2XXKA

Siap complex
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPDAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siap Complex
rcsb
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
molecule tags Transport protein
source organism Haemophilus influenzae
total genus 124
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xxkA00
4OVRA 4P1LA 4UABA 4MNIA 4O8MA 4N17A 4PAIA 4NN3A 4PDDA 4MNCA 5I5PA 4PAFA 2CEXA 4DI4B 4OANA 2ZZWA 4N8YA 5IGAA 4YZZA 2WX9A 4OVSA 2XWOA 3FXBA 2CEYA 2ZZXA 4NQ8A 4MX6A 4N91A 5IM2A 2V4CA 3B50A 4YICA 4PETA 4NG7A 4MIJA 4O94A 4NX1A 4PBQA 4PF6A 4MHFA 5IZZA 4P1EA 4X8RA 2XWKA 4N6KA 4N4UA 4PFIA 5CM6A 2XWVA 4P47A 4XF5A 4PGPA 4P9KA 4DI3D 4N15A 4PF8A 4PCDA 4LN5A 2HPGA 4PFRA 4MMPA 2ZZVA 4MNPA 2VPOA 2XA5A 5LTCA 4OVPA 2XWIA 4NHBA 4OA4A 2WYPA 4NGUA 2VPNA 2XXKA 4XFEA 4NAPA 4MAGA 3GYYA 2HZLA 4PE3A 4XEQA 4P56A 4PFBA 4OVQA 2PFZA 4PBHA 4PAKA 4MEVA 4X04A 4P3LA 4PDHA 3U65A 4PC9A 2HZKA 4P8BA 4MCOA 2WYKA 2PFYA 5I7IA 4NF0A 4OVTA 4O7MA 4PGNA 4N6DA 4N8GA
chains in the Genus database with same CATH superfamily
2DYXA 4RNSA 1OLCA 1UTBB 3K2DA 2Q8MA 2VT5A 2OWSA 3FASA 2VGQA 1N3XA 3KJ7A 4NTLA 4LVQA 5EQ8A 3IOWA 4DE8A 3CG1A 3SERA 1FPJA 1NH7A 5EYFA 3MAMA 5DW8A 5IGAA 3CSBA 3FXQA 4N13A 3GBBA 4RK9A 2WX9A 4WKMA 4FJPA 1FPBA 5AA2B 3I3VA 3C9HA 3RLFE 3ILTB 2QMXA 3B50A 1IITA 1B5JA 3O29A 3DELB 5CMCA 1Z7NE 2O68A 3K6XA 4YB6A 5JK4A 3B8BA 4H45A 4LUBA 4GQOA 3SZPA 1D9QA 5ITPA 3HHGA 4OMBA 4WEPA 3K6UA 4ZEDA 1OLAA 4FORA 5ET5A 1DSNA 3MSTA 4E0WA 1J1NA 3E78A 3Q27A 1LB8A 1FPIA 2O84X 2VHAA 4XEQA 5H8HA 2O51A 2RC9A 3PMXA 3MUQA 3V83A 3HPIA 1FTMA 2DQVA 3PU5A 2FA7A 5I2KA 3FVGA 1MXZA 3TELA 4GWUA 3FVKA 3C33A 5IZ3B 1HSEA 3ECRA 3KG2A 1QW0A 1N7WA 2NWJA 3K4UA 3FV2A 4GX6A 4M1VA 3L6HA 4PQJA 1A7LA 3MJNA 1FJ9A 2CZLA 1LAFE 1JEVA 2V3QA 3SEUA 3TYHA 1BLFA 2QL3A 2A5TA 4Q5TA 1R9LA 1DMBA 5I84A 4HE0A 3SETA 2UVGA 1JVXA 1MPBA 5H8QA 5HBCA 4ZDMA 1N84A 2F97A 2I0BA 3FV1A 2A5SA 3EN3A 3S9NC 2GH9A 4BDMA 2BJJX 3H3GA 4PF6A 3C32A 3FJMA 4JWYA 4Q8RA 4OXVA 1RYXA 2OBGA 1PB9A 5F1QA 3EHSA 1AIVA 4QFPA 1MRPA 4G77A 2XA5A 4OVPA 1YPNA 5ICTA 1Y3PA 1DTGA 5FBPA 4RY1A 4NAPA 2HQ0A 2ZYOA 3KN3A 4RK2A 1LSTA 4MJOA 1B0LA 1QJMA 1MXUA 1N0TA 4PDHA 1VDWA 4G68C 3RT6B 4TLMB 5IKBA 4DCYA 1B9JA 4NF0A 1FW0A 1NUZA 1A99A 5ICQA 4KD5A 3W9VA 3OENA 2GHBA 3RUMA 1TT1A 2ZYMA 2P1SA 3DLNA 5EQAA 3IORA 3LUZA 2Y5KA 5I57B 2CEXA 4QXDA 2PYYA 4IO2A 3V89B 3KN8A 4FECA 2YLNA 2NUVA 4G8MA 1DTZA 5AA4B 1NV3A 1YYZA 3QK6A 3KGCA 4JXIA 3LSXA 4OEUA 1CE2A 1OQHA 4ESWA 5LDZA 2Q9TA 4YKPA 1LLSA 3O6HA 5EYGA 3IAZA 4FATA 3CVGA 3G3HA 3CG3A 2H9BA 2AYSA 1IXCA 1M5DA 4XKNA 2ZNSA 3TQWA 4C1TA 3HN0A 4ND9A 1F9BA 2ONRA 2HPGA 1QKBA 5I3SA 2XWIA 1FTKA 3B7DA 4U21A 4OZ9A 1H44A 1TXFA 3AXFA 2QS4A 1NUYA 1FBHA 3IFAA 1RDYA 4YKJA 3RTFB 5I59B 3KBRA 4P8BA 2THIA 2L5VA 2G29A 3RY3A 1AOVA 4NEDA 2V3UA 1SPIA 5EHSA 5JEIA 2OJTA 2CZIA 2ANJA 3N6UA 1SVXB 2Q88A 2RF1A 3VVDA 2X7PA 1Y20A 3VLVA 3WAEA 3DP6A 5TP9B 3IX1A 1B0HA 3VXBA 3RNNA 1O7TA 2GHAA 4ZE9A 4KQPA 2AIXA 4E0XA 5DT6A 2FIEA 1PC3A 2YPNA 3RN8A 3T66A 4NQ8A 4X48A 3K1PA 4NF5B 4IO4A 5IAIA 2R6GE 3IOUA 4GLIA 1LCFA 3TDJA 1Y3NA 3DP4A 2KR0A 3MZ9A 4QRZA 3MVWA 4F3SA 2OK2A 4YMAA 1D9YA 1IZ1A 4NF4B 4KXPA 4ZZAA 4ZEBA 3WAFA 3V5AA 4PFRA 3TFLA 4OA4A 2UVHA 4IO7A 1QKAA 4LP2B 2HCAA 3IJXB 3PD8A 5CMBA 3PUWE 4PBHA 3T93B 2UXAA 3FGSA 3T9XB 4EDPA 1PEBA 1MXWA 2ZXTA 3Q28A 5L9SA 4R6YA 5F24A 1MPDA 1MM7A 2H98A 1NKXA 3MVZA 1B32A 2RKMA 4AQ4A 3IB1A 4MH5A 4GL8A 2HAUA 4ZEFA 1OIBA 2Z8EA 4F1UA 2XXXA 2HHMA 3Q26A 4N17A 5TPAB 5BUUA 2OZZA 3MVXA 3A29A 3MPLA 5DTBA 1QUIA 2QMWA 4F22A 4H8IA 4GRKA 3O66A 2X7QA 2XXVA 3KOSA 1JQFA 3UORA 1DBZA 1VR5A 3MQ9A 1DPEA 2Y7IA 1YXIA 4QBAA 1MG1A 2UVJA 2WBBA 2X26A 1I69A 3TKDA 3C34A 4Z7EA 2XX8A 2D5WA 3IK6B 5M2VA 1GVCA 1QVSA 4HTGA 4NF8A 2RCAA 2OX3A 4BDNA 4F3GA 3R26A 3OO8A 3QAXA 4F1VA 4F2QA 1POY1 3GBAA 4PGPA 4O3CA 1FPEA 1GGGA 1WODA 4LZ5A 1N3WA 1QGXA 2ZNUA 3DP8A 4GL0A 3LUYA 2QS1A 5LTCA 1FBPA 1A54A 3LSWA 4TQUQ 1GR2A 2NVUB 1NV6A 4G8NA 5K2XA 4MAGA 4IGTA 4PFBA 1A55A 4QSEA 5KDTB 1EYJA 1URGA 1B5HA 4R73A 2F5XA 3BFTA 1Y1MA 3BBRA 