2XX0A

Structure of the n90s-h254f mutant of nitrite reductase from alcaligenes xylosoxidans
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
335
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHSVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 92
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xx0A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xx0A02
2VW7A 4PCYA 1FFTB 1NIAA 1OCRB 3WNJA 1AIZA 1L9QA 1SFHA 1WAEA 4NB7A 1GW0A 5I5IA 5TK4A 1AANA 3FPYA 4M3HA 1M56B 1NPJA 2XYBA 3SBQA 4GP5B 1NINA 2PPCA 3NJGA 4HAKA 4WKXA 5E9NA 4A2DA 1J9SA 4AKOA 3NSDA 1W6WA 2FQFA 3OQRA 1EHKB 4YSOA 1DYZA 3RYMA 1OE3A 2DV6A 1BAWA 3FQYA 4NERA 1CC3A 1UATA 2JFCA 2BP8B 2TSAA 3WG7B 2N0MA 3H4HA 5IY5B 1AZRA 4GP8B 2W88A 3N55A 3TASA 1PCSA 2OCCB 3CVDA 3X1BA 2YXWA 2ZOOA 5AZUA 1L9RA 2TSBA 1A65A 3PXLA 3UACA 4ENZA 3HB3B 5I6OA 3NJLA 1CURA 2FWLB 1AS7A 1AZCA 3TBBA 1IKOP 1MDAA 2IDUA 3IBOA 1JZJA 3AZUA 3ASNB 3FSVA 1JZHA 3AG3B 1AG6A 2R7EB 3IN0A 2PLTA 3NJIA 4DPCX 1IBZA 4GYBA 2Y69B 4BXVA 4A2EA 4UAHA 2IH9A 1NZRA 4NAJA 2NRDA 4BDVA 2QPDB 3ABKB 4E9SA 3HEIB 3WI9A 2XLLA 1KBVA 2XXGA 3WNIA 2BWIA 2UXFA 1ZV2A 1ILSA 2MTAA 4KO6A 4F2FA 2P80D 4DP1X 1TKWA 2XU9A 1SHWA 3X2QB 7PCYA 2AVFA 1AAJA 5FC9A 3X1FA 3PLYA 5D4JA 3V9EA 2GB2A 3ABMB 4DP0X 4DPBX 3G5WA 4N8UA 2YQBA 3GDCA 4AZUA 3NJMA 3CDZA 2ZXWB 5I28A 3U25A 2FQDA 3UABA 4YVNA 1ID2A 8PAZA 1ADWA 3FYIB 4YSUA 5B7MA 5B3SB 4BWUA 4KNSA 3CVCA 2J57A 2FT7A 2XUWA 1XMEB 1GYCA 2EINB 2WO3B 2QPEB 5EHFA 1SFDA 4KO5A 4DP4X 2YXVA 4KOBA 1ASOA 1E65A 1GY2A 3UAAA 1N70A 3N2JA 2PP7A 4E9YA 1AOZA 1KCWA 2CBPA 4F2EA 2FTAA 1PNCA 3T6WA 3FQ2A 4E9XA 3BQVA 5B1KA 2BHFA 3UGEA 1RCYA 1GR7A 2FNWA 4JKNA 4DP7X 3PAVA 3AY2A 3SBPA 2VMJA 4BWTA 1JZGA 4YSTA 1FWXA 2HRGA 2PP8A 4AKPA 1OCOB 3CG8A 4A2FA 1GY1A 3ZBMA 2UXVA 3T6VA 1M9WA 1BYPA 1B3IA 1NPNA 2BZCA 4RH4A 1YLBB 2BWDA 2J5WA 1OCCB 2VSMB 4A67A 5B1AB 5AFAA 1FA4A 2FT6A 1A4BA 3AW5A 4AI7A 1WS7A 2BP0A 2IDFA 2YAPA 3H4FA 4YL4A 4DP6X 1NWOA 5I6NA 2XVBA 1BXVA 2B3IA 3OMAB 3FSAA 2HX9A 3EH5B 5A7EA 3FQ1A 3IN2A 4BK5C 1HFUA 2GI0A 4DP2X 2BZ7A 3UAEA 1MG3C 1ASPA 2UXGA 3QJTB 2XX1A 2ZONA 2LLNA 3FYEB 2YAFA 3ZDWA 1KBWA 2GC4C 1J9TA 2PP9A 4YSCA 1HAUA 1VLXA 1ET8A 1W6LA 1QNIA 4A2HA 1AQ8A 1AZUA 4YSQA 1BQ5A 3FU7A 1JZFA 2AFNA 1L9OA 1TEGA 1NTDA 3FU9A 1GS7A 1CYWA 2YARA 3ZIYA 3T9WA 3NSFA 2AANA 5I6KA 3NJNA 2DY2A 3NJFA 5I6MA 1EZLA 1KDIA 1IC0A 1T5KA 2DWTA 2YAQA 3PPSA 2Y1AA 1E5ZA 1NIBA 4E9RA 5B1BB 5I26A 7PAZA 4YVUA 1JXFA 2RACA 2IWEA 5LDUA 1GSKA 4G71B 5B7EA 3V9CA 4KNTA 4AKQA 4G70B 1AS6A 1SF3A 1IUZA 3GXUB 4E9VA 4DP5X 4FAAB 4HALA 2EIMB 2MRYA 3IEAA 1MZYA 5I5MA 2X87A 3X1GA 4G72B 2Q5BA 2YAMA 3EHBB 1NICA 4HHWA 4PAZA 1PLBA 2YAHA 4BXSV 4BDVB 4EF3A 5I5JA 1NIFA 2PPDA 1BYOA 1ZPUA 1QHQA 3BVDB 1JXGA 1AG0A 3KW8A 4M4RB 2A3TA 1A8ZA 3NYKA 3S3CB 1KCBA 1AZBA 3QJRB 2PCFA 2FQGA 2GBAA 3L45A 3AG4B 9PCYA 1KDJA 1PLAA 1JERA 4HCIA 1ET7A 4HZ1A 5D4IA 1A3ZA 2PPAA 3T6ZA 4A66A 1PZCA 3ZX1A 1MZZA 1WA0X 3PAZA 2QT6A 3NSYA 2E86A 3WIAA 1SDDA 3S3DB 3EH4B 2IH8A 1WA2X 1JOIA 1ET5A 1SF5A 3S8GB 4ZK8A 1R1CA 3CDZB 4G7QB 5D4HA 1OF0A 4F7KA 1OOWA 1SNRA 2QDVA 2Q9OA 5ANHA 2X88A 4JHVA 3UADA 4DP9X 1V54B 2IAAC 4FA7B 1OCZB 2CAKA 3NJJA 1RZQA 3QQXA 3DKHA 3EH3B 5AKRA 1PMYA 1GS8A 5PAZA 2XXFA 3CVBA 1RKRA 4G7RB 2H5UA 3PCYA 1JXDA 4KOCA 1J5DA 1L9PA 1KGYE 3NP4A 5TK2A 2FJSA 2VSKB 3SBRA 1X9UA 4YSSA 1L9SA 1XB6A 1TEFA 3QPKA 2JKWA 2DYRB 4CSPA 4HCFA 1E67A 1AR1B 2HLEB 3QJQB 1JZIA 1SHXA 1ZIAA 2GIMA 4TXVB 3FSWA 4UF7C 4JHUA 1ETJA 2CALA 2BP0B 3NT0A 3OMNB 1PZBA 4CSZA 1QLEB 1BEXA 4N4YB 5F7BA 1F56A 1J9QA 1AZNA 1JZEA 1URIA 5F7AA 4L0PB 2WSDA 3OD3A 2BP8A 2HRHA 2J55A 2XV2A 1HAWA 3OMIB 3MBWB 3ABLB 3PAUA 3QJVB 4HCGA 1ILUA 6PAZA 2VW4A 1ZDQA 2J56A 2PPFA 3X1EA 3QJSB 2HX8A 1BXUA 4QKTA 3FT0A 1ZIBA 3TU6A 4E9TA 2OV0A 3FPXA 4MFHA 4E9WA 1CUOA 1TU2A 2H47C 1V10A 4GXFA 4X4KA 4P5RA 4A2GA 4G7SB 2P80A 2IDTA 4YSDA 1KYAA 4Q8BA 1BXAA 1MG2C 2XV0A 3JT2A 4GY4A 4E9QA 6PCYA 3MX0B 3FU7B 1XB3A 2AZUA 2BO0A 2AZAA 2UX7A 5B7FA 2I85A 2R7EA 3T6XA 3QJUB 2FT8A 2GHZA 1NWPA 3IE9A 2EILB 2IDQA 1JVOA 2IWKA 3TA4D 2GC7C 1A4CA 1W8EA 1L9TA 4P5SA 1ASQA 3D12B 1PLCA 3X1NA 1AS8A 2EIJB 2UXTA 4K9JA 1M57B 5PCYA 1JVLA 3NJHA 1PY0A 3AG2B 2VM4A 4KO9A 2JXMA 2VN3A 4W9ZA 2BW5A 3H56A 5I6LA 3DTUB 3TBCA 2OJ1A 2UX6A 1J9RA 1WA1X 4DPAX 1OV8A 2FQEA 3FS9A 3WKPA 5B1JC 1DZ0A 2CJ3A 3FU8A 3AG1B 3ABGA 2H3XC 3S3BB 4UANA 3CZUB 4HHGA 1OE1A 3OM3B 5B1JA 4Q89A 1PF3A 1V55B 4A68A 3DIVA 3NP3A 1BQRA 3NSCA 1E30A 4YSRA 1AACA 4KNUA 2BW4A 4QLWA 1N68A 1PZAA 2HX7A 1NIEA 4GP4B 4BWWA 3SQRA 2I7SA 2GSMB 3KW7A 2DYSB 1I53A 2EIKB 1XB8A 1ZDSA 2ZWNA 3T71A 3GYRA 1SDDB 3JTBA 1NIDA 2CCWA 1BQKA 3FSZA 5I6PA 2WO2B 1NDTA 2W8CA 2XX0A 1PNDA 3EF4A 1GS6X 1CYXA 4HIPA 1PAZA 4DP8X 2HXAA 1J5CA 1OE2A 2XV3A 3ERXA 3NJKA 1KV7A 2DWSA 4W1TA 2YAEA 2PCYA 2B08A 1RZPA 3ASOB 1IBYA 2I7OA 1E5YA 4YSEA 4YSPA 4AX3A 1WS8A 2YAOA 3S8FB 2VW6A 2CUAA 3WKQA 2PPEA 1SJMA 2HZHA 1A4AA 2IDSA 3C75A 2IWFA 2VM3A 1X9RA 4WTQA 2XWZA 2QDWA 4KO7A 4YSAA
chains in the Genus database with same CATH superfamily
