2XX0A

Structure of the n90s-h254f mutant of nitrite reductase from alcaligenes xylosoxidans
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHSVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 92
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xx0A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xx0A02
6PAZA 2CUAA 1AZUA 1J9SA 1JXGA 1JVOA 1V10A 5AZUA 3CDZA 1OOWA 2UXFA 4DPAX 3NJKA 2VW4A 2VM4A 1NZRA 4AKQA 5B1BB 4MFHA 2BO0A 4A2GA 2BP8A 2ZONA 3ZX1A 4DP9X 2XWZA 1OV8A 1A8ZA 4WKXA 2UXTA 1L9RA 4JKNA 4YVNA 1BXUA 1WS8A 2YAPA 1GS6X 1BQKA 1YLBB 3ASOB 2BW5A 3X2QB 4BXSV 2AZAA 4AZUA 1BQRA 2YQBA 3C75A 3EH4B 2P80A 3GYRA 3S3DB 3WG7B 2Y69B 3BQVA 8PAZA 1AIZA 5D4IA 4BK5C 2FT7A 2IWEA 1E30A 1DZ0A 2I85A 1GR7A 2YAOA 3NT0A 4DPCX 3V9CA 2EILB 3PAZA 4NERA 1HFUA 4UANA 2YXVA 1L9QA 2FQDA 2OCCB 4DP4X 1AG0A 1WA0X 3IE9A 1MG2C 1SF3A 2XXFA 2B3IA 1RKRA 2QDWA 5I26A 3NYKA 1BQ5A 1NIEA 4HHGA 1V54B 4X4KA 2DY2A 1OE3A 2FQEA 4RH4A 4A2FA 1JZGA 3PAVA 4KNTA 1E65A 4DP1X 2EIMB 4UAHA 3FPXA 3FQYA 2HX7A 2QDVA 1N70A 4GXFA 4YSEA 2XV0A 2PPFA 1WAEA 4HAKA 2XX1A 2WSDA 4EF3A 1JVLA 3FS9A 2Q9OA 3V9EA 1SHXA 2JKWA 4G72B 2TSBA 3CG8A 2BZCA 1AZNA 3MBWB 1M57B 2PP9A 2J57A 4UF7C 2UXVA 3HB3B 3FQ1A 4HIPA 1NWPA 2FNWA 2AZUA 4FA7B 4AX3A 1T5KA 4A2HA 1W6LA 2DYRB 2EIJB 1ZIBA 2BWIA 5EHFA 3IEAA 5I5JA 3QQXA 4A67A 3AW5A 3FYIB 4BWWA 3UAEA 2HRGA 3H56A 2P80D 3SQRA 3TA4D 3IN0A 4YSAA 1FFTB 1RZQA 2FJSA 3NSFA 2FQFA 3G5WA 3SBQA 1FWXA 5I6LA 1NIFA 3FYEB 3KW8A 2UXGA 1DYZA 1QLEB 2GBAA 3NP3A 2JXMA 5I5IA 1L9OA 3UACA 3ZIYA 4ZK8A 3T9WA 5PAZA 1PY0A 1AANA 3DKHA 3OQRA 3ERXA 2H5UA 5PCYA 1ASQA 1AS6A 2EIKB 1KDIA 2OV0A 4PAZA 4BXVA 3ABMB 1IKOP 2PP7A 3ABLB 2Q5BA 2PPCA 2GHZA 3EH5B 2VSKB 3NJHA 5B3SB 4BDVA 4G71B 2DV6A 2LLNA 2FT6A 2XVBA 3IN2A 4YSOA 3ASNB 4M4RB 3NSDA 1ASOA 1JZFA 4A2DA 1EZLA 3ABKB 1BXAA 2BP0A 5AKRA 3FSWA 1JZHA 1JZJA 2CBPA 2ZWNA 1AR1B 5D4JA 4QKTA 1JXDA 1EHKB 4HCFA 3TASA 5E9NA 2RACA 1OE2A 3FSAA 2IDUA 3OMNB 3TBCA 2A3TA 3FU9A 4BWUA 1IC0A 2AANA 1ADWA 5B1KA 2GIMA 1F56A 2QPDB 4N4YB 1PLBA 3QPKA 3OMAB 1PNDA 5B1JA 2IWFA 1OE1A 1TKWA 1ZPUA 1ILUA 1BYOA 4E9RA 3NP4A 4PCYA 1NTDA 3TU6A 3PXLA 3AG4B 3IBOA 1ID2A 1B3IA 3NJMA 4E9XA 1JOIA 1XB8A 1L9SA 4CSPA 5IY5B 2XXGA 4A68A 2Y1AA 3GDCA 2PPAA 3TBBA 2IAAC 4L0PB 3NJIA 4GP8B 3ZDWA 5F7AA 5B7MA 1M56B 2YAEA 2XX0A 3OMIB 1PF3A 2J56A 2WO3B 3EF4A 4KNUA 2R7EB 2CALA 1SHWA 1XB6A 4DP0X 4AKOA 3NJLA 4A66A 4CSZA 4GP4B 5D4HA 1ZDSA 1AG6A 2IH8A 1PNCA 2BWDA 2XYBA 1GY1A 1UATA 2MRYA 2JFCA 3S8FB 1NICA 4DPBX 2PCYA 4E9QA 3EH3B 1MDAA 1A4AA 3PCYA 1PCSA 1CC3A 3PAUA 2FWLB 4YSUA 3T6ZA 3CVBA 4G7RB 1BEXA 2WO2B 3QJSB 3CZUB 1SNRA 2HX8A 2YARA 2X88A 3T71A 2CAKA 2YAFA 4KO6A 2HLEB 2YAMA 2I7SA 1GYCA 3X1EA 4P5SA 3UGEA 1CUOA 2YAHA 2OJ1A 3ZBMA 1KCBA 4YVUA 6PCYA 2HX9A 3NJJA 3CVCA 1AS7A 2FT8A 2XLLA 5I6PA 5I6NA 5ANHA 2DYSB 3DIVA 2B08A 4DP7X 1A3ZA 1X9UA 1ET8A 4A2EA 3U25A 3T6VA 1SDDB 1MG3C 2QPEB 4N8UA 2J55A 2UX7A 5FC9A 3S8GB 3CDZB 4NB7A 1E67A 4TXVB 2EINB 2DWTA 1HAUA 1NDTA 3T6XA 1KDJA 2IDQA 3UADA 4E9TA 2GB2A 1AS8A 1MZZA 1PLCA 4ENZA 3JTBA 2BW4A 1CYWA 2BP8B 3KW7A 5B1JC 2HXAA 1OCCB 4GYBA 2DWSA 2ZOOA 4G70B 3FU8A 3S3CB 3FSZA 3WIAA 1KYAA 3WNIA 1JZEA 3SBRA 3X1FA 1NIDA 3NJNA 2XV2A 1KBVA 2IDFA 3NJFA 3AZUA 2VSMB 4YSTA 2BZ7A 3WKQA 3X1GA 4E9YA 4Q89A 3OM3B 4FAAB 1NINA 2H47C 1PMYA 1TU2A 4BWTA 4HHWA 2PP8A 3FU7A 3UAAA 1SJMA 3FT0A 3QJTB 4KOBA 3QJQB 4KO7A 1PZAA 1NIBA 4KO5A 1CURA 3MX0B 4YSCA 5I28A 2W8CA 2IH9A 1TEFA 3S3BB 3AG2B 1SFHA 3JT2A 3X1NA 2CCWA 4M3HA 3D12B 1RCYA 1I53A 4HCGA 4JHUA 2HRHA 1JXFA 4YSRA 2NRDA 7PCYA 1N68A 2QT6A 3PPSA 1SF5A 4KOCA 3ABGA 7PAZA 2VW6A 3FPYA 1IBYA 1A65A 4NAJA 1FA4A 3EHBB 4AKPA 5LDUA 4G7QB 3WI9A 1BXVA 3NSYA 1V55B 2XU9A 3QJRB 4DP8X 1GS7A 3H4FA 2GI0A 2TSAA 3H4HA 1KGYE 4W9ZA 4HCIA 4GP5B 4JHVA 4DP6X 1OCZB 3RYMA 5TK4A 3QJUB 4E9SA 1KBWA 1X9RA 3WKPA 1AZCA 1PAZA 1OF0A 4WTQA 1TEGA 3NSCA 1BYPA 2HZHA 5TK2A 4E9VA 3SBPA 2VN3A 4YSDA 4YL4A 4QLWA 1AQ8A 1E5YA 1KCWA 1BAWA 1ZIAA 5A7EA 2IWKA 2GC7C 2CJ3A 4KNSA 4YSSA 1L9PA 3QJVB 2BHFA 1AZRA 1ET5A 4YSPA 3WNJA 4F2FA 1NPNA 1GS8A 2VMJA 4HALA 1R1CA 1VLXA 3T6WA 2ZXWB 5I6KA 1JZIA 1NPJA 2UX6A 2PPEA 1AOZA 4G7SB 1XMEB 2PPDA 3PLYA 1ETJA 1OCOB 1A4BA 3L45A 4F2EA 5B7EA 1OCRB 2E86A 1CYXA 1IBZA 1IUZA 4HZ1A 1GY2A 2R7EA 1PZBA 2YXWA 3HEIB 3BVDB 1WS7A 1WA2X 2GC4C 2PLTA 9PCYA 2AFNA 2VM3A 5I6MA 1L9TA 2MTAA 3FQ2A 1ILSA 1RZPA 4GY4A 4DP5X 1SFDA 5I5MA 1A4CA 2W88A 2FQGA 3OD3A 3AY2A 1AAJA 4BDVB 4P5RA 2FTAA 2X87A 2XUWA 1J5DA 2N0MA 1MZYA 1E5ZA 1PLAA 4DP2X 5AFAA 1HAWA 1J5CA 3DTUB 4K9JA 2BP0B 3GXUB 1GW0A 1KV7A 1URIA 3N55A 4W1TA 1ASPA 1JERA 1M9WA 2VW7A 5B1AB 1XB3A 1QNIA 1PZCA 3X1BA 4E9WA 3FU7B 1AZBA 1ZDQA 4KO9A 4AI7A 2XV3A 1W8EA 2IDTA 2IDSA 2PCFA 3CVDA 3N2JA 2J5WA 1AACA 5B7FA 3AG3B 1WA1X 1J9RA 2H3XC 4F7KA 1NWOA 1QHQA 5I6OA 2I7OA 4YSQA 1ZV2A 3AG1B 3FSVA 3NJGA 1GSKA 1ET7A 5F7BA 3UABA 2YAQA 2GSMB 1J9QA 1NIAA 2AVFA 1W6WA 1J9TA 1SDDA 4Q8BA
chains in the Genus database with same CATH superfamily
