2XXKA

Siap complex
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPDAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siap Complex
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
total genus 124
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xxkA00
4P47A 4OANA 4X8RA 5CM6A 4YICA 4UABA 4NG7A 5IM2A 5IGAA 2PFYA 4MIJA 4PAIA 5IZZA 4MCOA 2HZKA 3FXBA 4N6KA 4NQ8A 4PF8A 4PGPA 4DI4B 4N15A 4P3LA 2VPOA 4NHBA 4PAFA 3GYYA 4MNCA 2HZLA 4OVQA 4MNIA 4NGUA 4P56A 4PC9A 4MMPA 4O8MA 4PBQA 2WYPA 2XA5A 2CEYA 2XWIA 4YZZA 3U65A 2XWOA 4NF0A 4N4UA 2XWVA 2HPGA 4MNPA 4NAPA 4XFEA 4PGNA 4O7MA 4XF5A 4PFIA 4N6DA 4PDHA 4DI3D 4P8BA 2CEXA 4MEVA 4LN5A 4MHFA 4P9KA 4N17A 4PBHA 4PF6A 5LTCA 4N91A 4N8GA 4OVPA 4OVRA 4X04A 4P1LA 4MAGA 4PETA 2VPNA 5I7IA 2ZZWA 4OA4A 4PDDA 4OVSA 2PFZA 2WYKA 4PCDA 2V4CA 4PFBA 4PFRA 2WX9A 2XXKA 4NN3A 2ZZXA 4PE3A 4MX6A 4N8YA 3B50A 4PAKA 4XEQA 4OVTA 2XWKA 4NX1A 4O94A 2ZZVA 5I5PA 4P1EA
chains in the Genus database with same CATH superfamily
4DXCA 2V3UA 3N6UA 5H8FB 5LOMA 1EU8A 3S9MC 1MY0A 2WBBA 1KWHA 1OVBA 4BDNA 1Y1MA 2B3FA 3IO4A 4DI4B 3E3KA 4ECFA 3H06B 2GHBA 1IXCA 1DMBA 1LSTA 2ZNSA 5ESYA 3R6UA 1A54A 1B0LA 3B6WA 3DP6A 2XX7A 1FPKA 1Z7ME 4YKKA 1NFTA 1A55A 1IMBA 4U1ZA 1GGGA 4O7MA 4XF5A 3TCHA 4I8CA 1YYZA 4AS5A 4QRZA 2ANJA 4N91A 2NWJA 1DSNA 4ZEKA 2XXWA 1ZJLA 1UTBA 2QL3A 1M5FA 4OYVA 1M5DA 3IB2A 2DE3A 1TT1A 3L6GA 3HSTA 2REGA 4BDOA 4F22A 3VVDA 3OELA 3S9EA 4PFTA 5T3JA 1HSEA 1D3KA 3Q26A 3K0VA 3V8XB 5I2KB 3B7DA 1P1QA 1VDWA 4EXLA 3K2DA 4Q0CA 4QFOA 2ZZVA 1G0IA 5H8NB 1FW0A 1P99A 1HSLA 2ONRA 2R6GE 3TKDA 3HHGA 3EKIA 1MPCA 5CBSA 1IEJA 1OVTA 4UABA 3TQWA 1Y4CA 2XXQA 4ELQA 1DBZA 2OLBA 5IZZA 3H6TA 1PB8A 1QGXA 1O64A 3NOHA 2DE2A 4ZEBA 5CMBA 1RYXA 5CMKA 1LBZA 4RXLA 2QVVA 1LB8A 4R73A 1IQ7A 4HCYA 4X48A 3ZKKA 3SEUA 5FTIA 4ZE9A 1NNPA 3O29A 2V93A 3LSWA 1FBCA 2XWVA 4XFEA 1A7LA 4FIMA 4IO5A 4YMAA 1I6AA 2OZZA 1POY1 2Q8JA 4OFJA 1SW1A 1B5HA 5ICQA 1BK4A 1Q9DA 1UIVA 1B40A 3FV2A 4GWZA 3IJXB 1YXIA 4EUOA 3OSQA 3MP1A 4NF4A 4FECA 4XKPA 1H43A 2GH9A 1P1UA 5I7IA 1K9YA 2O7IA 2RC8A 3RTFB 5ISUA 4ESWA 2P1SA 4GWUA 4JWYA 3RTWB 4UACA 1LBCA 4H6DA 3BFUA 1FTMA 4N81A 5H8SA 1US5A 1LB9A 3IOWA 2H99A 2DXRA 2QJEA 4JWOA 4OVTA 3MWBA 4H65A 5EQAA 2P2AA 4FATA 3TTRA 5EQ8A 2D21A 5ET8A 1NL5A 1XHYA 4UA8A 1B9JA 3H6WA 1KA0A 3H4ZA 4FORA 1N84A 1FRPA 4N15A 1N04A 2O1LA 2VPOA 4JB7A 1Q35A 2DOJA 4OVQA 4E0WA 3IL1B 1Y4TA 1YPNA 4P56A 2I4CA 4PC9A 2FNCA 1AOVA 1R6ZA 1M5EA 2CEYA 2VOZA 4YZZA 3U65A 2A5SA 5L8DA 4GL0A 1MQGA 4HE0A 5M2VA 4LZ8A 1JQFA 1A8FA 4QSCA 2REJA 1JW1A 5A5XA 4OXVA 1CE2A 4U23A 1B3FA 2UXAA 2BJJX 2UYEA 3IOTA 4ZECA 4NF5A 4YAHX 3KN8A 4ZZAA 4H46A 3TTNA 1JNFA 3S2VA 4ZS9A 2X7QA 5FHOA 1CNQA 1NNKA 3MYUA 1N7XA 3IB0A 2VP1A 1UIUA 4G77A 1A40A 3KC1A 5H8QB 3KC0A 3QSLA 4DDDA 4P1EA 2DE4A 5I56B 4F3PA 3KN7A 4BDLA 5EQ7A 4EF2A 4DCXA 3CSBA 2F3BA 1I6QA 1EH3A 3MP8A 4PFUA 4P3LA 5CRYA 3SDFA 4AB5A 1USYH 5F1QA 5K2XA 1QKBA 1ANFA 3VV5A 3A3UA 4U1OA 3K1NA 5JEIA 4RA1A 5F7VA 1LFIA 3K00A 4R2BA 4IY5A 4QBAA 2RINA 1PEBA 4HE1A 4C0RA 3LBSA 3M3FA 4IO7A 2DSFA 1RKMA 3IAZA 1B58A 4YB6A 3FIRA 4LN5A 4U21A 1ZIUA 2CMOA 1DTZA 4OVRA 4R72A 5DVFA 4M4GA 4MAGA 4GBWA 4JDFA 3CFLA 4BDMA 4HE2A 3K1PA 4QSEA 2QRYA 1PB7A 2F6PA 1FQAA 3LUYA 3TPAA 3FASA 1UTBB 1SW5A 3OO6A 1RDXA 1R9LA 5L9OA 4HS7A 3QXMA 4GVOA 5JTYA 4QFKA 1Y3NA 1NKXA 2FIEA 3H6VA 2XXRA 1QKAA 4H8IA 1YAEA 3MPLA 3PPPA 5TU0A 3EQ1A 4MX6A 1Y1ZA 4O94A 2ABHA 1QUIA 4ELPA 2GFEA 1TFDA 4MIJA 5A5LA 3RN8A 3W9WA 1LGBC 3KGCA 1Y9UA 4H0WA 2ESNA 2RCAA 4YB7A 4P0IA 1XC1A 3FJMA 1FJ6A 5AE4A 3FV1A 2ZYMA 4H5GA 1IUDA 4OHNA 3C33A 3IFAA 3PPNA 2Y7WA 4MNPA 2H25A 2NVUB 2P0SA 2OCUA 4GD5A 4XKNA 4H5FA 4P8BA 4P9KA 1IMCA 4C1TA 5FHNA 5CI5A 4HTGA 3U93A 2PYYA 3OOAA 4G68A 5L9SA 1JETA 5AA1A 1FBFA 1A99A 1FTKA 2Q89A 2ZZWA 3UK4A 4PCDA 1MQDA 4PFBA 4I9DA 4GL8A 1LEVA 3B6QA 3RT6B 2PMSA 2HAVA 2F97A 3N5LA 3T22A 1LBVA 1L5TA 2X26A 4WXJA 4XEQA 2Q88A 2V3QA 3TTMA 3D1RA 4NG7A 1Y3QA 3TTKA 4IGRA 4OZ9A 4TLMB 4PF8A 1XS5A 1NUWA 3U92A 2Q2CA 2UVHA 2B3BA 5EYFA 1MH4A 3LC8A 1NV3A 4X1DA 1FPBA 2KLFA 3QK6A 1LCFA 4PP0A 1XT8A 5DT6A 