3KL5A 5H2BB 3QA3B 5BZZA 4TSAL 2NY1B 2DQUH 5AW5B 1EFXB 1RZGA 2FB4H 2ZP0T 3I6KA 2D7NA 3EOBA 1M56B 3NZUA 4QGYA 3WUWA 1XGQB 2X4SA 3U0PA 5G4OA 2H0EA 4Z8FL 4ZYKB 5E9NA 5FUCE 4DGWC 2ICEA 5E7FA 4MA7L 2FQFA 3OQRA 4DO5A 1JDCA 5HDLA 4PUBL 4NO2A 1AGDB 3IFNH 4KJQD 3QJXA 2EEFA 4JKPL 3MYZA 2J8UB 4JN1L 5E2WH 3B9KD 2F5AH 3SPJA 1TZOA 4NQCE 2GSGA 1CFQA 1BZ7B 4X6EB 1A6WL 3ZQ9A 4JPVH 1PCSA 2JKNA 3RB7A 2PO6B 2DL9A 2GJ6D 3AXIA 5BOZG 1TLKA 5IKCB 4H8UA 3JWDH 4HJSA 4EI5D 1KLGA 2NNAB 3UACA 4BFEA 4ZXBB 1CURA 1C08A 4N0YL 4QI3A 5T1LB 3UAJD 4FFZL 3OPZL 4D0CB 4CVXB 1N8ZB 3AGVA 4ALAH 5F72S 1CK0H 4WNQB 4Z78A 2IDUA 3FFCD 1INDH 1F3RB 2ORBH 1I8KB 4LPVA 5HPMA 2X4UB 25C8L 3H53A 3D3VE 3FUEA 3UPCA 3B8SA 1E40A 3O9WA 4X5RA 3TNNA 4XXDA 4XAWH 5IB3B 1WBXB 3BPNB 3ZE1B 4PI2A 3Q2VA 3TV3L 1OP5H 1XF2A 2SEBA 1BQSA 2FJFA 4K15A 1WFJA 4HJTA 3DJ9A 4N6RB 3BWSA 8CGTA 1NL0L 2WJ7A 3LRKA 5T33H 4WHTA 1ZMYA 1YQVH 1IJ9A 1I85C 3QQ4B 4AQOA 4ABWA 4LBEB 3RFZC 1F42A 2DBLH 1N4XH 2FL5B 4QXUL 3SQBB 4NKQB 1WIUA 1UB6B 1CT8B 4BEIA 1BVLA 1YEKH 1L7TL 1TSRA 2EYSA 2UXFA 1F90H 5SX5K 4R4BA 4HWBL 2WTRA 4P4RA 4HEMA 2C4FU 1V27A 5KN5B 4IBUA 3U0TA 2XU9A 4YHYB 1T66D 3CFNA 3CSYB 4M62H 4K55A 3X1FA 1XH3B 3VGHA 2R56L 2YC1A 3AROA 4HAFA 2O93L 5CCHE 4OF8A 3G5WA 3H3PL 3TX4A 4B60A 2ODHA 5DVKA 1DLFL 4FFWC 1WTGT 2X3CA 2F68X 1NGWA 1TJIL 1U4FA 1MIMH 2QMJA 2EIZA 2VN5A 3WCYA 4V2CB 4B0MM 3QZWA 5E08L 2EC8A 3FUNA 3MRRB 3QUGA 2DEYX 1B2YA 2Z31D 2OLDA 5AVWB 1SEQL 2KL6A 2VR8A 2WBXA 4HMCA 4HF5H 4OVUA 4ZO9A 5J12C 1F6AB 1SJHB 3F58L 1UXLA 1XEUA 3C5ZB 2GUOA 1DSFH 3FOMB 5I8OH 1AMYA 1EJFA 4OD1H 3MZGB 5T3ZE 3PAVA 3SBPA 1L7IL 3MTXA 1AR1C 2UWEA 4U6HB 4OSUL 4X5PA 4ZFQA 5T1MB 1JYWA 2CD0A 1G7MA 2ZKWA 3CK0L 1U3ZA 5DD5H 4JJHA 5FFGA 4CU6A 1IQDB 1ES0B 3GSUB 4MWFB 4RH4A 3VSQA 5I19L 2IO5A 4RFEA 5EF0A 3V9FA 3OAYH 4MDIA 3MU3A 4PVNA 2DQ6A 2J8HA 4YJZL 1A7PL 4XCNA 2BP0A 1LD9B 2HRLA 3AVEA 3HHSB 3QUKB 3F05A 5HYJA 5FYLE 3W37A 3BUDA 2KDYA 4OCSL 4DTGH 5JOPD 5CINL 4KK6C 3OZLA 1SOSA 5CJBA 4KHTL 3U1PA 4MZ3A 4BSVA 2AJXH 1CBVH 4XBGA 4FFYL 2XQBL 1S7WA 1R0AL 2GI0A 1Q9OB 1JPGB 1A9EA 4R3SA 1MG3C 4OF7A 3N0PB 3SODB 5JW4N 4RX4A 4RGOH 3NN8B 5GRJL 2IFGA 3BKYL 3U1SH 2DWDA 4LF3A 1FNGB 2EDKA 1OT4A 4CDHA 3VFRB 4ZMLA 5A2KH 1HKLH 4U1SA 1PBYA 2OR8A 3UTSB 3NRPA 1AQ8A 4ANXA 1D5ZB 2HPOA 3FU7A 3FQTB 2CDEA 4L1DA 1VEPA 2XTJC 3U4BL 5F2FA 1AI1L 2DB8A 5GS1C 2R69A 2XN1A 3ZE0B 4ZX5A 1Q9WA 4RFOL 1F4YH 5CN3A 1QWUA 1Q4NX 3C8HA 1M7DA 5DO2C 3SY6A 4DPRA 1QRND 2AK4B 1GZPA 1DBKH 4HFUL 4MA3B 5HP5A 1F1DA 2CLVB 4CMHC 1GKOA 5IVZB 2XG4B 2XWRA 3D30A 1SY6A 3MV8A 2D7TH 4P9HC 4B9PA 1YSOA 3L1GA 1ZHLA 1I9RL 4L1TA 3SGEH 4BUHA 2WMPB 3COOA 3CN1A 4DSYA 3PQYE 2JTYA 2JI1A 1DVFA 4G59C 4JZJC 4AGOA 2C9SA 3SIKA 2HG0A 1FYTB 3MACL 3QH3B 4FNLL 2VXTL 4MAYC 3KPMA 1S5IL 4JRYA 1HXMA 4QRPE 3D09A 2WHVA 5E9DA 4YDKL 5DUMH 5JIPA 4H1LA 4YPGA 4A39A 2H3KA 3HNVL 2VDQH 5DDHA 3DRQA 4LHUG 4LLVB 1ZPUA 1QHQA 1A1NA 4Z7VE 3NCMA 1JXGA 3QFJE 5CKGA 3TM6A 4K71C 4ZODA 4H2AA 3AU1B 3LZRA 3F8UB 3ARBB 2MH4A 2LFEA 5HVHB 3C08L 4HCIA 1IKFL 2F53E 3RWJB 4DEWA 5L4FA 1CF8L 4KVNH 4TNGA 1N9PA 4JO2L 2OW7A 3CXHJ 2W38A 4U4BA 4WU5B 2LVCA 4O02L 5KSAD 4LLDB 3BWAB 5C08A 3TZVC 2DQHH 4GG6B 2NY7L 3OJDA 4LAJH 1TZIB 2IH8A 1CJYA 1LNUA 3IDMB 3VUAA 2I07B 5I1CH 4ZK8A 2WXFA 4BZ2A 4JM0A 5I8CB 1N3NA 5DC4B 4G9DA 1NFDB 2FJGB 2DOCA 1J0HA 1FNHA 1IGCH 2WKOA 3GMLA 3IS0X 5MP6H 5ANHA 3NSXA 4JO1L 2X4OB 3R19A 1SBSL 2H6PB 4J39A 3VCLB 4ZI8A 1CI3M 1X5ZA 1DANU 1GYWA 4IHOB 4R0LB 5GJSH 2ZXGA 1SRDA 4U6YB 4JNXA 4Z3GA 1UYWL 4HEPG 4UM9D 2IXQA 5FA3B 3QQXA 3D4GA 3HE6A 4CJ0A 1J0YA 2K3TA 4K94H 2YMXL 3D39A 4RSVA 1IBBA 1OAUH 4MNGE 3GUTB 1B2WL 3FUKA 3V79C 3CXFA 1F4AA 5C6TH 2PTTA 4ZDHA 4Y9FA 1S7RB 5DRWB 2UWEF 3MRLA 4CRPA 1N0LB 4N8CL 2HA1A 4ODBD 3LDBC 5F8QC 3SDCD 3QFDB 4HX1A 3ML9A 4ETQB 3ZK0A 4TKWA 4R4FL 1OOAA 4PJGA 4ZUUB 4LNVA 2OI9B 5DYOA 4W6XB 1ZEAL 2WQRA 4KWUA 4OCXL 4HUNB 5B21A 5F7UA 1FRGH 2OMVA 3MUUA 3V55A 1S7UA 1JZEA 2WWMD 4D3CL 4D9QE 1IKNC 2ZXAA 3EYVA 3JV6B 1MJ8H 1XF5A 4NKDB 4G6FB 4G5ZL 2X89A 2EDJA 3QR2A 2VC2B 3MCKA 4XB3A 1MCOH 3EDFA 2PWEA 2WSPA 1ZHBB 2Y7QB 4YIQA 1BEYL 3EJTA 3VXTB 4EJ1C 4KKQA 2CH8A 3IU4L 4QF1B 2ZQKA 3U9WA 1W0YT 5JHDB 2BSRB 3IGAA 2IDTA 1CD0A 2XV0A 5FCUH 3H85A 2A9MH 1KYDA 1F13A 1OARH 2O72A 5DRNB 3P73A 1FNEA 2Y7LA 4ZMPA 2XKNA 3AM8C 3EO0B 3WTWA 2GITB 2XG5B 2FT8A 1MFCH 1FL5A 4J6RH 5C71A 3KYNA 5J6GA 2IDQA 2JELL 2IWKA 4PGCB 1KBGL 3DVIA 4A55A 4EDXB 5SV4A 2EYRB 3D69B 5IZ7A 2VABA 3CHPA 2R29H 5IMMB 1EEQA 4NRZB 4CAGA 3BKJH 4ZTPL 1DR9A 2W65B 2HJKA 3HPLB 1UXSB 4NBXB 4P9HL 3U2JA 4LEOB 1MN4A 1N10A 4JY4A 3RWEB 4PHZA 3GJFA 3S8WA 4F1ZA 1KB9J 3HBQA 2WLKA 1PQZB 4QRQB 1JZ8A 3WE6B 3T1WA 2OXGA 1KENH 2IPKA 1N19A 4JFYA 1I1AC 1OAZH 2I9LA 1DQQA 3L3OB 3KLDA 5I2IB 3D3VA 4CNIA 3WNMA 4YDIH 2ZUWA 3PWPE 1HCVA 1KN4H 3EBIA 4KRPB 2DDQL 5EC1A 4I3SL 3OMZA 4LHUD 1BQRA 1A7QL 5DS1A 4QEGA 5EZPA 3VNZA 3IAQA 2NNRA 2W60A 4W70A 4UOZA 2F19H 5IBTL 1TQSA 3N41F 1N6UA 4YHPA 5KBMA 4W4OC 2HRPH 3QUZA 4KZDL 5ICZA 3EGSA 2OK0H 1A5FH 2J12B 3W0WB 5D1ZA 4RFNC 5JQHC 2KQNA 4KTEL 2K0RA 4Y4KC 5A3IC 4XMXA 3MXVL 3JVFC 1K5NA 4I77L 5AYTA 1MFVA 4JG9A 4TSCL 3W39B 3KPSD 3MROB 4DVRL 