2XXKA

Siap complex
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPDAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siap Complex
rcsb
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 124
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xxkA00
4PBQA 4MX6A 4OVQA 4YICA 4NX1A 4P1EA 2WYPA 3B50A 5IGAA 4XFEA 4MIJA 4PBHA 4MNPA 4PETA 4P8BA 4PAIA 4NF0A 2V4CA 4MEVA 4DI4B 4MCOA 4PCDA 4OVSA 4OVTA 3U65A 5IM2A 2HZLA 2ZZXA 5CM6A 4P1LA 2VPOA 3FXBA 3GYYA 4N91A 2HPGA 4PE3A 4LN5A 4P9KA 2PFZA 4N6DA 4PC9A 4PFIA 2XXKA 4MNIA 4P56A 4NQ8A 4MAGA 2WYKA 2CEXA 5LTCA 4N6KA 4OVRA 2XA5A 2CEYA 4O8MA 4PGPA 4P47A 4NN3A 4OA4A 2PFYA 4NGUA 4XEQA 4PAKA 5IZZA 4P3LA 4X8RA 2XWVA 4DI3D 2HZKA 4N15A 4XF5A 4OANA 4O94A 4NG7A 2ZZWA 4PAFA 4NHBA 4PGNA 4NAPA 2VPNA 4OVPA 2XWKA 4N17A 2XWIA 4PFBA 4PDHA 4N8YA 4N8GA 4N4UA 2WX9A 2ZZVA 4PF8A 4MNCA 4PF6A 4UABA 2XWOA 4MHFA 4O7MA 4YZZA 5I7IA 4PDDA 4X04A 4MMPA 5I5PA 4PFRA
chains in the Genus database with same CATH superfamily
4OFLA 1KWHA 3GZGA 1AWBA 2OWZA 1IXHA 1LLSA 4R6HA 5IZ3A 3CFLA 1F9BA 1NUYA 4PETA 4ZE8A 3RYDA 2XX7A 1T0KA 4G68A 4N81A 5H8SA 1MY0A 3MVXA 2I3WA 2O1MA 3S9EA 4OVSA 4OFOA 4NF8B 1IXIA 1GR2A 1Z7NE 3KN3A 2XXPA 4JDFA 3U72A 2P3VA 2YLNA 5IZ3B 2I4BA 3B8BA 2G29A 1OVBA 4RPNA 1MQGA 2E1SA 1NH7A 3TCFA 2F7AA 3N6UA 3H06B 1D9QA 4R9FA 2XXKA 5ITPA 2ESNA 3MZ9A 5LTCA 1XS5A 4OEVA 2DVZA 1MPBA 1NNFA 4AS5A 3A29A 4O8MA 4PGPA 3IOWA 4OA4A 2DYXA 2UYEA 3Q29A 1UQWA 5L9MA 2QMWA 1LBCA 4NG7A 2ZXTA 3PTYA 4NHBA 4PGNA 2PT2A 3VXCA 3G3FA 2VPNA 3IB1A 2V25A 2XWKA 3CVGA 4N8YA 4GXSB 1LAXA 4HCYA 2B3FA 2XXQA 4O7MA 5CMBA 1DSNA 1BTJA 1LAGE 2NUVA 1YTVA 3ISPA 4XTCQ 2H25A 4NX1A 2XXUA 4U4XA 3CFXA 4YKKA 4F31B 4ELOA 2W7YA 5BWJA 2ZNTA 1FPDA 2MKZA 3K1NA 4LP2B 4OVJA 3V83A 1IMCA 2F3DA 1L5TA 4HS7A 3C35A 3TTKA 2DP8A 4H45A 1B32A 5EYHA 2VOZA 4MLVA 2VP1A 5CM6A 3FVKA 3LUYA 2O84X 5CBRA 1B7UA 5JTYA 3CR9A 3Q26A 4G68C 1MS7A 4F3GA 3HHGA 3C33A 3TYHA 3VVFA 2FVZA 1INPA 3TFLA 3K6VA 2V84A 4F18A 4FE8A 1FJ6A 1JP4A 2XA5A 1B40A 5FBPA 1UIVA 2XWVA 5JTYB 4OHNA 1MG1A 2HZKA 3HO7A 4OANA 4C0RA 4U21A 3W15C 3S9MC 4NAPA 2RC7A 1O63A 4JVDA 4FEBA 3T96B 1SI1A 2Q89A 2I4CA 4KCDA 4OTEA 4G61A 1EZPA 2XWIA 4IR8A 5I2NA 4E0XA 5ESYA 4I62A 1FPEA 4FIMA 1RDXA 3U8QA 1FTAA 3O6GA 5EHSA 4JBZA 4UACA 5CMKA 3D4GA 4R9GA 3HSTA 2CZIA 1IITA 1Q9DA 2RINA 4GX6A 4I8CA 4YICA 4GL0A 2P3NA 3IJXB 3LR1A 5IGAA 1VFDA 4F29A 4OYVA 1CE2A 1MPDA 4KPTA 1B1XA 3KOTA 2O51A 2KR0A 2NXOA 3LBSA 1BIYA 4H0WA 3E78A 2DWHA 1SQYA 3UN6A 1PB8A 3FIRA 5HPQA 1SW4A 4HE1A 4H65A 3Q25A 3E9XA 1FQBA 2AYSA 5CMCA 3HHFA 1JEUA 4ESXA 3T0JA 3HCQA 1ZBMA 2Y7WA 4U2RA 3IOVA 4RJZA 2AIXA 1LBBA 3L6HA 2I6EA 2JJKA 3JZJA 1SW5A 2R71A 4ECFA 5DVIA 3IOTA 5KCJB 3ZKLA 3QUFA 3O29A 4GWZA 1LAFE 1R6ZA 5H8HA 3GBAA 1FQCA 4U23A 3ONMA 1P1NA 2B65A 2HQ0A 3M3FA 3PMWA 1JQFA 5L9SA 2GHAA 2UYFA 1NUWA 5H8HB 2Z23A 2Y7IA 4H5FA 1B3FA 1ZU0A 3MUQA 3PUXE 5DT6A 4JWYA 1JVXA 1N3WA 4DDDA 4PFRA 1SD3A 5I59A 2UXAA 4P0IA 4O3AA 4QFKA 4PTKA 1AMFA 4FATA 1QUIA 4HTGA 1IZ1A 2L5VA 3H03A 3BKIB 4MIJA 4MH5A 1ELJA 3UIFA 1AIVA 4JXIA 3E3KA 3SEUA 4I1DA 1GVCA 1H3DA 4EF2A 5K2XA 1B3GA 3JYRA 5I59B 3KGCA 2QVRA 1MM7A 3HPIA 3KC1A 1QKAA 3FXRA 3M3LA 3TZAA 2XXHA 2VPOA 2QS3A 3O9PA 2AL5A 3OSRA 3TTMA 4HW8A 4ZEKA 4LUBA 2GRVA 1GGGA 1NUXA 1NUZA 3C4MA 3W9WA 4DXUA 4P56A 3C32A 1B6HA 4F1YA 3MBPA 3TTLA 1B0HA 1B1HA 4LZ5A 4TLMB 2D3IA 5IZZA 2M8CA 2Q2AA 4H8JA 4M1VA 5TPAA 4N15A 2F36A 4PFYA 2DSFA 1YAEA 4LQ5A 2I3VA 1PDAA 2QS1A 4MJOA 2DWAA 2OX3A 1QVSA 1IMAA 1SW1A 1MXYA 1FJ9A 3UGWA 1A54A 3OD7A 3IB0A 4GX3A 3KJ7A 5TPAB 1NFTA 4LQ2A 3USDA 1YZ0A 2V3UA 3OMBA 3S4UA 4KI0E 1NNTA 1UTBA 3PGFA 3CG1A 2XD2A 5EYFA 1IUDA 3QMFA 4QXDA 3VLUA 2PMSA 5TU0A 2DOJA 3SDFA 2IEEA 3HFUA 5JK4A 4BDRA 3IFCA 3K4UA 5LOMA 1YXIA 3H6UA 2WYPA 3B50A 5KZTA 2WBDA 4RYAA 2F7BA 3MYUA 3PPQA 1H44A 1UTBB 4YU0A 1JETA 3IO4A 3K6WA 1US4A 4XXUA 3OEMA 4F2OA 4KXPA 3TTRA 2ZNUA 5KDTA 2ZZXA 3IAZA 3RUMA 2H9BA 2VGQA 3E4RA 1B0LA 3FJGA 4H5GA 5CBSA 4K3FA 3GYYA 1H45A 2R9JA 3DLNA 1NL5A 4NF4A 2QSXA 5H8NA 3LSFB 4MNIA 2CEXA 4KQPA 1B51A 5KDTB 4JVIA 3KEIA 3N26A 1VFEA 2O1LA 2QVUA 