2XWOA 3EN3A 5LDZA 2ONSA 2HPGA 3C35A 2VD3A 4F2OA 2E1SA 3VDFA 3UA8A 4NF6A 1MG1A 4LQ5A 2HAUA 4N6DA 5DVJA 5BUUA 3MBPA 2KQZA 4IB2A 1NV6A 1MPDA 1GTKA 3KOTA 3PUZE 4PBHA 5LTCA 4ELOA 4R9FA 2WKYA 4GX4A 4F3GA 3E4RA 3G3FA 3HCQA 2XX8A 2Q9TA 3K02A 2I58A 4JVDA 1MXUA 4XTCQ 5ELVA 3CHGA 3PTYA 2A5TB 3KSJA 5K2YA 4X1BA 3UIFA 5FHMA 1B4ZA 3G3KA 4GWOA 3RPWA 1MXVA 1P1OA 1LAHE 2XWKA 4DE8A 2QVRA 2DDKA 2QS4A 4TQUQ 2DP8A 5H8QA 4QFLA 3T96B 2Y7IA 3GBAA 3A29A 1Y3PA 1N76A 2IEEA 3SESA 3T9HB 1PBQA 4F3SA 4PTKA 1FTLA 2XXIA 4N6KA 4KCCA 4ELRA 4TOZA 3EHTA 1AH5A 2I4BA 2FBPA 3RYDA 3RPLA 2DQVA 2O69A 3VXBA 2F8DA 1D9QA 2F35A 4RJZA 5EQ9A 1N3XA 4F31B 3TYHA 5B7DA 2F6GA 1B0HA 1QJMA 1FBGA 3IB1A 3QUJA 4OFLA 3KEIA 4F19A 2F3DA 2Q8MA 1NMUA 4R6YA 1LAXA 2O84X 5EHMA 3B8BA 4HXVA 4F1UA 3T9UA 4YMBA 4OVPA 4EF1A 1OLAA 3T9VA 1D4NA 4X04A 1F9BA 1FCKA 4Q8RA 3O6IA 5ET5A 1B7HA 2OJTA 4FBPA 3CVGA 2H98A 4GWYA 1MM7A 1FPGA 1FBPA 4MF3A 5IZ3A 3VVFA 4GX6A 4WKMA 2R8TA 4GBVA 3R26A 2WX9A 1S7YA 3MZBA 3RQTA 5ET6A 4GQOA 1MDP1 4LZ7A 1MM6A 3QAXA 3IX1A 4ZE8A 1BP5A 5DYHA 2I3VA 1N0TA 1NUXA 3SEWA 3ZSFA 3H03A 4P47A 2I6EA 2ZNUA 4MH5A 4WEDA 2WEFA 1NNTA 2AIXA 3VLWA 1BLFA 1NV4A 4NMYA 2E0SA 2CZHA 5I57B 4ZEIA 4MJOA 5TP9B 3PUXE 2HZLA 1M5BA 4R6HA 1SDXA 3IO6A 2VGQA 4ONYA 3KZGA 5H8FA 2WYPA 1LLSA 4G68B 1O7TA 1JP4A 2Z22A 1R1NA 4ZZEA 4GXAA 3U72A 1ZKBA 1H3DA 3C34A 3KBZA 2RKMA 1BIYA 1FBEA 3FXRA 3PUYE 2Y84A 3FGSA 2I48A 4KCDA 4MEVA 2ZYNA 3PMXA 3SEVA 4C1UA 4POWA 3LV0A 1TWYA 4JSOA 4AB6A 3O66A 4O3AA 3DM0A 1NV2A 3S9LC 1MY1A 4DLDA 2HHMA 1MS7A 4JVIA 2WYKA 2PT1A 1AWBA 4R2FA 2P3VA 4F29A 5AA2D 3TTLA 1QULA 1NNFA 4XKRA 3FJGA 3C36A 2YLNA 1NV1A 4AQ4A 4N8YA 1YZ0A 1GVCA 3CRBA 3FXQA 3VLUA 4YICA 3U8QA 1FQCA 5FTHA 2F7BA 4BDRA 4DCYA 1S9TA 3S9NC 1FPIA 5KDTA 4F1YA 4OVJA 4NHBA 1SD3A 3IORA 3UORA 4KI0E 1ELJA 1UTHB 3JZJA 2F7AA 3RUMA 3GLBA 4O8MA 4POXA 5L9MA 3HPIA 1LCTA 1ZMGA 3A3CA 4XXUA 4L17A 2Z8FA 4G8MA 3V89B 3LSXA 3QYTA 2RCBA 5ITOA 1P1NA 1DCUA 3MVXA 1B5IA 2O51A 3ZS6A 5KDTB 3OSRA 4MHFA 1DPPA 4ISUA 4HCWA 3EF7A 1KA1A 4NE4A 5I59A 1MDQA 4LQ2A 3FATA 3EPEA 3PV0E 2DXYA 1I69A 1LFHA 3BKIB 4EQBA 4OVSA 1LFGA 5J16A 4GWSA 4OEVA 3ROJA 3U94A 3KJ7A 1N7WA 3THIA 5DW8A 2XXKA 4F1VA 5AA3A 1NV5A 3HN0A 2JJKA 4WEPA 1GR2A 5I57A 4R74A 1JVXA 1FTAA 4OENA 2QSXA 1EYIA 5I5PA 2GQ1A 1SYHA 1IXGA 4OFOA 3T93B 3LUZA 4O3CA 2ZYOA 3CI8A 2PX1A 3GXAA 3LSLA 4P0GA 3FXBA 3OENA 2Z8EA 4KYEA 3JYRA 1G0HA 4EQ7A 5AA2B 1MXWA 1AL3A 1SI0A 1EZ9A 4I40A 1LBBA 3C4MA 3E79A 4PBQA 3T66A 3DP8A 3TCGA 4F18A 2AL5A 3TFLA 4NF5B 5IZ1A 1K9ZA 3TQLA 1BTJA 2B4MA 2H9BA 2I49A 3MSTA 3OEMA 1XOCA 2ZMBA 1JW4A 3EHSA 2FYIA 1B7UA 4GIZA 1QVSA 4GWWA 2PCRA 4YU0A 4NWDA 4DIGA 2V25A 4XIGQ 5CC2A 4KYDA 4N8GA 1URGA 3PD8A 1O63A 5DEXA 3B6TA 4P1LA 4PETA 1SI1A 3KJTA 4LZ5A 4I62A 5H8HA 3UN6A 2B65A 1UQWA 4RPNA 4GF8A 4NF8B 4PDDA 5I2NB 1CB6A 1PBPA 3PUWE 5DTBA 4KQPA 1MQHA 3RT8A 2DWHA 4G8HA 2DWIA 3ODBA 4QSDA 1FQDA 4GX3A 3VVEA 1WODA 1M5CA 4GOTA 4IO2A 1EYJA 3QUFA 1LAGE 1IXHA 2HXWA 4RPOA 3ISPA 3R7XA 3FUZA 5A5XB 4GWXA 1URSA 4FJPA 4X8RA 3MVWA 2F36A 1NUYA 2GHAA 4FAJA 4MCOA 4FE8A 2PT2A 4MLVA 3IR1A 1FPDA 5JTYB 3A09A 2RC9A 3TDJA 5B70A 1NV0A 2ONKE 1SBPA 3MJNA 2H4IA 1B3HA 4FEDA 2XA5A 4X9TA 2UVIA 2Q74A 1AIVA 5KCJA 1US4A 4JXIA 3SZPA 1ZTYA 2DYXA 3SERA 4NAPA 4KD5A 1PB9A 4KXPA 2DVZA 2QS1A 5CMMA 3FZVA 3RY3A 4EQ9A 4NEDA 4IY6A 1EZPA 1H44A 3ILUB 2QVUA 3OMBA 2Y5KA 3GZGA 5AA2A 2HQ0A 1B3EA 4YKJA 4DI3D 1EYKA 4QF9A 3WAFA 4MBPA 3E78A 2XXHA 3MP6A 1DOTA 4KYSA 4O3BA 5KZTA 3O97A 1VE4A 1H76A 1LAFE 2Y7RA 2F34A 2Z8DA 1OLCA 1NUZA 3N94A 1DTGA 5H8HB 4GXSB 1PDAA 3OO9A 1ATGA 4U22A 1MQIA 4DXBA 1FQFA 5JK4A 3ZKLA 3V5AA 1VFDA 1B3GA 2ZZXA 1OMPA 3KBRA 1SVXB 2ZYKA 3M3KA 1DPEA 2Y7KA 3MQ9A 4PE3A 1B1HA 3PPQA 1RDYA 3MZ9A 1FPFA 3T0JA 3TCFA 4YB5A 3G3HA 1HSJA 3K6WA 5DVIA 1IITA 5I2NA 4P11A 4U4XA 4OETA 2VD2A 4OWDA 5I58A 3HV1A 2OBGA 3D4GA 4LVQA 1VSOA 2P3NA 5DEXB 5I3SA 3OO7A 3TODA 1J1NA 3RNNA 1INPA 4H45A 2I0BA 2XXYA 2PBWA 3PU5A 3K4UA 5HM4B 3K1MA 4MNIA 1JEVA 4RK9A 2HXRA 4NGUA 2G29A 2V3TA 4NTLA 5CMCA 3DP4A 5AA4A 4G2ZA 3USDA 1ZLQA 4YKIA 1YCJA 3M8UA 3L6HA 4OQOA 2ALUA 1UTHA 