1A6UL 1HYSC 2VKWA 5I30H 4M5SA 4OCWL 3AT0A 2PCPB 2B14A 1HEZB 3D2UA 3LPOA 5FO7A 5A16B 2WKOF 4HFWB 1V7NH 1ZT4B 4FERA 1QEXA 1A3RH 2OKMA 1YNLL 4BYHA 2G5BB 2J8UE 2J3SA 4BFBD 5EOCH 3RTLA 4JRXD 3INUH 5CHNA 3B6SA 5ENWA 4AV4A 3DSFL 4NN7B 2AJUL 3MGTA 3V6OA 1FNSH 2C9QA 5CBAB 3WNOA 4UIKH 4YSAA 2A74B 2X9ZA 1AIZA 2Y2WA 4P05A 1MVUA 1UD4A 2Z4TA 1J1XL 1DO6A 3MV11 4MRCA 1KNOB 2OYLA 2JK5A 3ARSA 1WFIA 1YUHB 2PPCA 1FV1B 4J3TA 5F7YC 1RUPH 3HR5A 5L7XH 2R0ZL 4RDQF 1DYZA 3JQOB 4LU5L 3S35X 5ICUA 3ZE1E 4NERA 4H44C 1SN5A 3M8OL 5BRZD 3F5WB 5A2LH 1XH2A 2AI0L 2VM9A 1IT9L 3S98A 3E6FB 3FOLB 1CPUA 4PWIA 4WW2B 3WY3A 4XPTL 2B1AH 4NEHB 2YPLE 5JLZB 4OD3L 4MMYA 4GG8A 1DQDH 3THMH 3HRZC 3L3IA 1CXEA 3LS5H 3C2AL 3JXAA 3GD1C 5C86A 1A65A 4XB8A 4M5ZH 1YY8B 3HC4H 5C0CD 2ZAIA 1NJ9A 1TQBB 4GAJH 5DD1L 5EDXA 4PLOB 1AZCA 2ZKHL 5F71A 2HUHA 3SE3C 4IGBC 1D6VL 5DMJB 2ZX8A 4PGDB 5BZWB 3VWJD 2N3JA 1P5UB 3RFRA 3MNZA 2CBOA 2ZKYA 4UI2A 5DC2A 3EG9B 1OF2B 5KZCB 1UFGA 1LEGA 2B5IC 3L8QA 3FFDB 5GIRA 4LAQL 5HVWA 4FQHB 4XCEB 1SXAA 2DN7A 5L6YH 3WTUA 3I02A 5FYKH 3JBG7 3BCFA 4XBEL 5A2IH 5AW7B 4L37A 1ZJAA 5CIPA 4R90H 2X7LB 4K3HA 4JFFB 2C7UA 2XN2A 5E4EC 5DHVA 4FQIH 1QYGL 3QZOA 1VZIA 5IQ7H 1UXWB 1WIOA 4NUJB 1CIUA 3MKKA 4ELDA 2QQLH 7PCYA 4W9JC 2WLHA 4LCUB 5DU7A 3GSVB 3S37L 1ZS8A 2DI9A 1CS6A 5F9DC 3VFSA 5D1QE 2WQXA 5HJDA 5L88L 3MLZH 2ZOKA 1HOCA 3ABMB 1AQKH 3HZMB 3NFPB 3PQYA 4RDBA 2YQBA 5DMKB 1QSEB 2YOCA 3B7UX 5I28A 1MJUL 4WI7A 3T8VA 4N2CA 3S5YA 4HAGA 2JCWA 2AJVL 2DM4A 3S2AA 4WFGD 1X7QA 3V0WL 2BRQA 4P2YA 4QRPA 3RWHB 1F00I 3DX9B 3BP5B 5E2TL 1F11B 4OLEA 3GZPA 3UBXI 4CW1B 4KNSA 1GRWA 4AYBA 3L7EB 3E2HB 3X17A 1D5MA 3QPQC 4DGVH 3IFOB 9CGTA 1IL1B 2OAAA 4Z7VA 2H6UA 2XWXA 2RGSA 1QTPA 3QFJA 4L29A 4MJIB 1ASOA 4AYID 1X6LA 4KRLB 4GUCA 3I9GH 5EN2A 4Z77B 1MRCL 2GT9B 5CEXA 1XD1A 1XAUA 1XD0A 1WEJH 3QYCA 1A22B 2BSDA 3DTDA 4NZ8A 3TVMA 3UGEA 2X70A 2F53A 4XN1A 1INEL 3SZKC 4K73A 3I84A 4DKFL 1HDMA 4GJTB 3I9PA 4XNBA 2PP8A 1OCOB 4U7KA 1MXGA 4E2OA 3VGBA 5TH2B 4GAFB 3AQDA 5F7DA 2MQCA 3UTSE 1SM3H 4W9GC 3E80A 4D9LH 5DFWH 1NEZB 3ARGA 1ZVNA 4N24A 4YFLI 3LKOA 3DX8B 4NZUH 1WUZA 5IQNA 2B77A 1XCTA 2BRRH 2E47A 3ZE0E 3UAJC 3UBXG 3HRPA 3O3EA 3HAEA 3N1GC 2V17L 1A6PA 3V0FA 4XP4H 5DZOA 1YEJL 1KIRB 5F1NB 5D7JC 4DQOL 3WN5C 4BK5C 2VOTA 3DK0A 1E7VA 2QKIB 4PGZA 4Z0BL 4KAQH 4MNGA 1QUNB 5HJ3B 3PWUB 3L9YA 4I0PB 3CC5B 1FGVH 4HWNA 3QVAA 5CMAA 5LN4A 4TVPD 3DMMA 2APXA 1XGRA 5ACMA 1BAGA 4WI4A 3F84A 4RMRA 1GGYA 1AKJD 1W6LA 4X6BA 1FYTE 1MCKA 1JZFA 1X5KA 4NPKA 4L9DA 3VFGH 3ZHNA 1BOGB 1GMIA 1TCRA 4ABVA 3OKKA 4RMSA 4U4IA 3CFTA 5E5UB 4HBCL 3RNQB 1T66C 5HHME 3SD5A 3UGXA 2GSIA 2VYRE 3T2NL 3PPSA 1AGFB 3GXIA 4HC1L 4LPCA 3S36X 1S8DA 4LRIC 4YDLC 3D1MC 5H35A 2VLRB 1LDPL 2A1WL 4LLUB 4G1EA 1MAMH 2A9BA 5LDUA 2I60L 4UT6A 2WKGA 3IDNB 3KPOB 4RISL 4ZW8A 3VXQA 4CC0A 3QIWA 1IGFL 2KBGA 3MLVL 4AKQA 3VD3A 1PD6A 3OAZH 3CMOH 3DV6B 2V33A 2RA1A 2ZUSA 1SVCP 1LLAA 4GG6E 4P99A 4HOXA 1E8ZA 4FABL 4YOKA 5EBMB 1XF4B 4F7PB 2GVYA 3T0XA 3MRMA 4B9GA 2FX7H 4DGYL 1D6EB 2Q6WA 3QEHB 2Y5EA 3O8XA 4JKMA 4YE4L 1BYOA 4PI0A 2BM3A 2P8LA 4YGVB 4G3YH 4QRRB 2V37A 12E8H 4ZUWA 1R3LA 1A8ZA 3A4AA 1WLHA 1CBJA 2VE6A 1E6JH 2OMTB 4DK6A 1EANA 1AVAA 4Z7NE 3BSHA 3RFZB 4JQIL 4B9CA 5JUEH 3OSKA 1I1FA 4JPIB 4KRMB 3VFNB 2VWEE 2DYPD 1CE6A 5C0IA 1LO4H 4XPAH 2VDRL 2I9TB 2WNKA 3MCLH 2MQ0A 4HUUA 4UTBA 4DGIH 3MC0A 2EDEA 4BUQA 4JZOA 3TL5A 2GBTA 4WQOA 2Z6FA 5I75C 3PP3H 4ERSL 1IARB 4PCKA 3L3DA 1BG1A 1ZTXH 5TF1L 3JZYA 1CDGA 2YMOA 1AXTL 4PRNA 4F7KA 4MQSB 3SDDD 4QUOA 3PWPA 4O02B 2AQ1A 5E5RB 2X2JA 1KLUA 1VFBB 1BQHB 1XHHA 3B8YA 4GUQA 2AEPH 2W92A 3A67H 1KTDA 4FQ1L 4Z7VF 2DS4A 4OD2B 2B39A 5SWSD 1WD9A 1ZE3C 2JKTM 2NY6D 2ZWLT 1KYOJ 2C3VA 3EJRA 3O2VL 1HSBA 4J6IA 2WINA 4B7LA 2W5PA 1U8JB 2N7AA 1RZ7H 4XVSL 5J12B 3RPIB 2BXYA 5H2BA 5C2BL 2B2XH 4YSSA 5KVEL 3QA3A 2FHBA 4PB9H 1C9SA 1EFXA 2VJ8A 2O6CA 3M1CA 1YEEL 3LV3B 3ZO0A 5JHDE 1XGQA 4GKNB 3MTRA 1OK0A 4LOUD 3OKYA 1AR1B 1LO3L 3N1FC 1Q1PA 4ZYKA 4UTAL 4IRZL 2PWDA 5KYWB 1A47A 3GBNL 2GIYA 2GEQA 4RMTA 5IR1B 1KCVL 1CLYH 1UH3A 5DMYA 2GJPA 4Y4FC 1AGDA 4HJ1A 5DCCA 2LR4A 1EXHA 3ESUF 2D7QA 4A7SA 2J8UA 3LKRB 1TFHA 3D4ZA 4IKKA 1XL6A 2VZOA 5D9SA 1A14H 4GAAA 1BZ7A 1KCRL 4X6EA 3EAKA 1ILUA 4APXB 4OJDH 1ZDQA 1KG0B 3CU1A 5IKCA 3ATFA 4FTVB 5EZIL 3RDJA 2NNAA 3TU6A 4ZXBA 1NAML 2VTFA 3ULVC 4JG1L 5T1LA 3DHJA 2X28A 4D0CA 4N9GB 4CVXA 1N8ZA 1R3IH 3CVHH 2YWZA 4N90E 4P46C 4WNQA 4OV5A 4QGTA 1V8HA 3K6FA 1I8KA 4KZEL 3SJVE 1I4FB 1UCTA 3JT2A 3UIZA 3F7QA 3FO0H 2X4UA 5KOMC 3QWQB 3K2KA 1KJMB 4TTDD 3T1FA 3G6AB 3UTZB 2UYLB 2UX7A 5EPMB 2KI6A 5IB3A 1WBXA 2XNAB 3QJUB 2NCMA 2IJ0C 43CAB 3OZ9L 5D2NC 2XTJB 4NQDD 5D8JH 4N6RA 4K2UH 5F7WC 2ZWKA 5GS1B 2VN6A 2GFBB 1E3FA 4XP5H 4JM4H 4LBEA 1BGXL 5PCYA 2FL5A 3SQBA 1EPFA 1BZOA 1BJMA 1UB6A 1CT8A 4QHKJ 3TH4T 3VFUB 4NZDA 2ARWA 3B43A 4H2CA 3D9AL 5TE7L 1NBVH 4CMHB 4Z7WB 4GQQA 1O9WA 4JDEB 5IBUB 3OL2A 3CSYA 1JAEA 5FOJA 3FRUA 1XH3A 4R9HA 5J3HD 5FM5M 3D85B 1KYFA 4NO3B 4UU9B 2P24B 4PLJC 4LIQL 1PZDA 2NXYC 4S2SB 4MA8L 5KJ4A 4JZJB 4R4ND 1KJ3H 2FX8H 3FN3A 1MCWW 1KCLA 2VLME 4KJWD 4M5YH 1GW6A 4Z3TA 