2PYEA 4WHTA 3I9PA 3DV4A 4G7YL 4HK0A 4L9LA 4NGHH 3L5WA 4CC0A 2BVYA 2F54B 3B2UD 2B4CH 3CZGA 2VM4A 3DDFA 4PR5A 4AKQA 4KZEH 4DKEL 5I8EA 3F58L 4A2GA 1MN4A 3S96B 3ZLQC 5FUZL 4CGTA 4F57H 2UXTA 2DM7A 5ILTH 1MAJA 1NM9A 4NN6B 1G0DA 1CQKA 1ZHBB 1DCLA 1PG7L 4KY2A 5ACMA 2QMJA 3O41A 2XTJB 2WLNA 4BFIB 2NOYA 3GSNL 4JPKH 4ZS7L 2FCBA 2ZUXA 3K8KA 5GRVL 4UM9D 3EH4B 4J8RA 1UB5B 4C55A 3AM8C 1R3HA 3FN3A 5CEZD 2CKBA 4QY8A 2AMGA 2PTUA 4EIGB 2CO1A 4N6RA 4M5SA 3ECBB 1N7MH 3EJPA 1ZLUK 3N85L 2C3HA 3UJIH 5F3FA 2BNRE 5DQDH 1UH4A 1JS4A 5E5LA 2BXYA 2FX8H 3VMPA 5A16B 1LLAA 1N6QH 4M5ZH 2O93L 3DX7A 5F0JB 1HILB 4KKBC 4H0IA 1T6BX 4B6ZA 4N2FA 1XEDA 1LD9B 3GBEA 3P4OA 1IILE 4PRBB 5HDQH 4RH4A 1IO4C 5JUEH 2XWTB 2Z8RA 3GJFK 4XI5C 1TQCC 3X14B 1OGTB 4CILA 5L0QB 3RRQA 1AO7A 2QGCA 3LQAC 3PGFL 4JPIB 4UAHA 1NC4B 3K1DA 1N70A 1N8ZA 3CFDA 4I3RL 3V0DA 3CHXA 3E80A 2YLHA 1EXHA 4J12A 1CD1B 3ESUF 5BXFA 1L3WA 2K45A 4ZFFA 1U2YA 4QT5A 3O8XA 3BAXA 2BNRD 3HAEH 4ODWA 1MRDL 2EABA 1INDH 3MJWA 3U0PB 4ZMNA 3RE0A 3QZWG 4XPGH 3GUTA 3VGDA 4C56E 2BIMA 1GMEA 2AZUA 3W57A 1JFQL 4F8LA 2EIJB 1WZKA 3QP3A 2NXZB 3BSZA 5F3BA 3LPOA 3MAWA 1AYRA 3H3BC 5F7DB 3UBXG 3GRGA 3KD4A 4JDVA 4KH2A 2VL5B 2CLRA 2H0PA 4RA3A 5F7FA 1QBLL 3BIAX 4GW1A 4I18C 1GOGA 4YDKL 5AW6B 5K9KB 4KXCA 4OCSH 2I9TA 1LO5B 2XRAH 1ADQL 1FWXA 3ARFB 4HEME 3FT2A 3EGSB 3K6IA 3L54A 1A6VH 1UKQA 4D0CB 1P5UA 5ICXA 1PY0A 3BLKA 4G5ZH 1FFOA 4TYUA 2OXHA 2V17L 3LQZA 3VD4A 3AC0A 4C56D 3QORD 2AK1L 2BSRB 5AB1A 1ZHKA 2Y0SA 4IHOB 5I1IL 3QUKB 5J6HB 5DD5L 2X1OA 4R7VA 4FG0A 5HPMA 3L6FB 2VSKB 4MD4B 4QOKA 5F88A 1IZJA 3M17B 5KSAB 2UZYB 2R2CA 3TCLA 4LLVA 5MENB 3PWPA 2ADIB 5D2LB 4GMTH 4H1LA 2G4GA 5AKRA 2JKIS 3BVWA 5L7XH 2HRPL 3GXDA 1MI5A 2ZPKH 3SKUD 3U4BH 2X4PB 2X2YA 1AIFA 1N4XH 2ZWNA 3QNZA 3P30L 2OZ4H 4QXUH 3TNMA 1AR1B 5BUAA 4IOSD 3U0PA 2NY6B 1BZ7A 4ZW5A 2CIKA 2NY0C 1HHKA 1QR1A 5DMIH 1QLRB 3IXTB 1GRWA 3QFDA 4QHUA 3FSAA 1PZ3A 1R19A 2WNWA 4JRYB 4QHNB 3T8VA 5E51A 3D0VA 1DCEA 3FQ4A 4TOYH 2JKNA 2NTSP 4B7LA 1DQJA 1E3ZA 1ETA1 1HKFA 3O3AA 4TNWK 5E7FA 3O3EB 1RURL 4AXWB 5FFOA 1TKWA 3IF1B 1W0VA 3C60B 4R97B 4PCYA 1A02N 3WUWB 3BIBX 4LEXL 4PHXA 2NUPA 5J9PA 2CDGB 1HQ4B 1Q0EA 3LQAL 1WFMA 2X41A 3V9FA 4YHZL 5E94A 4H13C 2IXQB 5AOJA 3ASWA 3GI8H 2X3CA 1X5ZA 4N2MA 2LTQC 1O6SB 1PYWB 1DR9A 3RWJB 1HKLL 1QUNA 2EH8H 1U3YA 3B2MA 3OBAA 4QCIB 1GMIA 4UTBL 2I32A 5I0YA 2X5PA 1AI1L 4LVOB 5FA3B 2FGWL 3ZZLA 5DD1H 1OQXA 3KWUA 3QG6B 1ECZA 4J6IA 5CIPH 4ZXBA 2GITB 1S7TB 2ORBH 1MY7A 3TBTB 4EOWH 3CC1A 1ES0B 2YA0A 4A66A 4HP5A 3TH2T 4GP4B 5I74C 4UU9B 3TA3A 2MPVA 4XO5A 2ICWJ 3VFUB 2MRYA 1WT5C 1LEKA 1X7QB 1FYTE 2V5YA 3M1BA 2YD4A 4FQIL 3ULVH 4WI6A 1YN6A 3DYOA 1JNHA 1CGTA 4HFUL 3WHXB 2CM5A 5KUKA 3KLSA 3OF6A 2ZWLT 3PP3H 4B60A 2VH5H 4JG5A 2R59A 2P8LA 3S88H 4KKRA 4AZ8A 4UIKL 3QWQB 3T6ZA 4N5EC 5HYSG 4PLKC 3IAGC 2OX5B 2E27H 2VXTH 3ZKQD 2Q2EB 1F13A 3R4RA 3SPVA 3AB0B 1MHEA 2Y7LA 5T1DL 4Z7VB 3BH8A 5ID0B 3IBEA 5IB4A 2B1AH 4NP9A 2FX9H 4AC2A 4ZPVB 3S3PA 3QEQA 5EOQH 3BVXA 5I6PA 1FYTD 3UTTB 5ANHA 1CL7I 3DX3A 1AGFA 3D25B 2Q86A 3WTXA 4KGLA 1RULH 2YC1B 3DGGB 2J4WL 3CSPA 4F2MA 3VXOB 1A14L 3ILQD 3PAYA 3ETTA 4MXWH 2BNRB 4JEGB 2F58L 4MNQA 5ICUA 5DZJA 3CLWA 3WEOA 4HS6A 1HAUA 1NDTA 2I9LB 4OM1L 1MZZA 2ICWA 4UNUA 2NY0D 3V5HA 4EIBA 2BW4A 4BFKA 1SY6L 1TQBC 1RPKA 4JM2A 5LKNA 4OF0A 5TGBA 1K4CA 1C7SA 3CPLA 3ES6B 3O4LE 2NY1C 1FL5A 1MFBL 4QI3A 1GVIA 1J0YA 1JCVA 2BRRH 2VMFA 3BH4A 3P9LB 3FUIA 4RAHA 4EUPB 1S8DB 2BFVH 2IQAB 4PJIA 5DJDA 3IDNA 2GEQA 1EHXA 5IW1A 3BT0A 2PCXA 2BMKA 3LCYA 3UAAA 2DBJA 1KWKA 5HXMA 3IVKA 4XE0A 1RY7B 3LD8C 1C7TA 5ADPH 2W0FB 3FO9A 3WIHL 4ZS6D 1KN2L 1SFHA 1XGPB 5T1MB 3X1NA 3QDHA 1RCYA 2GFBA 5KG9B 3LKPB 1JGLH 4NENA 4JHUA 3WIIH 2D9CA 4C56B 1EO8H 2HRHA 4PREA 1T1XA 4TQPA 1H6FA 3DURA 3QUZC 3ABGA 4PRDB 3O4LD 3T0EC 1MIML 4KNQA 2O5YL 1G7PB 2QQLL 2WIIA 3RB5A 3LZNA 2JB5L 1EIBA 1EDQA 5JYMA 4KXZH 5GZOA 1A7NH 1JHTA 3VFOA 4XXWA 2G9HA 4UMGA 1CFSA 4IRZH 4Y8DC 5HDWA 2KI6A 5GSRA 4NFBA 4Z1PA 4XXDA 4JFOB 5TK4A 1A9BA 1WV7T 3BFOA 2E6PA 4NNYA 1PD6A 4JUSA 3V0FA 3U9PH 3EZJB 4JKLA 4UT7L 3MJ9L 5LBSA 4YH6A 3O3DB 4IRJA 1BYPA 2AJSH 2AEPL 3IFOB 3CXDH 1EPFA 4YL4A 2VERA 2CZNA 2LGNA 1FFNA 1JV5A 2I27N 4PLKD 5DUJA 3IDJA 3NUKA 4Y9EA 1V7ML 3OKLB 3LXUX 1BPLB 2YEZB 2KMWA 4R4ND 4PG2A 3LS4L 4IQHA 4IKNA 1MQKH 3KBHE 2YGVA 1TQCB 1IC5H 4EJ1C 2XXCB 3QQ9D 1RERA 1JK9B 5JHBA 1GS8A 1M71B 5C07E 1P4LA 4YZWA 5LHDA 4MJ5A 5A3ID 1KCVL 1QHPA 4M00A 1THCA 5TE7H 1E9QB 4MD5B 4XVUD 1BPVA 2YK1L 4FS0A 1T5XA 3SKNA 5KZCB 2PPEA 4MS6A 4FQXD 1XMEB 2E7HA 4FYRA 4YEEA 4WWKD 4KTDL 4TQHA 4JY6B 3U1SH 1QLEL 4CMHC 3FT9A 1TTCA 3MQIA 3MNVB 4Z3HA 1X7SA 4EZLA 4TF4A 4FI6A 1AGDA 2HVJB 3H7BB 5HGAB 1FNGA 2WQWA 4R26H 5DD0H 2R1XB 2ZOKA 1GIGH 2VDLL 2X3AA 4KJPC 9PCYA 4X7TA 1EV2E 2AHIA 3I6GA 4AEHL 4WTZA 5J8OA 1QAWA 5E6ID 1KXTA 1JZ4A 4O9HH 1LEIB 5JHLL 3BPLC 4KTGA 5E2UH 4PYHA 4PGJA 3I3DA 2KBGA 3GZPA 1NCIA 4TUUA 5EDXA 1Z32X 1WISA 2PMZA 2WTOA 5EOTA 1BIIB 5E8NB 2X6VA 4K9JA 1RIVL 1HC1A 3TLRA 5FB8B 3LKRB 5ICYB 1UKSA 2BVEA 2QSQA 5HPOA 1X5GA 2DJUA 2ZKXA 4XC1H 2EDWA 4NX0A 4QRRE 3VXMA 3CZKA 4XXCC 5LBGA 1JPST 3MBED 1OTTC 3QCTH 5H2BB 4PRIE 1ZK9A 4LSVH 4RRPG 4BEIA 3F7KA 1ZCRA 1IZKA 3MGTB 4M8QB 3WJLA 