2VT5A 3EHUA 1FPEA 3Q28A 1FTOA 2Y7PA 3RPLB 5I84A 3CFXA 1NH8A 2I0CA 1USYE 1I6BA 3H6UA 4XKQA 3PGFA 1OIBA 4G8NA 1SQYA 3MZ1A 3TAJA 2W7YA 4H1XA 3N6TA 5ICTA 2XXVA 1FSAA 3AXFA 3SEXA 1JVYA 4NN3A 1EZOA 2CZKA 1JW5A 4GRKA 1B6HA 1B4HA 3VLVA 3O9PA 3B50A 3TELA 3W9VA 2FHYA 3OD7A 1R9QA 1LBXA 4Q5TA 4IO6A 1FQEA 2Y5LA 3FJ7A 3W15C 5BWJA 1IMEA 3K01A 3N26A 5IM2A 1XI6A 4KHZE 5IGAA 2OWTA 4N13A 4LA9A 1P1WA 3U1OA 2DS9A 3I6VA 3VFJA 2AYSA 1MY4A 1FTJA 2RC7A 4MFIA 1ZBMA 4NF6B 5I2KA 2M8CA 3WAEA 1OQHA 5J1DA 4OERA 2AL4A 4R75A 3OEKA 3CR9A 4N4UA 2FIXA 2O68A 3KOSA 3RGYA 3G7WA 4I1DA 3MUQA 4PFIA 4MLQA 4NF4B 3C32A 5TPAB 3T1BA 3FVOA 1SYIA 1IXIA 2IA4A 3HHFA 3IOVA 3K6UA 4RY1A 3DLNA 1MXYA 3S4UA 3SKPA 3CIJA 1QW0A 3MPKA 1B2HA 4OTEA 4OA4A 2PFZA 1IZ1A 3O2AA 2CZIA 3CFZA 1SPIA 2UVJA 3K6XA 3IJOB 3KG2A 1TXFA 3TEPA 4DXUA 4RYAA 2OWSA 3HFUA 1B32A 1NV7A 4U4SA 1B51A 3PD9A 5IAIA 1NH7A 4ESXA 1T0KA 4H8JA 3BBRA 3QMFA 3TMGA 3PPRA 4OANA 1MXXA 1MH3A 3KN3A 4JSDA 3G3GA 1FPLA 2PFYA 2D5WA 4F3BA 3CG3A 3D4CA 1B46A 5F24A 5TP9A 2HZKA 4NQ8A 4KPTA 1IMDA 2QMWA 2HEUA 3QIMA 4U2RA 1FJ9A 4PAFA 5ITPA 1IMAA 2YJPA 2B4LA 4ZEFA 4N07A 2MKZA 5I58B 1B1XA 2XWIA 3FD3A 2H5YA 4GLIA 4NF0A 3ECRA 4QHQA 4TLLB 3TZAA 3KSXA 3I3VA 1Q1KA 1MPBA 2DWAA 2WBDA 4LONB 3VXCA 4LP2B 1POTA 4E0XA 1Y20A 1N3WA 3TUSA 4IO4A 4JVCA 2X7PA 4PDHA 4ND9A 3MVZA 3V83A 2CEXA 2XXPA 5EYGA 3MW0A 1FBHA 4N17A 1B5JA 2NXOA 3G3JA 2OK2A 3FBPA 5IZ3B 2R9JA 5AA4B 2FA7A 2R71A 4I3EA 3PUVE 3E13X 3I5OA 3CSGA 2XD2A 2XD3A 4DZ1A 4PFYA 1D9VA 3O6HA 4Z7EA 3G3IA 1BKAA 2XX9A 2O6AA 4GFRA 3SETA 1IIWA 1MY3A 1WVJA 2QS2A 2V4CA 4JWXA 4NWCA 3GBBA 2HCAA 4PFRA 1KZ8A 1RYOA 5IKBA 3PPOA 4K3FA 2A5TA 2QMXA 2O7UA 4ZDMA 3P7IA 4AS4A 4R6KA 2Z23A 1LBYA 3LR1A 3IOUA 3SEYA 3OO8A 1PC3A 2NUVA 5CM6A 4F39A 5I56A 2DWJA 3BIHA 4PAIA 2V84A 5HBCA 4M1VA 2OX3A 4PGPA 3FVGA 2GRVA 3VE1B 3DELB 4KFQA 3H3GA 3GYYA 4IGTA 4MNCA 1WDNA 1AMFA 4EDPA 1GV8A 1RDZA 3JV9A 4JBZA 3KFMA 4PQJA 4MMPA 3FXUA 3ILTB 5EYHA 2PVUA 4PGNA 2YPNA 1A8EA 2CZLA 4EXKA 4G4PA 1DK4A 2O1MA 2LAOA 2OWZA 1TFAA 1B3LA 4RNSA 3IFCA 4PF6A 5EHSA 3T9XB 2G93A 2XXTA 4LATA 5KCJB 2VHAA 2RF1A 3FVNA 1JEUA 4H67A 3BFTA 4QFNA 1II5A 4G68C 5I59B 3C9HA 1B05A 4QFPA 1OQGA 4IR8A 1MRPA 4HW8A 4YKPA 1D9YA 1MXZA 4OESA 1QUKA 4FEBA 2UVGA 3PMVA 2QFLA 1XVYA 3MAMA 1NI9A 3C31A 4PAKA 3K6VA 4NX1A 2XXUA 1SW2A 2UYFA 3LSFB 1VFEA 1B52A 4R9GA 1FBDA 1SW4A 5ET7A 2DVCA 3Q25A 3IK6B 4O7IA 2D3IA 4BLAA 2QS3A 3M3LA 3OXNA 2F7CA 4Z0IA 2ZNTA 2THIA 4LUBA 4OMBA 1ZU0A 3FVKA 1FPJA 3HO7A 1IMFA 4PE5B 5FBPA 2F78A 2Q2AA 2F5XA 1YTVA 4OEUA 5CBRA 2NOOA 5HPQA 4THIA 4QXDA 3PMWA 3UGWA 1URDA 4G61A 2I3WA 3H7MA 3MVYA 3CG1A 3Q27A 1B7ZA 1VR5A 3Q29A 4IO3A 1LBWA 4BDQA 2VPNA 2XXXA 1Z7NE 3ONMA 4RK2A 1S50A 1FQBA 1MQJA 3O6GA 5H8NA 3BIGA 3E9XA 3UP9A 4I3YA 4NF8A 3RLFE 1MY2A 4Q30B 1QUJA 4KR5A 1XVXA 2QPQA 3O28A 2BJIA 3F11A 1H45A 2XHDA 2FVZA 4N6PA 2HFBA 4F2QA 2L5VA 2ZXTA 3MC2A 5TPAA 2KR0A 4ZEDA 4PFWA
chains in the Genus database with same CATH topology
2GQ1A 4P47A 2V3QA 3EKIA 2Y5LA 3D1RA 4GWXA 4OANA 4X8RA 5EQ8A 5CM6A 4YICA 3A29A 3LUZA 5EQ7A 2WBBA 1IMEA 4UABA 4NG7A 1FPLA 1NUYA 1XI6A 3BIHA 2WEFA 2PFYA 4MIJA 5IM2A 2P3NA 5A5LA 5IGAA 1DBZA 2F3BA 4PAIA 5ET8A 1FBDA 5IZZA 4PTKA 5F24A 4M1VA 2HZKA 4MCOA 1QGXA 1KA0A 2OX3A 3FXBA 1NV4A 4N6KA 4NQ8A 4PF8A 4PGPA 5ET7A 3W9WA 4DI4B 1FPIA 2CZHA 1FRPA 5I3SA 3NOHA 4N15A 1IMDA 1NUWA 1G0HA 2DE2A 4P3LA 4MJOA 2FBPA 1FJ9A 4O7IA 2VPOA 4NHBA 5ESYA 1LBZA 1FPDA 3GYYA 4PAFA 1INPA 4H45A 3RPLA 4MNCA 2QVVA 1NV3A 2HZLA 1FPBA 1IMAA 1NV0A 4OVQA 1RDZA 4MNIA 1FJ6A 2B4LA 1D9QA 2HXRA 4NGUA 4P56A 4HCYA 4I40A 2MKZA 4PC9A 3E79A 5J1DA 4MMPA 4O8MA 4PBQA 2WYPA 2XA5A 2CEYA 2XWIA 4X9TA 4YZZA 5EQ9A 2Q74A 3U65A 1JP4A 5EYHA 2XWOA 4NF0A 1FPKA 4HE0A 4QBAA 4N4UA 3SZPA 4F18A 5LDZA 1FBCA 1FBGA 2XWVA 2FIXA 3IFAA 1FPJA 2HPGA 4MNPA 1IMFA 4NAPA 4XFEA 4KXPA 2DVZA 5IZ1A 5FBPA 1K9ZA 4PGNA 3KBZA 4HE1A 2F5XA 2WBDA 1IMBA 4F19A 2F3DA 2B4MA 1FBEA 3MSTA 4O7MA 4XF5A 2VT5A 4QXDA 1DK4A 2Q8MA 1FPEA 2QVUA 4PFIA 4N6DA 2OWZA 2Y5KA 3RPLB 4JVCA 1BK4A 4PDHA 4GWWA 2PCRA 5EQAA 1Q9DA 4G61A 1DCUA 4DI3D 4P8BA 2CEXA 3E78A 