4F91B 2YQ3A 2EEBA 4JFVA 4MAYB 1V55B 4XMTA 2B1OA 2W9DH 2WZ5A 5T3XH 2CHNA 4U1GC 4Y1AD 1E27B 2Z9TA 2VMDA 4WO4D 2ESVB 4CN6A 4F33B 1CL7H 2ZUQC 2QPFA 3MRRA 3ZRCC 4FXLA 5CEZE 5F6HI 2Z34A 3B2VL 1PX4A 1IEAB 2C34A 4K71B 3FMGH 5L9DH 4ZO8A 3SQRA 2VDLH 5HI3D 1SJHA 2DYSB 3C5ZA 3V4UL 1PD0A 2YUZA 3T71A 2ZG1A 3FOMA 4NWTL 1I3GL 2FDBP 4U6HA 2GYSA 4XNXH 1HCZA 1J8HD 2F7OA 5CP3A 2I69A 5T1MA 4AYEC 3TZVB 1U8PB 1JPFB 1OPGL 1AR2A 3CX5K 1IQDA 1ES0A 2XV3A 3GEWB 2QELA 3GSUA 3P02A 4MWFA 4RBPH 4F15C 3BAXA 1EAPB 1BJ8A 2BMKA 3VSVA 2ZICA 3CFDB 2H26B 1D7DA 4LCCC 5E6ZA 2VXVH 2Y1VA 4DZ8B 3IJ8A 1WWWX 4DEUA 4JFWA 3HHSA 2YAOA 2Z35B 3I6LE 4KC3B 2EACA 1KZQA 5DA0B 1E5BA 1ZKAA 2YQ2A 3WTSA 1IGJB 3NMEA 4K0OA 5F9AC 1BFOB 1U33A 2QHRH 3BKMH 4KK5D 5EOTB 5FUOL 1M7IB 3OGCB 1Q9OA 2MOQA 2V5SA 5HGDB 1E5AA 3FO1B 5H37G 5IROA 3NN8A 3DX1A 1MCPL 4HAKA 1R3HB 5I18L 1ORQA 2C9VA 1FNGA 3LDBB 1ZXKA 4W9KC 1EHKB 2G2PA 2DD8L 3ROLB 1OE3A 2R0KH 3IF1B 3UTSA 1D5ZA 3HUJB 3FQTA 1X4ZA 4DVBB 2K7PA 5HGAB 3TEZA 4F7TB 1KELH 3H0TB 3QG7L 2VDKH 2K6YA 1E5CA 2J8UF 4MJ5B 5SWZD 4G42A 1Q72H 1LWRA 1WGVA 2FR4B 3BLKA 5HYIA 1RIUH 1SUJA 1HL8A 3D33A 3LQAC 3ULVL 3NG5A 5GZOA 3KS0H 4Z5RB 3TTSA 4JFFE 3WUWG 3ZY7A 4E42B 3BQUC 1K6QL 2PR4L 2VN4A 1HHKB 4G8GD 4MA3A 1KJ2L 2AEIT 2CLVA 2EE9A 5IVZA 2XG4A 4HPOL 5HDOA 3TYGL 4IRJC 3VSTA 3EIFA 4GXVH 1NCAL 3QORA 4FFVC 3ZYJA 3EDJA 3EJPA 1MELA 4PJEB 3S48A 1SHMA 4A1RA 2WMPA 3C9NB 3NCXA 4I85A 4JPQA 1YQ2A 4ZOBA 3Q0HA 2AITA 1QSEE 4EIUA 5J9PB 1FYTA 2OSXA 3V0IA 2ERJC 2P1YA 3SZ6A 3V7MA 3QH3A 5EOQL 5J8OA 3LIUA 5DT1H 3ZR6A 3BXNB 3MRCA 5AB1A 3ZE1F 4KTDH 4OFPA 2XWBB 4ZX4A 4TOYL 3BE1H 4KBPA 4ZJ9A 2R2HB 4M93C 5FFLA 2GK2A 4TNVF 4NUGH 4LLVA 3RBGA 3BEWA 1QW9A 4PB0L 3QZLA 4MJIE 3QIUD 5ID0B 4F57H 4KO6A 3AU1A 1KEGH 3ARBA 1QNZL 3X2QB 3RWJA 5EORH 2YLHA 4IBLT 4LSUH 4NX0A 1F2QA 4WU5A 3MRHB 4LLDA 3BWAA 5A43C 1UHVA 4LP5A 4JPWL 3BMWA 3VFTB 4GG6A 3BZ5A 2YR3A 3IDMA 3CFIC 2PWGA 2WQUA 2I07A 1I1AB 1JF5A 3A4FA 5KJRL 2NW2B 5I6XC 5I8CA 4GO9A 5LBSH 1NFDA 2FJGA 4NJAH 5JXEC 1DJXA 4GKOA 4KJPC 1COBA 1OXYA 2X4OA 3BSZL 3DRTB 2FT7A 1RU9L 2J57A 1HSAB 2H6PA 2CK0H 4OFKA 3VCLA 1OWWA 4G7YH 4IHOA 1RZJH 4PW4A 4U6YA 1VA9A 5EA0L 2BSED 2VGLM 3N2JA 5FA3A 2FBOJ 4XODA 4LGSB 2CBPA 2R1YB 3V6ZB 1MHEB 4UT7L 4YHOL 3MLWH 1UZGA 1YC8A 3BRDA 4W93A 3GUTA 4BA0A 3N91A 3BRGC 1AHWC 1YN6B 5DRWA 1EGJH 3VB8A 1XIWD 1IQWH 3FF7A 1N0LA 3EGDB 3EO1A 4Y4KB 3QFDA 2WLJA 4ETQA 4F20A 2R4SL 4B9YA 3TCLB 4UV4H 3CAFA 1T2QL 4ZUUA 1Z0NA 3C60D 4WUUB 4B95C 3QZWG 2YZ8A 3FT3B 1EEUA 5F0JB 1MCSA 3B2UD 3TNMB 2KZBA 3H9HB 5FWRA 3H4FA 2NXZC 5E4IA 3SGEI 5CFAA 2YPVL 3GJEA 2XVBA 2VMFA 3JV6A 2WUBH 5DI8B 4FZ8H 2A2QT 4NKDA 2VLRE 4AVIA 5CJQL 3VXUE 3D2TA 5AVRB 3MOAH 5DF0A 5ESAB 1F58L 4NM8H 3F7PC 2UXGA 4G6MH 4JFED 2WXIA 2Q20A 3BH4A 4XBPA 2Y7QA 5F21B 1ZHBA 5C6WH 3VXTA 3SOTA 1NUFA 3FYEB 1NCBL 1FO0H 3NIFB 4QF1A 4NZRL 3T4YB 1IC4H 5JHDA 2BSRA 2GUYA 4EIGB 4KHXL 2FSDA 2BK8A 4OQ1A 5GSVB 4ZFOL 3QUYD 1AQDA 2HH0H 2XWTB 4YXHH 5IJDC 4X7FC 4DUXA 5DRNA 2QPSA 1BBJB 4F7MB 3EO0A 2WLMA 2GITA 2XG5A 3LQAL 4N6QA 4BHUA 4NCC2 4M7ZC 3ZE0F 5FWQA 1NA8A 4D94A 3K80A 4QAWA 2LLGA 3GZQA 5ACZB 1IC0A 1T5KA 2E46A 4QRRE 4PGCA 4TM9A 3PGDB 1NIBA 2WXQA 2EYRA 2X40A 3D69A 5I8EB 4UUJB 5B1BB 1NLBH 3QYNA 5IMMA 2V2TA 5C07B 3HFML 3GI9L 2W65A 1V7MH 5CP7B 1UXSA 5D4QA 4LEOA 4LDEB 1UM5H 2AQQA 3HRZB 4KUCF 1TJGL 1WCBB 1OZUA 1RZIB 4G70B 1IBDA 5K9QI 1PG7X 1CE1H 3CTTA 1EH9A 2FK9A 1PQZA 4G6JH 4IGBB 3LYRA 1WTLA 3SJVA 2D31B 2WWNA 5I2IA 4R26H 1MHCB 3EUDA 2AEWA 4OQTH 6FABH 1FVCA 5IQOA 5DHXB 5EEXA 1T7VA 2BOCB 2VXQH 3JWOC 3WIHH 3I6GA 5KYYB 4IBWA 1BWMA 3G5YB 5DEJA 2B5IB 4UMSA 4Y7MA 3M07A 5D2LB 5IF0B 4OJFH 5DZVA 5JHLL 2D3NA 3RGBA 1BVOA 3OSVA 5IWLC 2YXMA 1ZS2A 5FYKU 4R2GD 3P9LB 4KXZI 2X1OA 3Q6GL 3WXWH 2Y4SA 1XL4A 5B3NA 1PX8A 3F7VB 1M1SA 1XGPB 3MV9E 1XGYL 2G3ZA 1BA9A 3C2SA 4I9WE 2A9DA 2CU9A 4M6OL 5E4EB 1G5AA 1D5IL 4MKMA 2BVOA 3O9WD 3VD9A 2JJUA 4MJHA 5LUMA 2IADB 5ALBL 4DN4H 1KB5H 2E0PA 5DJYB 2I26N 4FXKC 4GG6F 1ET5A 3W39A 4H1LG 3MROA 5D4HA 1DN0B 1QA9B 3FSOA 5E8OB 1FAIH 3US9A 2VDRB 4A6YH 3VJ6A 4XMZA 1MNUL 2PCPA 1HEZA 3LXAA 5A16A 4HFWA 3QCUH 3AADB 1ZT4A 5FHAH 3BX7C 1D9KC 4ONHB 1L6ZA 2WXRA 4J3UA 1E9QB 1QOKA 2G5BA 3L5HA 4MZIA 1AH1A 2PTUA 4S11A 1YY9D 1Y7VA 1KXVC 3P9WB 1RY7B 3LRLA 2QPUA 4XP1L 2XQ0A 3B2DC 2F2HA 1GZQB 2YJQA 4Z7NF 2JKIS 5CBAA 2QVIA 3QZPA 5TDNB 4HU8A 3LN4B 1XZWA 1JJUA 2A74A 3MBEC 4XPHL 1PPIA 3MRFA 4RWHA 4PCTA 4YDMA 5FV2A 3V0DA 5EU3B 2IGFL 4Z7IA 4GMSL 2C26A 3HCVA 5LCVL 1TEYA 2FO8A 4JFPB 1FV1A 4FG6D 4QYOB 5DWUL 3UERA 1VFUA 2CKNA 2FWUA 3BRFA 1UD8A 4YBQD 4YZWA 4HHAB 2CALA 4QRFA 1D5BB 4OJEH 2JB5H 3QDGB 4XOAA 5CZKA 1AZNA 1HK6A 2XTJE 3F5WA 2FO4B 1Z0MA 3E6FA 3FOLA 1FFRA 4MAZA 2E59A 3WENA 3MBWB 1UOVA 1MRFH 4WW2A 3ARPA 3MFGB 3FFCB 5BOJA 1DVSA 2X41A 2CBTA 3NPZB 4IIZA 4RMBA 6TAAA 5C7ZA 1KCKA 3D8MA 1X5JA 4AY0A 1LK2B 3WEAA 1BXUA 2VLJB 1JHKH 4OGYL 5D7JB 3WN5B 4N26A 4UYPA 2ZXEB 1XVSA 4HETA 4M1DL 3TT1L 2WVVB 4RDQG 4Z7WE 5IK3B 5LAXA 5I73C 3MLRL 4PLKD 2WJ5A 3K4AA 4PGDA 1MG2C 5BZWA 3VRLE 1ESOA 3PYCA 1P5UA 5HYJD 4MKTA 1CQKA 5KVMC 3P3SA 3EG9A 1NAMB 