2XXKA

Siap complex
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPDAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
publication title Siap Complex
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 124
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xxkA00
4P1EA 4N8YA 4MIJA 4MAGA 4NN3A 4PF6A 4OVQA 2HZKA 4YICA 4PFIA 2WYKA 4OVRA 4NQ8A 4PDHA 3B50A 4NAPA 3U65A 4MNIA 4DI3D 2VPNA 4MNPA 2XWIA 4PCDA 4PE3A 4DI4B 5I5PA 4O7MA 4PC9A 4XFEA 2CEYA 4P56A 4MHFA 4MCOA 4N8GA 4PFBA 4PF8A 4N6KA 4PAIA 4X04A 4MMPA 4PAFA 4NX1A 2PFYA 4MX6A 2XA5A 4N15A 4P1LA 4O94A 5IGAA 2HPGA 4PGPA 5CM6A 2ZZVA 4XF5A 2HZLA 5I7IA 4NGUA 4X8RA 4P9KA 4PBHA 4PBQA 2WYPA 4PFRA 4OVSA 4PETA 2ZZXA 4PGNA 4YZZA 2PFZA 3GYYA 4PAKA 4OVPA 2XXKA 2ZZWA 4NF0A 4PDDA 4N6DA 4OA4A 2XWVA 2V4CA 2WX9A 2VPOA 4O8MA 4P8BA 2CEXA 4NG7A 5IZZA 5LTCA 4N91A 4MNCA 4P47A 5IM2A 4XEQA 4NHBA 2XWKA 4LN5A 4N17A 4MEVA 4N4UA 3FXBA 4OVTA 2XWOA 4UABA 4OANA 4P3LA
chains in the Genus database with same CATH superfamily
5ET7A 4P1EA 1YAEA 2A5TB 4OVQA 1KA1A 3MWBA 3PGFA 4LQ5A 2Y7KA 2KLFA 3PMWA 4DZ1A 4H0WA 5IZ3B 1LBZA 1ELJA 4PDHA 2F3BA 2VOZA 3FJMA 1ZU0A 3OD7A 2X7QA 4MNPA 4PE3A 1FBPA 2Q89A 3G3KA 4N81A 4MLVA 3H6VA 4P56A 4F3GA 1QUIA 3SETA 4PFBA 4EF1A 1DBZA 4NX1A 1B4ZA 3K6XA 2F35A 2NOOA 5ICQA 1IXGA 4TQUQ 1NUWA 1NV3A 2XXXA 2ZMBA 1IMBA 3LSFB 5I84A 1CE2A 5F24A 1N3XA 1XHYA 2HHMA 3KFMA 4XKQA 1T0KA 1JNFA 5F7VA 4ZEKA 1MQDA 1QKAA 4NE4A 5IZ1A 1JW4A 5B70A 3S9MC 3THIA 4HS7A 3PPQA 4U1OA 1VDWA 4I1DA 4OVPA 3C33A 2DWJA 4WKMA 1LEVA 5H8FA 3C31A 3BBRA 1FQDA 3UN6A 3IX1A 1QVSA 2Z8EA 5LTCA 1AIVA 1QULA 1MM7A 4NHBA 1IITA 2D5WA 4RY1A 3RT6B 1YTVA 1K9ZA 4YKIA 1FPEA 4OWDA 4ZS9A 2Q2AA 4OVTA 3VFJA 4RXLA 3CVGA 4XKNA 5KCJB 5K2YA 3EKIA 2NXOA 4YKKA 4K3FA 4C0RA 2F7CA 5ELVA 1FQFA 3FVNA 3RYDA 4OFLA 1QKBA 2AYSA 4AS4A 1O63A 1Q35A 1LGBC 4GX4A 4R6HA 