2KQZA 1YYZA 3T1BA 4MEVA 3B8BA 1EYKA 1NV6A 4LN5A 5EYGA 4AS5A 4HXVA 1FBHA 4MHFA 4P9KA 3IFCA 1IMCA 4N17A 4PBHA 4PF6A 4N91A 4GWZA 4N8GA 1LBWA 4OVPA 5LTCA 4GX4A 4OVRA 3LV0A 4HCWA 1YXIA 3FBPA 4X04A 1KA1A 5IZ3B 4P1LA 5ET5A 4MAGA 4PETA 2VPNA 4GBWA 3RYDA 4I3EA 2Q9TA 2DE3A 5I7IA 1K9YA 1NUZA 4H46A 4HE2A 1FBFA 4JVDA 4FBPA 1NV2A 4GWYA 2ZZWA 4OA4A 4PDDA 1FPGA 3BIGA 4GWUA 1FBPA 2HHMA 4JVIA 5IZ3A 4OVSA 2PFZA 2WYKA 4I3YA 5J16A 1RDXA 1CNQA 4GX6A 1AWBA 2CZIA 1FSAA 4GWSA 4PCDA 5T3JA 1SPIA 3CHGA 4IR8A 3ROJA 3PTYA 2V4CA 2R8TA 4GBVA 5JK4A 2P3VA 2QPQA 4PFBA 4N81A 4PFRA 1KZ8A 2BJIA 2WX9A 2XXKA 1LEVA 3MYUA 4NN3A 5DW8A 3QMFA 2CZKA 2ZZXA 4F1VA 3HFUA 1VDWA 1NV5A 2FVZA 2JJKA 4GX3A 2FIEA 5ET6A 4AS4A 1NV7A 2QFLA 4PE3A 4F1UA 1LBVA 1EYJA 1RDYA 1FPFA 2L5VA 3KC1A 1NV1A 3T0JA 1NI9A 3KC0A 1FTAA 1LBYA 4MX6A 3B50A 4N8YA 4PAKA 3W9VA 1EYIA 2KR0A 2FHYA 2XWKA 4NX1A 4O94A 4OVTA 2ZZVA 4XEQA 1G0IA 2QVRA 5I5PA 2DDKA 4P1EA 3ISPA 1NUXA 1LBXA 1YZ0A 2DE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P47 A;  4OAN A;  4X8R A;  5CM6 A;  4YIC A;  4UAB A;  4NG7 A;  5IM2 A;  5IGA A;  2PFY A;  4MIJ A;  4PAI A;  5IZZ A;  4MCO A;  2HZK A;  3FXB A;  4N6K A;  4NQ8 A;  4PF8 A;  4PGP A;  4DI4 B;  4N15 A;  4P3L A;  2VPO A;  4NHB A;  4PAF A;  3GYY A;  4MNC A;  2HZL A;  4OVQ A;  4MNI A;  4NGU A;  4P56 A;  4PC9 A;  4MMP A;  4O8M A;  4PBQ A;  2WYP A;  2XA5 A;  2CEY A;  2XWI A;  4YZZ A;  3U65 A;  2XWO A;  4NF0 A;  4N4U A;  2XWV A;  2HPG A;  4MNP A;  4NAP A;  4XFE A;  4PGN A;  4O7M A;  4XF5 A;  4PFI A;  4N6D A;  4PDH A;  4DI3 D;  4P8B A;  2CEX A;  4MEV A;  4LN5 A;  4MHF A;  4P9K A;  4N17 A;  4PBH A;  4PF6 A;  5LTC A;  4N91 A;  4N8G A;  4OVP A;  4OVR A;  4X04 A;  4P1L A;  4MAG A;  4PET A;  2VPN A;  5I7I A;  2ZZW A;  4OA4 A;  4PDD A;  4OVS A;  2PFZ A;  2WYK A;  4PCD A;  2V4C A;  4PFB A;  4PFR A;  2WX9 A;  2XXK A;  4NN3 A;  2ZZX A;  4PE3 A;  4MX6 A;  4N8Y A;  3B50 A;  4PAK A;  4XEQ A;  4OVT A;  2XWK A;  4NX1 A;  4O94 A;  2ZZV A;  5I5P A;  4P1E A; 
#chains in the Genus database with same CATH topology
 4DXC A;  2V3U A;  3N6U A;  5H8F B;  5LOM A;  1EU8 A;  3S9M C;  1MY0 A;  2WBB A;  1KWH A;  1OVB A;  4BDN A;  1Y1M A;  2B3F A;  3IO4 A;  4DI4 B;  3E3K A;  4ECF A;  3H06 B;  2GHB A;  1IXC A;  1DMB A;  1LST A;  2ZNS A;  5ESY A;  3R6U A;  1A54 A;  1B0L A;  3B6W A;  3DP6 A;  2XX7 A;  1FPK A;  1Z7M E;  4YKK A;  1NFT A;  1A55 A;  1IMB A;  4U1Z A;  1GGG A;  4O7M A;  4XF5 A;  3TCH A;  4I8C A;  1YYZ A;  4AS5 A;  4QRZ A;  2ANJ A;  4N91 A;  2NWJ A;  1DSN A;  4ZEK A;  2XXW A;  1ZJL A;  1UTB A;  2QL3 A;  1M5F A;  4OYV A;  1M5D A;  3IB2 A;  2DE3 A;  1TT1 A;  3L6G A;  3HST A;  2REG A;  4BDO A;  4F22 A;  3VVD A;  3OEL A;  3S9E A;  4PFT A;  5T3J A;  1HSE A;  1D3K A;  3Q26 A;  3K0V A;  3V8X B;  5I2K B;  3B7D A;  1P1Q A;  1VDW A;  4EXL A;  3K2D A;  4Q0C A;  4QFO A;  2ZZV A;  1G0I A;  5H8N B;  1FW0 A;  1P99 A;  1HSL A;  2ONR A;  2R6G E;  3TKD A;  3HHG A;  3EKI A;  1MPC A;  5CBS A;  1IEJ A;  1OVT A;  4UAB A;  3TQW A;  1Y4C A;  2XXQ A;  4ELQ A;  1DBZ A;  2OLB A;  5IZZ A;  3H6T A;  1PB8 A;  1QGX A;  1O64 A;  3NOH A;  2DE2 A;  4ZEB A;  5CMB A;  1RYX A;  5CMK A;  1LBZ A;  4RXL A;  2QVV A;  1LB8 A;  4R73 A;  1IQ7 A;  4HCY A;  4X48 A;  3ZKK A;  3SEU A;  5FTI A;  4ZE9 A;  1NNP A;  3O29 A;  2V93 A;  3LSW A;  1FBC A;  2XWV A;  4XFE A;  1A7L A;  4FIM A;  4IO5 A;  4YMA A;  1I6A A;  2OZZ A;  1POY 1;  2Q8J A;  4OFJ A;  1SW1 A;  1B5H A;  5ICQ A;  1BK4 A;  1Q9D A;  1UIV A;  1B40 A;  3FV2 A;  4GWZ A;  3IJX B;  1YXI A;  4EUO A;  3OSQ A;  3MP1 A;  4NF4 A;  4FEC A;  4XKP A;  1H43 A;  2GH9 A;  1P1U A;  5I7I A;  1K9Y A;  2O7I A;  2RC8 A;  3RTF B;  5ISU A;  4ESW A;  2P1S A;  4GWU A;  4JWY A;  3RTW B;  4UAC A;  1LBC A;  4H6D A;  3BFU A;  1FTM A;  4N81 A;  5H8S A;  1US5 A;  1LB9 A;  3IOW A;  2H99 A;  2DXR A;  2QJE A;  4JWO A;  4OVT A;  3MWB A;  4H65 A;  5EQA A;  2P2A A;  4FAT A;  3TTR A;  5EQ8 A;  2D21 A;  5ET8 A;  1NL5 A;  1XHY A;  4UA8 A;  1B9J A;  3H6W A;  1KA0 A;  3H4Z A;  4FOR A;  1N84 A;  1FRP A;  4N15 