2XXKA

Siap complex
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPDAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siap Complex
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
total genus 124
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xxkA00
4OVSA 2HPGA 4MEVA 4P56A 4PAFA 4PF6A 4N15A 2ZZXA 4NN3A 2ZZWA 5IM2A 4PFRA 2WYPA 5I7IA 4N4UA 4P3LA 4PDHA 4XEQA 4P1EA 2XA5A 4PE3A 4PETA 4P1LA 4XF5A 4YICA 4OVQA 4OANA 4PCDA 4NGUA 4YZZA 4NG7A 4MNPA 2V4CA 4XFEA 4X04A 2WYKA 4PBQA 5IGAA 4OVRA 4NF0A 3B50A 5LTCA 4P8BA 2XXKA 2VPNA 4PF8A 4PGNA 2XWVA 4MHFA 4OVPA 5IZZA 4NHBA 4N6KA 4PBHA 4PFBA 5CM6A 2ZZVA 2HZLA 5I5PA 4O94A 4X8RA 3U65A 4DI4B 4PAKA 2XWKA 4MCOA 4MIJA 4NAPA 4PFIA 3FXBA 4P47A 4MNCA 4O7MA 3GYYA 4MAGA 2XWOA 2PFZA 2CEXA 4N8GA 4N91A 4UABA 4OA4A 2VPOA 4NX1A 4N17A 4N8YA 2XWIA 4DI3D 4MMPA 2PFYA 4PGPA 4LN5A 4PAIA 4PC9A 4P9KA 2WX9A 4N6DA 4OVTA 2CEYA 4MX6A 4NQ8A 4MNIA 4O8MA 2HZKA 4PDDA
chains in the Genus database with same CATH superfamily
1SW4A 3B7DA 1DTGA 4P56A 5ICTA 3H03A 2I0CA 4JVDA 4H67A 5AA2B 1QGXA 4GBVA 4NWCA 3USDA 1FSAA 3EHUA 1BK4A 4H8JA 4AS5A 2THIA 4PETA 1G0HA 3I6VA 1QULA 2Y5KA 4F3PA 1M5CA 1N7WA 4OXVA 1PEBA 4HTGA 4R74A 4DXBA 3WAFA 3TCHA 3ONMA 4NEDA 5M2VA 4JSDA 3EHSA 4O7IA 3TCGA 1HSLA 1IQ7A 2DYXA 4O3CA 3M3KA 1FQFA 2YLNA 3KBZA 4PFBA 5T3JA 4YB7A 1AMFA 5DW8A 1FBGA 4H0WA 3H6WA 3IK6B 3UGWA 2E0SA 2L5VA 1NL5A 5HM4B 3RPLB 2PVUA 3GBAA 3ZSFA 1EZPA 1NV4A 1FPLA 3FGSA 4DIGA 5L9MA 2NUVA 1WDNA 1XI6A 3ODBA 3GBBA 2Z22A 4X9TA 3P7IA 1LFHA 4H65A 1II5A 4XXUA 2REJA 3NOHA 4GWYA 3VFJA 2I0BA 4GOTA 1H43A 3LR1A 2Y84A 3OELA 2Z23A 2IA4A 1NV1A 4OHNA 4KYDA 1T0KA 3QMFA 3O9PA 3H06B 1MQIA 1CNQA 1CB6A 3S9EA 2ABHA 1Z7ME 2HFBA 4OMBA 1NNFA 1ZJLA 3RTWB 1ZMGA 2DDKA 2ZYMA 3OSRA 4GBWA 5H8HB 1TWYA 4JVIA 4NGUA 1SPIA 4R73A 1B3LA 1O64A 4YMAA 1KA1A 1LCFA 4RNSA 5ITPA 4FATA 4OENA 3CI8A 3VXCA 4MLVA 2XXWA 2Q8MA 1OLCA 3HO7A 1K9YA 4ECFA 1MM6A 3CIJA 2OWSA 4MHFA 1FPBA 5H8HA 3OEMA 3A3CA 2HXRA 3RGYA 1VE4A 4LQ5A 3L6GA 2QMWA 4PFIA 3SDFA 4P11A 3FXBA 4NF6A 4E0XA 1LLSA 1QW0A 2H5YA 2PCRA 1TT1A 1D9QA 4UA8A 4LA9A 4MH5A 1XVXA 1QKAA 4MAGA 4HE0A 3E9XA 5KCJB 3FZVA 3KOSA 3O6HA 4IO4A 3B8BA 3RT6B 3UA8A 4ISUA 1LBCA 4GWXA 3I3VA 4LN5A 2Z8EA 4OWDA 2GQ1A 4ZECA 1LBZA 4JBZA 3O29A 2YPNA 1SW1A 3C34A 4MEVA 2H4IA 2QVVA 1B40A 4BDRA 4WKMA 2PMSA 5EQ7A 1A7LA 1OQGA 2VD2A 4PDHA 3IR1A 1NNTA 4PE3A 3FXQA 5CMKA 1FW0A 1B58A 4RK2A 3VDFA 3MVXA 5H8FA 4MNPA 5AA3A 4QXDA 1Y4TA 2XXXA 3IB1A 4HE1A 4FECA 1JP4A 1NKXA 4F3GA 4EDPA 1B4HA 4H8IA 2WBBA 1A8EA 1I6AA 3PTYA 5K2YA 4NF4A 5J16A 4IO7A 3TTKA 5AA1A 5B7DA 4PGNA 4U2RA 2QSXA 1B7ZA 1MPDA 4KQPA 1POTA 2HQ0A 2RCBA 1CE2A 5TPAB 1DBZA 3C33A 4EQ9A 1SVXB 4ELOA 3OMBA 3VLVA 4IO5A 4ZEFA 2F36A 4QSEA 3RNNA 2CEXA 3MP1A 3LUYA 4R9FA 2P0SA 3MVYA 3PPOA 2UVHA 5L9OA 1Y3PA 2XXRA 4NWDA 3G3IA 1OVBA 4NF8B 5KZTA 2AYSA 1YZ0A 1FBFA 4MNIA 4LONB 5FTIA 4GIZA 4ELRA 1IMCA 3L6HA 4G68A 2HHMA 3FASA 2ZZXA 3M3FA 2ZZWA 1VFEA 3R7XA 2G29A 5I7IA 2QVRA 2ZYKA 4I40A 4KD5A 2X7QA 4ONYA 3MZBA 3G3JA 1XHYA 4GRKA 3MC2A 4KFQA 2F35A 4RY1A 2M8CA 4ELQA 5B70A 1MH3A 2XX7A 3TMGA 1SI1A 5TP9B 1B52A 2XWVA 3U94A 4DXUA 2UVIA 4OERA 3VV5A 3FD3A 2AIXA 5ISUA 4NAPA 1NV3A 1NUWA 3IFAA 2Q88A 2F6PA 3OEKA 4G68C 4ESWA 1P1WA 5I3SA 1NV6A 3SEXA 3UP9A 2HXWA 3DP4A 2QFLA 3T9XB 1QVSA 5FHMA 2DXYA 5AA2A 1MDQA 3GZGA 4YKKA 4R9GA 5CMCA 2JJKA 2UVJA 5FHNA 5K2XA 1B3FA 5H8QB 2ONSA 2FYIA 3KN8A 4PQJA 2I58A 5I57B 1B3HA 4XKRA 2Q89A 3RYDA 2KQZA 3ILUB 2I4BA 4GVOA 1WVJA 4N15A 3IOUA 2VHAA 4P3LA 2OJTA 2O1MA 3VVEA 2OWTA 2B4MA 4FEDA 2VD3A 3T0JA 3FIRA 2WKYA 1IMAA 4NG7A 3TTRA 4GX4A 5I57A 2O7IA 1FTAA 4OVJA 4ZE8A 4R72A 4PBQA 4GX3A 2LAOA 4ZEKA 1A54A 3R26A 4JDFA 4NF5A 3RPLA 1P1OA 2F7AA 4IO2A 3H6VA 4AB5A 1LAGE 2VPNA 1BKAA 1R1NA 1WODA 3T9HB 5CRYA 5I56B 1S50A 4QSCA 3PPNA 1FPEA 3PPPA 1ZU0A 4NHBA 5L9SA 1DPEA 3HN0A 1DCUA 1EZ9A 2V84A 1PB8A 2F3DA 4H46A 5LDZA 1ZIUA 1EYJA 5EYGA 1MG1A 2B4LA 4O7MA 3TQWA 2B3BA 2XD2A 2ANJA 3W15C 4N8GA 4G2ZA 3FJ7A 2F34A 3ROJA 4POXA 1NNPA 1NI9A 3K00A 3FJMA 4F1UA 3MZ9A 2V25A 3MW0A 3EKIA 1IMBA 1SW2A 3GLBA 1B2HA 2ZMBA 2FIEA 