2CEYA 3OMBA 3Q26A 4POWA 4OENA 4QFLA 2D3IA 3E3KA 1D9VA 5EQ9A 4F1YA 3ILUB 1MH4A 4KCDA 3HFUA 3PPRA 5KDTA 3N94A 4GX3A 4KYEA 3B8BA 2YLNA 4KFQA 3G7WA 5H8HB 1Y3PA 3D4CA 2E0SA 1PB9A 2QS4A 3K6UA 3MPLA 4GWUA 4LVQA 4QFOA 2B3FA 1I6QA 4PFWA 4PAKA 5B7DA 4GXSB 5L8DA 3SKPA 4MLQA 3S9EA 1FJ9A 2OJTA 3B6TA 4H5GA 2XXRA 3HHGA 2I3WA 2FNCA 3OOAA 3TZAA 1NMUA 4BDLA 2NVUB 4C1UA 1Y4CA 2WKYA 3VVDA 2OCUA 3VE1B 5ITPA 1FBDA 3C36A 4THIA 4GD5A 4MAGA 5I2KA 2B3BA 2VT5A 1TWYA 1LAGE 4G77A 3LSWA 5CBSA 3DM0A 3TCGA 2GH9A 3FXRA 4G61A 1RKMA 3HCQA 3TELA 1BK4A 2REGA 4O7MA 3T9UA 3P7IA 4P11A 3SEXA 2Z23A 4NF4B 4IO7A 4I40A 2XXTA 3T0JA 3MP8A 4BDQA 3OELA 4H8JA 1LBCA 4LP2B 1LBWA 1OIBA 4LQ2A 2CZIA 4P9KA 2ABHA 4JWYA 4LATA 3B6WA 1HSEA 1DOTA 4GWOA 1SBPA 4C1TA 1P1QA 3TKDA 1IUDA 3IB0A 4U21A 2HEUA 3JYRA 1A99A 5ET5A 1L5TA 4G68B 1R9QA 5IM2A 4P47A 5I2NA 1JVYA 3IL1B 4NF6A 2GFEA 5EHMA 1LCTA 3I3VA 3MPKA 3QUFA 3PUWE 3B6QA 3MP6A 3TAJA 2PT1A 2ANJA 5DEXB 2FVZA 3AXFA 3HHFA 4OANA 1JVXA 2RKMA 3K0VA 5AA3A 3H6UA 3KSJA 4MIJA 4P0IA 4X9TA 4HW8A 1UTHA 1AMFA 4NF5B 5DTBA 3TUSA 4AS5A 1SI1A 2F7BA 5J16A 3O6GA 1MDQA 2WYKA 3KZGA 1B0HA 3H7MA 3ZS6A 3RY3A 4JVDA 4MNIA 3QYTA 4OEVA 4YU0A 4GFRA 5I3SA 3IB1A 3OENA 1B3EA 1FPKA 2F6PA 3UORA 4XFEA 4HE2A 2XXUA 4N8GA 5ITOA 4IO3A 4X04A 1O64A 1IMAA 3TCHA 1N7WA 4RYAA 3SEWA 4OVJA 5I56B 3H4ZA 1H45A 3CFZA 4DCXA 1NI9A 5L9OA 3SERA 2QS2A 1NH7A 4I3YA 4IO2A 4GXAA 2VHAA 5I7IA 1VFEA 1MY3A 3R7XA 1EZOA 3PMXA 3W9WA 3TFLA 4HCWA 1PC3A 4QXDA 2PBWA 2P3NA 4N07A 2HCAA 3O6IA 1MQJA 3T66A 4R9GA 1HSLA 2PFZA 3VV5A 1FTJA 4GL8A 3IR1A 1FBEA 3B7DA 4OA4A 4ND9A 3D4GA 1FTAA 3IJXB 1IXIA 5H8QA 4RK2A 2CEXA 3N26A 4NTLA 2XD3A 3G3JA 5L9MA 3CI8A 1MS7A 3FXBA 2Y5LA 1I6AA 1H44A 3OO8A 1HSJA 1A40A 1XC1A 4H1XA 3B50A 3MC2A 4HE0A 2Z22A 2RC8A 4DI3D 4ZE9A 3L6GA 5H8NA 3IOWA 3EHTA 1OQGA 3FVGA 1INPA 4QSEA 4G8HA 3KBZA 1Q1KA 1IXCA 3PPNA 