2QFRA 2Q8AH 3W38A 4P4RA 2VN4A 3VWKA 1Y1DA 1FYTB 1A6ZA 3AG1B 4JFZH 1JYNA 2NY3C 3C5SB 2YAQA 3HBGA 3G08B 5FK9A 3U2JA 5BOZG 4H25B 4GQRA 1KCRL 2RGSA 4I3SH 2YN5A 4KHXL 4MQXD 3TV8A 1SMOA 1FQ9C 3I84A 4OUUA 3STLA 3UP6A 2VAJA 2DWXA 3FT3A 3X3GH 4Z5RB 5GS0C 1KENL 4ICXA 2EIDA 4DPAX 5HVHB 5CEXA 3QISA 2Q1EA 3EGXA 1W8OA 2WHVA 3HVDA 1YVLA 4DKAA 5HD8C 2NY0B 4ZJ9A 5CGBA 1I8UA 3ZPDA 4WW2B 4CMMB 2YBRB 1M7IA 3VRIA 5IB3A 1VFMA 2NZ9D 1ZT7B 2V2WA 2AXWA 3BYTA 4PRID 3ULAB 4DGYH 4L3AA 3O3UN 4LE8A 5I16B 3ARPA 4N2CA 4F24A 4PN6A 2HMID 4WEBH 2WCPA 3B7UX 3VQMA 4M7LL 1S5HB 1NBYA 4MCYA 3RX8A 3DETC 3BWSA 2AEIT 4Q7DA 3GHEL 4Y5YB 1UH3A 1BW8A 3BQVA 4JFEE 4CL7A 1RK1B 4P2CG 1AIZA 3KS0H 1I3GL 4H8PA 4S1SL 2EP6A 3MX0A 1UT1A 3QZWB 2GJRA 4XN7A 3RTQD 4M62L 5HGDA 3M88A 2OCCB 4IS6B 5E99H 3FTWA 1JNNL 1HCFX 2BFGA 1MG2C 1TVBB 1WE5A 3RWEB 3ZYJA 5I18H 1MOEA 2QDWA 7FABL 4OFKA 4DN3H 1BQ5A 1G7IA 4X6DF 3O4LB 3V7MA 1ZSDB 3QCVH 2FLMA 4NSKA 1TZIB 3UBXB 4N2IA 3SHSA 5EA0H 3VW3H 1F3JA 5F7EL 3ATFA 4ODBD 1MJ8L 4CVXA 4NKMA 5HYJA 3I9IA 3VI3E 3BIKA 2PW1B 1D5BB 5T5FA 3WTWA 1OAZH 2VT0A 4K5LA 4YXKH 2JCWA 1S7UB 2ZCKH 4HKBA 3S48A 2GIYA 4JFED 4CADA 1DSYA 12E8H 1Q9LA 4GSQA 1VGKA 4PB0H 5EO0A 4FLOA 3R7QA 2QGDA 3WELA 4PJ9A 4HKZB 5DLMH 1A3QA 4JPQA 3DRTA 3SYCA 4JQXC 3MRKB 4KK8D 5GGRB 3A4AA 4YHOL 1UVQB 1ECYA 4OQTL 3FMGL 3HI6L 3P3YA 1II4E 2B0SL 4Z7UA 5J89A 5J6GB 5A2BA 4X6CB 2WO4A 5L88H 3SE8L 1AGBB 3QC5X 4XGZB 3KPQA 3N1PC 4JFSA 2F8XC 4R5VA 5IJBC 1GHFH 1O75A 1QFUH 3OR6B 2EDHA 1VAHA 2BY2A 5C9JB 4FXLA 4MNGA 1H3PH 4N2DA 3REVB 4PPTA 4MSWB 1HEZB 4O02B 4PW4A 3GRBA 2VTFA 4J3WA 4PY8I 5TDOA 3SQRA 2XG5A 2ILLA 1NBZA 4EZMA 3NSFA 4F9PC 3G5WA 1HL4A 5GRUL 3LEXB 4YEFA 3WJMB 3N04A 5JORB 4P49A 2FAUA 3NFSL 1SEQL 1QLEB 2GBAA 2GT9B 4F15C 2JXMA 5GS0L 3EDFA 2P24A 5GS0D 3F7VB 2DQIL 3MRIA 2BCKB 5E70A 2WNGA 4XH2A 1FZMA 3B5GA 3PS6A 5DK2A 2XN1A 4P59L 1FH2A 3KLAB 4MAUH 4AEEA 4N6QA 3ZU8A 1QPPA 3BUBA 1WF5A 1IBGL 2FZ3A 5ENWB 1GTFA 5IV2A 3ABLB 4FNLH 4AYEC 2AJYL 5KEZA 3NZ8B 1KCSL 1BA9A 5EN2A 1OARH 1WDAA 4IMLA 1RZ8B 4AVKA 4ZNCD 4AE1A 2BS8A 2DLHA 4TV3A 4WI4A 3L3OC 4AMKH 4ELMA 3LD8B 1OQOA 2NXYD 1NKGA 4XVOA 1XGUB 1AGEA 2RHEA 1XH3B 3CZJA 4XVSL 4X7EC 3WFEH 1CFQB 3MBEB 1MJJA 4LCUA 5ANMA 5CJXC 4NXSA 1OGAE 2JCCF 3D4ZA 3SKMB 5A1AA 1WAAE 4I77L 2F1AA 3REWB 3WFHA 3QUZB 1S7XA 3GBLA 4FP8L 1BD2E 2WXJA 4ODSH 4CSSA 5L4JA 1TSHA 4Z3IA 3BZEB 3O6KL 4OV5A 2R2HA 5B4MD 2VLLA 5I1EL 1ID2A 3FF7A 3MROA 2C9SA 2K4AA 3C2AL 1NOLA 4H88H 1BQHA 1ZY9A 5HYSB 4X8JA 3DI2B 2E7BA 4PHZA 2XXGA 3PABB 4U1HA 4DGWC 1GCFA 15C8H 4MZ3A 3IJSB 3DSFH 2PF6A 1YAIA 2CBQA 2J5LB 1JPSL 3D18B 3GB7B 4ZOBA 4PJFF 1KB9J 5IR1A 4PRIB 4B9CA 1OAXH 1OGAD 1UD2A 4DW2L 5KANI 4LHUA 3DX8A 3VX1A 1P7BA 2WPGA 3K0YA 5E1QA 3R8BB 3GC3A 1AD9A 1WCBA 5DWUH 3OKNB 1BD2D 4HF5H 5FGBA 1J1XL 3VI4A 3B9KA 1JZ7A 2C9QA 2IWGA 2CO7A 5EUKA 4J6RH 2VIRA 2AI0H 3CVHH 4JY5H 4XBPB 4LOUC 2VDKB 4P2RA 4U3XA 4FMFA 5F7MC 1A5FH 3NG5A 5HHVL 1J9CT 4YXHL 3QB7C 2OL3B 1MCPL 2FK9A 1A4AA 3GBNL 4K3JH 5EC1A 4HKXB 4JCMA 3FTYA 4N0CC 4Y2DD 3QEHA 4XCYA 5HHOE 3HE7C 4MJJA 4CMHB 4Y19E 4XTRD 1AOHA 35C8H 4OI9A 3T71A 1HXMB 2X88A 4M6OL 2HLEB 5TF1H 5K9OB 2YAMA 2I7SA 2BC4B 3FFCE 4P5SA 1HHHA 2P49B 4X98A 5DD6A 4YDNA 5IM7A 1KC5L 4KK9C 4AYDC 5C7XH 1B3JA 1QSVA 3HUJB 4L8DA 3ZTNL 4W6YB 1SLWA 5I1LA 1UFUA 3GSOA 4JO3L 1HSBB 4XNMA 3T4AB 1B0GB 4Y4KC 4JFEB 3MRBB 4JFYB 4XPFH 2DYPA 1K5WA 1CE1L 2ZWYA 4XB8A 4PUBL 5JNYA 1MG3C 4DFIA 1P4IH 2K8MA 4LB8A 1DL7L 3MLVL 4RNRB 5TDPB 1U3HC 1RHHB 4XPTH 5ABZA 4AUJA 3AREC 3NFPA 1KB9K 2BINA 3NJXA 5D7IA 3T77A 2NSQA 2W0KA 5HHOD 1SUHA 4OF5A 3IDYC 3QI9D 2ENJA 4IIQC 1PSKL 1Z0NA 3OAZK 4PJEA 3ZRCC 3JTBA 3TO4D 3HZMA 3IWVA 5B1JC 1I9JH 1C5CL 1FORL 1O7SA 4L4TE 4Y4FD 5AALA 3FFCD 2IV9A 1A4KB 3C5JB 2XSKA 4Z7QF 1EO5A 2ZOOA 4M61A 5F7KC 3HC4L 2RQ8A 1NA8A 4F80A 5KJRH 3Q48A 3WNKA 3X1FA 3MLUL 3VNZA 1PEWA 3K6SB 3TO2B 2HWZL 3DMMA 5IHZB 4R3SB 2BRQA 4KV5F 4PSRA 1J5OL 4QGYA 2NY3B 4KAQH 3N0AA 3X1GA 1LE9B 5HDLA 4NJ9L 4L1TA 2PP8A 3UYPA 4XN8A 4L4JA 1NCTA 2FO8A 4D3CL 3U9WA 1YEJH 1OF2B 1TJXA 3MLWH 2YOAA 4LSQL 5IVOA 5EF3A 1IEBB 4KDWA 3D12B 5GJTL 5F1NB 4HCGA 3ROOB 5DK3A 1DN2A 3CGTA 4RAVB 4L4TD 4MXQC 1G6RH 5IMKA 2X4NA 5JW3H 2IALB 3QA3B 4M8VA 4UDUA 1UXLA 4HZLA 4W6XB 3CFNA 3S37L 3SQOH 2VWEC 4HT1L 5CLYA 1INQA 1FNEB 4ZX5A 1M1SA 3TN0D 4DP8X 3MRNA 1FO0A 4XCEA 1BFVH 4HWNA 3S36H 4XNUH 1JHKH 4M6MH 4DP6X 1J0JA 4KUZL 4LOUD 1CFVH 1N5AA 4QTFA 1J5HA 2NXYB 3EJRA 3TBWB 1KTJA 3ZDYF 3D39E 1JJUA 3HZKA 4J3OH 3U83A 3DWTA 3MREA 4JRLA 4AV5A 1C08A 2MNJB 3FBKA 3P02A 4NUJB 1VSCA 5IFHH 3ARRA 4LT7A 1HWWA 2IPTH 2ED8A 4HUUB 4C83B 4FG4A 2X4SB 4NS0A 5EN3A 3V8OA 1T0MA 3QJVB 5IQLA 5SX4H 5JA8B 4YSPA 1U0QA 4J39A 1HI6B 5CJBA 5JOFB 3TEYA 3KBFA 2VMJA 3KYNB 4PJGA 2A6IA 5D5MF 3IU3A 3OQ3B 1UJ3C 1OZTG 5FHAH 3QQNA 5CHNA 1AOZA 3K71B 4JRXA 5AW2B 3L3KA 2VR4A 4LCYB 3ZZSA 5AOKA 1E90A 1DVZA 2FUQA 2X6CA 1H3VA 1N59B 1CMOA 1J1OL 2E86A 1DBAL 1JD9A 3EFFA 5TDNB 1XBRA 3RY6A 3MI6A 2R23A 1BMZA 5HGHB 2GJ6D 2YGPA 2J3SA 5DHXB 3BKMH 3CFBA 3HR5A 3QIUD 4NKDB 4LCIL 1BD2B 2VM3A 2Z1PA 3VGAC 4LDCA 3FAXA 4GAYA 5C0IB 5I8CA 1YN7A 