1FBPA 5EYHA 1BLFA 2HZKA 4U4SA 3DLNA 3KSJA 4EF2A 4NTLA 4U1ZA 4TLLB 2REGA 4GWZA 4BDOA 3JYRA 4IO3A 1IMDA 1NUYA 1PBQA 1PC3A 5ET5A 2XXUA 3KZGA 4GQOA 4HS7A 1YXIA 1DMBA 2QS1A 4X04A 4PFUA 3K01A 2RF1A 1B05A 1MXUA 1R9QA 3IO4A 5DEXA 4YKPA 3CHGA 1URDA 1XOCA 2I3WA 1AOVA 4NMYA 4F31B 1P99A 3M3LA 3FV2A 1JNFA 2DE2A 1A55A 2OK2A 3K1NA 5FTHA 3OO9A 4PF8A 2OZZA 1OQHA 3O66A 1KA0A 2HEUA 2RKMA 1D9VA 3RTFB 3CG3A 4PAKA 4POWA 2XX9A 1M5FA 1MXYA 1NUXA 4MCOA 4DE8A 5CBSA 2OLBA 1I6BA 1VR5A 3KN7A 3G3KA 3BKIB 4PFYA 1Y20A 4LP2B 2W7YA 3LSLA 4N91A 1JQFA 1YYZA 1QJMA 5DVIA 1M5EA 4N13A 2XWIA 1MS7A 5I59B 3PGFA 5TU0A 1B32A 2MKZA 4KCDA 3O2AA 4G77A 3C9HA 2P1SA 2F8DA 4NF6B 5L8DA 1NFTA 2HAVA 5IKBA 2FHYA 1IXCA 1JEUA 4PF6A 4LZ5A 4U1OA 2RC9A 1VDWA 2PBWA 5KCJA 4QFPA 3MJNA 2WBDA 3V8XB 1N3XA 3PD9A 1P1QA 2ONKE 4PCDA 3S9LC 2F78A 4JWYA 1GV8A 3RLFE 3FXUA 4GWWA 4OETA 4PFTA 4XFEA 1MXWA 3T9UA 3EF7A 1LBWA 1DK4A 5ET7A 4JXIA 1FBDA 1AH5A 3MBPA 2DS9A 2DE3A 4NF0A 1IZ1A 2V3QA 3S9NC 3B50A 1Q35A 3H6UA 3IL1B 3T93B 4R6HA 1F9BA 3LUZA 3E13X 5AA2D 3PMWA 2O1LA 3LBSA 3IOVA 2KLFA 3Q27A 2XWKA 2UYEA 3T96B 2A5SA 3U1OA 1YCJA 4ZE9A 3CFLA 2DWAA 4C1TA 3E79A 1ELJA 3CRBA 4ESXA 2Y7WA 3F11A 1J1NA 4YU0A 1FTMA 1SYHA 3O28A 3D1RA 3SEUA 3K4UA 1JW1A 5J1DA 4OQOA 2YJPA 5A5LA 1SQYA 2WX9A 1PB9A 2CEYA 1NUZA 1IXIA 3H4ZA 2O7UA 3CG1A 4GWOA 2F5XA 4Z7EA 2Y7RA 3G3HA 2XA5A 4U21A 5I2NB 3EN3A 1FJ6A 1US4A 4NF8A 3K1PA 2O84X 4GD5A 4UACA 2QS3A 4X48A 2VGQA 2G93A 4H5FA 1AWBA 4DCYA 2RINA 4OEVA 3KC0A 4RPOA 5EQ9A 2ONRA 3FXRA 3TAJA 3TQLA 3KG2A 1MY0A 5EHMA 4DLDA 4EF1A 3E4RA 2DVCA 3BIHA 4OVPA 3K0VA 2P2AA 2F7CA 4N6KA 1NH7A 3KJ7A 1H45A 2Y7PA 1MPBA 4NE4A 4KYSA 3QAXA 2VT5A 4THIA 2Q74A 4MNCA 1FPKA 2H25A 2Z8DA 1XS5A 4KYEA 5I58A 2PFZA 2PX1A 2OCUA 4RJZA 1LSTA 3VVFA 4H5GA 3K2DA 3TTLA 1LAFE 3TEPA 4QFOA 3A09A 2DWIA 3Q29A 1LB8A 3KBRA 4ND9A 4HCYA 1OVTA 5F1QA 3TPAA 5JK4A 1NH8A 4NF5B 3K6WA 2R71A 1B0HA 3BIGA 2VOZA 4RA1A 2QS4A 5I56A 3C31A 4YICA 4XKPA 2FA7A 2CZLA 1QKBA 4U23A 4XKQA 1IMEA 1UQWA 5FBPA 3E78A 3FUZA 1TFDA 1MM7A 3KN3A 5EYFA 3TYHA 1Y4CA 2DWJA 2E1SA 3OOAA 2XXKA 1I6QA 1B51A 4PFWA 1EYKA 2CZHA 1A99A 1SW5A 3K6XA 3MUQA 2P3VA 1UTHB 2BJIA 4BDMA 3ILTB 5EQ8A 2XXTA 1EYIA 2Z8FA 4U22A 1O63A 3OD7A 1FBEA 4TLMB 3U8QA 4G4PA 4P0GA 4UABA 4DXCA 1FQCA 2FVZA 5A5XB 3KOTA 4DI3D 4LVQA 3HHGA 4XTCQ 2IEEA 4PC9A 3B6QA 1IXGA 2ZNTA 3C4MA 1YAEA 3FJGA 4O8MA 2F3BA 2V93A 1ZTYA 1GGGA 1FBCA 1QUJA 3VE1B 5DEXB 5EQAA 3SEWA 2HAUA 4PFRA 2RCAA 1Q1KA 1NV0A 5A5XA 4MF3A 1H76A 4FJPA 4JB7A 4XF5A 2UXAA 4H6DA 5ELVA 4YZZA 4OZ9A 3IAZA 5F24A 1Y9UA 3C35A 4RK9A 3Q28A 3QYTA 4WEPA 4EXKA 3GXAA 5LTCA 3QSLA 3JV9A 3RPWA 1M5BA 4PBHA 1FBHA 5I5PA 4X8RA 4DI4B 5IZ1A 2KR0A 4H45A 2XXVA 5CMMA 3OXNA 1GR2A 4N07A 4EXLA 1Z7NE 2PT1A 4GF8A 3GYYA 2XD3A 2O6AA 3UORA 2XWOA 2DVZA 4RXLA 3N5LA 1LAXA 1HSJA 1KWHA 1LBBA 1K9ZA 4BDQA 4QFKA 3S4UA 2R8TA 2AL5A 4P9KA 2QVUA 2GRVA 4MX6A 2A5TA 3OO7A 4KI0E 3MPLA 2ZYOA 3ZKKA 1B5IA 4R6YA 3T66A 3EQ1A 4DZ1A 3O97A 2QRYA 4PAFA 1MY4A 5ICQA 1MY1A 4F29A 4I1DA 4MFIA 1PDAA 3PD8A 1FTKA 3BFTA 3W9WA 4F3BA 5I59A 2I48A 3PUWE 5BUUA 3O6GA 3K6UA 2A5TB 2AL4A 3PU5A 1A8FA 4R2FA 1DOTA 4QSDA 5AE4A 5IGAA 4MLQA 4OVRA 2OX3A 3TFLA 1MXXA 4RYAA 4LZ7A 4OYVA 1RYOA 1IEJA 2CZIA 1FQEA 4X1BA 4KPTA 1OLAA 1LGBC 3MYUA 5H8FB 2RC8A 3VVDA 3U65A 5JEIA 2Y7KA 3U72A 4F22A 5HBCA 1B0LA 3TKDA 1N7XA 3UIFA 5IZ3B 4FORA 1UTBA 1Q9DA 4G68B 4FAJA 1RDZA 1ZLQA 4IO6A 5LOMA 3H7MA 4GWSA 4DDDA 1ANFA 5I84A 5JTYB 5H8NB 1N84A 3CSBA 1B5JA 4R2BA 3I5OA 3HCQA 1FRPA 3DM0A 3LSWA 4IB2A 3MP8A 4QHQA 1FQAA 4N81A 2GH9A 3K1MA 4GXSB 5CMBA 3C32A 1POY1 2OWZA 4LZ8A 3RUMA 3SEYA 1IXHA 3HFUA 1DPPA 4GWUA 4NN3A 3IO6A 3MZ1A 1G0IA 1S7YA 4XEQA 3CR9A 2ESNA 1MXZA 3S2VA 5IAIA 1FQBA 2X7PA 3PMXA 3KSXA 4ZZAA 4F2QA 4JWXA 4O3BA 3H6TA 4L17A 2NOOA 2OBGA 4AQ4A 2PYYA 3HPIA 1LAHE 1D9YA 1LB9A 3EPEA 4BDNA 1B5HA 2ZYNA 1MPCA 3E3KA 4M1VA 5CM6A 3N6TA 1M5DA 1H3DA 4O94A 2I49A 3HSTA 4PP0A 4YB5A 1HSEA 3O6IA 4R6KA 1XC1A 1B7HA 5HPQA 4IY6A 1B1HA 3RN8A 4OTEA 4KCCA 5DTBA 4ZZEA 3N26A 3UK4A 3A29A 1DTZA 5F7VA 3PV0E 4MJOA 3LV0A 3T9VA 5CBRA 1N04A 1MY2A 4XKNA 4F2OA 4QRZA 2CZKA 