CJVA 1L3KA 5U47A 2Y6SD 2P5PA 4N0FA 5DXWA 1IUZA 2DNPA 4WF9Q 1SLWA 1A7PH 2RBLA 4IDKA 2EIKB 3F12A 3P73B 4DGIH 3K8KA 4M5GA 4F26A 4LF3B 2WBXA 1SXNA 2P5EE 2DMBA 5ACIA 2XWBB 1RIVL 1E0OB 4WK3A 3FQTA 1BEXA 5DEFB 1LEIA 3WFBL 1DHMA 4KXBA 5CABA 4F7CB 3KDMA 4AQ8A 3HZGA 4L0YA 4PIBA 1YZZA 4NHUB 2VRAA 5DFTA 3CFJB 1BYPA 4UTAL 2VM9A 2JI3A 4G7YL 1SVCP 1X31C 2MEWA 2OJ1A 4N2FA 4PIRF 1B0VA 4FXGB 1YJDH 4KJYA 4WK4B 4TL4A 2AEMA 1HSAA 2W88A 1EAOA 3HZVA 5I1GH 1INQA 1A8JH 4ONOA 4XXWA 3SCMC 5D78A 2ITDA 2NY7H 1OK8A 1CPUA 2YMOA 3LAFA 1EO8H 2LAAA 1EXGA 3MV7A 4KFZC 3T3PF 5L8KB 4X4NA 2DXFA 2X42A 3O0RL 1XJWB 2OP5A 3MAAA 1NGQL 4AVJA 1XEZA 3QZ7A 2JJTA 2HLAB 5JW4R 2JWYA 1BD6A 2AYEA 2IRXA 2DEYX 2VJ8A 1XF5B 5ESAA 3S3JA 3R5BA 5DQJA 1U95B 4NLSA 3Q2TC 1UD8A 5IFHL 4DUWA 1NEUA 3AG2B 3K6OA 1DTQB 4ZQKA 3VFGL 5H35B 3UABA 1PG7X 5J2PA 2BZDA 5EZOH 3FB8A 4RESB 2Z91B 3MFFB 5J2QA 4FYRA 4XWGH 2AW2A 5IBUB 2Z35B 1XGUA 3FT4B 1LE9B 3LP1B 1I9JH 3MLXH 3KDNA 3TX0A 3BKML 1VQ5S 4X4UA 3CHXA 3IJYB 4KKQA 4NKOA 3AQPA 1FL6B 3NCFB 1ZGLA 4U6HA 1AQKH 1A65A 1HCVA 1S2EA 2AK1H 3QIBA 2WXQA 3PRBA 1WYJA 3OAUH 1VFAB 2BY2A 2Y72A 5T1JA 3OL7A 3H2WA 2DGOA 3G08B 1MCPL 5DFAA 1KQGB 3DVFA 1WJ9A 3VXQA 1KC5L 5IV2B 4UT7L 3NBPA 2O1PA 3AOAA 2R0LL 3T9NA 1H9VA 3KPQB 2UXVA 3I9ZA 3FQLA 2F61A 2FHCA 3DXAD 3TNMB 1SBRA 3RJMB 3P30L 3PGFH 1S77D 5CJQH 2BP0B 5IGXL 3RIFF 4DR7F 5KUMA 4OZGE 5IOPB 2UY6A 4UM8B 1OP3H 4B9CA 2X6UA 1JLEB 3HPOA 4NB7A 4K4VA 5SWSD 1OAKH 4N2HA 4C57C 2JE8A 1AROP 1FLRL 1YNLL 2Z7UA 3DRQB 1CR9L 3ZTNL 2VUGA 3Q6FA 1LYQA 4PJDA 2VTCA 2IO5A 4R0JA 1Z5LB 2HHUA 1S5HA 2OH2A 1QRNB 1HIYA 4GUPB 1KLGB 5HI5D 2BFVH 1AI1L 2EDDA 5HLFA 4XMXA 1YUHA 5ANME 3D6FB 5L2KE 1JZ4A 4AV4A 4MNHA 1LW2A 2CVIA 4EI2A 1QKZH 5HDBE 4KZEL 3ZTJH 4DTGH 2JKNA 5HQMA 2CDFB 2VG5A 2XN0A 1JZIA 2A6JA 3GTTA 3BN9C 3NH7H 3QZMA 4X6FB 3AY4C 2G1DA 2IMOA 3VHQA 5FM4A 5KN5A 3NXZA 3TT3H 1C4AA 3QGVA 1MDTA 2W9EL 1E27A 4Q56A 4LT7A 4ZODA 5EO0B 5FK9A 4MNQD 5DEGA 4LBEA 1VK8A 2XB2D 4CLKA 1S6UA 3LPPA 4RBPK 1T02A 1NIAA 3V4VA 5HL7Q 1RK1B 1BMWA 2DEWX 3T0BA 1VADB 4X66J 1I4FA 2J76E 4H0IA 2WTOA 5A6WA 1Z1WA 4AYSA 2KS0A 1D5BA 2G5BA 2PXYD 5HDRA 4APQC 4Y89A 5IFAL 3JXOA 2WWNA 3FQYA 3ULUC 1USQA 2Z6FA 4QO1B 5ICYA 4EGLA 4F7TB 5F8HA 3PFQA 2XNAA 4LARL 3SKNA 1SN2A 4NIKB 4OIIH 2OSWA 3WU1A 4Q9RL 2P8PA 4WWNA 1P6WA 2VW6A 2QG9B 5ETLA 5IFAH 1MG3C 4B7LA 4E0DA 1ZHBB 2F4VF 4NI2B 5E08L 2HQFA 2WO2B 4IS6A 1HQ2A 5FUZL 2VAJA 1T3NA 3SKMB 4OZIE 1D7FA 2VLMD 4P4KB 1J9SA 2FL5B 4KMTH 1T04B 3C8KB 3VJ6A 3NBNA 5D1XC 2DTML 5E99L 1MCQA 2ZXBA 1KV7A 3DX4A 3ESPA 4NC2B 3SPJA 2EIMB 3DGDA 3X3FH 4M5NA 4JFEB 1GRWA 1WWCA 4PJEB 4UMGA 3VI3F 3HVNA 4Q7DA 3AH6A 8RUCA 2BRQA 2G2RB 1QEWA 1MFCH 3ENEA 3JTTA 1S78C 4C59B 3K71A 3THTA 2X4NB 5HLFB 1CT8B 2PABA 1BIHA 1UQSB 3ZYJA 4ALAL