3SEWA 1AWBA 3PMWA 4OEVA 3QIMA 1S9TA 2RINA 3K1MA 1SBPA 2B4MA 1JW4A 3TMGA 4NN3A 4KYSA 3SKPA 1RDXA 4HCWA 3G3FA 5CMKA 3C4MA 4NWDA 4PAFA 5BWJA 1BK4A 4GWXA 1S50A 1N76A 1KA1A 4YZZA 5F7VA 2ABHA 2DVZA 2GRVA 4PFTA 4RPNA 3ODBA 5IM2A 1PDAA 3HSTA 1Y4CA 4PP0A 4NWCA 1IMAA 4OWDA 1H43A 4GWOA 1IMDA 2O6AA 4I3YA 5ET6A 3KC0A 3OOAA 5IZZA 4N81A 1OVBA 3TQLA 1FPDA 4N4UA 2PVUA 4XF5A 2KLFA 3M3KA 1MM6A 1MXVA 2F34A 4YKIA 3O28A 2PMSA 4GVOA 4IO3A 5B7DA 2QRYA 2XXYA 1M5BA 1CB6A 1LBWA 3CR9A 1B52A 1ATGA 3PPPA 3TZAA 3MP6A 3JV9A 1SW5A 5H8SA 2F36A 1USYH 1IMBA 3OELA 5I57A 3MZ1A 3S9MC 5I2NB 1B51A 1NNPA 2F6GA 3FXRA 3FIRA 4XTCQ 4KR5A 3TAJA 3HO7A 3EHTA 3UA8A 1O63A 2I3WA 4MCOA 4EXLA 4F29A 3VVEA 5I7IA 3EHUA 1I6QA 4O3AA 1FSAA 1K9YA 1QUJA 3QUJA 3K1NA 4O7MA 1LAHE 4OVRA 4JDFA 1ZMGA 4OENA 5AA2D 4PFWA 4ZZEA 4HS7A 4XIGQ 3PD9A 3PTYA 4LZ7A 4MLVA 3PPNA 4PDDA 5I5PA 3RPLB 1MQJA 3FD3A 2I49A 3I6VA 3FZVA 5J1DA 2ALUA 4EQBA 1H3DA 2H25A 3TCHA 2H5YA 2WKYA 1UTHA 3MWBA 4TLLB 5HPQA 1LAXA 3CSGA 2P3VA 3F11A 4O3BA 3T9VA 4H67A 5I56B 4UACA 5DYHA 3SEXA 1NV5A 1B46A 5I59A 4P1EA 2B4LA 3N94A 4GBWA 4PFIA 3S2VA 1NH8A 3UGWA 1IUDA 1YAEA 3OEKA 3IO6A 2VOZA 2QS3A 4LATA 2RC8A 3OO6A 1TWYA 3DM0A 1FTAA 2WYPA 1QULA 2VPNA 1BKAA 5H8FA 4XFEA 2F3BA 4O7IA 3GYYA 3D4CA 3OD7A 4JWXA 2QJEA 1INPA 4I3EA 2PT2A 1MXXA 2P3NA 2DE3A 4PC9A 1SQYA 1B4ZA 1MPCA 5ISUA 3CFZA 4P11A 3KSXA 4HXVA 1Q35A 4NF5A 3KJTA 3KEIA 1B1XA 3MVYA 4MBPA 1HSJA 2LAOA 2REGA 1SI0A 3KSJA 4YKKA 3A09A 3SEVA 1ZU0A 4H0WA 4LONB 3Q25A 5CBRA 3TCFA 4EQ9A 4KPTA 1URDA 3N26A 1MS7A 1MQHA 5EQ9A 2F7AA 4G4PA 3OSQA 1G0HA 2FIXA 4RJZA 4KHZE 3RGYA 4O94A 4PBQA 2UVIA 4MHFA 3G7WA 4H1XA 4X8RA 2XWKA 1RYOA 5ESYA 3IB0A 4GXAA 4GX4A 1BIYA 4GWSA 5I58A 4N15A 4PF8A 2DWHA 3U1OA 1Q1KA 4YAHX 2V93A 1IXIA 2DXYA 4NHBA 1MY0A 5TPAA 3FVNA 3U72A 3CI8A 4JBZA 4PE5B 1SYHA 2F3DA 1B3HA 4U2RA 2XXWA 4NMYA 4F18A 1EZPA 2PFYA 3LBSA 2OWTA 3BFUA 2XXTA 1FRPA 4YB5A 4N8GA 3H6TA 4EQ7A 2CMOA 1B5IA 3U92A 1US4A 3T9UA 5I2KB 5JTYB 2VP1A 2DXRA 1BP5A 5DVJA 3C36A 4MNCA 1FTOA 1XS5A 1TFAA 4U1ZA 1IIWA 2Y84A 3TODA 4JWOA 3EKIA 3P7IA 3FXUA 1O64A 4IY5A 2P2AA 5DEXA 1SW1A 4PFUA 4G68A 5J16A 4F2OA 4MLQA 2G93A 1LBXA 1M5CA 1WVJA 4KCDA 3KC1A 2A5TB 4GWYA 3S4UA 3K00A 5IZ1A 5B70A 4LQ5A 4OFLA 1ELJA 3FVOA 1LBZA 2DWIA 3LV0A 2E0SA 2FVZA 3U93A 1R9QA 4YU0A 2DOJA 4ZEIA 3L6GA 2RCBA 3IR1A 2D21A 4DI3D 1B3GA 2ZYNA 3OO9A 3TTLA 4XKQA 3TTRA 1R6ZA 4JB7A 4H5GA 4NF6B 1ZKBA 2W7YA 2F7CA 1LCTA 4HCYA 1FBFA 3G3JA 2F78A 4H46A 3FUZA 3R6UA 4F1YA 1LBYA 2VD3A 3NOHA 2I4BA 4H5FA 4NE4A 2KQZA 2XD3A 3U8QA 1TFDA 4JVCA 3W15C 1B7HA 3MC2A 3D1RA 1UTBA 1VSOA 3QUFA 4BDQA 1WDNA 3FBPA 1NUXA 1SW2A 4JVIA 4UABA 3E3KA 4F3BA 4P0GA 4HE2A 2XX7A 3IL1B 2R9JA 3OXNA 1B6HA 4XKPA 4QSDA 1P1NA 1D3KA 4QFOA 1FPFA 4QF9A 4BDLA 1EZ9A 5AA2A 2ZZWA 3H6WA 2XXQA 1B3LA 4GIZA 1XVYA 4FAJA 2Y7PA 3CHGA 2O1LA 3TPAA 3H4ZA 1IXGA 2V84A 2V4CA 5I2NA 3QMFA 3VLUA 5EHMA 4M4GA 2PCRA 1US5A 2DWJA 5L8DA 1POTA 3E9XA 1K9ZA 4EXKA 3IFCA 1M5FA 2BJIA 5FTHA 1NUWA 3BIHA 4R72A 4ZE8A 1EH3A 4DIGA 1PB7A 4ZEKA 1PB8A 5DVIA 1LB9A 5AE4A 4LQ2A 4LN5A 4C0RA 1Y9UA 3O6GA 3OO7A 4MNPA 2Q74A 2B65A 3BKIB 4MF3A 2XXIA 1Y4TA 3RPLA 2I4CA 3G3KA 3R7XA 4P56A 4Q0CA 1ZLQA 3ZKLA 3EQ1A 2FBPA 4ELOA 5IZ3A 1JW1A 1B58A 3K6VA 2E1SA 3QYTA 3TEPA 4OERA 2HEUA 4X1BA 3VLWA 3IO4A 2Z8DA 3O97A 4THIA 2QS2A 1ZIUA 1FQAA 4Z0IA 1UIVA 1P1UA 3BIGA 4G2ZA 1LFIA 3IOVA 4OHNA 2FHYA 3JZJA 2JJKA 4G61A 1FBDA 2XXPA 4ZECA 3FJGA 2UYEA 4IGRA 1FPKA 3HCQA 2Z8FA 3SEYA 3MYUA 1P1WA 4DXBA 2XWOA 1IMCA 3S9EA 1DCUA 2HAVA 3FATA 3A3CA 3UP9A 2VD2A 4QHQA 1I6AA 3MPKA 1OVTA 4KCCA 4P47A 1VFDA 3OEMA 4OFOA 1A8FA 2MKZA 3S9LC 4I62A 2WBDA 1EZOA 1NV7A 4MMPA 1EYKA 2WEFA 1D4NA 1MY1A 4FE8A 1N04A 1LEVA 3LSFB 4R9FA 1LBBA 3TTNA 3PGFA 1FQFA 5A5LA 5KCJB 2QVRA 3ZKKA 2O69A 2PFZA 1B40A 3ILUB 4P0IA 2XD2A 4X1DA 1ZJLA 1YTVA 2WYKA 4ELPA 3ZSFA 1XI6A 1IMFA 2QPQA 1VE4A 2XXRA 3TTKA 3KOTA 3MW0A 4R9GA 1FPLA 4MFIA 1P99A 3CFLA 4O8MA 3ROJA 1P1QA 1FTLA 2NOOA 2M8CA 4AB6A 1FTJA 1NV4A 3H6VA 5AA4A 4ELQA 1RDZA 4OVSA 1SI1A 3ISPA 4BDOA 2GQ1A 2ONKE 4OQOA 4FIMA 3W9WA 3D4GA 1GTKA 5TU0A 4QSCA 4OYVA 1L5TA 2IA4A 4PETA 4GD5A 