1CXFA 4OLXH 3OKEA 4X5LA 4XBEL 5DRXB 1FL3A 2CK0L 2W88A 5EEUA 3OKOA 4DVBA 3AY2A 3ZZQA 4G82A 4EIUA 1NBVL 2DIAA 4TVPL 2Z8WC 4TVPD 1J5DA 1RU9L 3R0NA 3APNA 2O6CA 2OM5A 1KTLA 2WLYA 4WLCA 2JE8A 4JE4B 3DTUB 2WN2A 2BP0B 3MACH 4Y2DB 1URIA 1OAJA 2A74B 5JLZA 1K3ZA 3GM8A 1NCWL 4G6JH 5B1AB 3GMRA 3TPUA 1E7UA 1IIKA 4BQ6A 2W60A 2B20A 3ALPA 5MHSE 2R1WA 1ZDQA 5BRZE 2VISA 1VDGA 5JDSA 4PV9A 2IDTA 5TTRA 1KT2B 1PKQA 3OLIA 5KAQF 1S9YB 2KS0A 2D7QA 5LBSH 1EZVY 3OHXC 5DDHB 2P45B 1E8WA 4MXQD 5IOPB 5I6OA 3C5ZA 2D3NA 4FFTA 3HC0B 1ZV2A 4I5BB 1ET7A 1L3NA 2OI9B 4JHWH 1NANI 4K5OA 3GHBL 4YO0A 1PGRB 4LP5A 1B2YA 5DO2D 3RX7A 1J48A 4JFDE 3MLTA 4PTUB 5E8DL 1K6QH 3WFCL 4FFVD 3UXFA 2GI7A 1CLZH 2YPVL 5IB1A 3DI3B 2Q76B 1DJWA 3QJXA 3WKMH 3L3OB 4MYPA 2X70A 5FWQA 3KVQA 2WXNA 2XIDA 3ABZA 4W4OC 4PJ7A 1D5ZA 4XP1L 1VADB 2P28B 3VVVA 1CXLA 5TH2A 2AF2A 5BRZD 3TO4B 3RY4A 3HG4A 4Y4FB 1NM4A 3Q9QA 4JKNA 1ZA3B 5LCVA 4MHHI 1FUNA 3IGAA 4F7TA 1BZOA 5DMGD 2DQDL 1S9XA 3BP5A 4DCQA 4Z0BH 3LKOB 4AZUA 4ZW7A 3CE1A 5A2CA 5JPNA 1U4EA 5FM5O 5JXEC 4ZAKA 5HTSA 1TJMA 2OJZL 3IFLH 3JYCA 4YDMA 4NQTA 3GSQB 3RB7A 1TJGL 2Y69B 1G9MC 4JFDD 5KUMA 4LMQE 3ARUA 4YHMH 5EU6D 1YEGH 2PWGA 4Q9CA 3SIKA 5JTWA 1E30A 3JYBA 3BRGC 3IJHB 3HG1D 5IB2B 1NL0L 4L5FH 2WLMA 4LLQA 4NERA 1HFUA 1E8YA 3SCMD 3V5KA 4HIJB 5F0PB 3F7RA 3Q8EA 1IGJA 2V2TA 4P4KD 4ZNEA 4D0DA 1JV2B 3FQXB 3FCTA 4OKVB 43C9B 3D0AA 1FAKT 1WHPA 3P3UA 2A6DB 1WFOA 4UB0H 4Y89A 3J8F7 3OGOE 5EIVA 2GY5A 2KPNA 2H2PD 5C0EA 1BMGA 1ZHLA 1LP9F 4XNXH 2KZ1B 5BZDB 3L5XH 3INUH 1IB5A 3VB8A 2ATKB 3WGUB 4AIXA 2VQ4A 4FA8A 4ES8A 5KS9A 1OW0C 3N9GH 1BEYH 3DSNA 4DP1X 1T89A 1EHLL 3UJTH 3AQDA 3J2PA 1BJ1H 4G8EA 4FZ8H 3OJDB 4MJ2A 4YFLF 2IIJA 4W9IC 4YWGH 2KQNA 2BVUA 4N2OA 5C0DB 2XPYA 4ODHH 1QI3A 3HOGA 2CR0A 1U2HA 4B9FA 4OZFG 4AOFA 2E59A 2EVHA 1G9NH 2BZCA 5H4YA 1QO3A 1N3NB 5E8EA 5ISZE 1ZLVH 1WFUA 1J12A 5D7KD 3WLBB 4PWHA 5IKCB 3VJ6A 4UZSA 3O6FD 2CHNA 2PCPA 4UQDA 3QQXA 4K7PL 3TJHC 2XWDA 4BWWA 1I9IL 2YEVB 1UOWA 3L4ZA 3IN0A 1FFTB 2GKIA 4PV1C 2OCFD 5IBTH 1CLOH 4LSDA 4XNZC 1F0LA 5I6LA 4F58H 3H42H 1U3HB 1LVEA 4XMKL 2HH0L 4GW5B 1HL5A 5AENA 2WZPA 1DVFC 4YL9A 2GJ6B 1NSNL 3IDYB 3WTYA 4HA1A 1JN6B 1XF3B 1FGNL 2P5WB 5ISZD 3FQWA 1RZ7L 1XDTT 3O2DL 3VXQA 4ODTL 4OZHB 1HQRA 3TNNA 2NNCA 3H1ZA 1LO0L 3TBYB 2AC0A 1IKOP 2Q5BA 1NGQL 4G8GA 4ODXA 3NJHA 43CAB 1REIA 4D9LL 4OGXH 2Z93B 3MUZ1 1JZFA 1G9ML 5CMAA 2XZCL 4H8HA 1HE8A 4O5LH 5DHYA 4JLRA 5T5FH 3DUSA 3EJQA 2CBPA 4WCYH 2QADD 4LHJB 5D4JA 5IVZB 2VRQA 2OJEA 1JGDA 5MP6L 2YD2A 2DQEL 2RACA 1AQMA 2OSYA 1X7TA 1RMFH 4P57B 2R56L 5AW8B 4ODUA 4DETA 5IUSA 2ED9A 1GXEA 5CR8A 4U1MB 4QGTA 2VDPL 3QUMA 4JW3A 1EK3A 2QMKA 2MEJB 2IWFA 1ILUA 2P7TB 2V5MA 1BYOA 2ZG3A 2K78A 3FQUB 3RHWF 3WJJC 4WF7A 1NUGA 2FX7L 1NLBL 3SPGA 1YEHH 3D6GA 5HHXH 2YSSA 5KBDA 3VD0A 1GPOL 1OLLA 4MMXC 5E4EC 5IGXL 3SGJA 3BEWA 1I1YB 4D8PB 3KXFA 3PFQA 4WWPA 1AZZC 5DQ9A 3M8OL 3O45B 1NCDL 3THML 2BIHA 2UVEA 3EO0B 4UNTA 3RNQA 3SGKA 4N8CH 5BRZB 2QHLA 3NTCH 3UTZB 3EH2A 4PRHA 3ZO0A 5E6SB 2J56A 2YHGA 4WQOA 5D7JA 4PJBA 1D5MA 1AKJA 1Z5YD 3NA9L 3G6DL 1NFDF 4HIEB 5B39A 1GZHC 2R51A 4HUKB 1G6RB 3QDME 5JHMA 3JWNH 2BWDA 2XY2A 1ONQB 1NDMA 3AMLA 2YD1A 3OAUH 5IQOA 1YUHA 1EAPA 1MXGA 2WANA 4ONHA 4QTHA 4PJ5E 4JFDB 1NGPL 5EU6B 3QIBD 3PWUA 4MAYA 2HLFC 2QL1A 2W1NA 4AYID 4Q6IA 5I5RA 2XWXA 3HG1B 4G59C 3GI9L 4Y2OA 3VFWB 3UO8B 2YD6A 3SCMB 5IWLC 5CSZA 5GJSL 5F96H 3V7AG 1A7PL 2W07A 4P4KB 4HC1L 4K07A 3UCRA 3NVQA 1L7TH 2WO2B 4QXGH 3MCKB 4KQ4L 3G6JE 3LKNB 5TE6H 3P3TA 2Q8BH 1QWNA 2H45A 1SYSA 5DEGA 1JZ2A 4MJ4A 3VG0H 4TL5A 3L4VA 2FLBT 3SKJH 5J13C 4R5XA 1FNSL 4BUQA 3PNWB 3QDMD 1ED3B 5D9SA 4TNEA 1K2DA 3GSNA 1ZHNA 2DI7A 3K2UL 4JFXA 4M5YH 4PJ5D 4R90H 2DL2A 2H0EA 3GO1H 3BEVB 5FO8A 2XPGB 1OCWL 3AGVA 2Z92B 1XIWC 4KDTA 2VLKA 4OFDA 1BX2A 3MGOB 4I0KA 1FGVH 3G5VB 4NFCA 4AL8C 1X3DA 3DJZA 4M3JA 4ZPTA 4RMTA 1UUNA 2C9RA 4N68A 3Q6FB 2NY4C 1T3FB 4F7EA 1XZ0A 2HT4C 1VPOL 2J6EA 4Y5XC 4JFHE 2NT1A 3CX5J 4NC1E 2R2BA 1U8MB 1L5GB 1ND0A 1RUML 3WNPA 4XO4A 2XETA 5AAMA 4Q6KA 2WMPA 4UT6A 3OHXB 3KGTA 3CNKA 1KELH 2DQHH 2BJML 2VDNL 2WKOF 3HS0C 3U46A 2P48B 1JPTL 3L9RB 4QD2E 3V52L 5KSVA 2LVCA 3MC0A 2V2XB 5D6DC 4KRLB 3A22A 1JWMB 3WKQA 5DSCA 3ZVVA 5J1TC 5EG6C 4XB3A 3I9GL 5J1AA 4EBQH 2R0KH 4EXPX 3LXAA 5AUMB 2AS5M 1A6WL 2VXVH 3BP7B 4Q97A 4F8OA 1Q0XL 2VXUH 1IKFH 2Z7UA 5INDA 4U6YA 1O6VA 1NIBA 1PZAA 1YNKH 1ZTMA 4RWYL 4PJ8D 2W8CA 2IH9A 4P2QE 3PV7A 4M43L 2AV1A 4JJ5B 5T1KA 3IGUA 4FA6A 3DVFA 2E6JA 4JFHD 4M7JL 1IX2A 1QFWH 4QPEA 5ISZB 1W0WA 3H9SA 3LN5A 7PCYA 5DJZA 1CU4H 2WXFA 2C1OA 2AQPA 5HGGS 3I85A 2HFGH 1XH0A 2Z7ZA 3Q1SH 3FRPA 1GGBH 2D7MA 2OQJA 4LU5H 3SY0A 3QJHB 2HJKB 5DYFA 4IGBC 5DCCA 2D0GA 4WJ5B 3CQFA 1JXJA 3QIWA 4I1NB 2MJWA 2AEOA 4TNWF 3UL4A 2IQ9H 3LRSB 1R3IL 3O11B 3WS3A 2UWEA 5SWSE 1XR8B 1YNTF 1VIWA 3IDGB 3IJ7A 3OWEA 4DGUA 1IBHA 5DK0B 5DHDA 5E00A 3WS6A 3TURA 3GJFA 4U4BA 3CX5K 1GZPB 2A6KB 4CN6A 1ADQA 1XMWA 4ZMXA 2XWJA 1K3IA 1NCJA 4B0MM 5FLVA 3RIFK 4X80H 4HKJA 3GMMB 4UQCA 3SBPA 3HNTL 1CF8H 5TFSH 1MSPA 1YYLL 2WLKA 4QLWA 4MZIA 1E4XH 1WTLA 3CN2A 3IKCB 1M7DB 3V6OC 5IF0A 2VDPB 