3QIMA 4PAIA 1D3KA 2UVGA 3R6UA 3PUXE 3CFXA 2FIXA 1MDP1 3A3UA 4NQ8A 2X26A 1B6HA 2O69A 3SEVA 4EQ7A 3QUJA 1OMPA 3V83A 1RKMA 2NVUB 3HHFA 1LBVA 5I58B 1B9JA 4F19A 4Q8RA 4FBPA 4RPNA 4HW8A 2BJJX 4P1EA 5DVJA 1ZKBA 5H8SA 1FQDA 4IGTA 1XVYA 1TXFA 2VP1A 4ZEIA 1BTJA 2HCAA 3LSFB 3U93A 3DP6A 3Q26A 4GLIA 4ZEDA 3T1BA 2Q2CA 4O3AA 3TUSA 3SETA 3FVGA 1D4NA 3K02A 2FNCA 3PUZE 1PB7A 4JSOA 4C0RA 2D21A 1RYXA 3D4CA 3BBRA 2XXIA 4AS4A 3V89B 4G61A 3ECRA 5AA4A 1FTOA 3MQ9A 3VXBA 2ZNSA 3HV1A 3SESA 4Q0CA 3CFZA 1BP5A 3THIA 3PPQA 4EUOA 1Y1MA 4QFLA 2ZZVA 3RY3A 3B6WA 3OSQA 1FTLA 4I3EA 1IITA 4JVCA 1B3GA 2V3UA 1VSOA 4I62A 1NV5A 1LFGA 3IJXB 4I9DA 3LSXA 4F1VA 2ZNUA 5AA4B 1JW4A 2ZXTA 3G3GA 3H3GA 3G7WA 5DVFA 2UYFA 3SZPA 3SKPA 1SYIA 2PFYA 1ATGA 2NWJA 1SDXA 4GXAA 3V5AA 2Q9TA 1UTHA 1VFDA 4KHZE 3VLUA 1N76A 3IORA 4OVSA 2HPGA 2XXHA 1MH4A 4FE8A 1FPGA 2O51A 2QJEA 2I3VA 5IM2A 4F3SA 4OFJA 4YAHX 2DP8A 2WYPA 3UN6A 1EZOA 1IMFA 4HXVA 1FTJA 3IOWA 3BFUA 1FPIA 3AXFA 1S9TA 4I8CA 4P1LA 2DE4A 5CC2A 2D5WA 1B4ZA 2V4CA 1LEVA 3Q25A 2RC7A 1UIVA 3TTNA 1JVYA 4U4XA 3B6TA 4JWOA 4E0WA 3RQTA 1MQJA 2I6EA 3N94A 4KXPA 2F7BA 3QUFA 4KR5A 4I3YA 3IFCA 1JW5A 4GFRA 1GVCA 3PUYE 4R75A 4P8BA 1NNKA 1PBPA 1B7UA 5IZZA 2GHAA 3N6UA 1MQHA 5KDTB 1URSA 4YKIA 3DP8A 4P47A 2Q2AA 2Y5LA 5ET8A 1NV2A 3D4GA 2QL3A 3U92A 2NXOA 4X1DA 1YTVA 4G8NA 3MVWA 4OA4A 4N6PA 4QF9A 4FEBA 4IGRA 4Q30B 1YPNA 4NX1A 4N17A 1MQDA 1UIUA 1INPA 5KDTA 4PGPA 2F6GA 4OFOA 4HCWA 1B1XA 4Z0IA 3PUVE 1KZ8A 4OVTA 2R9JA 3PPRA 4H1XA 3C36A 3MPKA 2XXQA 4K3FA 2Q8JA 3TCFA 1MQGA 4ZDMA 4Q5TA 3DELB 1SD3A 4BDLA 3QK6A 4N4UA 1BIYA 5BWJA 1DSNA 3IX1A 4TQUQ 3FV1A 5DT6A 3W9VA 1XT8A 1RDYA 1MY3A 3TZAA 3LC8A 2DSFA 1Y1ZA 2DWHA 4TOZA 2CMOA 2DXRA 4ZS9A 1OIBA 3TELA 1UTBB 2XXPA 5ITOA 4WXJA 4GX6A 1MXVA 4IR8A 3KJTA 4LUBA 3FBPA 2GFEA 4OESA 3KFMA 1JETA 3OO8A 2QS2A 2XHDA 5JTYA 3VLWA 4YB6A 3FVNA 4BLAA 1QUIA 3SERA 1SBPA 1LBYA 2B65A 4MIJA 3KEIA 4G8MA 4HE2A 1USYE 2B3FA 3MSTA 1JVXA 3JZJA 3MP6A 4OFLA 4MBPA 4NF4B 4YKJA 1RDXA 4ELPA 3IB2A 4FIMA 2VPOA 4N8YA 4YMBA 5I2NA 3T22A 4MMPA 3ISPA 1LFIA 3RT8A 3MVZA 1IIWA 1IUDA 4N6DA 3S9MC 5FHOA 4XIGQ 5IZ3A 4PE5B 5TPAA 2GHBA 4QBAA 3IOTA 1B3EA 3IJOB 1I69A 1O7TA 1US5A 2DOJA 2PT2A 2QPQA 3QXMA 1FPFA 3KC1A 1L5TA 1FPJA 4IY5A 5H8NA 1P1NA 4WEDA 4GL0A 1R9LA 2P3NA 3CVGA 3OENA 3M8UA 4OVQA 4OANA 4ZEBA 1TFAA 4G8HA 4DCXA 2XX8A 1EH3A 1B46A 5CI5A 1LBXA 2O68A 3MAMA 2I4CA 1Y3QA 2WYKA 3FATA 3G3FA 4LATA 4GL8A 3K6VA 1N0TA 5ESYA 1H44A 1MRPA 1JEVA 2Y7IA 2D3IA 1A40A 2V3TA 1ZBMA 1LCTA 1N3WA 1NMUA 2H99A 1USYH 3ZS6A 2H98A 2HZLA 2FBPA 4M4GA 5H8QA 4F18A 3IB0A 4AB6A 5ET6A 3ZKLA 3TDJA 5I2KA 1FCKA 2DQVA 4P0IA 2H9BA 1AIVA 3TODA 5EHSA 1URGA 3TTMA 3WAEA 4QFNA 4PTKA 4C1UA 1R6ZA 3CSGA 3MWBA 1FPDA 2WEFA 4F39A 3FVOA 1FJ9A 3EHTA 1EU8A 4LQ2A 2ALUA 1GTKA 1Y3NA 2R6GE 5TP9A 1SI0A 2XXYA 1NV7A 3FVKA 4OEUA 5I2KB 5DYHA 1P1UA 2F97A 2QMXA 3KGCA 4EQBA 1QUKA 3PMVA 3OO6A 4PDDA 4F1YA 1AL3A
chains in the Genus database with same CATH topology
2F3BA 2KQZA 2OWZA 1IMCA 4OVSA 2HPGA 4MEVA 2FHYA 1FPGA 2QVVA 4P56A 1FBCA 2HHMA 3HFUA 4GWUA 4HCYA 4PAFA 4PF6A 1LBVA 2ZZXA 4N15A 4NN3A 2ZZWA 4JVDA 2QPQA 1NV1A 1FPFA 1VDWA 2F5XA 5EQAA 5IM2A 1QGXA 5JK4A 3QMFA 4GBVA 4PFRA 2WYPA 5EQ7A 3KC1A 1G0IA 4F19A 1FPJA 1FSAA 5I7IA 1BK4A 1NV0A 4FBPA 2QVRA 4N4UA 4P3LA 4PDHA 1CNQA 4P1EA 4XEQA 2XA5A 1IMFA 4AS5A 4HXVA 2WBDA 3BIGA 4I40A 4PE3A 4GWZA 4PETA 1G0HA 2B4MA 2P3NA 3W9WA 1FPIA 2DDKA 1FJ6A 2DE4A 4P1LA 1IMDA 4XF5A 1RDYA 3T0JA 2Y5KA 4GBWA 4OVQA 4OANA 4YICA 3W9VA 4JVIA 4NGUA 4PCDA 1SPIA 1NUYA 1IMAA 4YZZA 4NG7A 3T1BA 4GX4A 4MNPA 2V4CA 1LEVA 4GWWA 4XFEA 5ET5A 1LBXA 1YXIA 1KA1A 4X04A 4QXDA 5F24A 1FTAA 4HE1A 2WYKA 1LBWA 1JP4A 4PBQA 1DK4A 1IMEA 5IGAA 5ET7A 1FBDA 4KXPA 5FBPA 4GX3A 4GX6A 4OVRA 2OX3A 5ESYA 3CHGA 1AWBA 4O7IA 4I3YA 4AS4A 4IR8A 3IFCA 3E78A 2WBBA 2DE3A 3KC0A 3PTYA 4G61A 5EQ9A 4NF0A 3FBPA 2Q8MA 3RPLA 5J16A 2V3QA 1K9YA 3B50A 5LTCA 4P8BA 5EYGA 2DE2A 2CZIA 2XXKA 2VPNA 3BIHA 4PF8A 4PGNA 2XWVA 4MHFA 4OVPA 1FPBA 5IZZA 3LUZA 3KBZA 4NHBA 1FPEA 4M1VA 4N6KA 1KA0A 4PBHA 4PFBA 5CM6A 2ZZVA 3MYUA 1EYKA 1FBHA 2HZLA 2FBPA 