4X9TA 4R75A 3PPQA 4NX1A 4OVJA 3B6TA 4GWZA 1PBPA 4QFNA 1Y1ZA 2CZKA 5CI5A 1HSLA 2UYFA 1B1HA 5FHMA 2Q2AA 4XKRA 4NF8B 3RTWB 5FHOA 3G3GA 4DXCA 2YJPA 4HW8A 1VFEA 2ZNTA 1UIUA 5JTYA 2HXWA 4NGUA 4UA8A 1NFTA 2OCUA 3G3IA 2XXKA 4OESA 1B3EA 2I3VA 3T22A 3VXCA 2I48A 2I6EA 4EF1A 5A5XB 1IEJA 4FBPA 3OMBA 2HZKA 1Z7ME 4OFJA 4OVTA 3T1BA 1JW5A 3VFJA 5ELVA 5H8NB 3LR1A 4C1UA 3IJOB 5TP9A 4ELRA 2DDKA 4ONYA 2QVUA 3O9PA 1IXHA 1NV0A 1MY3A 2XXHA 5KZTA 5L9OA 4NF6A 4PFYA 5FHNA 2FYIA 3E4RA 3HHFA 5ET8A 1FPGA 3M3LA 2R8TA 4YB7A 1USYE 2DS9A 1B3FA 1XOCA 5T3JA 2Q89A 1BTJA 3VDFA 2O7IA 4NF4A 4YICA 4F39A 1DPPA 1JP4A 3FJ7A 4U4XA 4AS5A 3M3FA 2XWVA 4IO6A 2NXOA 1T0KA 4P9KA 3GLBA 4I40A 1LGBC 4R6HA 1FBEA 5LOMA 5DVFA 4K3FA 5EYHA 4GWWA 5L9MA 2ONSA 3LSLA 1QUKA 1B4HA 3RT8A 2XX9A 1NNFA 3K02A 3RPWA 2HZLA 1XVXA 4YMBA 2AL4A 1MY2A 4PAKA 1XT8A 2D3IA 4P3LA 1Y3QA 1NV2A 3QXMA 4RYAA 3RYDA 1ANFA 5ITOA 4FEBA 1AMFA 4R2FA 4I1DA 2AL5A 2R71A 1NV1A 3N5LA 5EQ7A 4H65A 4BDRA 3N6TA 1H76A 4P1LA 2F8DA 4ZS9A 1LAGE 1CNQA 1S7YA 1EYIA 5CRYA 1URSA 1R1NA 4F19A 4RA1A 3THIA 2ESNA 3CRBA 4XXUA 5H8HB 1H45A 1MY4A 1N7XA 3QSLA 1D9VA 5FTIA 3UN6A 3VVFA 3E13X 1IMEA 3T0JA 3C35A 4KYDA 4U22A 4U23A 4F31B 4ESXA 2XXUA 1B2HA 4R6KA 1SDXA 3ZS6A 3PUVE 2HFBA 1UTHB 4GBVA 1KWHA 5CBSA 3HV1A 4BLAA 4KI0E 3MP8A 1DOTA 5ET7A 4IY6A 3U94A 4POWA 1JETA 3H6UA 1XHYA 3PPOA 5K2YA 1SW4A 3O6IA 4JVDA 2DE2A 1LFGA 3RQTA 4Q30B 2VPOA 2XHDA 4IB2A 3OSRA 2Y5LA 1JEUA 5KDTA 4AS4A 3V8XB 5H8QB 3VV5A 4N07A 1RKMA 2OWZA 2QFLA 2ZYKA 4H8JA 3TTMA 4IO5A 3E79A 4JSDA 2F35A 4GOTA 4G8HA 2DWAA 4X04A 3CIJA 5H8FB 1MDP1 2PX1A 4POXA 4H6DA 1A40A 4GFRA 4DDDA 3MP1A 4DXUA 3U65A 2B3FA 1A8EA 2Y7KA 2REJA 1AH5A 3GZGA 4RPOA 2H99A 4EF2A 1ZBMA 1G0IA 1KZ8A 4DZ1A 1OMPA 1MH4A 1MQDA 1Q9DA 4OETA 1KA0A 1YZ0A 4KYEA 1B7ZA 4DI4B 3IB2A 4OANA 2I0CA 3KN7A 4N8YA 3JYRA 1NMUA 2I58A 3Q29A 4LA9A 1EU8A 4OTEA 2IEEA 1DK4A 4KFQA 3PMVA 1MQGA 3PUZE 1SD3A 2ZZXA 2DP8A 1OQGA 4U1OA 5KCJA 3ONMA 2V3TA 4L17A 1B05A 3TUSA 1JVYA 3H7MA 1ZTYA 3K6WA 4EUOA 4FEDA 5CM6A 3B6WA 1FBGA 4R2BA 3PUXE 2GFEA 3CFXA 4PCDA 4WEDA 2ZZVA 4ECFA 3M8UA 4TOZA 3USDA 4R74A 5AA3A 3H03A 5I58B 3EF7A 3H06B 4IR8A 4LZ8A 4PE3A 4OVQA 2H4IA 3A3UA 2F7BA 1LBVA 1IQ7A 2QSXA 3PPRA 3GXAA 1NI9A 3KZGA 4JSOA 3TCGA 3T9HB 4PGNA 2Z22A 4N6DA 2HXRA 4WXJA 2FNCA 4MNIA 3MZBA 1PBQA 4PAIA 2B3BA 4GF8A 3SESA 2Q8JA 3VE1B 4DCXA 5AA1A 1AL3A 3T96B 3HFUA 2DVCA 1P1OA 5I56A 1NNTA 2OLBA 3FXBA 2CEYA 2O1MA 1YCJA 4MX6A 2P0SA 2CZHA 4N91A 5HM4B 2V25A 4I8CA 5DEXB 3O2AA 1FQDA 4G68B 4N6PA 3I5OA 1UQWA 1FQCA 4NG7A 1LBCA 3EPEA 4MIJA 1II5A 4GX3A 5A5XA 1GV8A 3C31A 3K01A 1I6BA 1SYIA 4I9DA 2Z23A 3K0VA 4N6KA 1FQEA 1FCKA 4F3PA 3KFMA 1M5EA 3MBPA 5H8NA 3B6QA 3LC8A 2DSFA 1B7UA 2Q2CA 5CC2A 1FQBA 2DE4A 1XC1A 4QFLA 1JNFA 3UIFA 1FJ6A 3IOTA 3PV0E 1MH3A 4HE1A 1LFHA 2O7UA 2Y7RA 1MQIA 1NNKA 2RC7A 4PTKA 4AB5A 3KBZA 4RXLA 1MDQA 4GXSB 2QVVA 2PBWA 4MEVA 1FBCA 4DLDA 2ZMBA 3SDFA 2Y7WA 3PUYE 4ISUA 2F6PA 4U4SA 1NL5A 5CMMA 2PT1A 1MXYA 4QFKA 3UK4A
chains in the Genus database with same CATH topology
2Q8MA 2DDKA 2VT5A 4F1UA 2HHMA 4N17A 4MNCA 2QVUA 3A29A 5EQ8A 1NV0A 3EKIA 1FPJA 5DW8A 5IGAA 1DBZA 5ET8A 5J16A 1FPGA 1YXIA 2R8TA 2WX9A 5T3JA 1FPBA 1LBXA 4QBAA 2WBBA 3KC1A 4GWYA 3B50A 5IZ1A 4YICA 1JP4A 1LBZA 3LV0A 2OX3A 4AS5A 2FVZA 5JK4A 3B8BA 4H45A 2XWVA 4F1VA 4PGPA 4P9KA 4DI3D 4I40A 1FPEA 3SZPA 1D9QA 1QGXA 1FBEA 5LTCA 1FBPA 5EYHA 4GWWA 5ET5A 1NV6A 3MSTA 4HCYA 3E78A 1FPIA 1FBFA 4MAGA 4H46A 2HZLA 4XEQA 4PFBA 1LBYA 3NOHA 4PAKA 2KQZA 1EYJA 4JVCA 4P3LA 1NV2A 3D1RA 3RYDA 2F5XA 4GWUA 1NV1A 1AWBA 5EQ7A 3FBPA 5IZ3B 1NUXA 4JVIA 4P1LA 4UABA 4HE2A 1CNQA 4GX6A 4M1VA 1EYIA 2B4MA 4NN3A 1RDXA 4F19A 4HCWA 1FJ9A 1FPFA 4PAFA 2V3QA 2ZZWA 1BK4A 4GWXA 1KA1A 4YZZA 2DVZA 1IMEA 4HE0A 3T0JA 3CHGA 5IM2A 2V4CA 3QMFA 1IMAA 1IMDA 2PCRA 4I3YA 4GBVA 5ET6A 3KC0A 4PF6A 1K9ZA 5IZZA 4N81A 3IFCA 2BJIA 1FPDA 5ET7A 4N4UA 1NUWA 3BIHA 4XF5A 4JVDA 4LN5A 2DE2A 4MNPA 2VPOA 2XA5A 4OVPA 1LBWA 2Q74A 2Y5LA 4AS4A 5FBPA 3RPLA 4NAPA 1IMBA 2OWZA 2QFLA 3E79A 4P56A 2FBPA 4MJOA 5IZ3A 4X04A 4PDHA 1VDWA 4MCOA 5I7IA 4NF0A 1NUZA 1FSAA 1K9YA 4O7MA 3U65A 