3GIZL 5DJ0A 1ZIAA 5TQ2H 4DOHB 3VXPA 1MWAH 5AAPA 3CCHB 5EZOH 1MRCH 3EFDL 4MMZA 5EF2A 4Y9CA 1MLBA 3EO1B 1AC0A 2PWEA 1CYGA 1I31A 1DVQA 1AZRA 1D7CA 1H3UA 4LOEA 2RTTA 4HPYH 1HIML 4LK4A 4AT6A 4OLWL 2JKRM 3V10A 1BZ9B 1ZVNA 3LY6A 1WBXB 4M48L 5SWSD 3KLHC 4WW1A 1I9RH 5EU4B 2YD7A 5EO9B 3AM8A 3QHFH 4NM8H 3DXAA 5BJTB 1X6NA 4I48B 3MPCA 4X6DE 3SPIA 4AL8L 5K69A 1A4BA 3M7FB 1OCRB 1HJBC 4JREC 3RVVD 1F58H 2ZX5A 1IBZA 2Y07L 2A77L 1RFDH 1TTFA 2NY4D 1VEOA 3BGMA 5CUSL 5KVGE 2HRLA 1GY2A 4NQQA 4V2BA 2AXHA 5L2JB 5IEHA 5I19H 1HN1A 1KJVA 4GFXA 3SZKC 1IKNA 5EO1B 2BOBA 1M42A 4K2UH 5C0GA 1RZPA 4EDXB 5ACZA 3N50A 1ZOXA 1SFDA 5I5MA 4NPYB 3IRCA 4H8UA 4K3GA 3GXIA 3QIBB 4NRYA 5FS5A 3E6HB 5HY9B 1TZHB 3DROB 3ARYA 4GAFB 1U58A 1VCBC 4JFPA 3V7AE 1IM9B 1CDIA 3VFTB 2DQUH 3GXUB 5I9QC 3L1EA 2E8YA 3IRPX 3FCSB 4M9PA 3QDGA 1EDYA 2BP5M 1TU2B 3R19A 5EOCJ 5D2NE 2JF1A 4CSTA 1EJOL 5DTFA 3WD5L 5C0CE 3RDJA 2FUTA 1SGKA 3DHPA 3KPOB 1MREH 3UGUA 5KVGL 3AY4A 1I8AA 3KPPB 2PCFA 4JZNA 3D9AH 4XOEA 5MEOB 4YPGB 4TSAL 4F7KA 3LMJH 3ILPB 3IYLW 1LNUB 1QHQA 2V7NB 3ZIMA 4HUVA 1NBQA 1K8DB 5IREA 1IM3B 2DM4A 4N0YL 5KOMC 1VGEH 4QXTA 2CBMA 4LSSH 4XZUB 5IJKC 2IANE 2EYTA 4FYSA 1AH1A 4Y4HA 2E6QA 3MLRL 1VACA 4X0KA 4N5UA 4NGHL 4JM2F 1SDDA 1B0RA 4LCCC 3UTOA 5K1JA 2YGNA 4X5WA 5AZ2H 6PAZA 3LNEA 5GGSA 4I18A 5IW6A 3O2VL 2GTWA 1OOWA 5JXAH 4D7PA 2OSLA 1LMIA 3G5ZB 1U92B 3WTTA 1ZVHA 4F57L 1Z9SB 3US9A 5C0CD 4OCMC 3B2XA 4PJIF 4XX1G 3P0GB 1XGRB 5FF6B 3LIZL 4S1QH 5BRPA 3NZUA 5DWPA 4EN3D 4JPKL 4YC2C 1UWXH 3X11A 1BQKA 1G7MB 2OMXA 4APQD 2HG5B 5AYTA 4KVCH 3G9AB 4GSUA 3APCA 5DJ8B 3V4PH 3VD9A 3Q8BA 1CQYA 2UZXA 4EXKA 2IAND 2P80A 3T65A 1NC2A 5AVTB 1T1YA 4OI7A 5A43C 3C6LC 5D4IA 4BK5C 2ZXDA 5D7SL 5DQDL 4XAWL 2EKSB 2WOYA 2FX8L 4YPJA 4OZFB 5E4EB 2J21A 4JVUA 4PJ8B 3CVIH 3BKYH 2JCCE 2OPCA 3SDCD 4IBLT 1XO8A 4AQ8C 4WGWB 5LXVA 1ZT4B 1SF3A 2LQRA 4ZD3L 1TYJA 3KWWA 4RAUA 5I26A 5JUEL 2FSEA 3VXRE 2HTLC 4OLZH 2KUTA 4IOIA 4GT7A 5C2UB 5E8OA 4KJQD 2NDFA 3VCLA 3DX9A 5EFIA 3KNBB 2P3YA 4E5XA 1I4FA 1QSFA 3PAVA 1Q90A 4OAWB 1HNFA 3NAAL 4JANB 3MTRA 2Y7QA 1MJ7H 1E65A 2XVLA 4XHJC 1FPTH 1MUJB 1NAKL 4ALAC 1XF1A 1LWRA 2NYZA 3JTSA 4M7KH 3IDMA 4U4IA 4TSCH 4ELDA 5GRWA 1OPGH 1OD9A 2VLJA 4PJFE 5C08B 5IMLB 2CDFA 2H1PH 1MHCA 3WXWL 1MW3A 1NFIB 4CKVX 3UAJA 4NCC2 3R4DA 4L3CA 2GABA 1L6XA 1UOVA 1FZKA 2SEBA 3MFGB 5GGUB 3VFSB 3IPEA 1I1AC 4LKCA 4R6UA 3NH7H 3Q2WA 3VXRD 5CFAA 2MHAA 3ULVC 1ESOA 4IOFD 4F7PA 5H37G 5FYJL 2DMBA 3A23A 4X4XB 3W0WD 5J13B 3EUUA 5EF1A 4DFHA 1YNLH 2X1PA 3OTTA 5CCKL 2C4XA 3AW5A 4OCSL 1L4IA 4WU7B 2WIMA 5I82A 2HRGA 2LU7A 4X8XA 2W0LA 2Z35A 3LS5L 5C0JB 2QSTA 5SWSB 3DO3A 1A6VL 3L5JA 3LIUA 4QRQB 3KPSE 2FJSA 1MCLA 2OMUA 3IDIB 5GSVB 1XIWB 4BGLA 2EC8A 2R4RH 3MO1A 4L3EE 4A6YH 4BFBD 2WBWB 2UXGA 4G5ZL 1NEZG 2F53E 4Y1SA 4K94C 4W4NA 5BMFL 1K8IB 1ZMYA 2NY4B 4J1UB 5KAQG 1BVZA 2D2OA 2N56A 1AANA 5I0DA 4Y5XB 4LBEA 4ZOAA 3OXRA 1OAKL 3C6EA 3SDXA 3TC9A 3ZQ9A 4LLUB 5ETUA 4BZ2H 1V5JA 3UAFA 3HS0B 4M1CC 5E2WH 2XN2A 2XWRA 1MNNA 1IAII 1Y6KR 1C16B 2TRYA 2Y5TB 4WGVB 4OD1H 2DWEB 3NACH 5HHMB 3HTLX 3LOWA 3B3IB 3MOBH 3MRRB 3UTQB 3UZEA 2NMSA 1JI1A 1BVKB 1N4XL 4QXUL 1VCAA 4YSOA 4ZUSB 1TJIH 1JF1B 3KPSD 1PIFA 3BO8B 2X89A 3C6LD 4NAMA 4X6DB 4L3ED 1T20B 4S1DD 4GFTB 2XG4B 4QRTA 3LNHA 3QULA 5GGTH 1IFHH 1YY9C 2J72A 1EHKB 4Z7QE 3FO1B 2BSSA 5LWYL 2H3NA 4TULH 1BQLH 3MLPA 4YUEH 4TOYL 4MQTB 3W56A 3L9EA 3ZE1F 1LGVA 2FJFA 3RIAK 4LSUL 1RI8A 4KV5E 3FUNA 2CLZB 5CD5D 3DBXA 3ETBJ 1PLBA 2DEYX 4YAQB 1JNLL 2L7QA 5MI0C 4PV8B 1KJMB 1KJ2A 3WL9B 5FGSA 1XGYL 1FN4A 2FJHA 3FCGA 3QJFA 4R4BB 4KI5C 4YFDB 3TU6A 4A7UA 1Z9MA 4MDIA 3GI8L 4JO8A 3BGFB 3JV6B 4NHUA 1N0LA 5DHMC 2DN7A 1YCSA 2IDCA 4WI2A 2EH8L 4ALAL 4AGLA 1A1NB 2EVIA 3MV8E 4UT9A 3L95B 2Z8VC 4V1DE 1R3JB 3P73A 5D2NB 2Q7NA 4XX1E 5DD1L 5KN5B 4NQSB 4GSRA 5HI5D 3NZHL 2Q7AA 2ORBL 3LN4B 5BV7B 4PIBA 4RMRA 3U6RB 2HP4A 2HN7B 1RQ5A 2GAZA 4EN3B 2OSXA 4PS7A 4BKLA 3NCJL 1B4LA 1PG7W 1UOKA 4X4ZA 4ZO6A 1CFNB 1KLFB 4G8FA 5I1GH 2EXYD 4MA3B 1T66C 3CU1A 4CDHA 2R4SH 3ARGD 4PJCA 4EI5C 3C6SB 1Q4NX 3O4OB 1SOSA 4ORZC 3QO0A 1ODUA 3FN0H 4FFYH 4P5KB 3T0EA 3VB9A 1C9SA 2EO9A 5HVWA 3S8FB 1F8TH 3ZDYE 4ZUWB 4MA7H 4LSTH 2J43A 1H6UA 1KGCE 1W80A 2XDHA 4MJ6A 1JNJA 5D1QE 2QLVB 2G2PA 3D4YA 2X6AA 3D48R 3MV8D 2ZKMX 3PAUA 3OXSB 4V1DD 5BRQA 4BRJA 1TG8A 2E27L 3K4AA 2C5DC 4OCNC 4MJHA 3CVBA 1TVDA 2CO2A 4K94L 3AACA 4IBYA 4ADIA 1J05A 2RMNA 4N9GA 2AGJH 2JQMA 4IEFB 2B1AL 2FX9L 1DE4B 4D7BA 3X1EA 3W9EB 5F21B 2BNUA 2ZIDA 2OJ1A 3MXVH 5D5ME 2ICES 4BSVA 4PGBB 1A7QH 2WSKA 4C59B 1KCKA 4TNVF 3DIVA 5D7LE 5IHUL 3GF8A 3SKOA 5FM5M 3IAPA 2O5XH 3B1UA 3UPCA 5ECJE 1KGCD 1NUDA 2RB8A 2AJXH 5D1QD 2KLTA 1PY9A 4K73A 5FC9A 5I9QB 3TZVC 4U1KA 3HLAB 3JBG7 4FQCL 5HDBF 3QZPA 4TQEH 1UJTA 1FZJB 2CO6A 5HJ3A 2CO4A 1F3DH 1YY9D 3AAZA 3MBWA 4G42B 4QKXB 4FC3E 3TVMA 3FCBA 4HXAL 1OB1B 2BRRL 3W0WB 2ITDB 3AXLA 4B9IA 2ITCA 4ZFOA 4NQDA 1Z2KA 4LVNC 1HHIA 1CT8A 4U31A 2DD8L 1H0DA 4KTEL 4ZMPA 2Y06L 3FHQA 2AKRA 5K1NA 2H3KA 5D7LD 4YSTA 4LVHB 1T22A 1MPAH 4FG2A 4KJYA 3GIVB 5ADPL 1I8IB 4H4NA 1FSKC 4LLDB 4EQ2A 5AW3B 3U30B 4FEMA 5IMOB 