5I5PA 5T3JA 1DCUA 2HXRA 2CZHA 4F18A 4O94A 4X8RA 5DW8A 3U65A 1FBGA 1LBYA 4PAKA 5ET6A 5IZ1A 2XWKA 5EQ8A 4DI4B 2KR0A 4H45A 2F3DA 2P3VA 4MNCA 1NUXA 4MCOA 4H46A 4MIJA 4NAPA 5LDZA 4HE2A 2BJIA 4I3EA 1NV3A 4PFIA 5IZ3B 2VT5A 1EYJA 3FXBA 2Q74A 3MSTA 1EYIA 4P47A 1NUWA 1FPKA 3IFAA 1DBZA 2L5VA 2Y5LA 1NV2A 1Q9DA 2PCRA 3E79A 4JVCA 4PTKA 5ET8A 2B4LA 1D9QA 1NV6A 5I3SA 1NV5A 4O7MA 3A29A 1FPDA 2QFLA 1FBEA 2WEFA 3GYYA 3RPLB 1RDZA 4F1VA 4MAGA 1FJ9A 4HE0A 2XWOA 1NV4A 4GWSA 2PFZA 2DVZA 1FPLA 3LV0A 4MJOA 1RDXA 2CEXA 4N8GA 4N91A 3ROJA 4UABA 1NI9A 4OA4A 1YYZA 1XI6A 2FVZA 2JJKA 2VPOA 3D1RA 4F1UA 3B8BA 4NX1A 4N17A 1NV7A 4N8YA 5J1DA 2XWIA 1K9ZA 3SZPA 4MMPA 4DI3D 3ISPA 1INPA 2CZKA 2PFYA 4PGPA 1FRPA 4GWXA 4LN5A 2R8TA 4PAIA 4X9TA 5A5LA 4PC9A 4P9KA 4HCWA 4QBAA 2WX9A 2MKZA 3EKIA 1IMBA 2FIXA 1KZ8A 2Q9TA 4N6DA 4OVTA 2CEYA 2QVUA 4N81A 2GQ1A 1NUZA 3NOHA 4GWYA 4MX6A 5IZ3A 1LBZA 1YZ0A 1FBFA 4NQ8A 4MNIA 2FIEA 1FBPA 5EYHA 4O8MA 2HZKA 4PDDA 3RYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVS A;  2HPG A;  4MEV A;  4P56 A;  4PAF A;  4PF6 A;  4N15 A;  2ZZX A;  4NN3 A;  2ZZW A;  5IM2 A;  4PFR A;  2WYP A;  5I7I A;  4N4U A;  4P3L A;  4PDH A;  4XEQ A;  4P1E A;  2XA5 A;  4PE3 A;  4PET A;  4P1L A;  4XF5 A;  4YIC A;  4OVQ A;  4OAN A;  4PCD A;  4NGU A;  4YZZ A;  4NG7 A;  4MNP A;  2V4C A;  4XFE A;  4X04 A;  2WYK A;  4PBQ A;  5IGA A;  4OVR A;  4NF0 A;  3B50 A;  5LTC A;  4P8B A;  2XXK A;  2VPN A;  4PF8 A;  4PGN A;  2XWV A;  4MHF A;  4OVP A;  5IZZ A;  4NHB A;  4N6K A;  4PBH A;  4PFB A;  5CM6 A;  2ZZV A;  2HZL A;  5I5P A;  4O94 A;  4X8R A;  3U65 A;  4DI4 B;  4PAK A;  2XWK A;  4MCO A;  4MIJ A;  4NAP A;  4PFI A;  3FXB A;  4P47 A;  4MNC A;  4O7M A;  3GYY A;  4MAG A;  2XWO A;  2PFZ A;  2CEX A;  4N8G A;  4N91 A;  4UAB A;  4OA4 A;  2VPO A;  4NX1 A;  4N17 A;  4N8Y A;  2XWI A;  4DI3 D;  4MMP A;  2PFY A;  4PGP A;  4LN5 A;  4PAI A;  4PC9 A;  4P9K A;  2WX9 A;  4N6D A;  4OVT A;  2CEY A;  4MX6 A;  4NQ8 A;  4MNI A;  4O8M A;  2HZK A;  4PDD A; 
#chains in the Genus database with same CATH topology
 1SW4 A;  3B7D A;  1DTG A;  4P56 A;  5ICT A;  3H03 A;  2I0C A;  4JVD A;  4H67 A;  5AA2 B;  1QGX A;  4GBV A;  4NWC A;  3USD A;  1FSA A;  3EHU A;  1BK4 A;  4H8J A;  4AS5 A;  2THI A;  4PET A;  1G0H A;  3I6V A;  1QUL A;  2Y5K A;  4F3P A;  1M5C A;  1N7W A;  4OXV A;  1PEB A;  4HTG A;  4R74 A;  4DXB A;  3WAF A;  3TCH A;  3ONM A;  4NED A;  5M2V A;  4JSD A;  3EHS A;  4O7I A;  3TCG A;  1HSL A;  1IQ7 A;  2DYX A;  4O3C A;  3M3K A;  1FQF A;  2YLN A;  3KBZ A;  4PFB A;  5T3J A;  4YB7 A;  1AMF A;  5DW8 A;  1FBG A;  4H0W A;  3H6W A;  3IK6 B;  3UGW A;  2E0S A;  2L5V A;  1NL5 A;  5HM4 B;  3RPL B;  2PVU A;  3GBA A;  3ZSF A;  1EZP A;  1NV4 A;  1FPL A;  3FGS A;  4DIG A;  5L9M A;  2NUV A;  1WDN A;  1XI6 A;  3ODB A;  3GBB A;  2Z22 A;  4X9T A;  3P7I A;  1LFH A;  4H65 A;  1II5 A;  4XXU A;  2REJ A;  3NOH A;  4GWY A;  3VFJ A;  2I0B A;  4GOT A;  1H43 A;  3LR1 A;  2Y84 A;  3OEL A;  2Z23 A;  2IA4 A;  1NV1 A;  4OHN A;  4KYD A;  1T0K A;  3QMF A;  3O9P A;  3H06 B;  1MQI A;  1CNQ A;  1CB6 A;  3S9E A;  2ABH A;  1Z7M E;  2HFB A;  4OMB A;  1NNF A;  1ZJL A;  3RTW B;  1ZMG A;  2DDK A;  2ZYM A;  3OSR A;  4GBW A;  5H8H B;  1TWY A;  4JVI A;  4NGU A;  1SPI A;  4R73 A;  1B3L A;  1O64 A;  4YMA A;  1KA1 A;  1LCF A;  4RNS A;  5ITP A;  4FAT A;  4OEN A;  3CI8 A;  3VXC A;  4MLV A;  2XXW A;  2Q8M A;  1OLC A;  3HO7 A;  1K9Y A;  4ECF A;  1MM6 A;  3CIJ A;  2OWS A;  4MHF A;  1FPB A;  5H8H A;  3OEM A;  3A3C A;  2HXR A;  3RGY A;  1VE4 A;  4LQ5 A;  3L6G A;  2QMW A;  4PFI A;  3SDF A;  4P11 A;  3FXB A;  4NF6 A;  4E0X A;  1LLS A;  1QW0 A;  2H5Y A;  2PCR A;  1TT1 A;  1D9Q A;  4UA8 A;  4LA9 A;  4MH5 A;  1XVX A;  1QKA A;  4MAG A;  4HE0 A;  3E9X A;  5KCJ B;  3FZV A;  3KOS A;  3O6H A;  4IO4 A;  3B8B A;  3RT6 B;  3UA8 A;  4ISU A;  1LBC A;  4GWX A;  3I3V A;  4LN5 A;  2Z8E A;  4OWD A;  2GQ1 A;  4ZEC A;  1LBZ A;  4JBZ A;  3O29 A;  2YPN A;  1SW1 A;  3C34 A;  4MEV A;  2H4I A;  2QVV A;  1B40 A;  4BDR A;  4WKM A;  2PMS A;  5EQ7 A;  1A7L