3W9VA 4OVRA 3PTYA 1G0IA 1KZ8A 5EQAA 3BIGA 4PDDA 5I5PA 3LUZA 3RPLB 2FHYA 2Y5KA 1Q9DA 1KA0A 1YZ0A 2JJKA 2CEXA 4DI4B 4OANA 4QXDA 4G61A 1FBDA 4N8YA 1FPKA 5J1DA 3MYUA 1DK4A 1NV3A 2XWOA 1YYZA 2ZZXA 1IMCA 1DCUA 2P3VA 5LDZA 2Q9TA 1NV5A 5EYGA 4P1EA 2B4LA 4GBWA 4PFIA 5CM6A 1FBGA 4P47A 2MKZA 4PCDA 2WBDA 2HPGA 1NV7A 2ZZVA 4MMPA 1EYKA 2WEFA 5I3SA 2XWIA 1FTAA 2WYPA 1LEVA 2VPNA 4XFEA 2F3BA 4O7IA 3GYYA 1NUYA 4IR8A 5A5LA 1FBHA 2QVRA 4PE3A 1INPA 4I3EA 4OVQA 2PFZA 1LBVA 3IFAA 2P3NA 1NI9A 1RDYA 2DE3A 4PC9A 4P8BA 2WYKA 2L5VA 4HXVA 1XI6A 1IMFA 4PGNA 2QPQA 4N6DA 2HXRA 1SPIA 1FPLA 2CZIA 4MNIA 4O8MA 3ROJA 4PAIA 1NV4A 3HFUA 1RDZA 2FIEA 4OVSA 3ISPA 3FXBA 2CEYA 2GQ1A 4NQ8A 4MX6A 4N91A 2CZHA 5EQ9A 3W9WA 1G0HA 2FIXA 2KR0A 4PETA 4NG7A 4MIJA 4O94A 4X9TA 4GX3A 4NX1A 4PBQA 4MHFA 4GWZA 4X8RA 2XWKA 4N6KA 2CZKA 4KXPA 5ESYA 4GX4A 4GWSA 4N15A 4PF8A 4PFRA 2DE4A 4NHBA 1FJ6A 4OA4A 4NGUA 4HE1A 2XXKA 4PTKA 2F3DA 3KBZA 4PBHA 2QVVA 4MEVA 4F18A 1FBCA 4FBPA 2HZKA 5F24A 2PFYA 4OVTA 3T1BA 1FRPA 4N8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVR A;  4P1L A;  4UAB A;  4MNI A;  4O8M A;  4N17 A;  4PAI A;  4NN3 A;  4PDD A;  4MNC A;  5I5P A;  4PAF A;  2CEX A;  4DI4 B;  4OAN A;  2ZZW A;  4N8Y A;  5IGA A;  4YZZ A;  2WX9 A;  4OVS A;  2XWO A;  3FXB A;  2CEY A;  2ZZX A;  4NQ8 A;  4MX6 A;  4N91 A;  5IM2 A;  2V4C A;  3B50 A;  4YIC A;  4PET A;  4NG7 A;  4MIJ A;  4O94 A;  4NX1 A;  4PBQ A;  4PF6 A;  4MHF A;  5IZZ A;  4P1E A;  4X8R A;  2XWK A;  4N6K A;  4N4U A;  4PFI A;  5CM6 A;  2XWV A;  4P47 A;  4XF5 A;  4PGP A;  4P9K A;  4DI3 D;  4N15 A;  4PF8 A;  4PCD A;  4LN5 A;  2HPG A;  4PFR A;  4MMP A;  2ZZV A;  4MNP A;  2VPO A;  2XA5 A;  5LTC A;  4OVP A;  2XWI A;  4NHB A;  4OA4 A;  2WYP A;  4NGU A;  2VPN A;  2XXK A;  4XFE A;  4NAP A;  4MAG A;  3GYY A;  2HZL A;  4PE3 A;  4XEQ A;  4P56 A;  4PFB A;  4OVQ A;  2PFZ A;  4PBH A;  4PAK A;  4MEV A;  4X04 A;  4P3L A;  4PDH A;  3U65 A;  4PC9 A;  2HZK A;  4P8B A;  4MCO A;  2WYK A;  2PFY A;  5I7I A;  4NF0 A;  4OVT A;  4O7M A;  4PGN A;  4N6D A;  4N8G A; 
#chains in the Genus database with same CATH topology
 2DYX A;  4RNS A;  1OLC A;  1UTB B;  3K2D A;  2Q8M A;  2VT5 A;  2OWS A;  3FAS A;  2VGQ A;  1N3X A;  3KJ7 A;  4NTL A;  4LVQ A;  5EQ8 A;  3IOW A;  4DE8 A;  3CG1 A;  3SER A;  1FPJ A;  1NH7 A;  5EYF A;  3MAM A;  5DW8 A;  5IGA A;  3CSB A;  3FXQ A;  4N13 A;  3GBB A;  4RK9 A;  2WX9 A;  4WKM A;  4FJP A;  1FPB A;  5AA2 B;  3I3V A;  3C9H A;  3RLF E;  3ILT B;  2QMX A;  3B50 A;  1IIT A;  1B5J A;  3O29 A;  3DEL B;  5CMC A;  1Z7N E;  2O68 A;  3K6X A;  4YB6 A;  5JK4 A;  3B8B A;  4H45 A;  4LUB A;  4GQO A;  3SZP A;  1D9Q A;  5ITP A;  3HHG A;  4OMB A;  4WEP A;  3K6U A;  4ZED A;  1OLA A;  4FOR A;  5ET5 A;  1DSN A;  3MST A;  4E0W A;  1J1N A;  3E78 A;  3Q27 A;  1LB8 A;  1FPI A;  2O84 X;  2VHA A;  4XEQ A;  5H8H A;  2O51 A;  2RC9 A;  3PMX A;  3MUQ A;  3V83 A;  3HPI A;  1FTM A;  2DQV A;  3PU5 A;  2FA7 A;  5I2K A;  3FVG A;  1MXZ A;  3TEL A;  4GWU A;  3FVK A;  3C33 A;  5IZ3 B;  1HSE A;  3ECR A;  3KG2 A;  1QW0 A;  1N7W A;  2NWJ A;  3K4U A;  3FV2 A;  4GX6 A;  4M1V A;  3L6H A;  4PQJ A;  1A7L A;  3MJN A;  1FJ9 A;  2CZL A;  1LAF E;  1JEV A;  2V3Q A;  3SEU A;  3TYH A;  1BLF A;  2QL3 A;  2A5T A;  4Q5T A;  1R9L A;  1DMB A;  5I84 A;  4HE0 A;  3SET A;  2UVG A;  1JVX A;  1MPB A;  5H8Q A;  5HBC A;  4ZDM A;  1N84 A;  2F97 A;  2I0B A;  3FV1 A;  2A5S A;  3EN3 A;  3S9N C;  2GH9 A;  4BDM A;  2BJJ X;  3H3G A;  4PF6 A;  3C32 A;  3FJM A;  4JWY A;  4Q8R A;  4OXV A;  1RYX A;  2OBG A;  1PB9 A;  5F1Q A;  3EHS A;  1AIV A;  4QFP A;  1MRP A;  4G77 A;  2XA5 A;  4OVP A;  1YPN A;  5ICT A;  1Y3P A;  1DTG A;  5FBP A;  4RY1 A;  4NAP A;  2HQ0 A;  2ZYO A;  3KN3 A;  4RK2 A;  1LST A;  4MJO A;  1B0L A;  1QJM A;  1MXU A;  1N0T A;  4PDH A;  1VDW A;  4G68 C;  3RT6 B;  4TLM B;  5IKB A;  4DCY A;  1B9J A;  4NF0 A;  1FW0 A;  1NUZ A;  1A99 A;  5ICQ A;  4KD5 A;  3W9V A;  3OEN A;  2GHB A;  3RUM A;  1TT1 A;  2ZYM A;  2P1S A;  3DLN A;  5EQA A;  3IOR A;  3LUZ A;  2Y5K A;  5I57 B;  2CEX A;  4QXD A;  