1EJFA 4ZUVB 2NUTA 1VEMA 2YIHA 1JGLL 1O7DE 2CDEB 3GBMH 1NANH 3WIIL 1EO8L 5INCB 4J4PD 4TPRH 2E7CA 4MTMA 2R9HD 2EEAA 3U36B 2GSGA 3LB6D 1GYUA 3JVGC 3AUWB 5MERA 2CIIB 1H8OA 4ENED 4AIOA 3CFKB 5IG7B 2F8IA 1YJDH 3FRUB 1OVZA 3QPXL 2N7AA 4IRZL 1VFUA 1ZA6A 3L81A 1NJ9B 4PGDB 5HI4C 5IFAL 1T0NB 3KPSB 1TTGA 2G3MA 3U9PL 3C6LB 3DUUB 1KEMH 5KVEL 3H9HB 3VFNA 2AJSL 1Y6NR 3CXDL 4RISL 5C0BA 5T1JA 2C9VA 3D8MA 3N06B 2IGFH 3NQKA 1Z9OA 3V55A 3U4EA 4O58H 1MQKL 4P3DB 5DVMA 1I8KA 4POZC 1IC5L 3V8CA 2C7UA 4GQ9H 5HGBA 2QFPA 3QPQC 2VC2H 1O7VA 3NN8B 2X6BA 2C1PB 3ZE0F 3JV0A 1A7RH 1AD0A 4QRPE 2LR4A 4LFHD 3LHPH 4IMKC 3U1SL 4GBXC 3D2UA 2CMRH 4U05A 3CQPA 5AW1B 4OT1H 2E9IA 4YHIB 2PPDA 4Z7QB 3DX2A 4FXKA 5B7EA 1GAFL 5FR3A 5DD0L 2F0CA 1GYAA 1LP9E 3TBSA 5JOPD 1IUZA 2IGTA 3H8NA 3QZBA 2E75C 3JZ7A 4NWTH 5GZNA 1I1AB 5C71A 3OKDA 2EIBA 3EDEA 1UKTA 4HFWB 1H5BC 4ZW6A 3T5WA 4O9HL 5D1ZC 5J11C 3ARGB 4JZOA 1IC7H 1P7KA 1OP3K 3FO2A 4U1GB 2DTSA 3CLFH 4XCCH 2ZUQB 3S35X 4Y5VA 4E36A 5M94B 1NGYB 3GDBA 2FTAA 3P4LA 1ZLUH 4Y9GA 3LVEA 4HV8B 4POUB 1B9KA 3JWOC 2MNWA 1NMBL 1OSPH 5EDSA 4RETB 4XC1L 3MV8B 3HG3A 4JFFE 4V1DB 2K8QA 4L9LC 3WY3A 4K9EC 4DKDC 5JDJA 2P8PB 1DUZA 1FVCB 1G94A 2A73B 3PL6C 2N1TE 3OZ9H 3QCTL 5JPMC 1M3JA 3GGWB 1JGVL 4LSVL 1ZANL 2ZWZA 5HI3D 2XIIA 1B2WH 3CC5A 2YMXH 4XMVA 3GJFH 3D0LB 3HC3H 4CAGA 3CVDA 3ZTJG 5EBMB 1UCBH 5SX5K 1QNZH 2HKFH 4MX7B 5DF0A 3UX9B 5I1CH 3V0WL 5D7IF 2FGZA 2R2EB 1TTAA 2NR6A 5HHNB 4E68A 4YSQA 5G4OA 3ZDYB 4KDVA 1SM3H 1RL1A 2DTML 3L1FA 5BVPL 2ZJSL 4P99A 3X3GL 2WKLA 5EULV 1W6WA 2R8SH 4CGUB 2BVOB 5F44A 5D1QB 4L2YA 1QQDA 3KYKH 3O9WA 2QQQA 1X9QA 1UWFA 3FT4A 3OL2A 3QZNA 3EJYD 3OPZH 2UXFA 4N1HB 1KYUA 2ZP9A 3CPUA 3PE9A 1NZRA 4H1LG 4H40A 3KBPA 1P7HL 3Q8CA 1BOGB 4FI7A 3VTAA 1E4WL 4U49A 2PYFB 3KWTA 3DK2A 2EDTA 5AVSB 2HKHH 4R84A 4ETQB 1BXUA 5DVOA 3RDTD 5D5MB 3WSQH 1GGTA 1T1WB 1YLBB 4S10A 2Y2WA 1N6VA 5MI0B 5TE4L 3W1ZA 4YHPB 2YQBA 5D7LB 5FA4A 2HVKB 2DDQL 3NFNB 3QFJE 4GEIA 3P4MB 4S2SA 4U1LA 4ERSH 3W39A 5DMJB 1H9DA 4GG8B 8PAZA 4GUPB 2E9BA 2W80C 4G1EA 5E1HB 3EOBB 1IL1A 4N9OB 5E99L 4M6AA 5C7ZA 2Y22A 3ISRA 4XO8A 3VFMB 2EILB 3O8XC 4XBGB 3CFJB 4FLHA 2WTRA 1FNLA 1HOEA 4ESKA 1A1MB 2CR6A 4OIFA 1KGIA 3K7UA 2NPLX 5C0FB 4RMQA 5DYOA 4E41B 4WDIB 4ZBJA 1THAA 3FCUB 3ETSA 1A8JH 3KLLA 3MODH 5CJXA 1S7SB 3TYGL 2VJXA 2IEPA 2YWZA 3HE6C 4U1IB 3RKDD 5IJCC 3WY1A 1KCLA 12E8L 2PXYA 3HRZB 5G55A 2C34A 5JO5A 1I7UA 3FQNA 3QR1A 6FABL 1I7RB 3X3FH 4UTAA 4I1RA 5DLML 5FGCE 3VE0A 2QDVA 3EOTH 1DDHA 4MWFA 1NEZB 5EMYA 2XV0A 2WP3O 4L1LA 5C6TH 3BRDA 1L0XA 4K5NA 3JWOL 1Y18A 5FW7A 1JTTA 3IFPB 5LXGH 3V9EA 4K9EL 4ZUTB 1EEYA 1NFDE 1PLGH 4OCWH 1P5UC 3IXAA 4KVNH 1IEAA 2JSFA 1IAKA 4XPAL 3EG9B 4PJGF 3BQUA 4C4UA 2F5BL 5AD0B 1OP5K 5L8KB 1IGCH 3BW9A 2WXMA 2FNWA 4HIHA 4FA7B 2CPCA 3VSQA 4PGCA 1T5KA 3NQIA 4OFPA 5D70H 2DICA 3FQTA 3WXVL 4QNPF 5KJ4A 3LEVL 1A3RL 3ROLB 5D71L 5BS0A 2KZWA 1T04B 2BWQA 2G30A 3WDIA 1CVRA 1NCBH 1MCRA 3H7LA 1H3WM 3VO0A 4OI8A 4GKOA 1R9FA 1GSMA 2WM0A 1VZGA 7CGTA 3GKWL 3WN5B 4PG9A 1U8NB 3CN4A 2H7WA 4BJLA 3ZL2A 5J4MA 3QWRA 5ALBL 5KVFH 4AQ1B 1ZE3H 5T5NF 3Q3GB 4YDJB 3NP3A 2WNXA 3V4UL 2E4FA 4ZK8A 3ZT6A 3KYOA 1F42A 1S9WB 5HYIA 3I6KB 4WO4A 4P23D 2QBWA 5E0QA 3CJJA 4KHTH 1IQDB 4D0BA 3HE7A 3L9BA 4IKKA 3WHE1 3AT8A 4A04A 5IQ9A 5FO7A 4JX0A 3OZLA 3UYOD 1OARL 4KPHH 4LCWA 1KG0A 4LVNB 1YEWA 2PP7A 2EEBA 4NRZB 3V6FB 2R69H 4M93C 2VDMH 4X99B 2WLZA 4BDVA 4J2XA 3BESR 3WFDH 3K2IA 2QGBA 3PV6A 2IV8A 1AO7D 5IK3B 3ABKB 1BXAA 1EEQA 3KLDA 3HI1A 2PW2B 1FSKB 2WCSA 2O61A 3SB3A 2ZF9A 1BBDL 2EUZA 2QKIB 5GGQH 2YPLE 3TONA 4DQOH 4WJKB 1LP9B 5AWNH 3I3BA 5E9NA 2R83A 5HVGB 4PRAA 3RWGA 2FO4A 1AKPA 3AREA 4DF9A 1U8OA 2YA2A 2YO3A 5IBUG 4ODSL 2YUXA 1ADWA 4ZXBC 3W82A 1ZV9A 5ITFB 4IIQA 4ODVL 5CF3A 3WDJA 5B1JA 1QBMH 3IMRA 2IH1B 3O6MH 4PJ7F 3TA3C 2VQ1A 1HHJA 3CX2A 3SDAA 2VO5A 4OJDH 4ABUA 2J12B 1Y1UA 3CN1A 5FV2A 4YGVA 2VLRA 2ARJB 4TS6A 1MCEA 1XB8A 2LHAA 4QF1A 4QUOA 3H2PA 5D1XC 4XC3L 4LLAA 4BH7A 4ZODA 1IGYA 4L8CB 4WWOA 1U8HA 3PXJA 2YPLD 1HOCB 4A68A 2Y1AA 5FPIA 4JGNA 1KZQA 1QATA 2PPAA 1OAXL 5KVDL 3KEHA 3WFBL 4X2UA 2HLAA 3BD3A 2R7EB 5EORL 3DV6B 5E5RB 3JV5A 2XA8L 4J6RL 2X2JA 1AXTH 2EYSB 4GRWH 1R24B 2AI0L 3CVHL 4GKSA 4JDZB 4JY5L 4PY7B 3X13B 4FFZA 1UATA 4N2LA 4ZSOA 2J8UA 4I2XA 3HN8A 1A5FL 1SDYA 4WGKA 3JUYA 5AKTA 5I0WA 1D5IH 2K9UA 4QOKD 4DPBX 1CR9H 1W72A 2H6PA 2GJZA 3GLEA 4ISVA 3FB7A 2ZCLH 4J3OC 5AKSA 1IBBA 5E2VH 3RVUD 5AG8A 4G5AA 1PDKB 2I5YL 2EXSA 2KLSA 1BZQK 2YWYA 3SYOA 2EYRB 3CSYB 1Y6MR 2WLHA 4N2EA 1Z1WA 4PM1A 1MI5D 1XT5A 3N41B 2F7QA 4OVUA 5KVFE 2Q10A 5DJXB 3HB3C 4IU3A 1HINH 4QYOA 5IMMA 3CFIC 4A55A 2YMOA 5A2LH 1U8CB 1QVOA 1FH5H 4AQAA 3VVWA 5D93B 2ZNWA 4EEEA 1HZHH 5ADOH 3BAYA 5DJ6B 5E9DE 3PWJA 4G1MB 5I6NA 3KPRA 1QZ1A 1KBKA 1P4IL 1ACYH 4NQXA 2VC2B 1ET8A 4WTZG 4FTVE 2YQGA 4PJAE 4NZRH 3VMNA 2QPEB 4L4VA 3LZRA 2PYEB 3GRWH 4WHTB 1EA9C 4UI2A 3DV4B 2QJDA 4X7FC 1UUSA 2BHZA 3ARBC 3P11H 1JFHA 3CZEA 4R7NA 4DKFH 3VDBA 1FVDA 2VDOL 2HPOA 1J18A 1M6OB 1S9VB 3DYPA 3TWCH 4ELKA 4ZMLA 5L6YH 2BHUA 1WZ1H 1MLCA 4X5XA 4A63A 4DUVA 4ENZA 4IU2A 4EAEA 5IHWA 4NPJA 