4XVTL 1OF2A 4KMTL 5GGTL 4FFZA 1Q0YL 1U4EA 3ZDYB 2UUDK 1LHZA 3FFDA 3P54A 4U3SA 4FQHA 3GKWL 4JS7A 1KBKA 1W8EA 1SLUA 4XCEA 2BSBA 2YRBA 3EDDA 2ESVE 2X5PA 4RX4D 2KHAA 5K39B 4YN3A 4L4VB 1JVLA 2Z8SA 2X7LA 1DE4B 4JFFA 4YDLB 5L2KB 3SDDC 1OM9A 1UXWA 4F8QA 5IJBC 1RK1B 2X4NA 4NUJA 4E0RB 2FECI 1PSKH 4LCUA 3GSVA 3JWOL 5AOZA 1MIEH 2O61B 2V5TA 3HZMA 3NFPA 2CIIB 2NY6C 5DMKA 3KBHE 1QSEA 5FYJE 4HWBA 1VPOL 4C4KT 5EUOB 1UD5A 1OE1A 1A7RH 2FEJA 2AJSL 2OBGA 3ISWA 3RWHA 2YRLA 4LPWA 4XC3L 3DX9A 1OT2A 2GQHA 3BP5A 4YSRA 3SHSA 2HT3D 2WD0A 4YQXL 1F11A 4CW1A 2R8SL 5TPWH 1J88A 4P57B 2P4AB 3IFOA 2O5ZH 1IL1A 1JFHA 4LRNH 4OV6F 4FL4B 4MJIA 2VLLB 4P23C 1CR9L 4X7TA 1Z9MA 5MERB 2UZXB 1QPKA 2F08A 1DVFD 2YKLL 4Z77A 3HMXH 1OW0A 4AEIH 1MKFA 1JRHH 2BSCA 4HXBL 1Z9LA 2VDPL 3PNWA 1RZ8B 2E4FA 2YK1H 5GSRB 1X5AA 3ZKSD 4JRYD 4XCFH 5FGCE 5E9DD 1ZGLB 4PH8A 4OM1H 4PVMA 5IT2L 3BYTA 3L13A 3GFUA 5AW8B 3RHWF 5TH2A 1UC6A 3MJ9L 5I75B 5E1IA 3MKGA 4ODTH 4TVPL 4W1TA 1NEZA 1EJOH 1CVRA 5LGHL 5J13C 3DX8A 2XZAH 2C9XA 4YSEA 3LIZH 4O9HH 1DBMH 2XSKA 3WTYA 4WAFA 2HKFH 2J4WL 5AZ2L 5KTEL 2VW6A 2WW8A 2AF2A 1U8HB 2AW2A 2E9WA 3RVVD 1SJMA 3WKQA 3WDHA 1KIRA 3ECWA 4NKIH 5C08D 3HTLX 3SQOL 3ZL4H 4TTDC 2DQJH 2ADJB 5F1NA 1BPVA 4LSRH 1P9MA 3X14A 4QRTB 1OCRB 1U8QB 5DRZA 3AREC 2QKIA 3Q43A 3L9RB 4GQPH 4ZMWA 2VQ1B 3UAFA 2BVEA 1QUNA 2BDNH 3D87B 4Q58C 3PWUA 4I0PA 5HJ3A 1NSNH 3CC5A 4NGHH 4OLVL 4NHCH 4PJEE 3QK0A 2X1QA 2YBGA 1HCFX 1W6WA 3UEZA 4FFYA 1JSYA 1JTOA 3I50L 5CLYA 1BAWA 3UX9B 4PY8I 1QHPA 3O41B 1G6RH 5IVXB 4QO1B 4OGAD 1BOGA 4JZNB 2BP8B 1P4BL 4NRXB 1YYMH 2YRZA 3RNQA 4NLHA 1TXKA 1WBZB 4IBVA 1IM3B 1MCNA 2O5XL 3L9BA 1AGFA 2IBGA 4A37A 2ZOOA 4OIIH 2VLRA 4LLUA 3MQIA 1RMFL 3RJDA 1AKPA 3CN2A 2YUVA 1G1KA 3IDNA 3KPOA 1SJVA 4N86A 3EYQC 2RJMA 2V3EA 4BCYA 4YX2L 2K9UA 3QXUA 2EKSA 3EZJB 3LZFL 3DV6A 3V4PH 1CN4A 4I18C 5BS0B 4WO4C 1AQHA 3ATDA 1S3KL 1A7OL 5DJ2B 4QHMB 5D7KE 4LPXA 2GG1A 1VGEH 2R7EB 5EBMA 4TRPL 2H2PD 1XF4A 3JWNC 4ZMQA 4F7PA 1AZVA 1KJ2B 3I2CH 4GYBA 2OS7A 1D6EA 2ED6A 2BXZA 1JGUL 3QUXC 4FF9A 4EZMA 2QVMA 2X89D 3QEHA 1HEJC 2WLYA 2ZAHA 3U48A 2GKIA 5D2NB 4UZSA 1N7MH 4HUMB 3EH2A 4YGVA 2YIHA 4QRRA 3QQ9D 2DW5A 5A6LA 4XP9L 1BJ1H 1EHLL 1N64L 3O11B 4PRHB 1I85A 4LLWA 4H0LC 5BCAA 2OMTA 3F7LA 3IGFA 5TDOB 2QV4A 4S1SL 3RFZA 3I3BA 3VFNA 4KKRA 3IT8D 4XCCL 1GIGH 2EXYD 5LG6A 2I9TA 5AVTB 2E74C 4AQAB 1KBBA 1SN2A 3ES6B 3QAZC 3WE1A 5AENA 3VB9A 4FKKA 2JKLA 5J6HB 4P5TC 4JFZH 5IOPB 4K5MA 3MBXH 2OX5B 2ZXWB 2TRYA 3MA9L 3ARYA 2NXYB 1ID2A 2R23B 3PWLB 4NQCD 4WUUE 4UM9B 1HQRA 1VB9A 1OQXA 2XY1A 2BP5M 2RMNA 4ODVH 1UM4H 4O02A 3ULUC 4N2AA 2BIPA 1VFBA 2NY4D 1BQHA 4NQEB 1EXUB 3QS2A 1VERA 1WUNT 1DQIA 4ZD3L 4U1GB 4V1DB 5GXBB 5HHXL 4OD2A 2FUQA 2XYCA 3LOWA 2LAGB 2ZUQB 4R5TA 1AOZA 3MV9A 2BHZA 1KOAA 2QLVB 3AAZB 4GRWH 5B1KA 1IILE 2VL5B 5CGYD 3D3VD 1AYOA 5FUZH 1U8JA 5CZVH 5HHOB 3GI8L 3QJHB 1NMBH 1WYJA 4M7LH 3BT2L 1K2DB 2QTVA 5C0AE 3RPIA 1JGLL 3WSQL 3NIFE 4N2KA 3HFFA 3LV3A 5EWIL 4GKNA 1ZTMA 2B0SH 1OB1B 4I2XB 1BZ8A 2NY0D 3MLUL 5KYWA 3K1DA 3LSOB 4IKNA 3WFHB 1G0DA 2X2IA 5TFSH 5IR1A 3QAQA 1MQKL 2DLEA 4XC1L 2YAPA 3L1OH 3JV5A 3LHAA 4M6NL 1RFDH 4F15B 5I1EL 1YAZA 3QUZD 1NWOA 4IDLA 1WZKA 4LCCB 3AGWA 1JNJA 2NW3B 4ZOEA 3S35L 5TE6L 3FN9A 4AGQA 1HU8A 5FM8A 4OTXH 2RALA 4UDUA 3UYRH 4APXA 3DOHA 4ZMAT 1HFUA 2CHXA 5KVDL 1JNHB 1KG0A 1OAKH 1UWXH 2A6JA 4QXGH 3QNYB 4FTVA 4WWPA 5ITBL 2XX1A 4BFIA 4XHJC 4P49A 1DBAH 3D2UD 1DJHA 4ONGH 3LKSB 4N9GA 1CLOH 3LD8C 1A7NL 1R34A 3QQ3A 1E8YA 5BQ7B 4HIXH 5IW3A 4JFXB 1I4FA 1MY7A 4ZFFB 1WWBX 4JFQB 3K7UA 4MCZB 2CJUH 4M29A 4F8LA 3G6AA 3UTZA 3HAEG 2UYLA 4UAOC 4DK3A 3ELQA 3O2DL 4PM1A 3NFNB 1F5WA 2XNAA 3T9WA 3RWDB 2ZPKL 43CAA 1EZLA 4LKCB 1EO8L 1N59B 2Y1AA 1KLFB 5GS1A 5EF2A 4K8RC 3NCYS 1YPZB 4ZFOB 2GFBA 3N1QC 2Q8BL 1P84K 1JFQL 5T3ZD 1JXFA 4LHQB 2QGCA 2KLRA 3B5HA 4JFTA 3L1EA 3RURA 3VFUA 2ENQA 3LNGA 3UDWC 5F0MB 5E4OA 4HCRA 4GO8A 3UO1L 4XP6H 5JO5B 3D07A 4Z7WA 4JDEA 4YWGL 5BUPA 2X4RB 4DP5X 4E9VA 4IRJB 2C9PA 4ZUVB 3GSNH 3D85A 3VA6A 3LPWA 4NO3A 4UU9A 4S2SA 5FYLD 3K6DA 4JZJA 4B50A 5KVGH 5KOVC 4PAZA 4TYUA 4XRCB 2ERJB 1MFUA 4BINA 4MAYA 2IPUK 4TMPA 5JA8B 1S7SB 1V3LA 3VW3L 2Z64C 5ALCH 2DJSA 1OAXL 3MJWA 1TDQA 3QWOA 4PJCB 1E27A 4PWEA 2ESVA 5ESQB 4NNPH 4M93B 4F33A 4JL1A 3K8LA 1JN6B 2X3BA 9PCYA 2FZ3B 1TKWB 1IEAA 2IH3B 3CZJA 1RUAH 2AXFB 4I4WB 3ARDD 2QZ5A 1LEKB 4OGQC 2CIKB 4ICXA 5HBBA 3WIAA 1KGCE 1NCCL 3LRHA 4LMQI 5DUPL 3SPIA 5J1AA 4L3AA 3WXVH 1AYRA 1SF5A 3WO3B 1RUKL 4MNHB 3TZVA 4GT7A 1INQB 3V5HB 3ULUL 1U8PA 1JPFA 4G7VH 4JQVC 4LASH 2JKJA 1I9EA 1EAPA 5KVEE 5I6XB 3CFDA 2H26A 3QDGE 3CX5J 5IG7B 4QWWC 5ADOL 3P11H 2AXWA 4DZ8A 1HHGB 3FRPB 3U7AA 1QRKA 4NS0A 1LMIA 2Z35A 1RZQA 4HXAL 4K23L 5DMIH 2MIZA 2OJZL 1X44A 1ODAA 2C9AA 2OMBA 3BLBA 2ZZUT 1IGJA 4YH6A 5DUJA 5E1GA 3FAWA 5KSBB 2IALB 3RUGB 5A1AA 4KOCA 1LEIB 2MSPA 2ZYRA 4JAMB 2VLJE 5EOTA 3PQYD 3TLRA 2LU7A 4ALAC 1M7IA 2VSKB 5DJ8B 2V5RA 1XBDA 3FK3A 3NGBC 1W72L 1CB4A 5HGDA 1JNNH 2MMXA 2QFRA 3FO1A 5C09B 3OAUL 1E8WA 3CDGB 4QRPD 1AHWB 5GS0D 3V8OA 1R3HA 3QG6B 1DEEB 3NA4A 1X4XA 1OD7A 1E7UA 2GIMA 3TBSB 5IB1B 4DESA 4W9CC 