4NN3A 4NGUA 4OFJA 4XEQA 1A8EA 3ILUB 1MDP1 1NV6A 4NF4B 1WODA 1SW2A 3K1PA 2OBGA 4BDMA 1B3HA 3VLWA 3PUZE 1OQGA 5AA2A 3MP6A 1N84A 3VV5A 4GWUA 4RA1A 2GQ1A 3FVGA 1ZJLA 3D1RA 1MY4A 4N8GA 3TPAA 1EYJA 4U4SA 2P1SA 5AA2B 2D5WA 4MMPA 4UA8A 1SDXA 1A7LA 2P2AA 2Y5LA 3ILTB 4GFRA 3MPLA 5I58A 1FBGA 1MQJA 3UK4A 3DM0A 3EF7A 3RGYA 1S9TA 1MY3A 5ET6A 3SERA 1H76A 2XX9A 1Q35A 3A3CA 1FTKA 1M5DA 4R74A 2V93A 3BFUA 4NF8A 2FA7A 3EKIA 5I58B 2V3TA 3MZBA 1PB7A 1Z7ME 3H4ZA 3S2VA 1LBWA 4MLQA 1B3LA 1HSLA 4GBWA 2QMXA 4OEUA 4FBPA 2CEYA 1US5A 3JV9A 2G93A 4I3EA 1VSOA 2R6GE 2Z22A 3LC8A 1FPIA 4JSOA 2A5TA 2F78A 3NOHA 2PT1A 1FPJA 1P1QA 1FPFA 4JVCA 5DVFA 4U1ZA 1BK4A 3MVYA 2YJPA 2XXVA 2ANJA 4ZZEA 2XXWA 1PB9A 1B5IA 5I3SA 3I3VA 1O7TA 3QYTA 3WAFA 2A5TB 4IB2A 3SEWA 4QBAA 5ISUA 2REJA 4DCXA 1B4ZA 5ICTA 1ZLQA 3BIHA 2NWJA 1IXGA 3PUWE 5I5PA 1FQFA 3K2DA 3O6HA 3ROJA 3G3HA 1EYKA 5FTIA 5IZ1A 1FQDA 1TXFA 1VDWA 1XHYA 4GIZA 3I5OA 1SYHA 5F7VA 1M5EA 4I40A 3FATA 5H8FB 4NF0A 1SPIA 1SI0A 4RPOA 1FCKA 3KFMA 3KC0A 3MC2A 1Y3NA 2QVVA 1B7HA 3IR1A 3K0VA 4MFIA 3KSJA 2B4LA 4U22A 3MPKA 3OELA 1USYH 5H8QB 3MVZA 3QK6A 4XIGQ 5LDZA 3OOAA 2OCUA 1M5BA 1DTGA 3K6XA 3T93B 4YB6A 4LZ8A 5I84A 2CZHA 3UP9A 3WAEA 3FBPA 3N5LA 1QW0A 4HXVA 4X8RA 4X9TA 1JW4A 4GOTA 4F3PA 5F1QA 4R6KA 3SETA 4H67A 1D4NA 2Z8EA 4GWYA 4YKPA 2PCRA 3Q27A 5CC2A 1KA1A 4TLLB 1OLAA 4QFPA 1NV0A 4OENA 1N0TA 3O2AA 2RC8A 3N94A 5EQ9A 4JWXA 2WX9A 3S9LC 1B7ZA 1FPKA 1QUJA 4O3BA 3R7XA 4RNSA 3A09A 4PDDA 1D9VA 4NWDA 1NKXA 1MQIA 3OO8A 3UA8A 4HE0A 4X1DA 1JW5A 3PMXA 4QSDA 4G8HA 2I0CA 3PD9A 4MNPA 1M5FA 5T3JA 4F2QA 4H8IA 4G77A 3PPOA 5L9OA 3VDFA 4OVTA 4YKIA 3BFTA 1JNFA 2Q2CA 2IA4A 3CHGA 3OENA 3FV1A 2XX8A 3M3KA 4RY1A 5CRYA 3BBRA 1GV8A 4PFIA 4Z7EA 1UIUA 3H6VA 2HXWA 4QFNA 2QL3A 1PBPA 4NE4A 4C1UA 1D3KA 1LFGA 5IAIA 2VT5A 5HBCA 4PAKA 5KCJA 4ISUA 3PUYE 3RTFB 2NVUB 1DMBA 4BLAA 5DYHA 2O68A 2GFEA 3W9VA 2B4MA 2F7CA 4GX4A 2ZYMA 2DE3A 1WVJA 4HE2A 3H7MA 3LV0A 1TFAA 3K01A 4YB5A 1MQDA 4OQOA 4E0WA 1ATGA 4FJPA 4F19A 4F39A 4IO7A 2F6GA 2ONRA 1HSEA 2HCAA 2OK2A 2FHYA 4GWOA 4OVQA 2OJTA 3E13X 4PBHA 3CFZA 3FGSA 3O6IA 4OESA 1FQEA 1Y9UA 1NV2A 2ALUA 4WEPA 5ET5A 3VXBA 5AE4A 1VR5A 1LSTA 3E79A 3TCGA 2OWTA 5EQAA 5AA4A 2QFLA 4N91A 1AH5A 4H1XA 1FQAA 4PE3A 3QAXA 4P9KA 4R2BA 3ZKKA 1FPLA 3O66A 4IO4A 1FBDA 3KG2A 4G2ZA 4GQOA 1DPEA 4F1UA 1HSJA 5ICQA 1BKAA 4DI3D 5AA4B 2DXRA 2ZZWA 1LFIA 4GL8A 1JVYA 4LATA 4R6YA 3K00A 2VHAA 1I6BA 4ZEDA 3RNNA 4NF6A 3KSXA 1POTA 1LB8A 1XVXA 2Q9TA 3SEYA 2ZMBA 3GBBA 5J16A 2REGA 4ZZAA 4KHZE 3T9HB 5AA2D 5JEIA 1FBHA 4NF6B 1BLFA 2Y7KA 1NI9A 1AL3A 4PBQA 4XKRA 1FBCA 1MXXA 2UVHA 4N13A 3HN0A 3MSTA 2RC9A 2Y84A 2CMOA 3RT6B 3D4CA 4HCWA 1H43A 3EHUA 2V4CA 4TQUQ 1IEJA 1LGBC 1FSAA 1XOCA 1D9YA 2XXXA 3G7WA 2Q88A 3FXBA 1RYXA 2H99A 1O64A 4BDLA 4KFQA 2NOOA 4KYSA 4OMBA 3RQTA 4OZ9A 1PEBA 4PC9A 4AQ4A 4MF3A 4MAGA 1K9ZA 2DS9A 2DQVA 2WYKA 4N6KA 4N07A 3U92A 4KD5A 4ONYA 4RK9A 4POXA 2I49A 1Y4TA 5CI5A 4GF8A 4GWSA 1B9JA 4YKJA 4O94A 3UORA 2Q8JA 4PAFA 2WKYA 1JW1A 4IO6A 4C1TA 3VLVA 5A5LA 3THIA 2Q8MA 3V8XB 1PC3A 4N4UA 4G4PA 4H46A 5I57A 1B46A 5ET8A 3TEPA 2FYIA 2FIXA 3DELB 2F97A 2XXRA 5I2KA 1UTHA 3RT8A 3MP8A 2RCAA 1FBPA 4P1EA 2HEUA 5B70A 4Z0IA 1LBZA 1I6QA 2O7IA 3KBRA 1QJMA 3TMGA 5I57B 2OLBA 1DBZA 5FHNA 2P0SA 4ELPA 4PFWA 5F24A 4DI4B 5I2KB 4MCOA 4DZ1A 1UTHB 1IMDA 3U94A 4IO2A 2HZLA 1NNKA 3AXFA 3OEKA 1FBFA 3IO6A 3RTWB 1POY1 4G8NA 5ITOA 4GXAA 3MW0A 1FTOA 3TAJA 3F11A 1SBPA 3CI8A 3CIJA 4KR5A 4XKQA 1NV5A 2ZYKA 3OXNA 3SESA 2ZYOA 1OVTA 1MXWA 1MXVA 2QPQA 4M4GA 2X7PA 3H6WA 1GTKA 1YYZA 4JB7A 3K02A 3TTNA 3MP1A 4PP0A 3FJMA 4KCCA 1NNPA 3EN3A 4XKNA 2FNCA 5EYGA 2F3BA 3QUJA 3VFJA 3G3KA 4EQ7A 4JWOA 3OO9A 1A8FA 3QIMA 1TFDA 4IGRA 3PUVE 1NMUA 1B58A 4PE5B 2CZLA 3CRBA 2DVCA 4LONB 3PU5A 1LFHA 1LB9A 4ELRA 1Y1ZA 3CSGA 4WEDA 4X04A 1IMBA 3FJ7A 5EHMA 4EDPA 2XXIA 3VVDA 2DE4A 3GLBA 1FTLA 4POWA 2HFBA 3KOSA 4GBVA 1J1NA 3M8UA 3RLFE 4XFEA 1B2HA 4G68B 4F1VA 1LAHE 3B7DA 4EXKA 2FIEA 4H6DA 1QGXA 1NV3A 2ZYNA 5H8FA 5L8DA 1LBYA 1XI6A 4BDNA 2Y7RA 1QULA 3H6TA 3T66A 3TUSA 1MM6A 5K2YA 1MH4A 1B52A 1ZTYA 2ONKE 1Y3PA 2HPGA 5H8QA 