1IMDA 1B5HA 1LSTA 2GRVA 4PF8A 3O29A 2OLBA 3RTFB 3KOSA 3IO6A 3K1NA 3DP4A 2Y7IA 4WXJA 1H76A 4G8MA 4H67A 4F22A 2XX7A 5TPAA 3VVFA 4YMBA 1RDXA 2R9JA 3M8UA 5BWJA 1B9JA 5CM6A 3H6TA 4YKJA 1FQBA 1NUXA 4YMAA 1FBGA 3LUZA 2GHAA 4XTCQ 1SDXA 4RK9A 2OK2A 2A5TA 3C4MA 4U2RA 1URGA 1VFDA 3CR9A 5IZ3A 1NUYA 4OMBA 2F78A 1B32A 4Z7EA 2QFLA 2DWHA 1YZ0A 4O3CA 2FBPA 2JJKA 5AA4B 2IEEA 1B58A 4TLLB 4H8IA 2H4IA 3LUYA 4ESXA 2XWOA 4UABA 1LBXA 4F2OA 4F1VA 4ELQA 3N6TA 4UACA 4YKPA 1EZPA 4N8YA 1LB9A 1TFAA 5A5LA 3MVXA 2L5VA 1MM6A 3SZPA 3TEPA 2UYFA 4NAPA 4YB5A 4RA1A 2MKZA 1MXYA 4HE1A 1URSA 4PFUA 4FAJA 3M3LA 3MQ9A 1S50A 2AL5A 3K02A 1B7UA 1BTJA 2Q74A 2DE2A 1FJ6A 1II5A 1B3FA 3GBAA 3A09A 4MMPA 3LR1A 2PFYA 4LUBA 1P1WA 1USYE 4DIGA 3G3GA 1R1NA 3UGWA 2DP8A 4Q0CA 5AA2D 4EQ7A 3IO4A 1FBFA 4ISUA 4PBHA 2ONRA 5K2XA 4PFRA 2F97A 4F19A 1NV0A 4F29A 4KYDA 5KCJA 4G4PA 2QMXA 2V3TA 3I6VA 5CC2A 2Q8MA 4EDPA 1FPGA 1P1OA 4XIGQ 4PQJA 2QRYA 1B7ZA 1FQEA 4JSDA 1USYH 5HM4B 4N91A 3U72A 2I0BA 3N6UA 4N17A 5I59B 3O66A 3D1RA 1KA0A 3OO6A 1PDAA 1LFGA 3GBBA 4QSCA 1YYZA 3CSGA 5EYGA 2O1MA 1MY0A 4OVRA 3RPLB 5H8HA 2ZNSA 4PCDA 1PB7A 1R6ZA 2H99A 3E78A 1K9YA 2G93A 4ZEBA 2DWIA 4H6DA 2H25A 5KZTA 3LSLA 4OETA 1Y4TA 3ZKKA 3RGYA 2HFBA 4DXUA 2OZZA 4N15A 4FECA 1Q9DA 2QJEA 2Y84A 1FRPA 4I62A 1FPBA 2VD2A 2OWZA 2UYEA 3TMGA 3KC0A 1Y9UA 3SEVA 2X7PA 3Q27A 2XXIA 1JW5A 4NWCA 1EYJA 4Q5TA 4OVSA 3H03A 3G3HA 4QFPA 1FTMA 3KJTA 4U22A 2O69A 5H8SA 3ECRA 4AB6A 4ZEFA 1WVJA 3QSLA 4IB2A 1XS5A 3F11A 1QUJA 3MYUA 2R71A 2XWKA 5TP9B 1EZ9A 4RNSA 3RT8A 3M3FA 4GWYA 3I5OA 4DLDA 3KG2A 2Q9TA 1LFHA 4NF4A 4RPOA 3MSTA 3KN3A 1S9TA 2HZKA 1VSOA 1N76A 2ZNTA 3EF7A 3MZ1A 1GVCA 1LB8A 2WBBA 2HQ0A 2CZLA 3RQTA 5FHNA 1RYXA 4NEDA 3PUZE 2ZXTA 3K1MA 3MUQA 4O3AA 4MBPA 1DPEA 2KR0A 5HPQA 1M5EA 1N0TA 3IB2A 3CFXA 1IEJA 3S2VA 2V3QA 5AA2B 1LBBA 1LAFE 3T9VA 3UIFA 3T22A 4Z0IA 