A;  1N04 A;  2O1L A;  2VPO A;  4JB7 A;  1Q35 A;  2DOJ A;  4OVQ A;  4E0W A;  3IL1 B;  1Y4T A;  1YPN A;  4P56 A;  2I4C A;  4PC9 A;  2FNC A;  1AOV A;  1R6Z A;  1M5E A;  2CEY A;  2VOZ A;  4YZZ A;  3U65 A;  2A5S A;  5L8D A;  4GL0 A;  1MQG A;  4HE0 A;  5M2V A;  4LZ8 A;  1JQF A;  1A8F A;  4QSC A;  2REJ A;  1JW1 A;  5A5X A;  4OXV A;  1CE2 A;  4U23 A;  1B3F A;  2UXA A;  2BJJ X;  2UYE A;  3IOT A;  4ZEC A;  4NF5 A;  4YAH X;  3KN8 A;  4ZZA A;  4H46 A;  3TTN A;  1JNF A;  3S2V A;  4ZS9 A;  2X7Q A;  5FHO A;  1CNQ A;  1NNK A;  3MYU A;  1N7X A;  3IB0 A;  2VP1 A;  1UIU A;  4G77 A;  1A40 A;  3KC1 A;  5H8Q B;  3KC0 A;  3QSL A;  4DDD A;  4P1E A;  2DE4 A;  5I56 B;  4F3P A;  3KN7 A;  4BDL A;  5EQ7 A;  4EF2 A;  4DCX A;  3CSB A;  2F3B A;  1I6Q A;  1EH3 A;  3MP8 A;  4PFU A;  4P3L A;  5CRY A;  3SDF A;  4AB5 A;  1USY H;  5F1Q A;  5K2X A;  1QKB A;  1ANF A;  3VV5 A;  3A3U A;  4U1O A;  3K1N A;  5JEI A;  4RA1 A;  5F7V A;  1LFI A;  3K00 A;  4R2B A;  4IY5 A;  4QBA A;  2RIN A;  1PEB A;  4HE1 A;  4C0R A;  3LBS A;  3M3F A;  4IO7 A;  2DSF A;  1RKM A;  3IAZ A;  1B58 A;  4YB6 A;  3FIR A;  4LN5 A;  4U21 A;  1ZIU A;  2CMO A;  1DTZ A;  4OVR A;  4R72 A;  5DVF A;  4M4G A;  4MAG A;  4GBW A;  4JDF A;  3CFL A;  4BDM A;  4HE2 A;  3K1P A;  4QSE A;  2QRY A;  1PB7 A;  2F6P A;  1FQA A;  3LUY A;  3TPA A;  3FAS A;  1UTB B;  1SW5 A;  3OO6 A;  1RDX A;  1R9L A;  5L9O A;  4HS7 A;  3QXM A;  4GVO A;  5JTY A;  4QFK A;  1Y3N A;  1NKX A;  2FIE A;  3H6V A;  2XXR A;  1QKA A;  4H8I A;  1YAE A;  3MPL A;  3PPP A;  5TU0 A;  3EQ1 A;  4MX6 A;  1Y1Z A;  4O94 A;  2ABH A;  1QUI A;  4ELP A;  2GFE A;  1TFD A;  4MIJ A;  5A5L A;  3RN8 A;  3W9W A;  1LGB C;  3KGC A;  1Y9U A;  4H0W A;  2ESN A;  2RCA A;  4YB7 A;  4P0I A;  1XC1 A;  3FJM A;  1FJ6 A;  5AE4 A;  3FV1 A;  2ZYM A;  4H5G A;  1IUD A;  4OHN A;  3C33 A;  3IFA A;  3PPN A;  2Y7W A;  4MNP A;  2H25 A;  2NVU B;  2P0S A;  2OCU A;  4GD5 A;  4XKN A;  4H5F A;  4P8B A;  4P9K A;  1IMC A;  4C1T A;  5FHN A;  5CI5 A;  4HTG A;  3U93 A;  2PYY A;  3OOA A;  4G68 A;  5L9S A;  1JET A;  5AA1 A;  1FBF A;  1A99 A;  1FTK A;  2Q89 A;  2ZZW A;  3UK4 A;  4PCD A;  1MQD A;  4PFB A;  4I9D A;  4GL8 A;  1LEV A;  3B6Q A;  3RT6 B;  2PMS A;  2HAV A;  2F97 A;  3N5L A;  3T22 A;  1LBV A;  1L5T A;  2X26 A;  4WXJ A;  4XEQ A;  2Q88 A;  2V3Q A;  3TTM A;  3D1R A;  4NG7 A;  1Y3Q A;  3TTK A;  4IGR A;  4OZ9 A;  4TLM B;  4PF8 A;  1XS5 A;  1NUW A;  3U92 A;  2Q2C A;  2UVH A;  2B3B A;  5EYF A;  1MH4 A;  3LC8 A;  1NV3 A;  4X1D A;  1FPB A;  2KLF A;  3QK6 A;  1LCF A;  4PP0 A;  1XT8 A;  5DT6 A;  2XWO A;  3EN3 A;  5LDZ A;  2ONS A;  2HPG A;  3C35 A;  2VD3 A;  4F2O A;  2E1S A;  3VDF A;  3UA8 A;  4NF6 A;  1MG1 A;  4LQ5 A;  2HAU A;  4N6D A;  5DVJ A;  5BUU A;  3MBP A;  2KQZ A;  4IB2 A;  1NV6 A;  1MPD A;  1GTK A;  3KOT A;  3PUZ E;  4PBH A;  5LTC A;  4ELO A;  4R9F A;  2WKY A;  4GX4 A;  4F3G A;  3E4R A;  3G3F A;  3HCQ A;  2XX8 A;  2Q9T A;  3K02 A;  2I58 A;  4JVD A;  1MXU A;  4XTC Q;  5ELV A;  3CHG A;  3PTY A;  2A5T B;  3KSJ A;  5K2Y A;  4X1B A;  3UIF A;  5FHM A;  1B4Z A;  3G3K A;  4GWO A;  3RPW A;  1MXV A;  1P1O A;  1LAH E;  2XWK A;  4DE8 A;  2QVR A;  2DDK A;  2QS4 A;  4TQU Q;  2DP8 A;  5H8Q A;  4QFL A;  3T96 B;  2Y7I A;  3GBA A;  3A29 A;  1Y3P A;  1N76 A;  2IEE A;  3SES A;  3T9H B;  1PBQ A;  4F3S A;  4PTK A;  1FTL A;  2XXI A;  4N6K A;  4KCC A;  4ELR A;  4TOZ A;  3EHT A;  1AH5 A;  2I4B A;  2FBP A;  3RYD A;  3RPL A;  2DQV A;  2O69 A;  3VXB A;  2F8D A;  1D9Q A;  2F35 A;  4RJZ A;  5EQ9 A;  1N3X A;  4F31 B;  3TYH A;  5B7D A;  2F6G A;  1B0H A;  1QJM A;  1FBG A;  3IB1 A;  3QUJ A;  4OFL A;  3KEI A;  4F19 A;  2F3D A;  2Q8M A;  1NMU A;  4R6Y A;  1LAX A;  2O84 X;  5EHM A;  3B8B A;  4HXV A;  4F1U A;  3T9U A;  4YMB A;  4OVP A;  4EF1 A;  1OLA A;  3T9V A;  1D4N A;  4X04 A;  1F9B A;  1FCK A;  4Q8R A;  3O6I A;  5ET5 A;  1B7H A;  2OJT A;  4FBP A;  3CVG A;  2H98 A;  4GWY A;  1MM7 A;  1FPG A;  1FBP A;  4MF3 A;  5IZ3 A;  3VVF A;  4GX6 A;  4WKM A;  2R8T A;  4GBV A;  3R26 A;  2WX9 A;  1S7Y A;  