5DW8A 1DK4A 4ZDMA 1FBEA 1PBQA 3EHTA 3IOUA 2D21A 3IORA 4DCYA 2O69A 1TWYA 1BP5A 5TP9A 2KQZA 1G0HA 4ZS9A 3MQ9A 4DLDA 2VD2A 3O97A 1URSA 3SEXA 3B6TA 3S9NC 4OVPA 4GVOA 1N7WA 5TP9B 4NMYA 2Q74A 3PPPA 5FHMA 3T9UA 3TQWA 4R72A 4F22A 2BJJX 4F3SA 1RDZA 2ZZVA 4L17A 5M2VA 1IMEA 1FPGA 4FECA 4MHFA 2DXYA 1Y20A 5I7IA 1LBVA 3K6UA 1EZOA 2DWIA 4WKMA 3CSBA 4MX6A 1FTJA 1ANFA 1MDQA 1IIWA 4O3CA 2PVUA 3OO7A 1B5JA 3C9HA 1NH8A 1LCTA 2RF1A 1SYIA 3PPRA 1OQHA 1B05A 2VD3A 3TKDA 2ZNSA 4BDQA 2HAVA 3T9VA 3KN8A 3RN8A 1A55A 1P1UA 2XHDA 3SZPA 4P1LA 4AS4A 1LEVA 3R26A 3FXUA 2KLFA 1B5HA 2B3BA 1G0IA 1B3EA 2WBBA 4R2FA 2QJEA 3RY3A 4EQBA 1WDNA 3KBZA 4NQ8A 4IGTA 2V3QA 2F8DA 2THIA 1A40A 3G3GA 4P47A 4DXBA 3K1MA 1XC1A 1Y1MA 2X7QA 3C34A 4FAJA 3PMVA 4NF5A 2YPNA 3A3UA 4X48A 3DP6A 3PV0E 3OO6A 2I0BA 2O6AA 3IB2A 4PFUA 5DVJA 1P1OA 4KYEA 1A99A 2HAUA 3C31A 4X1BA 2Y7PA 4Q30B 1YPNA 2E0SA 1QUKA 2Z8FA 5I2NB 2XXTA 3MJNA 4GWWA 4NF5B 1S7YA 3IJOB 3MAMA 5B7DA 4ZECA 4P11A 4QRZA 1EYIA 1N04A 2O7UA 3VVEA 3KZGA 4TOZA 4QHQA 4DXCA 5CMMA 1FTMA 1NV1A 5EQ7A 1MRPA 4EUOA 3B6QA 2PBWA 4RK2A 4P8BA 1IXCA 1USYE 5DEXA 3IL1B 4FORA 3PD8A 3FUZA 2HXRA 4GWXA 5ELVA 1MPCA 4MBPA 4IY5A 1DOTA 1URGA 4ESWA 5J1DA 2H5YA 1Y4CA 4QF9A 4DE8A 5DEXB 2DDKA 3O28A 3HV1A 4EQ9A 4ZEBA 2XXYA 1KZ8A 4QSCA 1RDYA 2PFYA 4JSDA 4NWCA 3Q28A 3R6UA 4QFLA 2PX1A 5AA3A 1ZKBA 3FD3A 3H3GA 4BDOA 2UVIA 2Z8DA 1OLCA 1OIBA 4YAHX 3LSLA 3T22A 4OWDA 4YMAA 4XKPA 4PF8A 4MNCA 4FEDA 4LVQA 4PF6A 4UABA 2XWOA 1DCUA 4YZZA 5EQ8A 1MH3A 2ABHA 5HM4B 5BUUA 2Y5KA 3N6TA 2F5XA 4ND9A 2QS2A 3SEVA 1ZMGA 2PYYA 2UVJA 3T1BA 4OXVA 2OZZA 5AA1A 1YCJA 1MY2A 3MWBA 1FRPA 3QSLA 4PAIA 2R8TA 4PQJA 2GHBA 4GLIA 4PCDA 1AOVA 3OSQA 2F34A 3U65A 1Y3QA 5IM2A 4G8MA 1I6AA 3FXQA 1R9LA 3RPWA 4OERA 3DP8A 1QKBA 1VE4A 3TDJA 3ODBA 1MXUA 1CB6A 1MXZA 3EHSA 3VE1B 4ZEIA 5A5XA 1XT8A 4LN5A 2GH9A 1N7XA 2I48A 4N6DA 3ECRA 4QSEA 4ELQA 4Q8RA 1ZIUA 1DTZA 3LSXA 4EXLA 4OVRA 4Q5TA 4AB5A 4GD5A 2ONSA 3U93A 2QS4A 3G3IA 4LA9A 2X26A 4P3LA 1KA0A 5FHOA 4QFOA 2WEFA 5A5XB 3B6WA 3IX1A 3L6GA 4NTLA 1IMFA 3KJTA 3EPEA 3T9XB 4ZEFA 3C36A 1FW0A 1EH3A 4WXJA 4R73A 4KYDA 4N17A 1S50A 3KN7A 3FVOA 5IKBA 2DE2A 4PFBA 1EU8A 1EZ9A 3FVNA 4U1OA 5ET7A 4IY6A 2H98A 1II5A 1MY1A 4O7IA 1LBXA 1P1WA 3SKPA 3FZVA 3RPLA 1LCFA 3IK6B 3CG3A 2BJIA 4LZ7A 3G3JA 3ZSFA 1URDA 3EQ1A 1RYOA 1RKMA 3TELA 1XVYA 2UVGA 4DIGA 4THIA 3IFAA 1OMPA 2RCBA 4NEDA 3DP4A 3FV2A 3MZ1A 2A5SA 1R1NA 1P99A 3RPLB 4MEVA 2CZKA 4PFTA 4YMBA 3LSWA 4RXLA 1TT1A 4F3BA 2XD3A 3GXAA 5FTHA 5I56A 1B4HA 1I69A 4N6PA 1K9YA 3LUZA 1SVXB 1IQ7A 3I6VA 2H4IA 4Q0CA 2F35A 2LAOA 3PPNA 2QRYA 4R75A 3U1OA 1NV7A 5H8NB 2DWJA 1DPPA 2RKMA 2PFZA 4EF1A 5I56B 3BIGA 3TCHA 1JEVA 1FPBA 1N3XA 4IO3A 1R9QA 4P0GA 4XF5A 2I58A 1N76A 4GRKA 3MVWA 4I3YA 1NV4A 3P7IA 3FASA 1Q1KA 3V5AA 1M5CA 4ZE9A 4IO5A 3TQLA 1CNQA 4I9DA 4PDHA 2FBPA 2HHMA 5DTBA 3ZS6A 3QXMA 4AB6A 2OWSA 3TODA 4OETA 2AL4A 4YB7A 2F6PA 1MQHA 3V89B
chains in the Genus database with same CATH topology
4QXDA 2FHYA 3HFUA 4MX6A 5JK4A 4OVQA 3IFCA 1AWBA 2OWZA 1YXIA 2WYPA 3B50A 5IZ3A 2WBDA 4PBHA 1NUYA 4PETA 3MYUA 3RYDA 4N81A 1NV2A 5ET5A 4OVSA 4KXPA 3E79A 2ZZXA 3SZPA 4P1LA 4AS4A 2P3VA 1LEVA 5IZ3B 5EQAA 3B8BA 3GYYA 2QFLA 4N91A 1G0IA 2WBBA 4PE3A 4P9KA 1FPLA 1D9QA 2XXKA 3KBZA 4MNIA 4NQ8A 2V3QA 2CEXA 5LTCA 1FBDA 2DVZA 4F1UA 4JVIA 4AS5A 3A29A 4O8MA 4PGPA 2QVUA 4P47A 4NN3A 4OA4A 4NGUA 4XEQA 4DI3D 1NV6A 4NG7A 2ZZWA 3PTYA 4NHBA 4PGNA 2VPNA 4GWUA 2GQ1A 2XWKA 3D1RA 2Q9TA 4GWWA 4N8YA 4N8GA 5J16A 1EYJA 4HCYA 4O7MA 1EYIA 4MMPA 1FBHA 3ISPA 2Y5LA 4PBQA 1NI9A 1FBCA 1NV1A 4NX1A 5EQ7A 3MSTA 1FBGA 4P8BA 1FPDA 4HCWA 2MKZA 5ET6A 1IMCA 2V4CA 2F3DA 2HXRA 4GWXA 1FSAA 4H45A 5EYHA 5CM6A 3EKIA 3FXBA 5J1DA 1LBWA 2FVZA 1INPA 4PC9A 4F18A 4MAGA 1K9ZA 1FJ6A 2DDKA 1JP4A 2WYKA 4GBWA 4N6KA 4FBPA 2XA5A 2CEYA 1KZ8A 5FBPA 1RDYA 2PFYA 4I3EA 1FPIA 2XWVA 3NOHA 4GWSA 2HZKA 1FPJA 4OANA 1FPFA 4O94A 4JVCA 1BK4A 4PAFA 4NAPA 4JVDA 5I3SA 5A5LA 4G61A 2XWIA 2Q8MA 4IR8A 4QBAA 5ESYA 4N4UA 1FPEA 4PF8A 4H46A 4MNCA 1RDXA 4PF6A 4UABA 2XWOA 5ET8A 1FTAA 1DCUA 4YZZA 3BIHA 2FIXA 5EQ8A 5I5PA 2CZIA 3ROJA 1Q9DA 