A;  1OQG A;  2VD2 A;  4PDH A;  3IR1 A;  1NNT A;  4PE3 A;  3FXQ A;  5CMK A;  1FW0 A;  1B58 A;  4RK2 A;  3VDF A;  3MVX A;  5H8F A;  4MNP A;  5AA3 A;  4QXD A;  1Y4T A;  2XXX A;  3IB1 A;  4HE1 A;  4FEC A;  1JP4 A;  1NKX A;  4F3G A;  4EDP A;  1B4H A;  4H8I A;  2WBB A;  1A8E A;  1I6A A;  3PTY A;  5K2Y A;  4NF4 A;  5J16 A;  4IO7 A;  3TTK A;  5AA1 A;  5B7D A;  4PGN A;  4U2R A;  2QSX A;  1B7Z A;  1MPD A;  4KQP A;  1POT A;  2HQ0 A;  2RCB A;  1CE2 A;  5TPA B;  1DBZ A;  3C33 A;  4EQ9 A;  1SVX B;  4ELO A;  3OMB A;  3VLV A;  4IO5 A;  4ZEF A;  2F36 A;  4QSE A;  3RNN A;  2CEX A;  3MP1 A;  3LUY A;  4R9F A;  2P0S A;  3MVY A;  3PPO A;  2UVH A;  5L9O A;  1Y3P A;  2XXR A;  4NWD A;  3G3I A;  1OVB A;  4NF8 B;  5KZT A;  2AYS A;  1YZ0 A;  1FBF A;  4MNI A;  4LON B;  5FTI A;  4GIZ A;  4ELR A;  1IMC A;  3L6H A;  4G68 A;  2HHM A;  3FAS A;  2ZZX A;  3M3F A;  2ZZW A;  1VFE A;  3R7X A;  2G29 A;  5I7I A;  2QVR A;  2ZYK A;  4I40 A;  4KD5 A;  2X7Q A;  4ONY A;  3MZB A;  3G3J A;  1XHY A;  4GRK A;  3MC2 A;  4KFQ A;  2F35 A;  4RY1 A;  2M8C A;  4ELQ A;  5B70 A;  1MH3 A;  2XX7 A;  3TMG A;  1SI1 A;  5TP9 B;  1B52 A;  2XWV A;  3U94 A;  4DXU A;  2UVI A;  4OER A;  3VV5 A;  3FD3 A;  2AIX A;  5ISU A;  4NAP A;  1NV3 A;  1NUW A;  3IFA A;  2Q88 A;  2F6P A;  3OEK A;  4G68 C;  4ESW A;  1P1W A;  5I3S A;  1NV6 A;  3SEX A;  3UP9 A;  2HXW A;  3DP4 A;  2QFL A;  3T9X B;  1QVS A;  5FHM A;  2DXY A;  5AA2 A;  1MDQ A;  3GZG A;  4YKK A;  4R9G A;  5CMC A;  2JJK A;  2UVJ A;  5FHN A;  5K2X A;  1B3F A;  5H8Q B;  2ONS A;  2FYI A;  3KN8 A;  4PQJ A;  2I58 A;  5I57 B;  1B3H A;  4XKR A;  2Q89 A;  3RYD A;  2KQZ A;  3ILU B;  2I4B A;  4GVO A;  1WVJ A;  4N15 A;  3IOU A;  2VHA A;  4P3L A;  2OJT A;  2O1M A;  3VVE A;  2OWT A;  2B4M A;  4FED A;  2VD3 A;  3T0J A;  3FIR A;  2WKY A;  1IMA A;  4NG7 A;  3TTR A;  4GX4 A;  5I57 A;  2O7I A;  1FTA A;  4OVJ A;  4ZE8 A;  4R72 A;  4PBQ A;  4GX3 A;  2LAO A;  4ZEK A;  1A54 A;  3R26 A;  4JDF A;  4NF5 A;  3RPL A;  1P1O A;  2F7A A;  4IO2 A;  3H6V A;  4AB5 A;  1LAG E;  2VPN A;  1BKA A;  1R1N A;  1WOD A;  3T9H B;  5CRY A;  5I56 B;  1S50 A;  4QSC A;  3PPN A;  1FPE A;  3PPP A;  1ZU0 A;  4NHB A;  5L9S A;  1DPE A;  3HN0 A;  1DCU A;  1EZ9 A;  2V84 A;  1PB8 A;  2F3D A;  4H46 A;  5LDZ A;  1ZIU A;  1EYJ A;  5EYG A;  1MG1 A;  2B4L A;  4O7M A;  3TQW A;  2B3B A;  2XD2 A;  2ANJ A;  3W15 C;  4N8G A;  4G2Z A;  3FJ7 A;  2F34 A;  3ROJ A;  4POX A;  1NNP A;  1NI9 A;  3K00 A;  3FJM A;  4F1U A;  3MZ9 A;  2V25 A;  3MW0 A;  3EKI A;  1IMB A;  1SW2 A;  3GLB A;  1B2H A;  2ZMB A;  2FIE A;  1FBP A;  5EYH A;  1BLF A;  2HZK A;  4U4S A;  3DLN A;  3KSJ A;  4EF2 A;  4NTL A;  4U1Z A;  4TLL B;  2REG A;  4GWZ A;  4BDO A;  3JYR A;  4IO3 A;  1IMD A;  1NUY A;  1PBQ A;  1PC3 A;  5ET5 A;  2XXU A;  3KZG A;  4GQO A;  4HS7 A;  1YXI A;  1DMB A;  2QS1 A;  4X04 A;  4PFU A;  3K01 A;  2RF1 A;  1B05 A;  1MXU A;  1R9Q A;  3IO4 A;  5DEX A;  4YKP A;  3CHG A;  1URD A;  1XOC A;  2I3W A;  1AOV A;  4NMY A;  4F31 B;  1P99 A;  3M3L A;  3FV2 A;  1JNF A;  2DE2 A;  1A55 A;  2OK2 A;  3K1N A;  5FTH A;  3OO9 A;  4PF8 A;  2OZZ A;  1OQH A;  3O66 A;  1KA0 A;  2HEU A;  2RKM A;  1D9V A;  3RTF B;  3CG3 A;  4PAK A;  4POW A;  2XX9 A;  1M5F A;  1MXY A;  1NUX A;  4MCO A;  4DE8 A;  5CBS A;  2OLB A;  1I6B A;  1VR5 A;  3KN7 A;  3G3K A;  3BKI B;  4PFY A;  1Y20 A;  4LP2 B;  2W7Y A;  3LSL A;  4N91 A;  1JQF A;  1YYZ A;  1QJM A;  5DVI A;  1M5E A;  4N13 A;  2XWI A;  1MS7 A;  5I59 B;  3PGF A;  5TU0 A;  1B32 A;  2MKZ A;  4KCD A;  3O2A A;  4G77 A;  3C9H A;  2P1S A;  2F8D A;  4NF6 B;  5L8D A;  1NFT A;  2HAV A;  5IKB A;  2FHY A;  1IXC A;  1JEU A;  4PF6 A;  4LZ5 A;  4U1O A;  2RC9 A;  1VDW A;  2PBW A;  5KCJ A;  4QFP A;  3MJN A;  2WBD A;  3V8X B;  1N3X A;  3PD9 A;  1P1Q A;  2ONK E;  4PCD A;  3S9L C;  2F78 A;  4JWY A;  1GV8 A;  3RLF E;  3FXU A;  4GWW A;  4OET A;  4PFT A;  4XFE A;  1MXW A;  3T9U A;  3EF7 A;  1LBW A;  1DK4 A;  5ET7 A;  4JXI A;  1FBD A;  1AH5 A;  3MBP A;  2DS9 A;  2DE3 A;  4NF0 A;  1IZ1 A;  2V3Q A;  3S9N C;  