3MZB A;  3RQT A;  5ET6 A;  4GQO A;  1MDP 1;  4LZ7 A;  1MM6 A;  3QAX A;  3IX1 A;  4ZE8 A;  1BP5 A;  5DYH A;  2I3V A;  1N0T A;  1NUX A;  3SEW A;  3ZSF A;  3H03 A;  4P47 A;  2I6E A;  2ZNU A;  4MH5 A;  4WED A;  2WEF A;  1NNT A;  2AIX A;  3VLW A;  1BLF A;  1NV4 A;  4NMY A;  2E0S A;  2CZH A;  5I57 B;  4ZEI A;  4MJO A;  5TP9 B;  3PUX E;  2HZL A;  1M5B A;  4R6H A;  1SDX A;  3IO6 A;  2VGQ A;  4ONY A;  3KZG A;  5H8F A;  2WYP A;  1LLS A;  4G68 B;  1O7T A;  1JP4 A;  2Z22 A;  1R1N A;  4ZZE A;  4GXA A;  3U72 A;  1ZKB A;  1H3D A;  3C34 A;  3KBZ A;  2RKM A;  1BIY A;  1FBE A;  3FXR A;  3PUY E;  2Y84 A;  3FGS A;  2I48 A;  4KCD A;  4MEV A;  2ZYN A;  3PMX A;  3SEV A;  4C1U A;  4POW A;  3LV0 A;  1TWY A;  4JSO A;  4AB6 A;  3O66 A;  4O3A A;  3DM0 A;  1NV2 A;  3S9L C;  1MY1 A;  4DLD A;  2HHM A;  1MS7 A;  4JVI A;  2WYK A;  2PT1 A;  1AWB A;  4R2F A;  2P3V A;  4F29 A;  5AA2 D;  3TTL A;  1QUL A;  1NNF A;  4XKR A;  3FJG A;  3C36 A;  2YLN A;  1NV1 A;  4AQ4 A;  4N8Y A;  1YZ0 A;  1GVC A;  3CRB A;  3FXQ A;  3VLU A;  4YIC A;  3U8Q A;  1FQC A;  5FTH A;  2F7B A;  4BDR A;  4DCY A;  1S9T A;  3S9N C;  1FPI A;  5KDT A;  4F1Y A;  4OVJ A;  4NHB A;  1SD3 A;  3IOR A;  3UOR A;  4KI0 E;  1ELJ A;  1UTH B;  3JZJ A;  2F7A A;  3RUM A;  3GLB A;  4O8M A;  4POX A;  5L9M A;  3HPI A;  1LCT A;  1ZMG A;  3A3C A;  4XXU A;  4L17 A;  2Z8F A;  4G8M A;  3V89 B;  3LSX A;  3QYT A;  2RCB A;  5ITO A;  1P1N A;  1DCU A;  3MVX A;  1B5I A;  2O51 A;  3ZS6 A;  5KDT B;  3OSR A;  4MHF A;  1DPP A;  4ISU A;  4HCW A;  3EF7 A;  1KA1 A;  4NE4 A;  5I59 A;  1MDQ A;  4LQ2 A;  3FAT A;  3EPE A;  3PV0 E;  2DXY A;  1I69 A;  1LFH A;  3BKI B;  4EQB A;  4OVS A;  1LFG A;  5J16 A;  4GWS A;  4OEV A;  3ROJ A;  3U94 A;  3KJ7 A;  1N7W A;  3THI A;  5DW8 A;  2XXK A;  4F1V A;  5AA3 A;  1NV5 A;  3HN0 A;  2JJK A;  4WEP A;  1GR2 A;  5I57 A;  4R74 A;  1JVX A;  1FTA A;  4OEN A;  2QSX A;  1EYI A;  5I5P A;  2GQ1 A;  1SYH A;  1IXG A;  4OFO A;  3T93 B;  3LUZ A;  4O3C A;  2ZYO A;  3CI8 A;  2PX1 A;  3GXA A;  3LSL A;  4P0G A;  3FXB A;  3OEN A;  2Z8E A;  4KYE A;  3JYR A;  1G0H A;  4EQ7 A;  5AA2 B;  1MXW A;  1AL3 A;  1SI0 A;  1EZ9 A;  4I40 A;  1LBB A;  3C4M A;  3E79 A;  4PBQ A;  3T66 A;  3DP8 A;  3TCG A;  4F18 A;  2AL5 A;  3TFL A;  4NF5 B;  5IZ1 A;  1K9Z A;  3TQL A;  1BTJ A;  2B4M A;  2H9B A;  2I49 A;  3MST A;  3OEM A;  1XOC A;  2ZMB A;  1JW4 A;  3EHS A;  2FYI A;  1B7U A;  4GIZ A;  1QVS A;  4GWW A;  2PCR A;  4YU0 A;  4NWD A;  4DIG A;  2V25 A;  4XIG Q;  5CC2 A;  4KYD A;  4N8G A;  1URG A;  3PD8 A;  1O63 A;  5DEX A;  3B6T A;  4P1L A;  4PET A;  1SI1 A;  3KJT A;  4LZ5 A;  4I62 A;  5H8H A;  3UN6 A;  2B65 A;  1UQW A;  4RPN A;  4GF8 A;  4NF8 B;  4PDD A;  5I2N B;  1CB6 A;  1PBP A;  3PUW E;  5DTB A;  4KQP A;  1MQH A;  3RT8 A;  2DWH A;  4G8H A;  2DWI A;  3ODB A;  4QSD A;  1FQD A;  4GX3 A;  3VVE A;  1WOD A;  1M5C A;  4GOT A;  4IO2 A;  1EYJ A;  3QUF A;  1LAG E;  1IXH A;  2HXW A;  4RPO A;  3ISP A;  3R7X A;  3FUZ A;  5A5X B;  4GWX A;  1URS A;  4FJP A;  4X8R A;  3MVW A;  2F36 A;  1NUY A;  2GHA A;  4FAJ A;  4MCO A;  4FE8 A;  2PT2 A;  4MLV A;  3IR1 A;  1FPD A;  5JTY B;  3A09 A;  2RC9 A;  3TDJ A;  5B70 A;  1NV0 A;  2ONK E;  1SBP A;  3MJN A;  2H4I A;  1B3H A;  4FED A;  2XA5 A;  4X9T A;  2UVI A;  2Q74 A;  1AIV A;  5KCJ A;  1US4 A;  4JXI A;  3SZP A;  1ZTY A;  2DYX A;  3SER A;  4NAP A;  4KD5 A;  1PB9 A;  4KXP A;  2DVZ A;  2QS1 A;  5CMM A;  3FZV A;  3RY3 A;  4EQ9 A;  4NED A;  4IY6 A;  1EZP A;  1H44 A;  3ILU B;  2QVU A;  3OMB A;  2Y5K A;  3GZG A;  5AA2 A;  2HQ0 A;  1B3E A;  4YKJ A;  4DI3 D;  1EYK A;  4QF9 A;  3WAF A;  4MBP A;  3E78 A;  2XXH A;  3MP6 A;  1DOT A;  4KYS A;  4O3B A;  5KZT A;  3O97 A;  1VE4 A;  1H76 A;  1LAF E;  2Y7R A;  2F34 A;  2Z8D A;  1OLC A;  1NUZ A;  3N94 A;  1DTG A;  5H8H B;  4GXS B;  1PDA A;  3OO9 A;  1ATG A;  4U22 A;  1MQI A;  4DXB A;  1FQF A;  5JK4 A;  3ZKL A;  3V5A A;  1VFD A;  1B3G A;  2ZZX A;  1OMP A;  3KBR A;  1SVX B;  2ZYK A;  3M3K A;  1DPE A;  2Y7K A;  3MQ9 A;  4PE3 A;  1B1H A;  3PPQ A;  1RDY A;  