2Y5KA 1EYKA 2F5XA 4GX6A 4YICA 5IZ1A 2P3NA 1FBPA 4P1EA 1VDWA 5IGAA 1LBZA 3T1BA 4I40A 1DBZA 2KR0A 1FRPA 4PAIA 2R8TA 4NF0A 1SPIA 5F24A 4DI4B 4MCOA 3E78A 4PCDA 1IMDA 3U65A 5IM2A 3KC0A 2QVVA 2HZLA 4HE1A 2B4LA 1FBFA 3T0JA 5LDZA 4LN5A 4N6DA 2CZHA 2JJKA 1NV5A 4OVRA 3FBPA 4HXVA 4P3LA 4X8RA 4X9TA 2QPQA 4GWZA 1KA0A 2WEFA 1YYZA 4GWYA 2PCRA 1IMFA 1KA1A 5EYGA 2F3BA 1NV0A 4N17A 2DE2A 1NUWA 4PFBA 5EQ9A 5ET7A 2WX9A 4O7IA 1FPKA 1LBXA 4PDDA 4X04A 4PFRA 1IMBA 3RPLA 2DE4A 4HE0A 4PTKA 2BJIA 4GBVA 2L5VA 4XFEA 4MIJA 4MNPA 4F1VA 3IFAA 5T3JA 2FIEA 1QGXA 1NV3A 3RPLB 1LBYA 4MEVA 2CZKA 1XI6A 2QVRA 4OVTA 3KC1A 1K9YA 3LUZA 2VPOA 3CHGA 1NV7A 1NUXA 1NUZA 2HPGA 3W9WA 5DW8A 1DK4A 2PFZA 4PFIA 4P56A 1FBEA 3BIGA 1FPBA 2KQZA 2VT5A 1G0HA 4PAKA 5IZZA 4M1VA 4N15A 4XF5A 3W9VA 2B4MA 4I3YA 1NV4A 4MJOA 4GX4A 2DE3A 2OX3A 1IMAA 4OVPA 1FJ9A 4HE2A 2Q74A 3LV0A 1CNQA 4GX3A 4PDHA 1RDZA 2FBPA 2HHMA 1YZ0A 2ZZVA 1IMEA 1FPGA 4MHFA 5I7IA 4F19A 3QMFA 1LBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PBQ A;  4MX6 A;  4OVQ A;  4YIC A;  4NX1 A;  4P1E A;  2WYP A;  3B50 A;  5IGA A;  4XFE A;  4MIJ A;  4PBH A;  4MNP A;  4PET A;  4P8B A;  4PAI A;  4NF0 A;  2V4C A;  4MEV A;  4DI4 B;  4MCO A;  4PCD A;  4OVS A;  4OVT A;  3U65 A;  5IM2 A;  2HZL A;  2ZZX A;  5CM6 A;  4P1L A;  2VPO A;  3FXB A;  3GYY A;  4N91 A;  2HPG A;  4PE3 A;  4LN5 A;  4P9K A;  2PFZ A;  4N6D A;  4PC9 A;  4PFI A;  2XXK A;  4MNI A;  4P56 A;  4NQ8 A;  4MAG A;  2WYK A;  2CEX A;  5LTC A;  4N6K A;  4OVR A;  2XA5 A;  2CEY A;  4O8M A;  4PGP A;  4P47 A;  4NN3 A;  4OA4 A;  2PFY A;  4NGU A;  4XEQ A;  4PAK A;  5IZZ A;  4P3L A;  4X8R A;  2XWV A;  4DI3 D;  2HZK A;  4N15 A;  4XF5 A;  4OAN A;  4O94 A;  4NG7 A;  2ZZW A;  4PAF A;  4NHB A;  4PGN A;  4NAP A;  2VPN A;  4OVP A;  2XWK A;  4N17 A;  2XWI A;  4PFB A;  4PDH A;  4N8Y A;  4N8G A;  4N4U A;  2WX9 A;  2ZZV A;  4PF8 A;  4MNC A;  4PF6 A;  4UAB A;  2XWO A;  4MHF A;  4O7M A;  4YZZ A;  5I7I A;  4PDD A;  4X04 A;  4MMP A;  5I5P A;  4PFR A; 
#chains in the Genus database with same CATH topology
 4OFL A;  1KWH A;  3GZG A;  1AWB A;  2OWZ A;  1IXH A;  1LLS A;  4R6H A;  5IZ3 A;  3CFL A;  1F9B A;  1NUY A;  4PET A;  4ZE8 A;  3RYD A;  2XX7 A;  1T0K A;  4G68 A;  4N81 A;  5H8S A;  1MY0 A;  3MVX A;  2I3W A;  2O1M A;  3S9E A;  4OVS A;  4OFO A;  4NF8 B;  1IXI A;  1GR2 A;  1Z7N E;  3KN3 A;  2XXP A;  4JDF A;  3U72 A;  2P3V A;  2YLN A;  5IZ3 B;  2I4B A;  3B8B A;  2G29 A;  1OVB A;  4RPN A;  1MQG A;  2E1S A;  1NH7 A;  3TCF A;  2F7A A;  3N6U A;  3H06 B;  1D9Q A;  4R9F A;  2XXK A;  5ITP A;  2ESN A;  3MZ9 A;  5LTC A;  1XS5 A;  4OEV A;  2DVZ A;  1MPB A;  1NNF A;  4AS5 A;  3A29 A;  4O8M A;  4PGP A;  3IOW A;  4OA4 A;  2DYX A;  2UYE A;  3Q29 A;  1UQW A;  5L9M A;  2QMW A;  1LBC A;  4NG7 A;  2ZXT A;  3PTY A;  4NHB A;  4PGN A;  2PT2 A;  3VXC A;  3G3F A;  2VPN A;  3IB1 A;  2V25 A;  2XWK A;  3CVG A;  4N8Y A;  4GXS B;  1LAX A;  4HCY A;  2B3F A;  2XXQ A;  4O7M A;  5CMB A;  1DSN A;  1BTJ A;  1LAG E;  2NUV A;  1YTV A;  3ISP A;  4XTC Q;  2H25 A;  4NX1 A;  2XXU A;  4U4X A;  3CFX A;  4YKK A;  4F31 B;  4ELO A;  2W7Y A;  5BWJ A;  2ZNT A;  1FPD A;  2MKZ A;  3K1N A;  4LP2 B;  4OVJ A;  3V83 A;  1IMC A;  2F3D A;  1L5T A;  4HS7 A;  3C35 A;  3TTK A;  2DP8 A;  4H45 A;  1B32 A;  5EYH A;  2VOZ A;  4MLV A;  2VP1 A;  5CM6 A;  3FVK A;  3LUY A;  2O84 X;  5CBR A;  1B7U A;  5JTY A;  3CR9 A;  3Q26 A;  4G68 C;  1MS7 A;  4F3G A;  3HHG A;  3C33 A;  3TYH A;  3VVF A;  2FVZ A;  1INP A;  3TFL A;  3K6V A;  2V84 A;  4F18 A;  4FE8 A;  1FJ6 A;  1JP4 A;  2XA5 A;  1B40 A;  5FBP A;  1UIV A;  2XWV A;  5JTY B;  4OHN A;  1MG1 A;  2HZK A;  3HO7 A;  4OAN A;  4C0R A;  4U21 A;  3W15 C;  3S9M C;  4NAP A;  2RC7 A;  1O63 A;  4JVD A;  4FEB A;  3T96 B;  1SI1 A;  2Q89 A;  2I4C A;  4KCD A;  4OTE A;  4G61 A;  1EZP A;  2XWI A;  4IR8 A;  5I2N A;  4E0X A;  5ESY A;  4I62 A;  1FPE A;  4FIM A;  1RDX A;  3U8Q A;  1FTA A;  3O6G A;  5EHS A;  4JBZ A;  4UAC A;  5CMK A;  3D4G A;  4R9G A;  3HST A;  2CZI A;  1IIT A;  1Q9D A;  2RIN A;  4GX6 A;  4I8C