2PYY A;  4IO2 A;  3V89 B;  3KN8 A;  4FEC A;  2YLN A;  2NUV A;  4G8M A;  1DTZ A;  5AA4 B;  1NV3 A;  1YYZ A;  3QK6 A;  3KGC A;  4JXI A;  3LSX A;  4OEU A;  1CE2 A;  1OQH A;  4ESW A;  5LDZ A;  2Q9T A;  4YKP A;  1LLS A;  3O6H A;  5EYG A;  3IAZ A;  4FAT A;  3CVG A;  3G3H A;  3CG3 A;  2H9B A;  2AYS A;  1IXC A;  1M5D A;  4XKN A;  2ZNS A;  3TQW A;  4C1T A;  3HN0 A;  4ND9 A;  1F9B A;  2ONR A;  2HPG A;  1QKB A;  5I3S A;  2XWI A;  1FTK A;  3B7D A;  4U21 A;  4OZ9 A;  1H44 A;  1TXF A;  3AXF A;  2QS4 A;  1NUY A;  1FBH A;  3IFA A;  1RDY A;  4YKJ A;  3RTF B;  5I59 B;  3KBR A;  4P8B A;  2THI A;  2L5V A;  2G29 A;  3RY3 A;  1AOV A;  4NED A;  2V3U A;  1SPI A;  5EHS A;  5JEI A;  2OJT A;  2CZI A;  2ANJ A;  3N6U A;  1SVX B;  2Q88 A;  2RF1 A;  3VVD A;  2X7P A;  1Y20 A;  3VLV A;  3WAE A;  3DP6 A;  5TP9 B;  3IX1 A;  1B0H A;  3VXB A;  3RNN A;  1O7T A;  2GHA A;  4ZE9 A;  4KQP A;  2AIX A;  4E0X A;  5DT6 A;  2FIE A;  1PC3 A;  2YPN A;  3RN8 A;  3T66 A;  4NQ8 A;  4X48 A;  3K1P A;  4NF5 B;  4IO4 A;  5IAI A;  2R6G E;  3IOU A;  4GLI A;  1LCF A;  3TDJ A;  1Y3N A;  3DP4 A;  2KR0 A;  3MZ9 A;  4QRZ A;  3MVW A;  4F3S A;  2OK2 A;  4YMA A;  1D9Y A;  1IZ1 A;  4NF4 B;  4KXP A;  4ZZA A;  4ZEB A;  3WAF A;  3V5A A;  4PFR A;  3TFL A;  4OA4 A;  2UVH A;  4IO7 A;  1QKA A;  4LP2 B;  2HCA A;  3IJX B;  3PD8 A;  5CMB A;  3PUW E;  4PBH A;  3T93 B;  2UXA A;  3FGS A;  3T9X B;  4EDP A;  1PEB A;  1MXW A;  2ZXT A;  3Q28 A;  5L9S A;  4R6Y A;  5F24 A;  1MPD A;  1MM7 A;  2H98 A;  1NKX A;  3MVZ A;  1B32 A;  2RKM A;  4AQ4 A;  3IB1 A;  4MH5 A;  4GL8 A;  2HAU A;  4ZEF A;  1OIB A;  2Z8E A;  4F1U A;  2XXX A;  2HHM A;  3Q26 A;  4N17 A;  5TPA B;  5BUU A;  2OZZ A;  3MVX A;  3A29 A;  3MPL A;  5DTB A;  1QUI A;  2QMW A;  4F22 A;  4H8I A;  4GRK A;  3O66 A;  2X7Q A;  2XXV A;  3KOS A;  1JQF A;  3UOR A;  1DBZ A;  1VR5 A;  3MQ9 A;  1DPE A;  2Y7I A;  1YXI A;  4QBA A;  1MG1 A;  2UVJ A;  2WBB A;  2X26 A;  1I69 A;  3TKD A;  3C34 A;  4Z7E A;  2XX8 A;  2D5W A;  3IK6 B;  5M2V A;  1GVC A;  1QVS A;  4HTG A;  4NF8 A;  2RCA A;  2OX3 A;  4BDN A;  4F3G A;  3R26 A;  3OO8 A;  3QAX A;  4F1V A;  4F2Q A;  1POY 1;  3GBA A;  4PGP A;  4O3C A;  1FPE A;  1GGG A;  1WOD A;  4LZ5 A;  1N3W A;  1QGX A;  2ZNU A;  3DP8 A;  4GL0 A;  3LUY A;  2QS1 A;  5LTC A;  1FBP A;  1A54 A;  3LSW A;  4TQU Q;  1GR2 A;  2NVU B;  1NV6 A;  4G8N A;  5K2X A;  4MAG A;  4IGT A;  4PFB A;  1A55 A;  4QSE A;  5KDT B;  1EYJ A;  1URG A;  1B5H A;  4R73 A;  2F5X A;  3BFT A;  1Y1M A;  3BBR A;  3SEW A;  1AWB A;  3PMW A;  4OEV A;  3QIM A;  1S9T A;  2RIN A;  3K1M A;  1SBP A;  2B4M A;  1JW4 A;  3TMG A;  4NN3 A;  4KYS A;  3SKP A;  1RDX A;  4HCW A;  3G3F A;  5CMK A;  3C4M A;  4NWD A;  4PAF A;  5BWJ A;  1BK4 A;  4GWX A;  1S50 A;  1N76 A;  1KA1 A;  4YZZ A;  5F7V A;  2ABH A;  2DVZ A;  2GRV A;  4PFT A;  4RPN A;  3ODB A;  5IM2 A;  1PDA A;  3HST A;  1Y4C A;  4PP0 A;  4NWC A;  1IMA A;  4OWD A;  1H43 A;  4GWO A;  1IMD A;  2O6A A;  4I3Y A;  5ET6 A;  3KC0 A;  3OOA A;  5IZZ A;  4N81 A;  1OVB A;  3TQL A;  1FPD A;  4N4U A;  2PVU A;  4XF5 A;  2KLF A;  3M3K A;  1MM6 A;  1MXV A;  2F34 A;  4YKI A;  3O28 A;  2PMS A;  4GVO A;  4IO3 A;  5B7D A;  2QRY A;  2XXY A;  1M5B A;  1CB6 A;  1LBW A;  3CR9 A;  1B52 A;  1ATG A;  3PPP A;  3TZA A;  3MP6 A;  3JV9 A;  1SW5 A;  5H8S A;  2F36 A;  1USY H;  1IMB A;  3OEL A;  5I57 A;  3MZ1 A;  3S9M C;  5I2N B;  1B51 A;  1NNP A;  2F6G A;  3FXR A;  3FIR A;  4XTC Q;  4KR5 A;  3TAJ A;  3HO7 A;  3EHT A;  3UA8 A;  1O63 A;  2I3W A;  4MCO A;  4EXL A;  4F29 A;  3VVE A;  5I7I A;  3EHU A;  1I6Q A;  4O3A A;  1FSA A;  1K9Y A;  1QUJ A;  3QUJ A;  3K1N A;  4O7M A;  1LAH E;  4OVR A;  4JDF A;  1ZMG A;  4OEN A;  5AA2 D;  4PFW A;  4ZZE A;  4HS7 A;  4XIG Q;  3PD9 A;  3PTY A;  4LZ7 A;  4MLV A;  3PPN A;  4PDD A;  5I5P A;  3RPL B;  1MQJ A;  3FD3 A;  2I49 A;  3I6V A;  3FZV A;  5J1D A;  2ALU A;  4EQB A;  1H3D A;  2H25 A;  3TCH A;  2H5Y A;  2WKY A;  1UTH A;  3MWB A;  4TLL B;  5HPQ A;  1LAX A;  3CSG A;  2P3V A;  3F11 A;  4O3B A;  3T9V A;  4H67 A;  5I56 B;  4UAC A;  