3MZ9 A;  1FPF A;  3T0J A;  3TCF A;  4YB5 A;  3G3H A;  1HSJ A;  3K6W A;  5DVI A;  1IIT A;  5I2N A;  4P11 A;  4U4X A;  4OET A;  2VD2 A;  4OWD A;  5I58 A;  3HV1 A;  2OBG A;  3D4G A;  4LVQ A;  1VSO A;  2P3N A;  5DEX B;  5I3S A;  3OO7 A;  3TOD A;  1J1N A;  3RNN A;  1INP A;  4H45 A;  2I0B A;  2XXY A;  2PBW A;  3PU5 A;  3K4U A;  5HM4 B;  3K1M A;  4MNI A;  1JEV A;  4RK9 A;  2HXR A;  4NGU A;  2G29 A;  2V3T A;  4NTL A;  5CMC A;  3DP4 A;  5AA4 A;  4G2Z A;  3USD A;  1ZLQ A;  4YKI A;  1YCJ A;  3M8U A;  3L6H A;  4OQO A;  2ALU A;  1UTH A;  2VT5 A;  3EHU A;  1FPE A;  3Q28 A;  1FTO A;  2Y7P A;  3RPL B;  5I84 A;  3CFX A;  1NH8 A;  2I0C A;  1USY E;  1I6B A;  3H6U A;  4XKQ A;  3PGF A;  1OIB A;  4G8N A;  1SQY A;  3MZ1 A;  3TAJ A;  2W7Y A;  4H1X A;  3N6T A;  5ICT A;  2XXV A;  1FSA A;  3AXF A;  3SEX A;  1JVY A;  4NN3 A;  1EZO A;  2CZK A;  1JW5 A;  4GRK A;  1B6H A;  1B4H A;  3VLV A;  3O9P A;  3B50 A;  3TEL A;  3W9V A;  2FHY A;  3OD7 A;  1R9Q A;  1LBX A;  4Q5T A;  4IO6 A;  1FQE A;  2Y5L A;  3FJ7 A;  3W15 C;  5BWJ A;  1IME A;  3K01 A;  3N26 A;  5IM2 A;  1XI6 A;  4KHZ E;  5IGA A;  2OWT A;  4N13 A;  4LA9 A;  1P1W A;  3U1O A;  2DS9 A;  3I6V A;  3VFJ A;  2AYS A;  1MY4 A;  1FTJ A;  2RC7 A;  4MFI A;  1ZBM A;  4NF6 B;  5I2K A;  2M8C A;  3WAE A;  1OQH A;  5J1D A;  4OER A;  2AL4 A;  4R75 A;  3OEK A;  3CR9 A;  4N4U A;  2FIX A;  2O68 A;  3KOS A;  3RGY A;  3G7W A;  4I1D A;  3MUQ A;  4PFI A;  4MLQ A;  4NF4 B;  3C32 A;  5TPA B;  3T1B A;  3FVO A;  1SYI A;  1IXI A;  2IA4 A;  3HHF A;  3IOV A;  3K6U A;  4RY1 A;  3DLN A;  1MXY A;  3S4U A;  3SKP A;  3CIJ A;  1QW0 A;  3MPK A;  1B2H A;  4OTE A;  4OA4 A;  2PFZ A;  1IZ1 A;  3O2A A;  2CZI A;  3CFZ A;  1SPI A;  2UVJ A;  3K6X A;  3IJO B;  3KG2 A;  1TXF A;  3TEP A;  4DXU A;  4RYA A;  2OWS A;  3HFU A;  1B32 A;  1NV7 A;  4U4S A;  1B51 A;  3PD9 A;  5IAI A;  1NH7 A;  4ESX A;  1T0K A;  4H8J A;  3BBR A;  3QMF A;  3TMG A;  3PPR A;  4OAN A;  1MXX A;  1MH3 A;  3KN3 A;  4JSD A;  3G3G A;  1FPL A;  2PFY A;  2D5W A;  4F3B A;  3CG3 A;  3D4C A;  1B46 A;  5F24 A;  5TP9 A;  2HZK A;  4NQ8 A;  4KPT A;  1IMD A;  2QMW A;  2HEU A;  3QIM A;  4U2R A;  1FJ9 A;  4PAF A;  5ITP A;  1IMA A;  2YJP A;  2B4L A;  4ZEF A;  4N07 A;  2MKZ A;  5I58 B;  1B1X A;  2XWI A;  3FD3 A;  2H5Y A;  4GLI A;  4NF0 A;  3ECR A;  4QHQ A;  4TLL B;  3TZA A;  3KSX A;  3I3V A;  1Q1K A;  1MPB A;  2DWA A;  2WBD A;  4LON B;  3VXC A;  4LP2 B;  1POT A;  4E0X A;  1Y20 A;  1N3W A;  3TUS A;  4IO4 A;  4JVC A;  2X7P A;  4PDH A;  4ND9 A;  3MVZ A;  3V83 A;  2CEX A;  2XXP A;  5EYG A;  3MW0 A;  1FBH A;  4N17 A;  1B5J A;  2NXO A;  3G3J A;  2OK2 A;  3FBP A;  5IZ3 B;  2R9J A;  5AA4 B;  2FA7 A;  2R71 A;  4I3E A;  3PUV E;  3E13 X;  3I5O A;  3CSG A;  2XD2 A;  2XD3 A;  4DZ1 A;  4PFY A;  1D9V A;  3O6H A;  4Z7E A;  3G3I A;  1BKA A;  2XX9 A;  2O6A A;  4GFR A;  3SET A;  1IIW A;  1MY3 A;  1WVJ A;  2QS2 A;  2V4C A;  4JWX A;  4NWC A;  3GBB A;  2HCA A;  4PFR A;  1KZ8 A;  1RYO A;  5IKB A;  3PPO A;  4K3F A;  2A5T A;  2QMX A;  2O7U A;  4ZDM A;  3P7I A;  4AS4 A;  4R6K A;  2Z23 A;  1LBY A;  3LR1 A;  3IOU A;  3SEY A;  3OO8 A;  1PC3 A;  2NUV A;  5CM6 A;  4F39 A;  5I56 A;  2DWJ A;  3BIH A;  4PAI A;  2V84 A;  5HBC A;  4M1V A;  2OX3 A;  4PGP A;  3FVG A;  2GRV A;  3VE1 B;  3DEL B;  4KFQ A;  3H3G A;  3GYY A;  4IGT A;  4MNC A;  1WDN A;  1AMF A;  4EDP A;  1GV8 A;  1RDZ A;  3JV9 A;  4JBZ A;  3KFM A;  4PQJ A;  4MMP A;  3FXU A;  3ILT B;  5EYH A;  2PVU A;  4PGN A;  2YPN A;  1A8E A;  2CZL A;  4EXK A;  4G4P A;  1DK4 A;  2O1M A;  2LAO A;  2OWZ A;  1TFA A;  1B3L A;  4RNS A;  3IFC A;  4PF6 A;  5EHS A;  3T9X B;  2G93 A;  2XXT A;  4LAT A;  5KCJ B;  2VHA A;  2RF1 A;  3FVN A;  1JEU A;  4H67 A;  3BFT A;  4QFN A;  1II5 A;  4G68 C;  5I59 B;  3C9H A;  1B05 A;  4QFP A;  1OQG A;  4IR8 A;  1MRP A;  4HW8 A;  4YKP A;  1D9Y A;  1MXZ A;  4OES A;  1QUK A;  4FEB A;  2UVG A;  3PMV A;  2QFL A;  1XVY A;  3MAM A;  1NI9 A;  3C31 A;  4PAK A;  3K6V A;  4NX1 A;  2XXU A;  1SW2 A;  2UYF A;  3LSF B;  1VFE A;  1B52 A;  4R9G A;  