3B50 A;  1Q35 A;  3H6U A;  3IL1 B;  3T93 B;  4R6H A;  1F9B A;  3LUZ A;  3E13 X;  5AA2 D;  3PMW A;  2O1L A;  3LBS A;  3IOV A;  2KLF A;  3Q27 A;  2XWK A;  2UYE A;  3T96 B;  2A5S A;  3U1O A;  1YCJ A;  4ZE9 A;  3CFL A;  2DWA A;  4C1T A;  3E79 A;  1ELJ A;  3CRB A;  4ESX A;  2Y7W A;  3F11 A;  1J1N A;  4YU0 A;  1FTM A;  1SYH A;  3O28 A;  3D1R A;  3SEU A;  3K4U A;  1JW1 A;  5J1D A;  4OQO A;  2YJP A;  5A5L A;  1SQY A;  2WX9 A;  1PB9 A;  2CEY A;  1NUZ A;  1IXI A;  3H4Z A;  2O7U A;  3CG1 A;  4GWO A;  2F5X A;  4Z7E A;  2Y7R A;  3G3H A;  2XA5 A;  4U21 A;  5I2N B;  3EN3 A;  1FJ6 A;  1US4 A;  4NF8 A;  3K1P A;  2O84 X;  4GD5 A;  4UAC A;  2QS3 A;  4X48 A;  2VGQ A;  2G93 A;  4H5F A;  1AWB A;  4DCY A;  2RIN A;  4OEV A;  3KC0 A;  4RPO A;  5EQ9 A;  2ONR A;  3FXR A;  3TAJ A;  3TQL A;  3KG2 A;  1MY0 A;  5EHM A;  4DLD A;  4EF1 A;  3E4R A;  2DVC A;  3BIH A;  4OVP A;  3K0V A;  2P2A A;  2F7C A;  4N6K A;  1NH7 A;  3KJ7 A;  1H45 A;  2Y7P A;  1MPB A;  4NE4 A;  4KYS A;  3QAX A;  2VT5 A;  4THI A;  2Q74 A;  4MNC A;  1FPK A;  2H25 A;  2Z8D A;  1XS5 A;  4KYE A;  5I58 A;  2PFZ A;  2PX1 A;  2OCU A;  4RJZ A;  1LST A;  3VVF A;  4H5G A;  3K2D A;  3TTL A;  1LAF E;  3TEP A;  4QFO A;  3A09 A;  2DWI A;  3Q29 A;  1LB8 A;  3KBR A;  4ND9 A;  4HCY A;  1OVT A;  5F1Q A;  3TPA A;  5JK4 A;  1NH8 A;  4NF5 B;  3K6W A;  2R71 A;  1B0H A;  3BIG A;  2VOZ A;  4RA1 A;  2QS4 A;  5I56 A;  3C31 A;  4YIC A;  4XKP A;  2FA7 A;  2CZL A;  1QKB A;  4U23 A;  4XKQ A;  1IME A;  1UQW A;  5FBP A;  3E78 A;  3FUZ A;  1TFD A;  1MM7 A;  3KN3 A;  5EYF A;  3TYH A;  1Y4C A;  2DWJ A;  2E1S A;  3OOA A;  2XXK A;  1I6Q A;  1B51 A;  4PFW A;  1EYK A;  2CZH A;  1A99 A;  1SW5 A;  3K6X A;  3MUQ A;  2P3V A;  1UTH B;  2BJI A;  4BDM A;  3ILT B;  5EQ8 A;  2XXT A;  1EYI A;  2Z8F A;  4U22 A;  1O63 A;  3OD7 A;  1FBE A;  4TLM B;  3U8Q A;  4G4P A;  4P0G A;  4UAB A;  4DXC A;  1FQC A;  2FVZ A;  5A5X B;  3KOT A;  4DI3 D;  4LVQ A;  3HHG A;  4XTC Q;  2IEE A;  4PC9 A;  3B6Q A;  1IXG A;  2ZNT A;  3C4M A;  1YAE A;  3FJG A;  4O8M A;  2F3B A;  2V93 A;  1ZTY A;  1GGG A;  1FBC A;  1QUJ A;  3VE1 B;  5DEX B;  5EQA A;  3SEW A;  2HAU A;  4PFR A;  2RCA A;  1Q1K A;  1NV0 A;  5A5X A;  4MF3 A;  1H76 A;  4FJP A;  4JB7 A;  4XF5 A;  2UXA A;  4H6D A;  5ELV A;  4YZZ A;  4OZ9 A;  3IAZ A;  5F24 A;  1Y9U A;  3C35 A;  4RK9 A;  3Q28 A;  3QYT A;  4WEP A;  4EXK A;  3GXA A;  5LTC A;  3QSL A;  3JV9 A;  3RPW A;  1M5B A;  4PBH A;  1FBH A;  5I5P A;  4X8R A;  4DI4 B;  5IZ1 A;  2KR0 A;  4H45 A;  2XXV A;  5CMM A;  3OXN A;  1GR2 A;  4N07 A;  4EXL A;  1Z7N E;  2PT1 A;  4GF8 A;  3GYY A;  2XD3 A;  2O6A A;  3UOR A;  2XWO A;  2DVZ A;  4RXL A;  3N5L A;  1LAX A;  1HSJ A;  1KWH A;  1LBB A;  1K9Z A;  4BDQ A;  4QFK A;  3S4U A;  2R8T A;  2AL5 A;  4P9K A;  2QVU A;  2GRV A;  4MX6 A;  2A5T A;  3OO7 A;  4KI0 E;  3MPL A;  2ZYO A;  3ZKK A;  1B5I A;  4R6Y A;  3T66 A;  3EQ1 A;  4DZ1 A;  3O97 A;  2QRY A;  4PAF A;  1MY4 A;  5ICQ A;  1MY1 A;  4F29 A;  4I1D A;  4MFI A;  1PDA A;  3PD8 A;  1FTK A;  3BFT A;  3W9W A;  4F3B A;  5I59 A;  2I48 A;  3PUW E;  5BUU A;  3O6G A;  3K6U A;  2A5T B;  2AL4 A;  3PU5 A;  1A8F A;  4R2F A;  1DOT A;  4QSD A;  5AE4 A;  5IGA A;  4MLQ A;  4OVR A;  2OX3 A;  3TFL A;  1MXX A;  4RYA A;  4LZ7 A;  4OYV A;  1RYO A;  1IEJ A;  2CZI A;  1FQE A;  4X1B A;  4KPT A;  1OLA A;  1LGB C;  3MYU A;  5H8F B;  2RC8 A;  3VVD A;  3U65 A;  5JEI A;  2Y7K A;  3U72 A;  4F22 A;  5HBC A;  1B0L A;  3TKD A;  1N7X A;  3UIF A;  5IZ3 B;  4FOR A;  1UTB A;  1Q9D A;  4G68 B;  4FAJ A;  1RDZ A;  1ZLQ A;  4IO6 A;  5LOM A;  3H7M A;  4GWS A;  4DDD A;  1ANF A;  5I84 A;  5JTY B;  5H8N B;  1N84 A;  3CSB A;  1B5J A;  4R2B A;  3I5O A;  3HCQ A;  1FRP A;  3DM0 A;  3LSW A;  4IB2 A;  3MP8 A;  4QHQ A;  1FQA A;  4N81 A;  2GH9 A;  3K1M A;  4GXS B;  5CMB A;  3C32 A;  1POY 1;  2OWZ A;  4LZ8 A;  3RUM A;  3SEY A;  1IXH A;  3HFU A;  1DPP A;  4GWU A;  4NN3 A;  3IO6 A;  3MZ1 A;  1G0I A;  1S7Y A;  4XEQ A;  3CR9 A;  2ESN A;  1MXZ A;  3S2V A;  5IAI A;  1FQB A;  2X7P A;  3PMX A;  3KSX A;  