2XA5A 2Z8FA 2V84A 1UIVA 1H3DA 3MVWA 2OWSA 4G68A 1QGXA 4E0XA 2HPGA 4R73A 5AA1A 3U8QA 4IY5A 2FIXA 4GWZA 4NGUA 4GBVA 1UTBB 5I57B 1GGGA 1YPNA 1RDZA 2PVUA 5DEXA 4NMYA 2UVJA 3U92A 1LFIA 2QVVA 4KR5A 1NV1A 3FJ7A 3LBSA 4F3SA 1H43A 3OO7A 1B6HA 4NF5A 4BLAA 3ZSFA 2XXPA 4FIMA 3BIGA 1B3GA 2OBGA 5FTHA 3SESA 2E1SA 5A5XB 2V93A 1XVXA 4OEUA 2PMSA 4MF3A 1QJMA 2I6EA 3BKIB 4KHZE 1AOVA 2I49A 3TQLA 2OWTA 1QUKA 3Q29A 3E79A 3QMFA 1A54A 3K00A 1FSAA 5EHSA 5I56A 3MVYA 4JXIA 1EH3A 3G3IA 3IORA 4PFIA 2HAVA 3TTMA 2Q8JA 4NQ8A 4OQOA 2VD3A 5F1QA 3EHUA 3MJNA 4KYSA 4QFKA 1B4HA 1IXHA 3MAMA 1DTZA 3MVZA 1MY4A 3M3KA 2I58A 2KQZA 1XOCA 1P1NA 2HXWA 1NH8A 5DVJA 4KD5A 4QSDA 2PT2A 4F31B 3EN3A 3ZKLA 1YXIA 3JZJA 1FW0A 3FXQA 1FQAA 3IK6B 5IGAA 5ESYA 3EHSA 5JTYA 2YJPA 4PGPA 3FBPA 4H46A 2XXQA 4X8RA 1POY1 1FPJA 1IZ1A 4LONB 4ZDMA 1SVXB 3ONMA 4BDNA 4O7IA 1KWHA 3R26A 1ZBMA 1B52A 4OHNA 4KXPA 1SW2A 3LSXA 2F36A 2QVRA 3PPPA 3UP9A 3LV0A 4LZ7A 1I6BA 1JETA 4N6DA 3FZVA 3N5LA 2WEFA 5HBCA 4G8NA 3MP1A 4P8BA 1OVTA 5LDZA 3KOTA 2VP1A 3IAZA 1NKXA 1N7XA 2DE4A 1SW1A 1Z7ME 1DPPA 4KI0E 3CIJA 3WAFA 2XX8A 3CG1A 3S9NC 4QHQA 4NN3A 3Q28A 2UVGA 3W15C 2CMOA 2B4LA 4M4GA 3HSTA 5JTYB 1DSNA 4MJOA 4NF8B 3K01A 1TFDA 1D3KA 2YPNA 4H5FA 1N84A 1ZLQA 3T9HB 2UXAA 3RPWA 1MY1A 3V83A 1US5A 2RF1A 4MCOA 2O7IA 1F9BA 3IOTA 3FVOA 4JBZA 1NV7A 2ALUA 3FV1A 4ONYA 1NUZA 4R75A 3DLNA 1BP5A 4OERA 2F7AA 1YCJA 2FIEA 2G29A 2BJJX 3O6HA 2I48A 1O7TA 1MQIA 3IOVA 4R2FA 1S7YA 3O9PA 3DP8A 4KQPA 5AA4A 1B40A 3MZBA 5ICTA 4EXKA 4H65A 4PBQA 4R6KA 2WYPA 1DMBA 2O68A 5EYFA 3R6UA 3G3FA 3OEKA 5JEIA 1PBPA 2PX1A 1NV4A 5ET8A 4GOTA 1NL5A 1IIWA 3PUVE 4NF0A 1PBQA 1ZIUA 1MXWA 4LA9A 1Y1ZA 1MXUA 4ZEIA 4XKRA 1SI0A 3O97A 1A8FA 4IR8A 1NNPA 4JSOA 1N3WA 4UA8A 4BDOA 3FD3A 2P2AA 2LAOA 1FPLA 4XEQA 1OLAA 2NWJA 3S4UA 4O3BA 4MEVA 4EF2A 4R9FA 4ZZEA 4P3LA 1AWBA 2DSFA 2ZYNA 3A29A 3V5AA 