5DYH A;  3SEX A;  1NV5 A;  1B46 A;  5I59 A;  4P1E A;  2B4L A;  3N94 A;  4GBW A;  4PFI A;  3S2V A;  1NH8 A;  3UGW A;  1IUD A;  1YAE A;  3OEK A;  3IO6 A;  2VOZ A;  2QS3 A;  4LAT A;  2RC8 A;  3OO6 A;  1TWY A;  3DM0 A;  1FTA A;  2WYP A;  1QUL A;  2VPN A;  1BKA A;  5H8F A;  4XFE A;  2F3B A;  4O7I A;  3GYY A;  3D4C A;  3OD7 A;  4JWX A;  2QJE A;  1INP A;  4I3E A;  2PT2 A;  1MXX A;  2P3N A;  2DE3 A;  4PC9 A;  1SQY A;  1B4Z A;  1MPC A;  5ISU A;  3CFZ A;  4P11 A;  3KSX A;  4HXV A;  1Q35 A;  4NF5 A;  3KJT A;  3KEI A;  1B1X A;  3MVY A;  4MBP A;  1HSJ A;  2LAO A;  2REG A;  1SI0 A;  3KSJ A;  4YKK A;  3A09 A;  3SEV A;  1ZU0 A;  4H0W A;  4LON B;  3Q25 A;  5CBR A;  3TCF A;  4EQ9 A;  4KPT A;  1URD A;  3N26 A;  1MS7 A;  1MQH A;  5EQ9 A;  2F7A A;  4G4P A;  3OSQ A;  1G0H A;  2FIX A;  4RJZ A;  4KHZ E;  3RGY A;  4O94 A;  4PBQ A;  2UVI A;  4MHF A;  3G7W A;  4H1X A;  4X8R A;  2XWK A;  1RYO A;  5ESY A;  3IB0 A;  4GXA A;  4GX4 A;  1BIY A;  4GWS A;  5I58 A;  4N15 A;  4PF8 A;  2DWH A;  3U1O A;  1Q1K A;  4YAH X;  2V93 A;  1IXI A;  2DXY A;  4NHB A;  1MY0 A;  5TPA A;  3FVN A;  3U72 A;  3CI8 A;  4JBZ A;  4PE5 B;  1SYH A;  2F3D A;  1B3H A;  4U2R A;  2XXW A;  4NMY A;  4F18 A;  1EZP A;  2PFY A;  3LBS A;  2OWT A;  3BFU A;  2XXT A;  1FRP A;  4YB5 A;  4N8G A;  3H6T A;  4EQ7 A;  2CMO A;  1B5I A;  3U92 A;  1US4 A;  3T9U A;  5I2K B;  5JTY B;  2VP1 A;  2DXR A;  1BP5 A;  5DVJ A;  3C36 A;  4MNC A;  1FTO A;  1XS5 A;  1TFA A;  4U1Z A;  1IIW A;  2Y84 A;  3TOD A;  4JWO A;  3EKI A;  3P7I A;  3FXU A;  1O64 A;  4IY5 A;  2P2A A;  5DEX A;  1SW1 A;  4PFU A;  4G68 A;  5J16 A;  4F2O A;  4MLQ A;  2G93 A;  1LBX A;  1M5C A;  1WVJ A;  4KCD A;  3KC1 A;  2A5T B;  4GWY A;  3S4U A;  3K00 A;  5IZ1 A;  5B70 A;  4LQ5 A;  4OFL A;  1ELJ A;  3FVO A;  1LBZ A;  2DWI A;  3LV0 A;  2E0S A;  2FVZ A;  3U93 A;  1R9Q A;  4YU0 A;  2DOJ A;  4ZEI A;  3L6G A;  2RCB A;  3IR1 A;  2D21 A;  4DI3 D;  1B3G A;  2ZYN A;  3OO9 A;  3TTL A;  4XKQ A;  3TTR A;  1R6Z A;  4JB7 A;  4H5G A;  4NF6 B;  1ZKB A;  2W7Y A;  2F7C A;  1LCT A;  4HCY A;  1FBF A;  3G3J A;  2F78 A;  4H46 A;  3FUZ A;  3R6U A;  4F1Y A;  1LBY A;  2VD3 A;  3NOH A;  2I4B A;  4H5F A;  4NE4 A;  2KQZ A;  2XD3 A;  3U8Q A;  1TFD A;  4JVC A;  3W15 C;  1B7H A;  3MC2 A;  3D1R A;  1UTB A;  1VSO A;  3QUF A;  4BDQ A;  1WDN A;  3FBP A;  1NUX A;  1SW2 A;  4JVI A;  4UAB A;  3E3K A;  4F3B A;  4P0G A;  4HE2 A;  2XX7 A;  3IL1 B;  2R9J A;  3OXN A;  1B6H A;  4XKP A;  4QSD A;  1P1N A;  1D3K A;  4QFO A;  1FPF A;  4QF9 A;  4BDL A;  1EZ9 A;  5AA2 A;  2ZZW A;  3H6W A;  2XXQ A;  1B3L A;  4GIZ A;  1XVY A;  4FAJ A;  2Y7P A;  3CHG A;  2O1L A;  3TPA A;  3H4Z A;  1IXG A;  2V84 A;  2V4C A;  5I2N A;  3QMF A;  3VLU A;  5EHM A;  4M4G A;  2PCR A;  1US5 A;  2DWJ A;  5L8D A;  1POT A;  3E9X A;  1K9Z A;  4EXK A;  3IFC A;  1M5F A;  2BJI A;  5FTH A;  1NUW A;  3BIH A;  4R72 A;  4ZE8 A;  1EH3 A;  4DIG A;  1PB7 A;  4ZEK A;  1PB8 A;  5DVI A;  1LB9 A;  5AE4 A;  4LQ2 A;  4LN5 A;  4C0R A;  1Y9U A;  3O6G A;  3OO7 A;  4MNP A;  2Q74 A;  2B65 A;  3BKI B;  4MF3 A;  2XXI A;  1Y4T A;  3RPL A;  2I4C A;  3G3K A;  3R7X A;  4P56 A;  4Q0C A;  1ZLQ A;  3ZKL A;  3EQ1 A;  2FBP A;  4ELO A;  5IZ3 A;  1JW1 A;  1B58 A;  3K6V A;  2E1S A;  3QYT A;  3TEP A;  4OER A;  2HEU A;  4X1B A;  3VLW A;  3IO4 A;  2Z8D A;  3O97 A;  4THI A;  2QS2 A;  1ZIU A;  1FQA A;  4Z0I A;  1UIV A;  1P1U A;  3BIG A;  4G2Z A;  1LFI A;  3IOV A;  4OHN A;  2FHY A;  3JZJ A;  2JJK A;  4G61 A;  1FBD A;  2XXP A;  4ZEC A;  3FJG A;  2UYE A;  4IGR A;  1FPK A;  3HCQ A;  2Z8F A;  3SEY A;  3MYU A;  1P1W A;  4DXB A;  2XWO A;  1IMC A;  3S9E A;  1DCU A;  2HAV A;  3FAT A;  3A3C A;  3UP9 A;  2VD2 A;  4QHQ A;  1I6A A;  3MPK A;  1OVT A;  4KCC A;  4P47 A;  1VFD A;  3OEM A;  4OFO A;  1A8F A;  2MKZ A;  3S9L C;  4I62 A;  2WBD A;  1EZO A;  1NV7 A;  4MMP A;  1EYK A;  2WEF A;  1D4N A;  1MY1 A;  4FE8 A;  1N04 A;  1LEV A;  3LSF B;  4R9F A;  1LBB A;  3TTN A;  3PGF A;  1FQF A;  5A5L A;  5KCJ B;  2QVR A;  3ZKK A;  2O69 A;  2PFZ A;  1B40 A;  3ILU B;  4P0I A;  