A;  4YIC A;  4GL0 A;  2P3N A;  3IJX B;  3LR1 A;  5IGA A;  1VFD A;  4F29 A;  4OYV A;  1CE2 A;  1MPD A;  4KPT A;  1B1X A;  3KOT A;  2O51 A;  2KR0 A;  2NXO A;  3LBS A;  1BIY A;  4H0W A;  3E78 A;  2DWH A;  1SQY A;  3UN6 A;  1PB8 A;  3FIR A;  5HPQ A;  1SW4 A;  4HE1 A;  4H65 A;  3Q25 A;  3E9X A;  1FQB A;  2AYS A;  5CMC A;  3HHF A;  1JEU A;  4ESX A;  3T0J A;  3HCQ A;  1ZBM A;  2Y7W A;  4U2R A;  3IOV A;  4RJZ A;  2AIX A;  1LBB A;  3L6H A;  2I6E A;  2JJK A;  3JZJ A;  1SW5 A;  2R71 A;  4ECF A;  5DVI A;  3IOT A;  5KCJ B;  3ZKL A;  3QUF A;  3O29 A;  4GWZ A;  1LAF E;  1R6Z A;  5H8H A;  3GBA A;  1FQC A;  4U23 A;  3ONM A;  1P1N A;  2B65 A;  2HQ0 A;  3M3F A;  3PMW A;  1JQF A;  5L9S A;  2GHA A;  2UYF A;  1NUW A;  5H8H B;  2Z23 A;  2Y7I A;  4H5F A;  1B3F A;  1ZU0 A;  3MUQ A;  3PUX E;  5DT6 A;  4JWY A;  1JVX A;  1N3W A;  4DDD A;  4PFR A;  1SD3 A;  5I59 A;  2UXA A;  4P0I A;  4O3A A;  4QFK A;  4PTK A;  1AMF A;  4FAT A;  1QUI A;  4HTG A;  1IZ1 A;  2L5V A;  3H03 A;  3BKI B;  4MIJ A;  4MH5 A;  1ELJ A;  3UIF A;  1AIV A;  4JXI A;  3E3K A;  3SEU A;  4I1D A;  1GVC A;  1H3D A;  4EF2 A;  5K2X A;  1B3G A;  3JYR A;  5I59 B;  3KGC A;  2QVR A;  1MM7 A;  3HPI A;  3KC1 A;  1QKA A;  3FXR A;  3M3L A;  3TZA A;  2XXH A;  2VPO A;  2QS3 A;  3O9P A;  2AL5 A;  3OSR A;  3TTM A;  4HW8 A;  4ZEK A;  4LUB A;  2GRV A;  1GGG A;  1NUX A;  1NUZ A;  3C4M A;  3W9W A;  4DXU A;  4P56 A;  3C32 A;  1B6H A;  4F1Y A;  3MBP A;  3TTL A;  1B0H A;  1B1H A;  4LZ5 A;  4TLM B;  2D3I A;  5IZZ A;  2M8C A;  2Q2A A;  4H8J A;  4M1V A;  5TPA A;  4N15 A;  2F36 A;  4PFY A;  2DSF A;  1YAE A;  4LQ5 A;  2I3V A;  1PDA A;  2QS1 A;  4MJO A;  2DWA A;  2OX3 A;  1QVS A;  1IMA A;  1SW1 A;  1MXY A;  1FJ9 A;  3UGW A;  1A54 A;  3OD7 A;  3IB0 A;  4GX3 A;  3KJ7 A;  5TPA B;  1NFT A;  4LQ2 A;  3USD A;  1YZ0 A;  2V3U A;  3OMB A;  3S4U A;  4KI0 E;  1NNT A;  1UTB A;  3PGF A;  3CG1 A;  2XD2 A;  5EYF A;  1IUD A;  3QMF A;  4QXD A;  3VLU A;  2PMS A;  5TU0 A;  2DOJ A;  3SDF A;  2IEE A;  3HFU A;  5JK4 A;  4BDR A;  3IFC A;  3K4U A;  5LOM A;  1YXI A;  3H6U A;  2WYP A;  3B50 A;  5KZT A;  2WBD A;  4RYA A;  2F7B A;  3MYU A;  3PPQ A;  1H44 A;  1UTB B;  4YU0 A;  1JET A;  3IO4 A;  3K6W A;  1US4 A;  4XXU A;  3OEM A;  4F2O A;  4KXP A;  3TTR A;  2ZNU A;  5KDT A;  2ZZX A;  3IAZ A;  3RUM A;  2H9B A;  2VGQ A;  3E4R A;  1B0L A;  3FJG A;  4H5G A;  5CBS A;  4K3F A;  3GYY A;  1H45 A;  2R9J A;  3DLN A;  1NL5 A;  4NF4 A;  2QSX A;  5H8N A;  3LSF B;  4MNI A;  2CEX A;  4KQP A;  1B51 A;  5KDT B;  4JVI A;  3KEI A;  3N26 A;  1VFE A;  2O1L A;  2QVU A;  4NN3 A;  4NGU A;  4OFJ A;  4XEQ A;  1A8E A;  3ILU B;  1MDP 1;  1NV6 A;  4NF4 B;  1WOD A;  1SW2 A;  3K1P A;  2OBG A;  4BDM A;  1B3H A;  3VLW A;  3PUZ E;  1OQG A;  5AA2 A;  3MP6 A;  1N84 A;  3VV5 A;  4GWU A;  4RA1 A;  2GQ1 A;  3FVG A;  1ZJL A;  3D1R A;  1MY4 A;  4N8G A;  3TPA A;  1EYJ A;  4U4S A;  2P1S A;  5AA2 B;  2D5W A;  4MMP A;  4UA8 A;  1SDX A;  1A7L A;  2P2A A;  2Y5L A;  3ILT B;  4GFR A;  3MPL A;  5I58 A;  1FBG A;  1MQJ A;  3UK4 A;  3DM0 A;  3EF7 A;  3RGY A;  1S9T A;  1MY3 A;  5ET6 A;  3SER A;  1H76 A;  2XX9 A;  1Q35 A;  3A3C A;  1FTK A;  1M5D A;  4R74 A;  2V93 A;  3BFU A;  4NF8 A;  2FA7 A;  3EKI A;  5I58 B;  2V3T A;  3MZB A;  1PB7 A;  1Z7M E;  3H4Z A;  3S2V A;  1LBW A;  4MLQ A;  1B3L A;  1HSL A;  4GBW A;  2QMX A;  4OEU A;  4FBP A;  2CEY A;  1US5 A;  3JV9 A;  2G93 A;  4I3E A;  1VSO A;  2R6G E;  2Z22 A;  3LC8 A;  1FPI A;  4JSO A;  2A5T A;  2F78 A;  3NOH A;  2PT1 A;  1FPJ A;  1P1Q A;  1FPF A;  4JVC A;  5DVF A;  4U1Z A;  1BK4 A;  3MVY A;  2YJP A;  2XXV A;  2ANJ A;  4ZZE A;  2XXW A;  1PB9 A;  1B5I A;  5I3S A;  3I3V A;  1O7T A;  3QYT A;  3WAF A;  2A5T B;  4IB2 A;  3SEW A;  4QBA A;  5ISU A;  2REJ A;  4DCX A;  1B4Z A;  5ICT A;  1ZLQ A;  3BIH A;  2NWJ A;  1IXG A;  3PUW E;  5I5P A;  1FQF A;  3K2D A;  3O6H A;  3ROJ A;  3G3H A;  1EYK A;  5FTI A;  5IZ1 A;  1FQD A;  1TXF A;  1VDW A;  1XHY A;  4GIZ A;  3I5O A;  1SYH A;  5F7V A;  1M5E A;  4I40 A;  3FAT A;  5H8F B;  4NF0 A;  1SPI