4ZZA A;  4F2Q A;  4JWX A;  4O3B A;  3H6T A;  4L17 A;  2NOO A;  2OBG A;  4AQ4 A;  2PYY A;  3HPI A;  1LAH E;  1D9Y A;  1LB9 A;  3EPE A;  4BDN A;  1B5H A;  2ZYN A;  1MPC A;  3E3K A;  4M1V A;  5CM6 A;  3N6T A;  1M5D A;  1H3D A;  4O94 A;  2I49 A;  3HST A;  4PP0 A;  4YB5 A;  1HSE A;  3O6I A;  4R6K A;  1XC1 A;  1B7H A;  5HPQ A;  4IY6 A;  1B1H A;  3RN8 A;  4OTE A;  4KCC A;  5DTB A;  4ZZE A;  3N26 A;  3UK4 A;  3A29 A;  1DTZ A;  5F7V A;  3PV0 E;  4MJO A;  3LV0 A;  3T9V A;  5CBR A;  1N04 A;  1MY2 A;  4XKN A;  4F2O A;  4QRZ A;  2CZK A;  3QIM A;  4PAI A;  1D3K A;  2UVG A;  3R6U A;  3PUX E;  3CFX A;  2FIX A;  1MDP 1;  3A3U A;  4NQ8 A;  2X26 A;  1B6H A;  2O69 A;  3SEV A;  4EQ7 A;  3QUJ A;  1OMP A;  3V83 A;  1RKM A;  2NVU B;  3HHF A;  1LBV A;  5I58 B;  1B9J A;  4F19 A;  4Q8R A;  4FBP A;  4RPN A;  4HW8 A;  2BJJ X;  4P1E A;  5DVJ A;  1ZKB A;  5H8S A;  1FQD A;  4IGT A;  1XVY A;  1TXF A;  2VP1 A;  4ZEI A;  1BTJ A;  2HCA A;  3LSF B;  3U93 A;  3DP6 A;  3Q26 A;  4GLI A;  4ZED A;  3T1B A;  2Q2C A;  4O3A A;  3TUS A;  3SET A;  3FVG A;  1D4N A;  3K02 A;  2FNC A;  3PUZ E;  1PB7 A;  4JSO A;  4C0R A;  2D21 A;  1RYX A;  3D4C A;  3BBR A;  2XXI A;  4AS4 A;  3V89 B;  4G61 A;  3ECR A;  5AA4 A;  1FTO A;  3MQ9 A;  3VXB A;  2ZNS A;  3HV1 A;  3SES A;  4Q0C A;  3CFZ A;  1BP5 A;  3THI A;  3PPQ A;  4EUO A;  1Y1M A;  4QFL A;  2ZZV A;  3RY3 A;  3B6W A;  3OSQ A;  1FTL A;  4I3E A;  1IIT A;  4JVC A;  1B3G A;  2V3U A;  1VSO A;  4I62 A;  1NV5 A;  1LFG A;  3IJX B;  4I9D A;  3LSX A;  4F1V A;  2ZNU A;  5AA4 B;  1JW4 A;  2ZXT A;  3G3G A;  3H3G A;  3G7W A;  5DVF A;  2UYF A;  3SZP A;  3SKP A;  1SYI A;  2PFY A;  1ATG A;  2NWJ A;  1SDX A;  4GXA A;  3V5A A;  2Q9T A;  1UTH A;  1VFD A;  4KHZ E;  3VLU A;  1N76 A;  3IOR A;  4OVS A;  2HPG A;  2XXH A;  1MH4 A;  4FE8 A;  1FPG A;  2O51 A;  2QJE A;  2I3V A;  5IM2 A;  4F3S A;  4OFJ A;  4YAH X;  2DP8 A;  2WYP A;  3UN6 A;  1EZO A;  1IMF A;  4HXV A;  1FTJ A;  3IOW A;  3BFU A;  1FPI A;  3AXF A;  1S9T A;  4I8C A;  4P1L A;  2DE4 A;  5CC2 A;  2D5W A;  1B4Z A;  2V4C A;  1LEV A;  3Q25 A;  2RC7 A;  1UIV A;  3TTN A;  1JVY A;  4U4X A;  3B6T A;  4JWO A;  4E0W A;  3RQT A;  1MQJ A;  2I6E A;  3N94 A;  4KXP A;  2F7B A;  3QUF A;  4KR5 A;  4I3Y A;  3IFC A;  1JW5 A;  4GFR A;  1GVC A;  3PUY E;  4R75 A;  4P8B A;  1NNK A;  1PBP A;  1B7U A;  5IZZ A;  2GHA A;  3N6U A;  1MQH A;  5KDT B;  1URS A;  4YKI A;  3DP8 A;  4P47 A;  2Q2A A;  2Y5L A;  5ET8 A;  1NV2 A;  3D4G A;  2QL3 A;  3U92 A;  2NXO A;  4X1D A;  1YTV A;  4G8N A;  3MVW A;  4OA4 A;  4N6P A;  4QF9 A;  4FEB A;  4IGR A;  4Q30 B;  1YPN A;  4NX1 A;  4N17 A;  1MQD A;  1UIU A;  1INP A;  5KDT A;  4PGP A;  2F6G A;  4OFO A;  4HCW A;  1B1X A;  4Z0I A;  3PUV E;  1KZ8 A;  4OVT A;  2R9J A;  3PPR A;  4H1X A;  3C36 A;  3MPK A;  2XXQ A;  4K3F A;  2Q8J A;  3TCF A;  1MQG A;  4ZDM A;  4Q5T A;  3DEL B;  1SD3 A;  4BDL A;  3QK6 A;  4N4U A;  1BIY A;  5BWJ A;  1DSN A;  3IX1 A;  4TQU Q;  3FV1 A;  5DT6 A;  3W9V A;  1XT8 A;  1RDY A;  1MY3 A;  3TZA A;  3LC8 A;  2DSF A;  1Y1Z A;  2DWH A;  4TOZ A;  2CMO A;  2DXR A;  4ZS9 A;  1OIB A;  3TEL A;  1UTB B;  2XXP A;  5ITO A;  4WXJ A;  4GX6 A;  1MXV A;  4IR8 A;  3KJT A;  4LUB A;  3FBP A;  2GFE A;  4OES A;  3KFM A;  1JET A;  3OO8 A;  2QS2 A;  2XHD A;  5JTY A;  3VLW A;  4YB6 A;  3FVN A;  4BLA A;  1QUI A;  3SER A;  1SBP A;  1LBY A;  2B65 A;  4MIJ A;  3KEI A;  4G8M A;  4HE2 A;  1USY E;  2B3F A;  3MST A;  1JVX A;  3JZJ A;  3MP6 A;  4OFL A;  4MBP A;  4NF4 B;  4YKJ A;  1RDX A;  4ELP A;  3IB2 A;  4FIM A;  2VPO A;  4N8Y A;  4YMB A;  5I2N A;  3T22 A;  4MMP A;  3ISP A;  1LFI A;  3RT8 A;  3MVZ A;  1IIW A;  1IUD A;  4N6D A;  3S9M C;  5FHO A;  4XIG Q;  5IZ3 A;  4PE5 B;  5TPA A;  2GHB A;  4QBA A;  3IOT A;  1B3E A;  3IJO B;  1I69 A;  1O7T A;  1US5 A;  2DOJ A;  2PT2 A;  2QPQ A;  3QXM A;  1FPF A;  3KC1 A;  1L5T A;  1FPJ A;  4IY5 A;  5H8N A;  1P1N A;  4WED A;  4GL0 A;  1R9L A;  2P3N A;  3CVG A;  3OEN A;  3M8U A;  4OVQ A;  4OAN A;  4ZEB A;  1TFA A;  4G8H A;  4DCX A;  2XX8 A;  1EH3 A;  