4UT9H 4CA4A 4LARH 5D7EA 5FYLH 4U2YA 1N0XL 2QV4A 3S9DB 1T03L 1OTUD 1KYAA 4KAQL 1JZEA 5E9DD 1NIDA 3HJ0A 3O41B 3RVTC 2D7OA 1T7XA 1KBVA 3FTGA 1QEXA 4XCFL 2VMCA 3ZYIA 5GZOC 1FVEA 3QEQE 2CG9X 5FGCB 1DQMH 1U8QA 4J8RB 1D6VL 4NQEA 4Q89A 1T2QL 4XXWC 4ZFZA 3RL2A 4FMKA 2MFNA 3MZTA 1KPRA 1R3HB 4HHWA 2CKBB 4KKQA 3MLWL 1KLUA 3FT0A 4QY8B 1DEEA 2D31B 4RIRA 5F9OH 4F2ME 1R5WA 4N6RB 1TZGH 4KKLC 5F9DC 3OF6D 3FOMA 3VUAA 4YSCA 2ZP8A 4LPYA 5ITBH 5TPWH 3QXVA 4MNQE 4P23B 1AY1H 1KIUA 3N1QC 2PUQT 5FKAA 2UY6B 1RJYA 3DX7B 3SQOL 3TYFA 2G5UA 2BVPA 2ZOUA 3EYVA 5AOMA 2ZKHH 5GGVY 5TQ0L 4EVNB 3OGCA 1JVKA 2GIXA 4HGMA 5GGVH 3RLSA 4XPBH 4XNAA 1KMGA 3WI9A 2DIBA 2K0RA 2XU9A 4WWNA 5AW5B 4URTB 1K4DA 3DOIA 4PRPE 3QEQD 4F5CE 3TESA 1AO7B 4M56A 4O2EA 4UQ3A 2AEQL 1YYMH 1N8ZB 1ZRUA 3CFDB 3NCYS 2Y5EA 4G6FB 2HFFB 4HCIA 2X4RA 4L9DA 4M9OA 4MDRA 4PJIE 5BW7C 4LESA 3PP4H 4CU7A 3UTSE 5IROD 5BXFB 3B2PA 1VRSA 4X7SL 4ZFFB 2DQGH 4QT5B 3O8XB 4JS7A 1J8RA 1D9KD 4ODWB 5IFHL 4MNQD 1IGFH 5C2BH 2HZHA 5E1IA 5FCUH 2A4ZA 5K39A 4YSDA 1NH6A 1CS6A 1QW9A 5EEXA 3GK8H 5FUCC 1BAWA 1XF5B 1A2YA 2EEDA 3TT3L 4B50A 3TFKC 4JM2D 4OD2A 1KB5A 3O2DA 4KNSA 2EDQA 4Z6AT 4BSWA 2CWRA 1WG3A 5F3BB 5ESVA 1KTCA 5DFVD 3ZOAA 3MVSA 1TMCB 4X9IA 2X9WA 2JLLA 4JDVB 2CLRB 4JFVA 5EC2B 1M2OA 3DVIA 4FEIA 4GW1B 3ULUF 3T6WA 2WZ6A 1FHNA 5DHVH 2YPLB 4ZMVA 4G7SB 3CSTA 1O9WA 3FT2B 1OWWA 2B5IC 1A66A 1E4KA 1G43A 1IMHC 2AP2A 4LO9A 3FT1A 4JG1H 3RGHA 2XWTA 4N0FB 1FFOB 2OXHB 1Q72L 1OGTA 3ARDC 3L3JA 4OCYH 5I1KL 2GCYA 3LQZB 5DEZA 2BSCA 1C1EL 1ZHKB 1NC4A 2X9ZA 2ED7A 2RBLA 3EDDA 4UQ9A 5FYLE 4Y2NA 4KGJA 1VF5C 4UAOC 8FABA 5HPMB 1CD1A 4QOKB 5F88B 4DUWA 1TFPA 2WLIB 3TCLB 4A37A 4LLVB 1L7IH 1G9NC 4HSAC 3SJVE 1OW0A 4H1LB 4DEUA 4PP2A 1MI5B 4AQEA 2VW7A 1AIFB 1G87A 3QNZB 3U6XS 3TEZA 5DZLA 3X1BA 4E9WA 5CJ5A 5ELIA 2BZDA 4FLRA 2CIKB 2OMZA 2FATH 1HHKB 5LBSL 1QR1B 2APFA 4MKTA 4GLRI 1WP6A 4QHUB 3QFDB 4IRJD 3TM6A 3ZMEA 3K6OA 5ABDE 2J5WA 1OY3B 3BWUF 3WENA 2BS71 3D0VB 3LV3B 4JHWL 1F45A 1DQJB 3AVEA 3O3AB 3T2NH 3U48A 5K9KA 1U3ZA 5FYLD 1QX1A 4XNYL 4QDGA 1E50A 1TKWB 1W0VB 4M93B 1K6QL 1J9QA 3EGSA 3LNGA 1QEWA 2ID5A 2NUPB 3EYUH 4R8WH 3U0WH 3CDGB 1FL6A 1QUPA 3WKML 3SJVD 1BSIA 1HXYA 4QHLA 4P46A 5E94B 2VZVA 3DBSA 2VDOB 3RPIA 4Z7VF 4G80A 2E56A 5DC2A 4Y1AA 2R0ZH 3GSXB 1I3RA 3IPBA 4PWJA 2BSRA 1QUNB 4Z7NE 2RAMA 1LHZA 4IHOA 3HC2A 4RDQF 4M5TA 4U3HA 4F7MA 2XQYG 4DP9X 2XWZA 1FV1A 1JHLL 3ZHDA 4BV1A 3KHQA 4JM4H 3M17A 5J12B 5MENA 1MAMH 5D2LA 3TFKD 3BFQG 2IJ0C 5C0ND 4G6KL 4YHML 5DVKA 1EAOA 4X7CC 5KBPA 1LEKB 3M1BB 1PZUB 4XN4A 3QO1A 1MIEH 4Z77A 2PETA 1YN6B 4L5FL 2K3HA 2WUCH 5I73B 4KKZA 1XAKA 2ERJB 1O0VA 1QLRA 3ZE1E 2WXGA 5LN8A 4NOBA 4EKXA 1FRGH 4UINL 3RTLA 4PLNC 5M95B 2P8LB 2OYLA 1KCUH 2A0LC 4YHKL 4AZ8B 3QQDA 1QOKA 3SY6A 4AIZA 1BQHG 5DC9B 1CPUA 1NCNA 3VAEA 4HX1A 3WDHA 4UILL 4XNXL 5IQ7L 4NBZB 3FN9A 3INUL 1J8KA 4HJ0C 5C9KA 4K71B 3ATDA 1MCWM 3SPVB 1MHEB 3N9GL 3B83A 5AOLA 5EV7A 3BH8B 1CIDA 3U4AA 1HX0A 1WFTA 5IB4B 1GTNA 4LHUG 3QEQB 2ATPA 3VWKD 4PW9A 1I1FB 2WXOA 4L29A 5DUML 5HJDA 1AGFB 1JRHI 1BF8A 2H32A 4FNUA 3C8HA 5F9JA 5I8KH 4OGYH 4F2MB 4FL4C 3N3EA 3WJJA 1G9NL 4JO2H 2F68X 1D9KB 3FS9A 4MNQB 3QG6A 2Z31D 4MMXA 2GITA 1RLWA 5GRXG 2TSBA 1T0OA 1G7QA 4UF7C 2UXVA 2B8OT 3HB3B 3RURA 2ICWB 3JWNC 4JAMA 3V5HB 4UM9A 2XCMC 3VFUA 4O2FA 4JM2B 4X6BB 3UC0L 3V4VH 2CO3A 1K4CB 3ZKXC 3CPLB 2EUXA 1MELA 1WEJH 3WHXA 1H8LA 3FU0A 1FL5B 3QDJE 5T3XH 3KZ8A 3FUHA 1IIIA 1CLOL 4QRBA 3UAEA 1F18A 3WTSA 1MCWW 2VNCA 4NEHB 5B38G 3GLDA 3H42L 1QSEE 3PQYA 4PJIB 4QMEA 5DJDB 3IDNB 1PD1A 1CL7L 1RZQA 5L8JB 5IW1B 2BMKB 4IIZA 3INOA 3HI5H 1NIFA 2SODB 3LSOA 5FV1L 3IVKB 2OX5A 3B3BA 5IBUB 2W92A 1NAMH 3FO9B 1HCYA 5FDWA 1GW6A 3WY2A 3BT2L 5E5UB 3EKCA 1JZ3A 3QHZH 4ONFL 5JZ7C 2GFBB 4NKOA 1WZAA 4NENB 4ONGH 4QHMA 1MFCL 2BPBA 2H5UA 3QBTB 1E9OA 4ZPVA 4PP1D 4PREB 3ZKND 1R0AH 1T1XB 3DURB 5I1JH 5DA4A 3M1OA 2BS9A 4CW1B 3QUXD 2WIIB 1TLMA 3II1A 1RD6A 3EDJA 1FLTX 4LF3A 4ABWA 3BPNC 5HDBE 2BNRA 2XVBA 3ML8A 1DUYB 1MCBA 2WXLA 3DIFA 4X8GA 5T5FL 1QSED 3T8XB 3UO1H 1QRNA 3E38A 2XZAH 2X9YA 2G9HB 4A2DA 2I9LA 4FKHA 2FBOJ 1MCOH 4J5VA 4F91B 5GSRB 1JZHA 3W11C 4XXDB 1A9BB 4JKWA 3R1GH 2WLLA 4NNYB 2CRIA 4JZJA 4PJ9D 3DO7A 4X4YB 3KJ6L 4K3EL 2G5RA 2W9EH 4IRJB 1CICD 2A0LD 5C0RL 2OLDA 4GPVA 3C08L 4JG0H 3OKYA 3PNRB 4OCRH 3ZT5A 4RESB 2RCSL 4X6FA 1Q0YH 4R7LA 4JN2A 3TV3H 3IDJB 4HGWA 3OLGA 4XX5A 2JQAA 4HJ0D 2IQAA 3NRPA 5G4MA 3LRGA 4IBVA 1YEHL 3PHSA 4D8OA 3B9KC 4PGEA 5JW5A 3QRGH 5IVNA 1X44A 4UBDD 4GKNA 2FSDA 1U91A 3FH5A 3MRFB 1TNNA 2P1YA 4M6NH 3SJVB 3C09C 5DJCA 4BZ1H 1P4LB 2BERA 2WD0A 4JKPH 4MD5A 5D6DA 4MJ5B 3SE6A 3ZR5A 1KV3A 1AJ7H 4OLVH 2Y7NA 3NTCL 4W9EC 3LKPA 1T5XB 1U8IB 2GBUA 5TF0A 2WZ0A 4N85A 2YSTA 4HS3A 1QWUA 3QORA 3KL3A 4TUJA 2VXSH 1NKRA 3V0JA 3RGVD 2Y7MA 4GP8B 3ZDWA 3IMBA 2IH3A 5IBLC 1NOAA 3EYQC 1AGDB 3EF4A 4OTXL 5HVFB 2A9BA 5D72H 3D34A 1KIQA 1FNGB 5ANME 2EDBA 1SHWA 4P07A 3E3QE 4TUKL 2ZOKB 2G0LA 3NJLA 4CSZA 5LQBH 4X7TB 2IH8A 3CFEB 5FOJA 3HA0A 3I6GB 4KKAC 3FSOA 4HEMA 1COBA 1KGUA 1KXTB 1TTRA 3PWVA 1SQ2N 3FOLA 3QYCA 1T4KB 3D5OF 3WEXA 2NTFA 5T3XE 4IGBA 5EOTB 