A;  1SI0 A;  4RPO A;  1FCK A;  3KFM A;  3KC0 A;  3MC2 A;  1Y3N A;  2QVV A;  1B7H A;  3IR1 A;  3K0V A;  4MFI A;  3KSJ A;  2B4L A;  4U22 A;  3MPK A;  3OEL A;  1USY H;  5H8Q B;  3MVZ A;  3QK6 A;  4XIG Q;  5LDZ A;  3OOA A;  2OCU A;  1M5B A;  1DTG A;  3K6X A;  3T93 B;  4YB6 A;  4LZ8 A;  5I84 A;  2CZH A;  3UP9 A;  3WAE A;  3FBP A;  3N5L A;  1QW0 A;  4HXV A;  4X8R A;  4X9T A;  1JW4 A;  4GOT A;  4F3P A;  5F1Q A;  4R6K A;  3SET A;  4H67 A;  1D4N A;  2Z8E A;  4GWY A;  4YKP A;  2PCR A;  3Q27 A;  5CC2 A;  1KA1 A;  4TLL B;  1OLA A;  4QFP A;  1NV0 A;  4OEN A;  1N0T A;  3O2A A;  2RC8 A;  3N94 A;  5EQ9 A;  4JWX A;  2WX9 A;  3S9L C;  1B7Z A;  1FPK A;  1QUJ A;  4O3B A;  3R7X A;  4RNS A;  3A09 A;  4PDD A;  1D9V A;  4NWD A;  1NKX A;  1MQI A;  3OO8 A;  3UA8 A;  4HE0 A;  4X1D A;  1JW5 A;  3PMX A;  4QSD A;  4G8H A;  2I0C A;  3PD9 A;  4MNP A;  1M5F A;  5T3J A;  4F2Q A;  4H8I A;  4G77 A;  3PPO A;  5L9O A;  3VDF A;  4OVT A;  4YKI A;  3BFT A;  1JNF A;  2Q2C A;  2IA4 A;  3CHG A;  3OEN A;  3FV1 A;  2XX8 A;  3M3K A;  4RY1 A;  5CRY A;  3BBR A;  1GV8 A;  4PFI A;  4Z7E A;  1UIU A;  3H6V A;  2HXW A;  4QFN A;  2QL3 A;  1PBP A;  4NE4 A;  4C1U A;  1D3K A;  1LFG A;  5IAI A;  2VT5 A;  5HBC A;  4PAK A;  5KCJ A;  4ISU A;  3PUY E;  3RTF B;  2NVU B;  1DMB A;  4BLA A;  5DYH A;  2O68 A;  2GFE A;  3W9V A;  2B4M A;  2F7C A;  4GX4 A;  2ZYM A;  2DE3 A;  1WVJ A;  4HE2 A;  3H7M A;  3LV0 A;  1TFA A;  3K01 A;  4YB5 A;  1MQD A;  4OQO A;  4E0W A;  1ATG A;  4FJP A;  4F19 A;  4F39 A;  4IO7 A;  2F6G A;  2ONR A;  1HSE A;  2HCA A;  2OK2 A;  2FHY A;  4GWO A;  4OVQ A;  2OJT A;  3E13 X;  4PBH A;  3CFZ A;  3FGS A;  3O6I A;  4OES A;  1FQE A;  1Y9U A;  1NV2 A;  2ALU A;  4WEP A;  5ET5 A;  3VXB A;  5AE4 A;  1VR5 A;  1LST A;  3E79 A;  3TCG A;  2OWT A;  5EQA A;  5AA4 A;  2QFL A;  4N91 A;  1AH5 A;  4H1X A;  1FQA A;  4PE3 A;  3QAX A;  4P9K A;  4R2B A;  3ZKK A;  1FPL A;  3O66 A;  4IO4 A;  1FBD A;  3KG2 A;  4G2Z A;  4GQO A;  1DPE A;  4F1U A;  1HSJ A;  5ICQ A;  1BKA A;  4DI3 D;  5AA4 B;  2DXR A;  2ZZW A;  1LFI A;  4GL8 A;  1JVY A;  4LAT A;  4R6Y A;  3K00 A;  2VHA A;  1I6B A;  4ZED A;  3RNN A;  4NF6 A;  3KSX A;  1POT A;  1LB8 A;  1XVX A;  2Q9T A;  3SEY A;  2ZMB A;  3GBB A;  5J16 A;  2REG A;  4ZZA A;  4KHZ E;  3T9H B;  5AA2 D;  5JEI A;  1FBH A;  4NF6 B;  1BLF A;  2Y7K A;  1NI9 A;  1AL3 A;  4PBQ A;  4XKR A;  1FBC A;  1MXX A;  2UVH A;  4N13 A;  3HN0 A;  3MST A;  2RC9 A;  2Y84 A;  2CMO A;  3RT6 B;  3D4C A;  4HCW A;  1H43 A;  3EHU A;  2V4C A;  4TQU Q;  1IEJ A;  1LGB C;  1FSA A;  1XOC A;  1D9Y A;  2XXX A;  3G7W A;  2Q88 A;  3FXB A;  1RYX A;  2H99 A;  1O64 A;  4BDL A;  4KFQ A;  2NOO A;  4KYS A;  4OMB A;  3RQT A;  4OZ9 A;  1PEB A;  4PC9 A;  4AQ4 A;  4MF3 A;  4MAG A;  1K9Z A;  2DS9 A;  2DQV A;  2WYK A;  4N6K A;  4N07 A;  3U92 A;  4KD5 A;  4ONY A;  4RK9 A;  4POX A;  2I49 A;  1Y4T A;  5CI5 A;  4GF8 A;  4GWS A;  1B9J A;  4YKJ A;  4O94 A;  3UOR A;  2Q8J A;  4PAF A;  2WKY A;  1JW1 A;  4IO6 A;  4C1T A;  3VLV A;  5A5L A;  3THI A;  2Q8M A;  3V8X B;  1PC3 A;  4N4U A;  4G4P A;  4H46 A;  5I57 A;  1B46 A;  5ET8 A;  3TEP A;  2FYI A;  2FIX A;  3DEL B;  2F97 A;  2XXR A;  5I2K A;  1UTH A;  3RT8 A;  3MP8 A;  2RCA A;  1FBP A;  4P1E A;  2HEU A;  5B70 A;  4Z0I A;  1LBZ A;  1I6Q A;  2O7I A;  3KBR A;  1QJM A;  3TMG A;  5I57 B;  2OLB A;  1DBZ A;  5FHN A;  2P0S A;  4ELP A;  4PFW A;  5F24 A;  4DI4 B;  5I2K B;  4MCO A;  4DZ1 A;  1UTH B;  1IMD A;  3U94 A;  4IO2 A;  2HZL A;  1NNK A;  3AXF A;  3OEK A;  1FBF A;  3IO6 A;  3RTW B;  1POY 1;  4G8N A;  5ITO A;  4GXA A;  3MW0 A;  1FTO A;  3TAJ A;  3F11 A;  1SBP A;  3CI8 A;  3CIJ A;  4KR5 A;  4XKQ A;  1NV5 A;  2ZYK A;  3OXN A;  3SES A;  2ZYO A;  1OVT A;  1MXW A;  1MXV A;  2QPQ A;  4M4G A;  2X7P A;  3H6W A;  1GTK A;  1YYZ A;  4JB7 A;  3K02 A;  3TTN A;  3MP1 A;  4PP0 A;  3FJM A;  4KCC A;  1NNP A;  3EN3 A;  4XKN A;  2FNC A;  5EYG A;  2F3B A;  3QUJ A;  3VFJ A;  3G3K A;  4EQ7 A;  4JWO A;  3OO9 A;  1A8F A;  3QIM A;  1TFD A;  4IGR A;  3PUV E;  1NMU A;  1B58 A;  