3EADA 4FQJL 3ROLA 3IF1A 1WFTA 3QFJD 3HUJA 3KLKA 2Y5QA 5F7BA 1AJ7L 2HJFB 3L4VA 2E4TA 4Y4HC 3ZDYE 1HZHL 2XKSA 4G11A 3MRGB 2HRHA 4F7TA 2R59A 3H0TA 5ISZB 2QV2A 4I8DA 3TVMD 1QSFE 3NA9H 3HR6A 4MJ5A 3ZDZB 2NXZB 2F53D 3TT3L 2I24N 1MNNA 4Q9RL 2P44B 3Q5OA 2FR4A 1OAQH 1IKNA 3RKPA 4BGDA 4L4VE 4MCMA 4Z5RA 5EZOL 4AJYV 1W2KT 2CM5A 5L2KE 1AZZC 1U8OB 4E42A 1UZ8B 3FPXA 3S36L 4BQ9A 3NJXA 1HHKA 5TE4L 4MXVE 2ZCKH 5KW9L 3ARGD 2FJHB 1CL7I 2LU5A 1KYAA 2HCZX 2JTDA 1P69B 2ED8A 1CFVH 4PJEA 3C9NA 3IJEB 3ZYOA 4AYDC 1OALA 5B7FA 4ES9A 4LLYB 5J9PA 4K8RL 5EUOE 2VLKE 3G08B 3A47A 4J3WA 4MNQB 4X2UA 3QJFB 2DLFH 4K7PH 4MHHI 1I7TB 2IVFC 4PW3A 4TUKH 3AM8A 5ADPL 4Q9CA 2R2HA 3II2A 4LLAA 4M7ZB 4BKSC 3O0RL 2V5YA 3E8UL 2BH0A 1RHFA 3CLFL 3MOBL 2VDOL 4QOKB 3UJTH 5ID0A 2Z93B 4POUB 2FVNA 7FABL 3PHSA 1JG9A 3QPXL 1TZGH 2C4FT 1ACXA 4RMQA 5FKPB 5I1AB 5INDA 1MFDL 1FL6B 3SDXB 4PJAE 4ZS6D 3CN3A 4MQXD 3MRIB 2JJSC 3KPLB 3S4SB 4Z7WF 2XTLA 2PW1B 3MRHA 1OGSA 1M2VB 4LEBA 1ZLWH 1QABA 3TA3C 3VRLF 5LQBL 3VFTA 1GCFA 1X3DA 3TO2B 3CZUB 3CU7A 2R0LL 4ADIA 3ZN6A 4D9QD 4ODUB 1BQLH 1I1AA 2BP3A 3GJFK 2ATAA 4B27A 3NRQA 1YVLA 2WZ0A 3DI3B 4ZQKB 4HIHB 3QXDB 4AMKH 3DRTA 3G5XB 2FB4L 5CJOH 4XPFH 1HSAA 1SDYA 2BW4A 3QIWD 2XRAH 1F8TH 2K4WA 2N7SA 1IFGA 1UM6L 4AT6B 4TN9A 2L04A 1N0XL 3M6DA 2R1YA 1WO2A 3V6ZA 1MHEA 3CGTA 3DECA 3GC3A 3GHBL 4JDZB 3IFNL 1CTMA 4W4OA 4PD4K 5CIPH 3EYOB 3WBDA 5AVXB 1Z2KA 4ELME 5DHVH 1TG8A 1MRDL 3WNPA 1YN6A 1NDTA 2J21A 5EZJB 3H9ZA 2LV4A 1K4DB 5M95B 2DIBA 3EGDA 4Y4KA 3ZTJH 3O8XD 3ZW3A 35C8H 3VFPB 4FXKB 4JPVL 1I9IH 3QXTA 1HHJB 4XI5C 2VDPB 4WUUA 4ODXB 1VGKB 1RZPA 3FT3A 2IAMC 2HYMA 3TNMA 4JLRB 4UM8B 2BVYA 3H9HA 2XN0A 1HIML 1QUPA 3TH2T 4M8RA 3F12B 2XTSA 1D9KB 3TOPA 4WHCA 4JDVA 4ALAL 1CK0L 2YBRB 2JQZA 2ORBL 1ZLUH 5DI8A 2IWFA 1EQWA 1XZ0B 3QCVH 2VISB 1D5XB 3T8MA 5CR8A 1YNTF 1PX3A 2JLLA 2QMKA 5LLIC 1S7TB 2C5DC 2EDRA 3HI5H 4OFIA 2YLKA 1TQWA 4UILH 3G6DL 3QWNA 4JREC 3VX1A 3RL1B 5JTWA 3QSKB 5BS0E 3MBEB 3PWPD 5T33L 3ULVE 2VXUH 1QBLH 1S46A 4JO8A 4X9FA 3RP1A 1FAKT 4YSOA 3T4YA 2UVFA 2ENJA 4OF5A 2HT2D 1JBJA 1N4XL 2CGRL 2NY2D 5GSVA 3WU1A 2XWTA 3PABB 4KVCH 3FCBA 1YEKL 2BNUB 1CC3A 3V0EA 1F90L 3ARFC 3PL6D 3WG7B 3DSNB 3PHOA 4PWKA 4F7MA 5DGRA 4XMPL 1OGTB 1M7UA 4NIYE 5ACZA 3NCBB 3X13B 3IBEA 4MAUH 5I8EA 2O6PA 2NY1D 4PRHE 4UUJA 5AYQA 1EFXD 2ZCLH 3QNXA 4MXWH 1IRAY 3MGAA 5C07A 5HI4D 1NCNA 3LJ3A 3O6MH 4L0ZA 3HRZA 4GSDH 3VTAA 1UWFA 1JZ5A 1RZIA 1KEMH 1YJDC 1MIML 4UZGA 4H8VA 2HT3C 4WSJA 4HC1A 1JZJA 3WLWD 4ZO6A 3ASNB 2P3YA 3V0VB 2OP4H 2EECA 5G55A 4MX7B 4IGBA 4PJEF 1JZHA 3SE3A 1TCMA 2DIEA 2YD7A 5I73B 5J56B 2D31A 1B9ZA 3DVFA 4K7FB 2QGEA 3ZKQD 1MHCA 4FJZA 4PRDB 5CZXC 1PW3A 2CKBL 2XC8A 3BUYB 2GI7A 2BOCA 3BDBA 4HF5L 4PG2C 4M4PA 3ZIMA 1OHQA 4MZRA 5I8OL 3NK3A 4HD9A 4E9SA 5I1IL 4W9EC 5D2LA 3SBWC 5IF0A 4HUVB 4NQEE 3HMWL 3MV7E 4LDLB 1XH1A 3H7LA 4V1DE 3P9LA 4K94C 4J7RA 5T1LD 2BWIA 4EXPX 2JJWA 2MTAA 3LZNA 3F7VA 1QMUA 1XGPA 3IJ7A 2QSCH 5DD5L 5JW5B 1ETZB 1Q0XH 5E6UB 1VHPA 2JXMB 1C12B 4PJ6A 3SDDB 5HHOE 4WFEE 2IADA 4FCHA 4A7QA 5KVFL 1BG9A 1PU0A 5KSUB 5DJYA 1U8CB 3JUYA 3NJMA 1LO5B 5AVUB 5JPNC 4I2XE 4DTGL 5F0PB 1DN0A 1QA9A 2NUPB 4N0FB 5CJXC 2NX5B 3Q1EA 3TJEH 2AJXL 1OTTC 5SWSB 2NY6B 2FBRA 5CD5C 5D7SH 5CFHA 2MCPH 1KN2H 2YPLD 2E7LC 3N0AA 2Y7NA 4ONHA 1XMEB 1E9QA 4BH7B 1JZDC 1DANT 1SFDA 4KXCA 4UB0L 5HJBA 5FW8A 3LB6D 2E27H 4FXGC 2X2YA 1RK0B 3MMEB 2WWKT 4E9XA 2UZIH 1HKLL 1GZQA 2DJMA 3BP6B 1Z3RA 4P23B 3OKDB 5TDNA 3T0EC 1QZNA 1JZGA 1W0VB 5I23A 4YXLH 5EBLB 4WK4B 1RPKA 2NT1A 1UUNA 1BECA 5EU3A 1BYPA 5J57B 3QHFH 1AHMA 3FCUB 4Z7UB 1F4YL 3FDWA 4JFPA 4HULB 4QYOA 5I15L 2B4CH 4L48A 4N25A 3TF4A 3W57A 1R47A 4YK4C 2PXYC 4HHAA 3CIQA 3BAEH 1E2ZA 4NNXA 1P4IL 4YL4A 2GTQA 1D5BA 2YA0A 3BN9D 3QDGA 4ZMTA 3SKJH 5J13B 3PDOB 2FO4A 3C5ZD 1QACA 4UTAA 1YPZE 3UAJA 4IRZA 4Q56A 1HH6B 5DVLA 3FQ1A 4Y2NA 1KMGA 2H2PC 5D1QD 5CZRA 4X98B 5A40E 2IC2A 3DJZA 3HBGA 2K4AA 4BELD 1LK2A 2WYTA 4L8DB 2VLJA 5D7JA 1U58B 1GOHA 4M7JH 3WN5A 4BK5A 4JGNA 2LLNA 5AW6B 3RZCC 3AREB 3C09C 2WVVA 2FH6A 5DUML 3ZDWA 4X42A 1Z9PA 2I32A 2VDQL 5AB2A 1VLXA 5IK3A 2YD4A 1TTCA 3NIFF 4KMQA 1AIFB 4X50A 5LWYH 3QQ9C 1WC7B 3L5XL 3ESOA 3V0HA 4ACTA 5BJTB 4KI5E 3FO2B 1CDIA 2XBTA 1NAMA 3V6BR 2EXYC 1DP0A 4F80A 4AEHH 2B20A 4KVNL 3IGLA 3JTTB 4PJCE 4E9RA 3RB5A 3L7FB 1YJDL 1IM9B 5IROD 5K39A 1NBYB 1LQBC 3AWFA 5I1CL 5J06A 4L4VA 4JY5H 1R19A 4LRIA 5L2KA 1CDBA 4ZUTA 4OLWH 3AC0A 1IGCL 3TJHD 1RK1A 1KCUL 3UTSD 4DH2A 3I9IA 5GHWH 3K2UH 4E0RA 4LL1A 1M4KA 1IUZA 1VEMA 1Y1UA 1HHHA 3IEAA 5A2JH 5E70A 1IE5A 4I18B 4Y1AB 4I0PC 4WO4B 5F70A 3V4VH 2O61A 2EZ0C 2CIIA 1UADC 4F93B 1I8UA 5EUOA 1QI4A 2IIJA 4K94L 3VU2A 5GZOD 2ATKB 2Y6SD 3NCEB 4J28A 3IXTB 3QUXB 5C6TL 1AG0A 2DMKA 3KW8A 4KUCD 5DZPA 3DHMA 1KCBA 4ORGB 4LSPH 5CD3B 3QJRB 4P57A 3VYNA 4D9RE 3DROB 1JGVL 4GH7B 4I1RA 3AG4B 5HHNB 1KGJA 5TTRA 3QORD 2PYEE 5CGTA 1O75A 2VLLA 4OZFB 2N56A 5KSBE 3U0WH 3ULSB 2CG9X 2R0WL 5MERA 5D4IA 1ZGLP 4YR6B 3S34H 2UZXA 3ZX1A 4PEEA 4HK3N 4PS7A 1FYTD 2Q2LA 3VG0H 5GSRA 1RZ8A 4LSQL 1FRGL 3TEWA 5C09E 3QAZB 5JIIA 3DYPA 4IKJA 1N5YL 4R96B 5HD8C 3BLPX 4NNYA 4P5TB 