1FBD A;  1SW4 A;  5ET7 A;  2DVC A;  3Q25 A;  3IK6 B;  4O7I A;  2D3I A;  4BLA A;  2QS3 A;  3M3L A;  3OXN A;  2F7C A;  4Z0I A;  2ZNT A;  2THI A;  4LUB A;  4OMB A;  1ZU0 A;  3FVK A;  1FPJ A;  3HO7 A;  1IMF A;  4PE5 B;  5FBP A;  2F78 A;  2Q2A A;  2F5X A;  1YTV A;  4OEU A;  5CBR A;  2NOO A;  5HPQ A;  4THI A;  4QXD A;  3PMW A;  3UGW A;  1URD A;  4G61 A;  2I3W A;  3H7M A;  3MVY A;  3CG1 A;  3Q27 A;  1B7Z A;  1VR5 A;  3Q29 A;  4IO3 A;  1LBW A;  4BDQ A;  2VPN A;  2XXX A;  1Z7N E;  3ONM A;  4RK2 A;  1S50 A;  1FQB A;  1MQJ A;  3O6G A;  5H8N A;  3BIG A;  3E9X A;  3UP9 A;  4I3Y A;  4NF8 A;  3RLF E;  1MY2 A;  4Q30 B;  1QUJ A;  4KR5 A;  1XVX A;  2QPQ A;  3O28 A;  2BJI A;  3F11 A;  1H45 A;  2XHD A;  2FVZ A;  4N6P A;  2HFB A;  4F2Q A;  2L5V A;  2ZXT A;  3MC2 A;  5TPA A;  2KR0 A;  4ZED A;  4PFW A; 
#chains in the Genus database with same CATH homology
 2GQ1 A;  4P47 A;  2V3Q A;  3EKI A;  2Y5L A;  3D1R A;  4GWX A;  4OAN A;  4X8R A;  5EQ8 A;  5CM6 A;  4YIC A;  3A29 A;  3LUZ A;  5EQ7 A;  2WBB A;  1IME A;  4UAB A;  4NG7 A;  1FPL A;  1NUY A;  1XI6 A;  3BIH A;  2WEF A;  2PFY A;  4MIJ A;  5IM2 A;  2P3N A;  5A5L A;  5IGA A;  1DBZ A;  2F3B A;  4PAI A;  5ET8 A;  1FBD A;  5IZZ A;  4PTK A;  5F24 A;  4M1V A;  2HZK A;  4MCO A;  1QGX A;  1KA0 A;  2OX3 A;  3FXB A;  1NV4 A;  4N6K A;  4NQ8 A;  4PF8 A;  4PGP A;  5ET7 A;  3W9W A;  4DI4 B;  1FPI A;  2CZH A;  1FRP A;  5I3S A;  3NOH A;  4N15 A;  1IMD A;  1NUW A;  1G0H A;  2DE2 A;  4P3L A;  4MJO A;  2FBP A;  1FJ9 A;  4O7I A;  2VPO A;  4NHB A;  5ESY A;  1LBZ A;  1FPD A;  3GYY A;  4PAF A;  1INP A;  4H45 A;  3RPL A;  4MNC A;  2QVV A;  1NV3 A;  2HZL A;  1FPB A;  1IMA A;  1NV0 A;  4OVQ A;  1RDZ A;  4MNI A;  1FJ6 A;  2B4L A;  1D9Q A;  2HXR A;  4NGU A;  4P56 A;  4HCY A;  4I40 A;  2MKZ A;  4PC9 A;  3E79 A;  5J1D A;  4MMP A;  4O8M A;  4PBQ A;  2WYP A;  2XA5 A;  2CEY A;  2XWI A;  4X9T A;  4YZZ A;  5EQ9 A;  2Q74 A;  3U65 A;  1JP4 A;  5EYH A;  2XWO A;  4NF0 A;  1FPK A;  4HE0 A;  4QBA A;  4N4U A;  3SZP A;  4F18 A;  5LDZ A;  1FBC A;  1FBG A;  2XWV A;  2FIX A;  3IFA A;  1FPJ A;  2HPG A;  4MNP A;  1IMF A;  4NAP A;  4XFE A;  4KXP A;  2DVZ A;  5IZ1 A;  5FBP A;  1K9Z A;  4PGN A;  3KBZ A;  4HE1 A;  2F5X A;  2WBD A;  1IMB A;  4F19 A;  2F3D A;  2B4M A;  1FBE A;  3MST A;  4O7M A;  4XF5 A;  2VT5 A;  4QXD A;  1DK4 A;  2Q8M A;  1FPE A;  2QVU A;  4PFI A;  4N6D A;  2OWZ A;  2Y5K A;  3RPL B;  4JVC A;  1BK4 A;  4PDH A;  4GWW A;  2PCR A;  5EQA A;  1Q9D A;  4G61 A;  1DCU A;  4DI3 D;  4P8B A;  2CEX A;  3E78 A;  2KQZ A;  1YYZ A;  3T1B A;  4MEV A;  3B8B A;  1EYK A;  1NV6 A;  4LN5 A;  5EYG A;  4AS5 A;  4HXV A;  1FBH A;  4MHF A;  4P9K A;  3IFC A;  1IMC A;  4N17 A;  4PBH A;  4PF6 A;  4N91 A;  4GWZ A;  4N8G A;  1LBW A;  4OVP A;  5LTC A;  4GX4 A;  4OVR A;  3LV0 A;  4HCW A;  1YXI A;  3FBP A;  4X04 A;  1KA1 A;  5IZ3 B;  4P1L A;  5ET5 A;  4MAG A;  4PET A;  2VPN A;  4GBW A;  3RYD A;  4I3E A;  2Q9T A;  2DE3 A;  5I7I A;  1K9Y A;  1NUZ A;  4H46 A;  4HE2 A;  1FBF A;  4JVD A;  4FBP A;  1NV2 A;  4GWY A;  2ZZW A;  4OA4 A;  4PDD A;  1FPG A;  3BIG A;  4GWU A;  1FBP A;  2HHM A;  4JVI A;  5IZ3 A;  4OVS A;  2PFZ A;  2WYK A;  4I3Y A;  5J16 A;  1RDX A;  1CNQ A;  4GX6 A;  1AWB A;  2CZI A;  1FSA A;  4GWS A;  4PCD A;  5T3J A;  1SPI A;  3CHG A;  4IR8 A;  3ROJ A;  3PTY A;  2V4C A;  2R8T A;  4GBV A;  5JK4 A;  2P3V A;  2QPQ A;  4PFB A;  4N81 A;  4PFR A;  1KZ8 A;  2BJI A;  2WX9 A;  2XXK A;  1LEV A;  3MYU A;  4NN3 A;  5DW8 A;  3QMF A;  2CZK A;  2ZZX A;  4F1V A;  3HFU A;  1VDW A;  1NV5 A;  2FVZ A;  2JJK A;  4GX3 A;  2FIE A;  5ET6 A;  4AS4 A;  1NV7 A;  2QFL A;  4PE3 A;  4F1U A;  1LBV A;  1EYJ A;  1RDY A;  1FPF A;  2L5V A;  3KC1 A;  1NV1 A;  3T0J A;  1NI9 A;  3KC0 A;  1FTA A;  1LBY A;  4MX6 A;  3B50 A;  4N8Y A;  4PAK A;  3W9V A;  1EYI A;  2KR0 A;  2FHY A;  2XWK A;  4NX1 A;  4O94 A;  4OVT A;  2ZZV A;  4XEQ A;  1G0I A;  2QVR A;  5I5P A;  2DDK A;  4P1E A;  3ISP A;  1NUX A;  1LBX A;  1YZ0 A;  2DE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...