4PE5 B;  2CZL A;  3CRB A;  2DVC A;  4LON B;  3PU5 A;  1LFH A;  1LB9 A;  4ELR A;  1Y1Z A;  3CSG A;  4WED A;  4X04 A;  1IMB A;  3FJ7 A;  5EHM A;  4EDP A;  2XXI A;  3VVD A;  2DE4 A;  3GLB A;  1FTL A;  4POW A;  2HFB A;  3KOS A;  4GBV A;  1J1N A;  3M8U A;  3RLF E;  4XFE A;  1B2H A;  4G68 B;  4F1V A;  1LAH E;  3B7D A;  4EXK A;  2FIE A;  4H6D A;  1QGX A;  1NV3 A;  2ZYN A;  5H8F A;  5L8D A;  1LBY A;  1XI6 A;  4BDN A;  2Y7R A;  1QUL A;  3H6T A;  3T66 A;  3TUS A;  1MM6 A;  5K2Y A;  1MH4 A;  1B52 A;  1ZTY A;  2ONK E;  1Y3P A;  2HPG A;  5H8Q A;  5DW8 A;  1DK4 A;  4ZDM A;  1FBE A;  1PBQ A;  3EHT A;  3IOU A;  2D21 A;  3IOR A;  4DCY A;  2O69 A;  1TWY A;  1BP5 A;  5TP9 A;  2KQZ A;  1G0H A;  4ZS9 A;  3MQ9 A;  4DLD A;  2VD2 A;  3O97 A;  1URS A;  3SEX A;  3B6T A;  3S9N C;  4OVP A;  4GVO A;  1N7W A;  5TP9 B;  4NMY A;  2Q74 A;  3PPP A;  5FHM A;  3T9U A;  3TQW A;  4R72 A;  4F22 A;  2BJJ X;  4F3S A;  1RDZ A;  2ZZV A;  4L17 A;  5M2V A;  1IME A;  1FPG A;  4FEC A;  4MHF A;  2DXY A;  1Y20 A;  5I7I A;  1LBV A;  3K6U A;  1EZO A;  2DWI A;  4WKM A;  3CSB A;  4MX6 A;  1FTJ A;  1ANF A;  1MDQ A;  1IIW A;  4O3C A;  2PVU A;  3OO7 A;  1B5J A;  3C9H A;  1NH8 A;  1LCT A;  2RF1 A;  1SYI A;  3PPR A;  1OQH A;  1B05 A;  2VD3 A;  3TKD A;  2ZNS A;  4BDQ A;  2HAV A;  3T9V A;  3KN8 A;  3RN8 A;  1A55 A;  1P1U A;  2XHD A;  3SZP A;  4P1L A;  4AS4 A;  1LEV A;  3R26 A;  3FXU A;  2KLF A;  1B5H A;  2B3B A;  1G0I A;  1B3E A;  2WBB A;  4R2F A;  2QJE A;  3RY3 A;  4EQB A;  1WDN A;  3KBZ A;  4NQ8 A;  4IGT A;  2V3Q A;  2F8D A;  2THI A;  1A40 A;  3G3G A;  4P47 A;  4DXB A;  3K1M A;  1XC1 A;  1Y1M A;  2X7Q A;  3C34 A;  4FAJ A;  3PMV A;  4NF5 A;  2YPN A;  3A3U A;  4X48 A;  3DP6 A;  3PV0 E;  3OO6 A;  2I0B A;  2O6A A;  3IB2 A;  4PFU A;  5DVJ A;  1P1O A;  4KYE A;  1A99 A;  2HAU A;  3C31 A;  4X1B A;  2Y7P A;  4Q30 B;  1YPN A;  2E0S A;  1QUK A;  2Z8F A;  5I2N B;  2XXT A;  3MJN A;  4GWW A;  4NF5 B;  1S7Y A;  3IJO B;  3MAM A;  5B7D A;  4ZEC A;  4P11 A;  4QRZ A;  1EYI A;  1N04 A;  2O7U A;  3VVE A;  3KZG A;  4TOZ A;  4QHQ A;  4DXC A;  5CMM A;  1FTM A;  1NV1 A;  5EQ7 A;  1MRP A;  4EUO A;  3B6Q A;  2PBW A;  4RK2 A;  4P8B A;  1IXC A;  1USY E;  5DEX A;  3IL1 B;  4FOR A;  3PD8 A;  3FUZ A;  2HXR A;  4GWX A;  5ELV A;  1MPC A;  4MBP A;  4IY5 A;  1DOT A;  1URG A;  4ESW A;  5J1D A;  2H5Y A;  1Y4C A;  4QF9 A;  4DE8 A;  5DEX B;  2DDK A;  3O28 A;  3HV1 A;  4EQ9 A;  4ZEB A;  2XXY A;  1KZ8 A;  4QSC A;  1RDY A;  2PFY A;  4JSD A;  4NWC A;  3Q28 A;  3R6U A;  4QFL A;  2PX1 A;  5AA3 A;  1ZKB A;  3FD3 A;  3H3G A;  4BDO A;  2UVI A;  2Z8D A;  1OLC A;  1OIB A;  4YAH X;  3LSL A;  3T22 A;  4OWD A;  4YMA A;  4XKP A;  4PF8 A;  4MNC A;  4FED A;  4LVQ A;  4PF6 A;  4UAB A;  2XWO A;  1DCU A;  4YZZ A;  5EQ8 A;  1MH3 A;  2ABH A;  5HM4 B;  5BUU A;  2Y5K A;  3N6T A;  2F5X A;  4ND9 A;  2QS2 A;  3SEV A;  1ZMG A;  2PYY A;  2UVJ A;  3T1B A;  4OXV A;  2OZZ A;  5AA1 A;  1YCJ A;  1MY2 A;  3MWB A;  1FRP A;  3QSL A;  4PAI A;  2R8T A;  4PQJ A;  2GHB A;  4GLI A;  4PCD A;  1AOV A;  3OSQ A;  2F34 A;  3U65 A;  1Y3Q A;  5IM2 A;  4G8M A;  1I6A A;  3FXQ A;  1R9L A;  3RPW A;  4OER A;  3DP8 A;  1QKB A;  1VE4 A;  3TDJ A;  3ODB A;  1MXU A;  1CB6 A;  1MXZ A;  3EHS A;  3VE1 B;  4ZEI A;  5A5X A;  1XT8 A;  4LN5 A;  2GH9 A;  1N7X A;  2I48 A;  4N6D A;  3ECR A;  4QSE A;  4ELQ A;  4Q8R A;  1ZIU A;  1DTZ A;  3LSX A;  4EXL A;  4OVR A;  4Q5T A;  4AB5 A;  4GD5 A;  2ONS A;  3U93 A;  2QS4 A;  3G3I A;  4LA9 A;  2X26 A;  4P3L A;  1KA0 A;  5FHO A;  4QFO A;  2WEF A;  5A5X B;  3B6W A;  3IX1 A;  3L6G A;  4NTL A;  1IMF A;  3KJT A;  3EPE A;  3T9X B;  4ZEF A;  3C36 A;  1FW0 A;  1EH3 A;  4WXJ A;  4R73 A;  4KYD A;  4N17 A;  1S50 A;  3KN7 A;  3FVO A;  5IKB A;  2DE2 A;  4PFB A;  1EU8 A;  1EZ9 A;  3FVN A;  4U1O A;  5ET7 A;  4IY6 A;  2H98 A;  1II5 A;  1MY1 A;  4O7I A;  1LBX A;  1P1W A;  3SKP A;  3FZV A;  3RPL A;  1LCF A;  3IK6 B;  3CG3 A;  2BJI A;  4LZ7 A;  3G3J A;  3ZSF A;  1URD A;  3EQ1 A;  1RYO A;  1RKM A;  3TEL A;  1XVY A;  2UVG A;  4DIG A;  