3OSQA 3PUYE 5EQ7A 3UK4A 3KGCA 4FEDA 4E0WA 4GWWA 1A8EA 3BFTA 2QS1A 2PYYA 2DS9A 5J1DA 1BKAA 2XXYA 5ISUA 1SYIA 3OSRA 3QIMA 1MRPA 5I58B 5DW8A 2Y7RA 3VVEA 1FPFA 2RC9A 4X1DA 4FBPA 4JWXA 4PTKA 3ODBA 1P99A 4MX6A 3HN0A 4L17A 4G68C 1OLCA 3W9VA 3KBRA 4DXCA 5CMBA 4FJPA 4PFTA 4GQOA 1TT1A 1LAXA 3CG3A 1FTLA 1UIUA 4MH5A 1NV6A 2H9BA 2DXRA 3BFUA 3IOUA 1JP4A 5I59A 2ZZXA 3H6WA 3E13X 4FORA 1ZMGA 4QFNA 4YZZA 5DVFA 4LZ5A 1US4A 1Y20A 1AL3A 1B51A 3GZGA 3KN7A 1FQCA 2HAUA 2AL4A 3FATA 3K4UA 3T96B 4OFOA 4ZECA 4X48A 1ATGA 3RPLA 2VPOA 4GWSA 2Y5KA 4O8MA 1B05A 1P1UA 1DTGA 4NG7A 3O2AA 3TTKA 3KJ7A 4DCYA 2QPQA 4MFIA 1MXXA 5L9SA 4N13A 3USDA 3IFAA 5TU0A 4PFYA 3TODA 3ISPA 1B5JA 3PD8A 2W7YA 4PF6A 3QAXA 3K6WA 4OZ9A 1MDP1 3FV2A 1CNQA 4QF9A 2DVZA 4RPNA 1J1NA 5CI5A 4F3PA 2RCAA 1NFTA 2VGQA 2ZYMA 3TYHA 2XWIA 3U94A 1SPIA 4DI4B 2RC7A 4R2BA 3VDFA 1B1XA 5EYHA 2XXWA 1MH3A 4IGTA 2HXRA 2RINA 3RUMA 3U1OA 2F3DA 2QSXA 2UVIA 4GBWA 1MXZA 1LBVA 3CRBA 2O51A 4FEBA 2ZNUA 4H45A 5TP9A 2NUVA 4GIZA 2THIA 3ROJA 1XT8A 2QVUA 4PETA 4PP0A 1XI6A 1GR2A 4HXVA 4YB6A 1NV2A 2P0SA 3PPOA 2V25A 2O1LA 5CMKA 2DWAA 1KZ8A 1M5BA 2XXKA 2ZZWA 2F8DA 4PDDA 1A7LA 1MXVA 2XWVA 2X26A 4GWXA 4XKPA 3LC8A 1MPBA 1TXFA 3EQ1A 3OEMA 3Q25A 5IZZA 3K2DA 5DVIA 4OXVA 3E4RA 2R8TA 2DQVA 1B1HA 3IFCA 1Y3NA 4KPTA 5AA2A 4GX6A 3GLBA 1OMPA 4ELRA 3QXMA 1B0LA 2O84X 3FXUA 4Q30B 3OXNA 5H8FB 2H5YA 4IGRA 4U23A 4GVOA 3TPAA 1UTBA 1MPDA 5I57A 4EXLA 4JB7A 5T3JA 2ESNA 3C32A 3DELB 1POTA 4GRKA 4R72A 1ANFA 1LLSA 4OFJA 4PAFA 4ZEDA 5A5XA 3HV1A 2I4BA 2Q2CA 4JVIA 1DK4A 3DP6A 3FVKA 2XHDA 2ZZVA 2HZLA 4IY6A 3CHGA 3NOHA 1Y1MA 4P0GA 4ECFA 1IMFA 1NNFA 4U4XA 1IMEA 4FATA 3FASA 1XVYA 2RCBA 3VLUA 1SW4A 5FHOA 4EQBA 3L6HA 3T1BA 4TLMB 2V4CA 1A55A 5KDTB 4NWDA 4U1ZA 2PCRA 4ZE8A 2QMWA 3O28A 1WODA 1MG1A 4QRZA 1JW1A 1MY2A 4LZ8A 2Y7WA 4OTEA 4N4UA 1B46A 4IO5A 1D4NA 4BDRA 1B2HA 1FPDA 