2IWGA 3K8KA 3Q2WA 5CU5A 5HHMD 1J10A 1OAYH 3VD5A 1TZHB 1CD8A 2O4EA 2H1PH 3OQ3B 3PHQB 3UADA 1MCOL 4FA8A 4K5NA 1NKRA 3PIQB 3A5VA 2WZ6A 1Q1JH 4MS8D 2W95A 5ISZE 5F6HJ 3Q48A 2XWCA 4PG9A 2OR9L 4ONOA 5DS8B 1U8HA 3LNHA 1KFAL 4YLQT 2BHUA 2WNWA 4XO3A 5FHBH 3NCJH 5FKAB 3BJLA 5FCUL 2Q1EA 3REVB 1RH8A 2A9ML 2ADJA 4Q6IC 3GM0A 1OARL 4AC4A 3ILQD 4QRTA 1U8QA 4GT0A 4XWOD 2WXGA 3K6OA 3L9RA 3BVNA 1H0DB 2VQ1A 5CLZA 4EAEA 4J6RL 1CIDA 2GAZB 2O30A 3ZRFC 1ML0A 4ELMA 4JCMA 1JGIA 4HBQA 2HLEB 3Q06A 4H0IA 2NQDA 1NANI 5LHDA 2R29L 5SWZB 1D7CA 3BKJL 1PL3A 4X0NA 1W72B 3A6BL 4MNQE 3ECUA 2FWOB 2P7TB 4ZUSB 3O41A 4M61B 5IVXA 4QO1A 4JZNA 2BP8A 2UY7A 1A0QL 2Q0ZX 4Y4FA 4EZKA 4NRXA 2VO5A 1EK3A 1GGIH 4WHDA 4XVUD 1WBZA 4GQRA 5DC9B 5DLML 1KENL 2VW4A 1ED3B 1IM3A 2UZYB 4BZ1L 2J56A 3NJVA 1OAZL 2H1XA 3UTTB 4ZMOA 3QJSB 4QOKE 2VR4A 2OJEB 4IQHA 1SPDA 2P26A 4GIAA 4RQQB 4XPBH 3NIDB 5E2UH 1LO2H 1ZIBA 1MCHA 4MFHA 2UY6B 4QRBA 3T3PE 1CUOA 2YN3A 4YDIL 3H3BC 1U3YA 4GXFA 4BSWB 5FB8B 1D7BA 4MB3A 1KN4L 4P5RA 1PZUB 2OSWA 4G7SB 3VD2A 2R9HD 1SZNA 2FYYB 2ZYIA 5G5DB 5BS0A 3P3YA 3DVNB 4KQ4H 2AZAA 1PDKB 2F19L 5DJ2A 4P46A 4QHMA 3IGUA 3LD8B 4HH9B 1VACB 4D8OA 1PG7L 4EO5A 1QLEH 2R7EA 3FJTA 4OI9A 1JRHI 2HRPL 2H41A 5T5NF 2CXGA 5EBGA 3ARDC 1SMAA 4G6FD 1XSIA 1OM3H 2BVPB 1D5RA 4C56B 4YNYB 1KUMA 1UA6H 2CPCA 1HINL 2CM6A 4UNIA 2AQNA 1MFEH 3HKZA 5DUBB 3O11A 4PRHA 4YHZL 4C58B 3AG2B 3B1UA 5TDOA 5JHDD 4QRAA 5E2VH 4S1QH 2WQVA 5FA4B 4U6VH 5C3TA 2X1PA 1V7NL 1SLXA 4MXVF 4TNVK 4QKXB 1A3RL 1YECH 4AQAA 1WA1X 3LAFA 3ES6A 3OC8A 2F18A 2VNCA 1XAKA 1TVHB 1QO3B 1I1YB 2Z8WC 4TQEH 4GS7B 2FECL 2VDOB 5EOCL 3INUL 5GS2D 5IV2B 3IJHB 2AMGA 5J6HA 2YGQA 3HN8A 1DL7H 4KKCD 4UANA 2EJ1A 5AYUH 4GEIA 2OX5A 3OM3B 1UB5B 3SKUD 5EUOF 2R23A 3P9MB 1P2CB 2CPUA 3FU6A 4UIKL 4XMVA 5EEUA 5F7NC 4ZX3A 2PCFB 5G4NA 4NQEA 4PWJA 4V1DA 4UOJA 5T1DH 5D72H 4YBHA 1XXFC 4GW5B 4CVZB 4X6DB 5L7XL 2I7SA 4N90D 2HUEA 3KW7A 1Q9KB 4W9DC 3F6LA 1HE8A 3H1ZA 3AAZA 1XB8A 1WZMA 1X9QA 3PNRB 3SJVD 4BD4A 2VZVA 2VL5A 3BSZA 4PJAF 4F7CB 5HHOA 3QJHA 5CJ8A 4KKAC 1K2DA 1TJHH 2W8CA 1WVZA 2HLAA 3TXAA 2G9HB 4KRPD 4OCYH 5JW3H 2VR9A 3E38A 2B1AL 3GUFA 1OB1A 2HFTA 4I2XA 3THML 1JD7A 4LXFA 4BKLB 3LS5L 3LSOA 3WFHA 4AYFA 4NJ9L 4M5ZL 1REIA 3IFLH 3HC4L 4FX5A 1UA7A 2WUCH 3W2DH 1W91A 4LCCA 1G9EA 1X9LA 1FFQA 1T6VN 5ECGA 2NW3A 1A4AA 3VACA 1C1EH 1FGNH 3L2MA 4WTQA 2APWA 1E9PB 1F3DJ 1ONQA 2YMTA 1JNHA 4LCIL 1SFHA 4BJLA 4J3OH 3QNYA 4GOSA 1EZVY 4M3HA 3DNKA 4OUOA 2Q8AH 1MCRA 3K72B 5EG6C 2F1AA 1LXMA 2ZWYA 3MHZA 3NGBB 4F7EB 4ELMF 3DARA 1Q0EA 2VLMD 1NEZG 3KWWB 3LKSA 2J25A 3CFKB 5L6YL 2BCMA 5FYKL 4EIBA 5BQ7A 1OPOA 4JFXA 4ZFFA 5LJYH 1QR1B 4PGBB 2XA8L 3NRFA 4R90L 2V7HB 4MCZA 1QBML 1WZ1L 3GGWB 4FQIL 3CSBA 5IQ7L 3NFNA 3CMGA 5CEZD 1AZRA 3RWDA 2ZUTA 2W88A 2QQLL 2AABH 1TPXC 4LKCA 3TESA 1N59A 2XJLA 3B9EA 1S4IA 4G80B 4Y4HB 1KLFA 3UTPE 4P0DA 1YPZA 3MLZL 5AVVB 4ZFOA 2XXCB 1KT2B 2YGPA 3HBZA 1JE6A 3ATAA 3RVXC 2HWZH 4N2BA 5AKVA 2GJZB 3HHRB 5AW9B 1P84J 1DFBH 4IW4C 2CMRL 2J20A 3SE9L 5BPPA 3BQUA 1L5GB 3KWUA 1L3NA 4JDTH 4HS3B 5JO5A 1CDCA 5F3BB 3ULVF 2ZUUA 3FTZA 3ZYZA 2NZ1A 4IRJA 2H3NB 4DGVL 3JYBA 3I3EA 4ZUVA 2E7DA 4XMLH 3QYMA 2NYKA 4R2GB 3EFDL 2NX5E 2K1MA 3EOTH 3I6LD 4UAHA 3ABZA 3I9GL 4X9HA 2IH9A 3F6IA 2DQCH 4XRCA 4RZKA 1WEJL 3Q6FB 3QB7C 1E3XA 1S7SA 3KBFA 5F9JB 3H9YA 1B88A 4PJCA 4XN4A 5ESQA 4FYSA 2CKBB 2Y6TE 1JN6A 4F8NA 1M9SA 1CFMA 1NQBA 1SM3L 1TKWA 2FZ3A 2IH3A 3QS3A 1S78C 3IPFA 1PJ9A 2AXFA 3P2BA 1CXKA 4I4WA 1OTSD 2NZ9D 1BLNB 1LEKA 4D0BB 5JHLA 3GM8A 2WV3A 3ECVA 4NZUL 4J8RB 2GB2A 2Q3ZA 1IEHA 4L3EE 5KZCD 1G1OA 2KDGA 4B7IA 1VCAA 4Z7UE 2EYSB 3PWVB 2D3JA 2CK2A 2BCKB 3ETTA 4MNHA 3B9VA 3FW6A 2RD0A 2N1KA 3V5HA 1INQA 3TA3B 1QPXA 4HWUA 3U0TB 1E9OB 2P9RA 1VRSA 4O4YH 4IM8A 3ZKXC 4DKEH 2FEDD 4JFFD 5IG7A 2EINB 3NEEA 5JXEA 1DJIA 2AC0A 1HHGA 3FRPA 1FGVL 5KSVB 2BHYA 1E65A 3DK2A 3QDME 1TR7A 2A9NH 2ZCHH 3HG1E 3NPSC 1CLZH 3T6WA 1I75A 5IW6B 1G7PB 2HT2C 1TETH 5KSBA 2BHFA 4YDNA 1E8XA 2IALA 3AJ7A 2FNWA 2E6JA 2X6BA 3PJNA 1LEIA 4JAMA 1WISA 2IQ9H 3CJJA 5EU6E 3II3A 3PL6C 1QSED 2ZUVA 4NC2B 5I1JH 4JO4L 2Y24A 4AZ8B 1OSZB 5C09A 3CDGA 4Q4IA 1AHWA 5DMGD 5KVDE 3QG6A 3BSGA 1DEEA 5B1AB 4IYKA 3EDKA 4FADA 5IB1A 3TBSA 5HI4C 2W80C 5BVPH 5C9JB 4MJID 3LMJH 5D7IB 4BCXA 2HJFA 2IAMB 1BXVA 3AS0A 2CHDA 2PYFB 3CMOL 3OMAB 5ISZA 5LCVA 4FG2A 3WLWC 5A7EA 4UCFA 3VE0B 5I16B 4G8AC 5SWQB 3HOGA 2BZ7A 2CLRB 3WTTA 5FECB 1QG3A 4PFEA 2BFVH 2OTWB 1RLWA 2J6EH 1U8OA 3VA2C 1V5JA 4HJGA 1UZ8A 1IVLA 1BBDH 5L8JB 1ZV5A 4FMKA 1O6VA 4QD2E 2J1KA 1C8PA 1FZOB 2FJHA 2G0LA 2VT0A 4RNRB 3HZKB 3P3RA 4A63A 1IMHC 4JREB 1XR9B 1KZYA 1P7KB 2E9IA 12E8L 1BSIA 4BSJA 1T80A 2WB7A 1BP3B 3CHQA 3IJEA 4G6AD 4ESKA 3L3GB 1XGUA 2C9UA 4LLYA 5JUEL 3G08A 4MNQA 3QJFA 1LO4L 2VDQB 4P06A 4XPAL 3LNIA 1I7TA 1IAMA 3EH1A 3EXLA 3ARFB 5L4JA 3REWB 2WIIB 3OB0H 4DN3L 5BO1H 4YVUA 1YPZF 3HC3H 3B4NA 4R8WH 4TSAH 5GGRB 4R5XA 3VD7A 4I0PD 4YFEA 4GKZB 1ZTXL 4QOKA 5GGTA 4K9EH 1YYLH 1JMXA 1SVZA 4MA7H 5I1AA 5FKPA 4KU1A 1T89C 1AS6A 3SDXA 4PUBH 1E4XH 4KROC 5BV7H 3HG2A 2R2BB 3MRIA 3VVVA 3KPLA 3S4SA 2MQ3A 2PW1A 4OJYA 4JKPH 2RQ8A 