4THI A;  3IFA A;  1OMP A;  2RCB A;  4NED A;  3DP4 A;  3FV2 A;  3MZ1 A;  2A5S A;  1R1N A;  1P99 A;  3RPL B;  4MEV A;  2CZK A;  4PFT A;  4YMB A;  3LSW A;  4RXL A;  1TT1 A;  4F3B A;  2XD3 A;  3GXA A;  5FTH A;  5I56 A;  1B4H A;  1I69 A;  4N6P A;  1K9Y A;  3LUZ A;  1SVX B;  1IQ7 A;  3I6V A;  2H4I A;  4Q0C A;  2F35 A;  2LAO A;  3PPN A;  2QRY A;  4R75 A;  3U1O A;  1NV7 A;  5H8N B;  2DWJ A;  1DPP A;  2RKM A;  2PFZ A;  4EF1 A;  5I56 B;  3BIG A;  3TCH A;  1JEV A;  1FPB A;  1N3X A;  4IO3 A;  1R9Q A;  4P0G A;  4XF5 A;  2I58 A;  1N76 A;  4GRK A;  3MVW A;  4I3Y A;  1NV4 A;  3P7I A;  3FAS A;  1Q1K A;  3V5A A;  1M5C A;  4ZE9 A;  4IO5 A;  3TQL A;  1CNQ A;  4I9D A;  4PDH A;  2FBP A;  2HHM A;  5DTB A;  3ZS6 A;  3QXM A;  4AB6 A;  2OWS A;  3TOD A;  4OET A;  2AL4 A;  4YB7 A;  2F6P A;  1MQH A;  3V89 B; 
#chains in the Genus database with same CATH homology
 4QXD A;  2FHY A;  3HFU A;  4MX6 A;  5JK4 A;  4OVQ A;  3IFC A;  1AWB A;  2OWZ A;  1YXI A;  2WYP A;  3B50 A;  5IZ3 A;  2WBD A;  4PBH A;  1NUY A;  4PET A;  3MYU A;  3RYD A;  4N81 A;  1NV2 A;  5ET5 A;  4OVS A;  4KXP A;  3E79 A;  2ZZX A;  3SZP A;  4P1L A;  4AS4 A;  2P3V A;  1LEV A;  5IZ3 B;  5EQA A;  3B8B A;  3GYY A;  2QFL A;  4N91 A;  1G0I A;  2WBB A;  4PE3 A;  4P9K A;  1FPL A;  1D9Q A;  2XXK A;  3KBZ A;  4MNI A;  4NQ8 A;  2V3Q A;  2CEX A;  5LTC A;  1FBD A;  2DVZ A;  4F1U A;  4JVI A;  4AS5 A;  3A29 A;  4O8M A;  4PGP A;  2QVU A;  4P47 A;  4NN3 A;  4OA4 A;  4NGU A;  4XEQ A;  4DI3 D;  1NV6 A;  4NG7 A;  2ZZW A;  3PTY A;  4NHB A;  4PGN A;  2VPN A;  4GWU A;  2GQ1 A;  2XWK A;  3D1R A;  2Q9T A;  4GWW A;  4N8Y A;  4N8G A;  5J16 A;  1EYJ A;  4HCY A;  4O7M A;  1EYI A;  4MMP A;  1FBH A;  3ISP A;  2Y5L A;  4PBQ A;  1NI9 A;  1FBC A;  1NV1 A;  4NX1 A;  5EQ7 A;  3MST A;  1FBG A;  4P8B A;  1FPD A;  4HCW A;  2MKZ A;  5ET6 A;  1IMC A;  2V4C A;  2F3D A;  2HXR A;  4GWX A;  1FSA A;  4H45 A;  5EYH A;  5CM6 A;  3EKI A;  3FXB A;  5J1D A;  1LBW A;  2FVZ A;  1INP A;  4PC9 A;  4F18 A;  4MAG A;  1K9Z A;  1FJ6 A;  2DDK A;  1JP4 A;  2WYK A;  4GBW A;  4N6K A;  4FBP A;  2XA5 A;  2CEY A;  1KZ8 A;  5FBP A;  1RDY A;  2PFY A;  4I3E A;  1FPI A;  2XWV A;  3NOH A;  4GWS A;  2HZK A;  1FPJ A;  4OAN A;  1FPF A;  4O94 A;  4JVC A;  1BK4 A;  4PAF A;  4NAP A;  4JVD A;  5I3S A;  5A5L A;  4G61 A;  2XWI A;  2Q8M A;  4IR8 A;  4QBA A;  5ESY A;  4N4U A;  1FPE A;  4PF8 A;  4H46 A;  4MNC A;  1RDX A;  4PF6 A;  4UAB A;  2XWO A;  5ET8 A;  1FTA A;  1DCU A;  4YZZ A;  3BIH A;  2FIX A;  5EQ8 A;  5I5P A;  2CZI A;  3ROJ A;  1Q9D A;  2Y5K A;  1EYK A;  2F5X A;  4GX6 A;  4YIC A;  5IZ1 A;  2P3N A;  1FBP A;  4P1E A;  1VDW A;  5IGA A;  1LBZ A;  3T1B A;  4I40 A;  1DBZ A;  2KR0 A;  1FRP A;  4PAI A;  2R8T A;  4NF0 A;  1SPI A;  5F24 A;  4DI4 B;  4MCO A;  3E78 A;  4PCD A;  1IMD A;  3U65 A;  5IM2 A;  3KC0 A;  2QVV A;  2HZL A;  4HE1 A;  2B4L A;  1FBF A;  3T0J A;  5LDZ A;  4LN5 A;  4N6D A;  2CZH A;  2JJK A;  1NV5 A;  4OVR A;  3FBP A;  4HXV A;  4P3L A;  4X8R A;  4X9T A;  2QPQ A;  4GWZ A;  1KA0 A;  2WEF A;  1YYZ A;  4GWY A;  2PCR A;  1IMF A;  1KA1 A;  5EYG A;  2F3B A;  1NV0 A;  4N17 A;  2DE2 A;  1NUW A;  4PFB A;  5EQ9 A;  5ET7 A;  2WX9 A;  4O7I A;  1FPK A;  1LBX A;  4PDD A;  4X04 A;  4PFR A;  1IMB A;  3RPL A;  2DE4 A;  4HE0 A;  4PTK A;  2BJI A;  4GBV A;  2L5V A;  4XFE A;  4MIJ A;  4MNP A;  4F1V A;  3IFA A;  5T3J A;  2FIE A;  1QGX A;  1NV3 A;  3RPL B;  1LBY A;  4MEV A;  2CZK A;  1XI6 A;  2QVR A;  4OVT A;  3KC1 A;  1K9Y A;  3LUZ A;  2VPO A;  3CHG A;  1NV7 A;  1NUX A;  1NUZ A;  2HPG A;  3W9W A;  5DW8 A;  1DK4 A;  2PFZ A;  4PFI A;  4P56 A;  1FBE A;  3BIG A;  1FPB A;  2KQZ A;  2VT5 A;  1G0H A;  4PAK A;  5IZZ A;  4M1V A;  4N15 A;  4XF5 A;  3W9V A;  2B4M A;  4I3Y A;  1NV4 A;  4MJO A;  4GX4 A;  2DE3 A;  2OX3 A;  1IMA A;  4OVP A;  1FJ9 A;  4HE2 A;  2Q74 A;  3LV0 A;  1CNQ A;  4GX3 A;  4PDH A;  1RDZ A;  2FBP A;  2HHM A;  1YZ0 A;  2ZZV A;  1IME A;  1FPG A;  4MHF A;  5I7I A;  4F19 A;  3QMF A;  1LBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...