2XD2 A;  4X1D A;  1ZJL A;  1YTV A;  2WYK A;  4ELP A;  3ZSF A;  1XI6 A;  1IMF A;  2QPQ A;  1VE4 A;  2XXR A;  3TTK A;  3KOT A;  3MW0 A;  4R9G A;  1FPL A;  4MFI A;  1P99 A;  3CFL A;  4O8M A;  3ROJ A;  1P1Q A;  1FTL A;  2NOO A;  2M8C A;  4AB6 A;  1FTJ A;  1NV4 A;  3H6V A;  5AA4 A;  4ELQ A;  1RDZ A;  4OVS A;  1SI1 A;  3ISP A;  4BDO A;  2GQ1 A;  2ONK E;  4OQO A;  4FIM A;  3W9W A;  3D4G A;  1GTK A;  5TU0 A;  4QSC A;  4OYV A;  1L5T A;  2IA4 A;  4PET A;  4GD5 A;  4X9T A;  4R75 A;  3PPQ A;  4NX1 A;  4OVJ A;  3B6T A;  4GWZ A;  1PBP A;  4QFN A;  1Y1Z A;  2CZK A;  5CI5 A;  1HSL A;  2UYF A;  1B1H A;  5FHM A;  2Q2A A;  4XKR A;  4NF8 B;  3RTW B;  5FHO A;  3G3G A;  4DXC A;  2YJP A;  4HW8 A;  1VFE A;  2ZNT A;  1UIU A;  5JTY A;  2HXW A;  4NGU A;  4UA8 A;  1NFT A;  2OCU A;  3G3I A;  2XXK A;  4OES A;  1B3E A;  2I3V A;  3T22 A;  3VXC A;  2I48 A;  2I6E A;  4EF1 A;  5A5X B;  1IEJ A;  4FBP A;  3OMB A;  2HZK A;  1Z7M E;  4OFJ A;  4OVT A;  3T1B A;  1JW5 A;  3VFJ A;  5ELV A;  5H8N B;  3LR1 A;  4C1U A;  3IJO B;  5TP9 A;  4ELR A;  2DDK A;  4ONY A;  2QVU A;  3O9P A;  1IXH A;  1NV0 A;  1MY3 A;  2XXH A;  5KZT A;  5L9O A;  4NF6 A;  4PFY A;  5FHN A;  2FYI A;  3E4R A;  3HHF A;  5ET8 A;  1FPG A;  3M3L A;  2R8T A;  4YB7 A;  1USY E;  2DS9 A;  1B3F A;  1XOC A;  5T3J A;  2Q89 A;  1BTJ A;  3VDF A;  2O7I A;  4NF4 A;  4YIC A;  4F39 A;  1DPP A;  1JP4 A;  3FJ7 A;  4U4X A;  4AS5 A;  3M3F A;  2XWV A;  4IO6 A;  2NXO A;  1T0K A;  4P9K A;  3GLB A;  4I40 A;  1LGB C;  4R6H A;  1FBE A;  5LOM A;  5DVF A;  4K3F A;  5EYH A;  4GWW A;  5L9M A;  2ONS A;  3LSL A;  1QUK A;  1B4H A;  3RT8 A;  2XX9 A;  1NNF A;  3K02 A;  3RPW A;  2HZL A;  1XVX A;  4YMB A;  2AL4 A;  1MY2 A;  4PAK A;  1XT8 A;  2D3I A;  4P3L A;  1Y3Q A;  1NV2 A;  3QXM A;  4RYA A;  3RYD A;  1ANF A;  5ITO A;  4FEB A;  1AMF A;  4R2F A;  4I1D A;  2AL5 A;  2R71 A;  1NV1 A;  3N5L A;  5EQ7 A;  4H65 A;  4BDR A;  3N6T A;  1H76 A;  4P1L A;  2F8D A;  4ZS9 A;  1LAG E;  1CNQ A;  1S7Y A;  1EYI A;  5CRY A;  1URS A;  1R1N A;  4F19 A;  4RA1 A;  3THI A;  2ESN A;  3CRB A;  4XXU A;  5H8H B;  1H45 A;  1MY4 A;  1N7X A;  3QSL A;  1D9V A;  5FTI A;  3UN6 A;  3VVF A;  3E13 X;  1IME A;  3T0J A;  3C35 A;  4KYD A;  4U22 A;  4U23 A;  4F31 B;  4ESX A;  2XXU A;  1B2H A;  4R6K A;  1SDX A;  3ZS6 A;  3PUV E;  2HFB A;  1UTH B;  4GBV A;  1KWH A;  5CBS A;  3HV1 A;  4BLA A;  4KI0 E;  3MP8 A;  1DOT A;  5ET7 A;  4IY6 A;  3U94 A;  4POW A;  1JET A;  3H6U A;  1XHY A;  3PPO A;  5K2Y A;  1SW4 A;  3O6I A;  4JVD A;  2DE2 A;  1LFG A;  3RQT A;  4Q30 B;  2VPO A;  2XHD A;  4IB2 A;  3OSR A;  2Y5L A;  1JEU A;  5KDT A;  4AS4 A;  3V8X B;  5H8Q B;  3VV5 A;  4N07 A;  1RKM A;  2OWZ A;  2QFL A;  2ZYK A;  4H8J A;  3TTM A;  4IO5 A;  3E79 A;  4JSD A;  2F35 A;  4GOT A;  4G8H A;  2DWA A;  4X04 A;  3CIJ A;  5H8F B;  1MDP 1;  2PX1 A;  4POX A;  4H6D A;  1A40 A;  4GFR A;  4DDD A;  3MP1 A;  4DXU A;  3U65 A;  2B3F A;  1A8E A;  2Y7K A;  2REJ A;  1AH5 A;  3GZG A;  4RPO A;  2H99 A;  4EF2 A;  1ZBM A;  1G0I A;  1KZ8 A;  4DZ1 A;  1OMP A;  1MH4 A;  1MQD A;  1Q9D A;  4OET A;  1KA0 A;  1YZ0 A;  4KYE A;  1B7Z A;  4DI4 B;  3IB2 A;  4OAN A;  2I0C A;  3KN7 A;  4N8Y A;  3JYR A;  1NMU A;  2I58 A;  3Q29 A;  4LA9 A;  1EU8 A;  4OTE A;  2IEE A;  1DK4 A;  4KFQ A;  3PMV A;  1MQG A;  3PUZ E;  1SD3 A;  2ZZX A;  2DP8 A;  1OQG A;  4U1O A;  5KCJ A;  3ONM A;  2V3T A;  4L17 A;  1B05 A;  3TUS A;  1JVY A;  3H7M A;  1ZTY A;  3K6W A;  4EUO A;  4FED A;  5CM6 A;  3B6W A;  1FBG A;  4R2B A;  3PUX E;  2GFE A;  3CFX A;  4PCD A;  4WED A;  2ZZV A;  4ECF A;  3M8U A;  4TOZ A;  3USD A;  4R74 A;  5AA3 A;  3H03 A;  5I58 B;  3EF7 A;  3H06 B;  4IR8 A;  4LZ8 A;  4PE3 A;  4OVQ A;  2H4I A;  3A3U A;  2F7B A;  1LBV A;  1IQ7 A;  2QSX A;  3PPR A;  3GXA A;  1NI9 A;  3KZG A;  4JSO A;  3TCG A;  3T9H B;  4PGN A;  2Z22 A;  4N6D A;  2HXR A;  4WXJ A;  2FNC A;  4MNI A;  3MZB A;  1PBQ A;  4PAI A;  2B3B A;  4GF8 A;  3SES A;  2Q8J A;  3VE1 B;  4DCX A;  5AA1 A;  1AL3 A;  3T96 B;  3HFU A;  2DVC A;  1P1O A;  5I56 A;  1NNT A;  2OLB A;  