3LB6C 1M2VA 5I5MA 2AEPL 2DLGA 2FLRT 3A67L 4P2OC 3MR9B 2YAMA 3TO2A 2X4PB 4JB9L 3VD1A 4ODUA 4KI5F 4BDVB 4WGVB 4Y5VC 4RGMC 5JYMA 4XTRC 3IDIB 5D7HA 3CE1A 1C5DB 2VLRD 3F65A 2GEEA 3ECBA 1AY1L 3VXUD 4ZQKA 1U8KB 4NC1C 3QXDA 3EW3B 3J27A 4PB9L 3MLTB 3G5XA 1DUZB 3ULUE 4PJCF 3CN0A 3OPZH 2BWQA 5H8DA 4QHLB 3V5KB 5EOCJ 2YEQA 1C16B 3OG6B 5IBUG 4OFVA 2D3LA 1YMMB 4EN3C 3VD0A 4XN5A 2WYZA 1DQKA 5CGBA 3ME0B 2EVFA 4AGPA 2R1XB 3P0VH 2OMUB 4H88H 3GXTA 4NI6A 4PLNC 2AMUA 3S37X 5K59E 3W82A 4Y7OC 5EZJA 4PD4J 3CXHK 1K4DA 4JX0A 4LCWB 1A14L 2A83A 3VFPA 3BZ4B 2EADA 4FXKA 4QRRD 5D1QC 3SPCA 4XVJH 5JPNB 1HHJA 1BYNA 4JHVA 4YMPA 4YLCA 4ODXA 4NWUH 4JLRA 4LGRB 4UM8A 4R7VA 2G9KA 4YAQB 2EVIA 4N2GA 4Q4EA 2QFPA 4IBZA 1I7UB 3F12A 4GMTH 1D9KA 3RHWK 2NDFA 1T20B 1R3IL 2VZ3A 3CVHL 3MJ9A 2D9QB 4OFDA 5PAZA 3CVBA 2YBRA 4N2LA 2CLZB 3UTTE 4F3FB 1XZ0A 3FO0L 4O00A 5KSBF 4MLSA 3BD3A 2VISA 3NIDE 1D5XA 2XACC 4FXGB 3VXOB 3SBRA 1KXVA 2WLIB 2IMNA 1YYCA 1S7TA 1LILA 1X5LA 4M8VA 1DLFH 2OMYA 2XWJB 3T0EB 4IIQC 2E3VA 4M6ML 4K2UL 3RL1A 1TJIH 1TMQA 3BH8B 3MBEA 4LVEA 3S0PA 5KUKA 5AAMC 1SHXA 1F86A 3IDXH 4FFWD 1U6AL 3DIDA 1H8OA 4FRWA 4XP5L 5E08H 4EUPB 2MPVA 4HQQH 1CLVA 1MREH 4ZDHB 3Q2NA 1RIHL 4CSZA 1LTXA 4H8PA 3QUMA 1V3KA 3PABA 1CDUA 2AVGA 1QLFA 2BNUA 3RY4A 2N59A 4YK4B 3TJHC 2PXYB 1RJCA 3BGMB 1MJJB 3MV9D 3N42F 4AQEB 2MPAH 2XDHA 4I9WD 3V5DB 1NBVL 1OGTA 1I3RB 5KWYC 4C56E 3GSRB 1OVZA 4JE4B 1NUNB 2OL3H 1B90A 2LU3A 3KXFE 4R83A 2HX8A 4QKTA 4AQZA 1AR1D 2FX8L 4FS0A 2J44A 4CDGC 2RQEA 5DJ6B 4HUWB 1XF5B 2LW3A 4M5YL 1S9WB 4PJFE 1KGIA 2FJUB 2PN5A 4WIQA 2DIAA 1TO5A 2IG2H 1F4WH 3E1ZA 3RZCB 3C09B 5EUKB 1A7PH 2BOLA 4PY8J 3V0VA 3GK8L 2WO4A 3AWEA 1CL7L 4YIQB 3QORC 5AW3B 3ZTEA 4K7FA 3ZLQC 1ZRUA 4PRDA 3P4NB 1WAAE 5KBKA 5L9DL 3BFWA 3BUYA 4H0HB 4JUSA 4KHTH 5JIQA 1EV2E 4BK4A 3L08A 5FM5O 1T2JA 1R0AH 3N9GL 5FOBB 4G6KH 1R3JA 5LB1A 1GGUA 2ZOTA 4HUVA 1PLCA 3KNBB 4GIPD 1U3HD 1WDAA 3LQMA 1KWKA 4X6DE 1J5OH 5J6GB 5JW5A 1ETZA 1Q8MA 3C6LC 3U82B 2JXMA 4GIOA 4F24A 2K45A 3H56A 1C12A 3T3PF 2R39A 1T5WB 2WCPA 4NQCB 3SDDA 2E7HA 1J9RA 2VXVL 2Y23A 3DURB 4CN4A 3STZB 1OV8A 2FQEA 1Y07A 1T6WA 3FS9A 3R4RA 4HK0B 4HKXB 4HS8L 4F8OA 5HHPB 4L0YA 1TJXA 3ABGA 3LQZA 4JY4B 3S3BB 3ZQXA 1KB9K 5KSUA 3O6LH 2XTJD 4GLRI 2V2WB 4RFOH 1U8CA 2X4QA 3GJFB 1UEYA 2WZPA 3DO7B 1QSVA 2NUPA 2WP3T 2YA1A 2NX5A 4PCSA 5E94B 2QHRL 3BKML 3DIVA 1E43A 5SWSA 3T3MB 3VVWA 2HTKD 4YXKH 4EPSA 4XWOC 2I9LB 3HNTH 4HFUH 3D3VB 3WIIL 3KVDD 4X0KB 5DO2D 3MUY1 2IOIA 3C5XA 3L1FA 2R1WA 4CN1A 1ECYA 4M1CC 4PV8B 4HWEH 3WEMA 1DQML 1I9RH 1JVKA 1VSCA 1RK0A 3WFEH 2HFGH 3MMEA 1T4KB 1U93B 1DLHB 3BP6A 3ALXA 3D85D 4P23A 3OKDA 3MN8A 4LSSH 3MACH 1H5BC 2ZJSH 1T0MB 4FNLH 5ES4B 2VXTH 3GSQB 1W0VA 2JNZA 2F8XC 4EN2A 5EBLA 1KELL 4YHPB 5BVJB 1PNDA 4DUVA 4YDKH 4MAYD 1SXNA 3CWGA 4ZPTB 1O9ZA 4NUMA 4Z7UA 3U6XS 1IGIH 3ZMRA 1JI1A 1J5CA 3A6OA 4ZTEA 4X83A 3WHXB 2BVTA 2ESVD 1IBYA 4TLTA 3O4OC 5I66B 4FLOA 1JP5A 1U3NA 2E76C 5BXFB 2BIMA 5GZNC 3C08H 2IDSA 2RFXB 1BZDA 1U2YA 1CF8H 1O5DT 4OLZH 3ETBJ 3V0AC 4L18A 3QDMA 3NK4A 1HH6A 3U7WL 3HG1A 1M3IA 4PCYA 4AE0A 1NIAA 4DETA 3FTSA 4U6TA 4X98A 3OF6D 3FPYA 3KJ6H 3TZVD 3BEVB 4L8DA 5DT1L 2QSQA 3SBQA 1U58A 4Q6IB 4KTDL 5LNEA 3HLAB 5FYJD 5JYLA 5K1NA 3AREA 3MGTB 3MOQA 2X4TB 2MNWA 3GXMA 1JXJA 3OLIA 4JO1H 4NUGL 2ITDA 1AIFA 2X12A 4F58H 1WC7A 3U30C 3DPBB 4H0GA 3FB6B 4TNEA 4ANUA 4F57L 5BJTA 2OZNA 3FO2A 4N0UE 1Z9SB 2A4EA 3HR5B 2YMXH 1BMWA 3FL7A 4P2CG 4LSUL 4B3EA 3JTTA 2YXWA 5CSBA 4WRLA 2J73A 4KKCC 3WELA 5HGBA 4N8CH 3L7FA 1IM9A 3O2DA 4MD4B 1NBYA 5J7CC 1TU2B 5AUMB 3EJZD 3CD4A 1MF2H 3WDIA 3GEFA 4FEIA 3IBOA 1G9MH 5KYNA 3FBKA 1OD9A 3T09A 3L3IB 1TO4A 4OCXH 5F3HB 2QEJA 4HG4J 1MCFA 4L8CB 1ICTA 2CK0L 5K93A 1F02I 2ZF9A 4I18A 4PWGA 4PS3A 2H0JA 4Y1AA 1IBZA 4WO4A 4W4NA 4YO0A 2W0KA 3SPVB 2OPCA 2WXNA 4KFMA 1ITBB 3CV5A 4G5ZH 2ZWSA 2VH5H 4OLYL 3WJLC 4D7BA 4EVNB 4PBWD 5H4YA 3ARDB 3TH3T 3IXTA 3QUXA 4Q14A 1T22B 1BEYH 4JQXC 1EGJL 4OFYA 4AL8C 3US1A 1IQWL 4ORGA 4PPTA 5CD3A 1HWGB 1JWSB 2FUTA 3DROA 3ZTCC 2XKUA 2ENYA 5HHNA 3QDAA 4RSYA 3NABH 1AD0B 4OZFA 3ULSA 2YD5A 1GYUA 5AVQB 1L3WA 3OJ2C 1CCZA 2JF1A 2BSSB 4YR6A 4JMNA 5D4JA 1V05A 3V9EA 1EJ8A 5JXAL 5CEYB 2C7UB 5EC2B 4KKNA 3POHA 3O6FC 1PY4A 2CUHA 5I8KH 2WUBL 4R96A 1KBGH 3N40P 4P5TA 4FZ8L 2C9RA 3I9AA 1TZHA 3UC2A 1EO5A 3MOAL 5D7IE 3PHQA 4P9HH 2WXOA 1A66A 5DJZB 4NM8L 4PN6A 4KY2A 2D7MA 3OHXC 3PIQA 4JFHE 4JE0A 4U7MA 1XX9C 1BM7A 1X6NA 1EVTC 1KV3A 3EBGA 1R3KB 1FO0L 3BI9X 3JSSA 2CNZA 4RWYH 2YWYA 5DS8A 2VCOA 2PETA 1IC4L 1SDAB 4ZQTA 3BQVA 2BVUA 5FKAA 1FL3B 1K9TA 5C0EB 3REVA 1EEYB 2YSSB 2HH0L 3AY2A 4PJHB 1UWXK 4ZW6A 2VMJA 4AV5A 5D7KD 4MQTB 3RWFA 1WRFA 1BOYA 3K81A 1H0DA 3FT9A 1UT9A 3O3BB 3QFJB 4A7GA 4A2FA 3CSTA 2GAZA 4ZTOH 4P04A 4Z7UF 4A67A 4M03A 1NLBL 5ABDE 5DZ9A 4Y5XC 1YEGH 1PEWA 1A4BA 2PABA 2ZX7A 5IBTH 1M53A 3E8VA 4AI7A 1VKXB 1UWGH 1ZV9A 1W72A 4C8XA 1II4E 5D7LB 1AO7E 1ZSDA 2NY3D 4PHXA 2FWOA 2P7TA 4QHPA 1NAKH 4ZUSA 5ETUB 2WVUA 4M61A 4YHLH 2FGWH 1ERNA 2KC0A 3LN9A 4Y9BA 4F2MB 5F7DB 1CE1L 3ARVA 3KH3A 2C3HA 4N1CA 4HPHA 3ARGB 4KTEH 2Y36L 4L8SC 1KCSL 5J1TC 3DXAB 4WFHE 4I77H