3GM0A 3PCYA 1ZKAA 3BFWA 4QXGL 3K0WA 4QHKJ 4YHNB 1AR2A 1MFDL 1OGSA 2FWLB 2Q8BL 4QO1A 3SE9H 2B5IB 3BAIA 5JMOC 2YEZA 1R46A 1L0QA 1R75A 1UM5H 3CZUB 4GEJA 3SKJL 2YAFA 3FU6A 1UEMA 1N19A 3UPRB 4FQJH 4QRUA 2APWA 3ATAA 5FGRA 1RK7A 3UGEA 3ZE0E 1KPVB 4HJSA 2WQXA 4M5YL 4R90L 1M71A 1YPZA 2KT6A 1CJYA 4K8RH 4IJ3C 4P4RB 7TAAA 3VWKB 4ZYKB 2ROXA 4WZ9A 1A6ZB 2CJUH 3DMMC 3VXSE 5J7CC 2BVTA 4FNPA 1FGVL 1KYOJ 1S2EA 2YD8A 5FK9B 3RFZC 2X09A 4UQIM 5T5NG 4JY6A 4XOCA 5T3XD 2QTVA 4HUXA 3ZE1B 3OVUB 4NO3A 4P2RE 4J3VA 1V7NH 4OUUB 3STLB 4ZQKB 2WN3A 3CHQA 4FQ2H 2HVJA 2Z31B 2AJUL 3H7BA 3W11D 3BSHA 2ROYA 5CEXB 2GSIA 2R1XA 3EGXB 5T3ZL 1KDJA 2VR5A 1CWVA 2IDQA 2Y6SC 1NDGA 2DQHL 5FX3A 2BSEA 5IW3A 2L0DA 2O26U 1OCCB 1M7IB 2Y3NA 2H2SD 3VRIB 5IB3B 1Z0MA 1LEIA 4LHUD 1U3JA 3MRPA 1G4RA 2FRGP 2ZUTA 3S97C 1GOHA 5AB0A 1F3RB 2CRMA 5E8NA 2R0KL 2VXVL 1FG9C 5F72S 3IMUA 4MCYB 5FB8A 3LKRA 2VXUL 2EADA 3QAZB 5E56A 2BZ7A 2A9MH 2LW3A 2XFXA 4E9YA 1YNKL 2EH7H 4LGSB 4B9ZA 3MLZL 2V9TA 4YDVA 4LIQH 4P2RD 4X6CF 2F5AL 2FBJL 2WYTA 3LZQA 3QJQB 3HAEA 3MX0B 5DFWH 1T5WB 4GAJH 2P9RA 4ATTA 1QI5A 3I75A 5C0AE 1A7BA 1MW0A 2CXKA 2DLTA 5HGDB 5CBEA 3TP4A 5D7IE 1HYRC 1DEDA 3A3YB 3UEZA 2HFGL 2OTWA 3FB6B 1FP5A 2BY1A 1GGBL 2IG2H 4G9FA 1BP3B 3LAFA 4YSRA 1JXFA 1SF5A 1G7IB 4CBPA 3C5SA 3PJSA 3L3GA 2YD3A 4KXZI 1A65A 5C1MB 3BXNB 4GO6B 5DUPH 4B41A 2EO1A 2IQ9L 3KYMA 3P9MB 5I17A 4CVXB 3RIAF 3VQ1C 2KDYA 5G5DA 2ENYA 4DGIH 4PJXA 3BIKB 5HYFA 4Z5RA 1JYXA 3RWIA 1MCQA 4HKBB 4KY1H 4CADB 1Q9LB 2X4QA 5EO0B 1YA5A 1RLBA 3E2HB 4X80L 2DQ6A 3L7EA 4PJ9B 4WW2A 4CMMA 1CF8L 4XMTA 3ZL1A 3DRTB 4LCCA 2Q7YA 2Y7OA 5C0AD 1CICB 3GMPA 4P48A 3RY6C 3RQ3A 4NQUA 3MXWL 1U21A 4MQ7A 5CLTA 1MRCL 5GHWL 4RFOH 1ZLWK 1UQSA 3GT6A 4JM0A 5CCGE 2JELH 2V3FA 4Y5YA 2FBRA 5DLLA 3KPQB 4BELD 2CGRH 3HN5A 1L9PA 4OGAC 1MFAH 4F92B 2J88H 3VA6A 5HDBB 2FYVA 2NY7H 1I9RL 3TF4A 1T6WA 5E6ZA 4MNGB 5TDOB 4I0PC 3S5YA 4HG4K 4XO9A 2ZCHH 1NBZB 4FL4B 2OZ4A 4JO1H 1RFDL 5CBAA 4C54A 2B3RA 1XGTA 1GA2A 2O1AA 5CD3B 2VO8A 2A83A 3RGVB 2C3GA 2ZYSA 2JXMB 2W9DL 2P24B 1KXVA 2MQ0A 1TZIA 3ZTDC 1Q9WA 4M02A 4L8BA 2WQUA 4K2UL 1JUFB 4AQ8A 3BVDB 1N2RA 3M1CA 2PW1A 4JJOA 5BO1L 5BZXA 1S7UA 3T04D 3RJDA 1L9TA 3R06B 1ILSA 2FZ3B 1AP2A 1LWHA 1ETZA 5L8LB 1DJIA 5IV2B 4KZDH 4FHBD 4GS7C 3QQ4A 3QT2A 5EN2B 1H19A 4K8RD 5GGRA 4UV4H 1FO0L 3QXAA 3A6CL 4LP8A 2HSIA 4JHZA 1IE4A 1YO4A 4PJGE 4DERA 1PJ9A 1DQQA 1KV7A 5F6IC 4IDJH 3GMQA 3QZLA 4HJ1A 1H3TA 1IT9L 4OF3A 1QNIA 1DVXA 4JRXE 4LIQE 2BP3A 3U2IA 5CZVL 2O6DA 3WKYA 1YHPA 5SWZE 4QNPE 1AGEB 5C3LD 5GS2D 4UDTA 2I60H 3V2AR 1MJJB 3OR6A 4LCUB 5ANMB 1QYGL 2IDSA 3N2JA 2W94A 1AACA 2R1YB 2A9NL 3KHOA 4WK2B 3BUPA 1XH1A 1S7XB 4O02A 3CDFA 1MFMA 1QABA 5CGMA 2RFXB 2VRAA 5JPNC 4ZAKC 1NMCB 1DDTA 3F05A 4FQXA 1FZOA 1O9VA 4WHYG 4WWKA 5AZ2L 1A22B 2R2HB 3EBGA 4OV5B 3QNXA 2AVFA 2VLLB 1D5XA 4GRMB 3ME0A 5GXBB 3MROB 4OIBA 1BIHA 1TEYA 2KL6A 3F7VA 2BCKA 4NJAH 1U33A 1J0IA 5EH1A 1JXGA 1OSEA 1BQHB 5AZUA 4X8JB 3NJKA 5LG1A 3F64A 4BCZA 1KFGA 2VW4A 4S1QL 4JRXD 3MOAH 3EBAA 5SWZD 1P84K 4HIQA 2APSA 4N2AA 2FDBP 3QW9A 5E6IA 2EIEA 1ZTXE 2V7HA 5IR1B 3BVVA 3ZE0B 1J86A 3B1TA 1PAMA 2YAPA 4LHUB 3DX8B 1YEIH 5C07A 1NEPA 5FDYA 1C12A 1AD9B 1WCBB 3JV4B 4WK4B 3PWLA 4DEPC 4NQVA 1JE6A 4OCXL 2WC7A 1B4JL 2A4EA 2EDJA 1JCKA 3F01A 3GZOA 4RFNB 3FTZA 2CO7B 2D03H 5EUKB 1IVLA 2VIRB 1T89C 2AERT 2XKNA 3BD5A 1UCTA 3MV7E 4A7GA 4OSUH 2NW3B 1CFMA 3G3LA 4P2RB 2XT1B 4NZJA 3C09B 1JXKA 5CILL 5I75C 3TT1H 4P5TD 1TVHA 3MBEA 1F4YH 1DVUA 3BDYH 2AK4E 2EXTA 5EC1B 4MJIE 1CD0A 5JR1H 1CO1A 3SYPA 4WFFD 4AQZA 1UM4H 3QEHB 3CZFA 1YECL 4G6MH 4PJ7E 4HPHA 1RJLA 1U36A 3MCG1 1UA6L 2AQQA 5F9WB 4GG6A 1NIEA 1KBPA 2JJWA 4NZTH 2L8AA 5D55A 4C58B 1L0PA 1IC4L 1HHHB 2Z65C 1ZXKA 4X98B 4UOJA 1FPTL 1Q9KA 4KK6C 2PKDA 1JZGA 1LMKA 4NFDA 4HUWA 4X6EA 4L8DB 5B38B 2ADJA 5D1ZI 5FM8A 1TT6A 3C5ZD 3CIAA 4TSCL 5DZOA 1UM6H 3GSOB 4ZTPH 3RWDB 1OPGL 5I1LB 1CBVH 1KIPA 5B39G 3MV7D 3FPXA 3PABA 2JJVA 5K33A 1AQKH 4QRRA 3QXWA 4Y2LA 1DBKL 2C9UA 2C9XA 5JNYB 3S36X 2FD6H 3NK4A 2AK4D 2GUYA 5E4IA 1A9EA 4MJID 4BKTC 3IDUA 5D7IB 3T77B 2P5EE 3BI9X 4RZCA 4OJFL 5FIEA 3CFCH 2J71A 2H8PA 2VRKA 4K3DL 5JHDE 5KYUA 3HZMB 2F54E 1YNLL 5ICZA 3UEQA 2P5PA 3KR3H 3H6JA 3PF2A 4M61B 1ZEAH 4XBPA 1DBJH 1OTSC 2I26N 4I9XA 4IJ3B 4QRSA 2R0LL 2YZ8A 2OR9L 1LWJA 5F9AC 2R4RL 4IRZA 3RTQA 2AQNA 4MHHG 4EI5A 3TA4D 2COVD 3EGDA 4NN7C 4Y7OC 1WQVT 1I7TA 1L9OA 2BC4A 4KKCC 2BNQA 5CCHE 3V0VA 4H26A 2B14A 2P5ED 4FNRA 1I85C 2DH2A 4B9YA 5CAYB 5EIIA 2OR8A 5AVXB 2CU9A 3OQRA 4ZO8A 5JHDD 4IKJA 3HNVH 3DX0A 1HSBA 3C2SA 5MEPA 4OZGA 2EIKB 2OV0A 1CXEA 3WGVB 5IMKB 2WBJD 1WBZA 2KZKA 1E43A 1HE7A 4JFYA 4HLJA 2KLRA 4UDUB 3MOBL 1HDMA 4X7DC 3G5YA 3LZPA 4HZLB 4FQ1L 1GJWA 4JGJA 5CINL 1BWMA 1TJIL 1INQB 2ZOWA 1TNMA 3GJEA 5TDPA 6TAAA 1C8PA 2LLNA 2DBLL 1FO0B 1JD7A 5KTEL 4APXB 4AM0Q 2CK2A 3WMQA 2OYPA 2YPKB 2X0VA 2FWOA 3VD7A 5I1HH 4XMLL 1QFOA 1N5AB 4YDZA 2QZ5A 5HYQA 4FZEH 2EVJA 3SGKC 1A4KA 4FFWD 3QJZA 4DKEH 2WOBA 3HZKB 4J2QA 3TZVA 4YNYA 3OMNB 5FUZH 3PU7A 3VI3A 2NQCA 5EF0A 1C08B 1IC0A 2ZT9C 3K6SA 4OB5L 4X9BA 2IPKA 4FGMA 2WZAA 4O00A 4N4YB 1PG7H