3FXB A;  2CEY A;  2O1M A;  1YCJ A;  4MX6 A;  2P0S A;  2CZH A;  4N91 A;  5HM4 B;  2V25 A;  4I8C A;  5DEX B;  3O2A A;  1FQD A;  4G68 B;  4N6P A;  3I5O A;  1UQW A;  1FQC A;  4NG7 A;  1LBC A;  3EPE A;  4MIJ A;  1II5 A;  4GX3 A;  5A5X A;  1GV8 A;  3C31 A;  3K01 A;  1I6B A;  1SYI A;  4I9D A;  2Z23 A;  3K0V A;  4N6K A;  1FQE A;  1FCK A;  4F3P A;  3KFM A;  1M5E A;  3MBP A;  5H8N A;  3B6Q A;  3LC8 A;  2DSF A;  1B7U A;  2Q2C A;  5CC2 A;  1FQB A;  2DE4 A;  1XC1 A;  4QFL A;  1JNF A;  3UIF A;  1FJ6 A;  3IOT A;  3PV0 E;  1MH3 A;  4HE1 A;  1LFH A;  2O7U A;  2Y7R A;  1MQI A;  1NNK A;  2RC7 A;  4PTK A;  4AB5 A;  3KBZ A;  4RXL A;  1MDQ A;  4GXS B;  2QVV A;  2PBW A;  4MEV A;  1FBC A;  4DLD A;  2ZMB A;  3SDF A;  2Y7W A;  3PUY E;  4ISU A;  2F6P A;  4U4S A;  1NL5 A;  5CMM A;  2PT1 A;  1MXY A;  4QFK A;  3UK4 A; 
#chains in the Genus database with same CATH homology
 2Q8M A;  2DDK A;  2VT5 A;  4F1U A;  2HHM A;  4N17 A;  4MNC A;  2QVU A;  3A29 A;  5EQ8 A;  1NV0 A;  3EKI A;  1FPJ A;  5DW8 A;  5IGA A;  1DBZ A;  5ET8 A;  5J16 A;  1FPG A;  1YXI A;  2R8T A;  2WX9 A;  5T3J A;  1FPB A;  1LBX A;  4QBA A;  2WBB A;  3KC1 A;  4GWY A;  3B50 A;  5IZ1 A;  4YIC A;  1JP4 A;  1LBZ A;  3LV0 A;  2OX3 A;  4AS5 A;  2FVZ A;  5JK4 A;  3B8B A;  4H45 A;  2XWV A;  4F1V A;  4PGP A;  4P9K A;  4DI3 D;  4I40 A;  1FPE A;  3SZP A;  1D9Q A;  1QGX A;  1FBE A;  5LTC A;  1FBP A;  5EYH A;  4GWW A;  5ET5 A;  1NV6 A;  3MST A;  4HCY A;  3E78 A;  1FPI A;  1FBF A;  4MAG A;  4H46 A;  2HZL A;  4XEQ A;  4PFB A;  1LBY A;  3NOH A;  4PAK A;  2KQZ A;  1EYJ A;  4JVC A;  4P3L A;  1NV2 A;  3D1R A;  3RYD A;  2F5X A;  4GWU A;  1NV1 A;  1AWB A;  5EQ7 A;  3FBP A;  5IZ3 B;  1NUX A;  4JVI A;  4P1L A;  4UAB A;  4HE2 A;  1CNQ A;  4GX6 A;  4M1V A;  1EYI A;  2B4M A;  4NN3 A;  1RDX A;  4F19 A;  4HCW A;  1FJ9 A;  1FPF A;  4PAF A;  2V3Q A;  2ZZW A;  1BK4 A;  4GWX A;  1KA1 A;  4YZZ A;  2DVZ A;  1IME A;  4HE0 A;  3T0J A;  3CHG A;  5IM2 A;  2V4C A;  3QMF A;  1IMA A;  1IMD A;  2PCR A;  4I3Y A;  4GBV A;  5ET6 A;  3KC0 A;  4PF6 A;  1K9Z A;  5IZZ A;  4N81 A;  3IFC A;  2BJI A;  1FPD A;  5ET7 A;  4N4U A;  1NUW A;  3BIH A;  4XF5 A;  4JVD A;  4LN5 A;  2DE2 A;  4MNP A;  2VPO A;  2XA5 A;  4OVP A;  1LBW A;  2Q74 A;  2Y5L A;  4AS4 A;  5FBP A;  3RPL A;  4NAP A;  1IMB A;  2OWZ A;  2QFL A;  3E79 A;  4P56 A;  2FBP A;  4MJO A;  5IZ3 A;  4X04 A;  4PDH A;  1VDW A;  4MCO A;  5I7I A;  4NF0 A;  1NUZ A;  1FSA A;  1K9Y A;  4O7M A;  3U65 A;  3W9V A;  4OVR A;  3PTY A;  1G0I A;  1KZ8 A;  5EQA A;  3BIG A;  4PDD A;  5I5P A;  3LUZ A;  3RPL B;  2FHY A;  2Y5K A;  1Q9D A;  1KA0 A;  1YZ0 A;  2JJK A;  2CEX A;  4DI4 B;  4OAN A;  4QXD A;  4G61 A;  1FBD A;  4N8Y A;  1FPK A;  5J1D A;  3MYU A;  1DK4 A;  1NV3 A;  2XWO A;  1YYZ A;  2ZZX A;  1IMC A;  1DCU A;  2P3V A;  5LDZ A;  2Q9T A;  1NV5 A;  5EYG A;  4P1E A;  2B4L A;  4GBW A;  4PFI A;  5CM6 A;  1FBG A;  4P47 A;  2MKZ A;  4PCD A;  2WBD A;  2HPG A;  1NV7 A;  2ZZV A;  4MMP A;  1EYK A;  2WEF A;  5I3S A;  2XWI A;  1FTA A;  2WYP A;  1LEV A;  2VPN A;  4XFE A;  2F3B A;  4O7I A;  3GYY A;  1NUY A;  4IR8 A;  5A5L A;  1FBH A;  2QVR A;  4PE3 A;  1INP A;  4I3E A;  4OVQ A;  2PFZ A;  1LBV A;  3IFA A;  2P3N A;  1NI9 A;  1RDY A;  2DE3 A;  4PC9 A;  4P8B A;  2WYK A;  2L5V A;  4HXV A;  1XI6 A;  1IMF A;  4PGN A;  2QPQ A;  4N6D A;  2HXR A;  1SPI A;  1FPL A;  2CZI A;  4MNI A;  4O8M A;  3ROJ A;  4PAI A;  1NV4 A;  3HFU A;  1RDZ A;  2FIE A;  4OVS A;  3ISP A;  3FXB A;  2CEY A;  2GQ1 A;  4NQ8 A;  4MX6 A;  4N91 A;  2CZH A;  5EQ9 A;  3W9W A;  1G0H A;  2FIX A;  2KR0 A;  4PET A;  4NG7 A;  4MIJ A;  4O94 A;  4X9T A;  4GX3 A;  4NX1 A;  4PBQ A;  4MHF A;  4GWZ A;  4X8R A;  2XWK A;  4N6K A;  2CZK A;  4KXP A;  5ESY A;  4GX4 A;  4GWS A;  4N15 A;  4PF8 A;  4PFR A;  2DE4 A;  4NHB A;  1FJ6 A;  4OA4 A;  4NGU A;  4HE1 A;  2XXK A;  4PTK A;  2F3D A;  3KBZ A;  4PBH A;  2QVV A;  4MEV A;  4F18 A;  1FBC A;  4FBP A;  2HZK A;  5F24 A;  2PFY A;  4OVT A;  3T1B A;  1FRP A;  4N8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...