1B46 A;  5CI5 A;  1LBX A;  2O68 A;  3MAM A;  2I4C A;  1Y3Q A;  2WYK A;  3FAT A;  3G3F A;  4LAT A;  4GL8 A;  3K6V A;  1N0T A;  5ESY A;  1H44 A;  1MRP A;  1JEV A;  2Y7I A;  2D3I A;  1A40 A;  2V3T A;  1ZBM A;  1LCT A;  1N3W A;  1NMU A;  2H99 A;  1USY H;  3ZS6 A;  2H98 A;  2HZL A;  2FBP A;  4M4G A;  5H8Q A;  4F18 A;  3IB0 A;  4AB6 A;  5ET6 A;  3ZKL A;  3TDJ A;  5I2K A;  1FCK A;  2DQV A;  4P0I A;  2H9B A;  1AIV A;  3TOD A;  5EHS A;  1URG A;  3TTM A;  3WAE A;  4QFN A;  4PTK A;  4C1U A;  1R6Z A;  3CSG A;  3MWB A;  1FPD A;  2WEF A;  4F39 A;  3FVO A;  1FJ9 A;  3EHT A;  1EU8 A;  4LQ2 A;  2ALU A;  1GTK A;  1Y3N A;  2R6G E;  5TP9 A;  1SI0 A;  2XXY A;  1NV7 A;  3FVK A;  4OEU A;  5I2K B;  5DYH A;  1P1U A;  2F97 A;  2QMX A;  3KGC A;  4EQB A;  1QUK A;  3PMV A;  3OO6 A;  4PDD A;  4F1Y A;  1AL3 A; 
#chains in the Genus database with same CATH homology
 2F3B A;  2KQZ A;  2OWZ A;  1IMC A;  4OVS A;  2HPG A;  4MEV A;  2FHY A;  1FPG A;  2QVV A;  4P56 A;  1FBC A;  2HHM A;  3HFU A;  4GWU A;  4HCY A;  4PAF A;  4PF6 A;  1LBV A;  2ZZX A;  4N15 A;  4NN3 A;  2ZZW A;  4JVD A;  2QPQ A;  1NV1 A;  1FPF A;  1VDW A;  2F5X A;  5EQA A;  5IM2 A;  1QGX A;  5JK4 A;  3QMF A;  4GBV A;  4PFR A;  2WYP A;  5EQ7 A;  3KC1 A;  1G0I A;  4F19 A;  1FPJ A;  1FSA A;  5I7I A;  1BK4 A;  1NV0 A;  4FBP A;  2QVR A;  4N4U A;  4P3L A;  4PDH A;  1CNQ A;  4P1E A;  4XEQ A;  2XA5 A;  1IMF A;  4AS5 A;  4HXV A;  2WBD A;  3BIG A;  4I40 A;  4PE3 A;  4GWZ A;  4PET A;  1G0H A;  2B4M A;  2P3N A;  3W9W A;  1FPI A;  2DDK A;  1FJ6 A;  2DE4 A;  4P1L A;  1IMD A;  4XF5 A;  1RDY A;  3T0J A;  2Y5K A;  4GBW A;  4OVQ A;  4OAN A;  4YIC A;  3W9V A;  4JVI A;  4NGU A;  4PCD A;  1SPI A;  1NUY A;  1IMA A;  4YZZ A;  4NG7 A;  3T1B A;  4GX4 A;  4MNP A;  2V4C A;  1LEV A;  4GWW A;  4XFE A;  5ET5 A;  1LBX A;  1YXI A;  1KA1 A;  4X04 A;  4QXD A;  5F24 A;  1FTA A;  4HE1 A;  2WYK A;  1LBW A;  1JP4 A;  4PBQ A;  1DK4 A;  1IME A;  5IGA A;  5ET7 A;  1FBD A;  4KXP A;  5FBP A;  4GX3 A;  4GX6 A;  4OVR A;  2OX3 A;  5ESY A;  3CHG A;  1AWB A;  4O7I A;  4I3Y A;  4AS4 A;  4IR8 A;  3IFC A;  3E78 A;  2WBB A;  2DE3 A;  3KC0 A;  3PTY A;  4G61 A;  5EQ9 A;  4NF0 A;  3FBP A;  2Q8M A;  3RPL A;  5J16 A;  2V3Q A;  1K9Y A;  3B50 A;  5LTC A;  4P8B A;  5EYG A;  2DE2 A;  2CZI A;  2XXK A;  2VPN A;  3BIH A;  4PF8 A;  4PGN A;  2XWV A;  4MHF A;  4OVP A;  1FPB A;  5IZZ A;  3LUZ A;  3KBZ A;  4NHB A;  1FPE A;  4M1V A;  4N6K A;  1KA0 A;  4PBH A;  4PFB A;  5CM6 A;  2ZZV A;  3MYU A;  1EYK A;  1FBH A;  2HZL A;  2FBP A;  5I5P A;  5T3J A;  1DCU A;  2HXR A;  2CZH A;  4F18 A;  4O94 A;  4X8R A;  5DW8 A;  3U65 A;  1FBG A;  1LBY A;  4PAK A;  5ET6 A;  5IZ1 A;  2XWK A;  5EQ8 A;  4DI4 B;  2KR0 A;  4H45 A;  2F3D A;  2P3V A;  4MNC A;  1NUX A;  4MCO A;  4H46 A;  4MIJ A;  4NAP A;  5LDZ A;  4HE2 A;  2BJI A;  4I3E A;  1NV3 A;  4PFI A;  5IZ3 B;  2VT5 A;  1EYJ A;  3FXB A;  2Q74 A;  3MST A;  1EYI A;  4P47 A;  1NUW A;  1FPK A;  3IFA A;  1DBZ A;  2L5V A;  2Y5L A;  1NV2 A;  1Q9D A;  2PCR A;  3E79 A;  4JVC A;  4PTK A;  5ET8 A;  2B4L A;  1D9Q A;  1NV6 A;  5I3S A;  1NV5 A;  4O7M A;  3A29 A;  1FPD A;  2QFL A;  1FBE A;  2WEF A;  3GYY A;  3RPL B;  1RDZ A;  4F1V A;  4MAG A;  1FJ9 A;  4HE0 A;  2XWO A;  1NV4 A;  4GWS A;  2PFZ A;  2DVZ A;  1FPL A;  3LV0 A;  4MJO A;  1RDX A;  2CEX A;  4N8G A;  4N91 A;  3ROJ A;  4UAB A;  1NI9 A;  4OA4 A;  1YYZ A;  1XI6 A;  2FVZ A;  2JJK A;  2VPO A;  3D1R A;  4F1U A;  3B8B A;  4NX1 A;  4N17 A;  1NV7 A;  4N8Y A;  5J1D A;  2XWI A;  1K9Z A;  3SZP A;  4MMP A;  4DI3 D;  3ISP A;  1INP A;  2CZK A;  2PFY A;  4PGP A;  1FRP A;  4GWX A;  4LN5 A;  2R8T A;  4PAI A;  4X9T A;  5A5L A;  4PC9 A;  4P9K A;  4HCW A;  4QBA A;  2WX9 A;  2MKZ A;  3EKI A;  1IMB A;  2FIX A;  1KZ8 A;  2Q9T A;  4N6D A;  4OVT A;  2CEY A;  2QVU A;  4N81 A;  2GQ1 A;  1NUZ A;  3NOH A;  4GWY A;  4MX6 A;  5IZ3 A;  1LBZ A;  1YZ0 A;  1FBF A;  4NQ8 A;  4MNI A;  2FIE A;  1FBP A;  5EYH A;  4O8M A;  2HZK A;  4PDD A;  3RYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...