2F5XA 1RDYA 5M2VA 3SEUA 1IMCA 1LCFA 4GF8A 1MQHA 1UQWA 1ZKBA 2DE3A 4DDDA 2O7UA 2DVCA 2I4CA 2ONSA 5I5PA 2FA7A 1JEVA 3QK6A 1GTKA 3PUXE 2XD2A 4N6KA 2Q88A 3V89B 3RN8A 5I2KB 1B3HA 4R74A 1WDNA 1FPIA 5FTIA 4RJZA 1Z7NE 4XF5A 4N6PA 2F34A 3U93A 2QL3A 2BJIA 3C9HA 1SQYA 3KN8A 4F1UA 5ET6A 4AQ4A 1PB8A 5FHMA 1EYIA 1Y3QA 2I3VA 3WAEA 3RLFE 4PGNA 2ZYOA 1FBHA 3GYYA 2WBDA 4X1BA 3RNNA 2UVHA 4ELOA 1ZJLA 2DDKA 3CFLA 4I3EA 3KEIA 3K6VA 4NF8A 3FJGA 4GL0A 5EQAA 3TDJA 3TQWA 1BIYA 4MNCA 2F6GA 5BUUA 2ZYKA 4GLIA 3S9LC 4U4SA 4OESA 1IQ7A 1D9QA 3C34A 1EYKA 1CB6A 2DYXA 3C35A 3PTYA 2V3UA 4YICA 2O6AA 5IKBA 3PMVA 3U65A 4M1VA 2XXHA 3PV0E 2VPNA 3KSXA 1MQGA 3A3UA 2Y7PA 5I2NB 3GXAA 4NF6B 3TCFA 5CRYA 4AB5A 3T93B 3JV9A 3E9XA 4MHFA 5CMCA 4EQ9A 4R6YA 1BLFA 1URDA 1SYHA 4XXUA 4HTGA 3OO9A 3MW0A 4JWOA 4DE8A 1PEBA 3FIRA 1UTHB 4POXA 4I8CA 3UA8A 1RYOA 4JVCA 2REJA 3TTLA 1LBYA 4WEDA 2IA4A 3VLWA 4IO6A 1MPCA 2M8CA 1OQHA 4OYVA 2DXYA 2Z8DA 2DOJA 5I58A 5IAIA 5AE4A 2CZHA 4F2QA 2D21A 5DYHA 3BIHA 1FBCA 4YAHX 1I69A 2GHBA 2GQ1A 3VXCA 2FYIA 5DT6A 2XXVA 3FGSA 1B5IA 1FTKA 1SD3A 4KCCA 2A5SA 3MZ9A 1VE4A 2P1SA 3FUZA 4I9DA 2CZKA 3MBPA 4DXBA 1G0HA 1SW5A 5H8QB 2B4MA 2B65A 3TTNA 4G2ZA 2ONKE 4F3BA 5JK4A 3A3CA 1N04A 5LOMA 1B7HA 4PC9A 3SEYA 4F39A 3CSBA 1FCKA 4PAIA 1B3LA 2I0CA 4WEPA 1OVBA 2OX3A 3VXBA 2H98A 1JEUA 4P1LA 4O94A 1LAHE 1M5CA 4Q8RA 5CBRA 3TTRA 1NV5A 3KC1A 3PD9A 4F18A 1JQFA 5H8NB 1NNKA 1EU8A 3QUJA 4FE8A 1M5DA 5EQ8A 4BDMA 1M5FA 4ELPA 2QS3A 4HCYA 4IO4A 1AH5A 3SDFA 5FBPA 2AIXA 3V8XB 1GV8A 1ZTYA 3HPIA 5TPAB 3H3GA 4TOZA 2XX9A 2WX9A 4YB7A 1NNTA 3VLVA 1QW0A 2P3VA 3EPEA 4EUOA 4PE5B 3K1PA 4ESWA 4QBAA 4ZZAA 3HO7A 1FTOA 3IJOB 3RTWB 1D9YA 1VR5A 1DCUA 4LN5A 3ILTB 4JDFA 3PU5A 1R9LA 2FHYA 1G0IA 5CMMA 3H06B 2R6GE 3T9XB
chains in the Genus database with same CATH topology
5ET7A 4P1EA 1FSAA 4OVQA 1KA1A 4PFIA 5IZ3B 1LBZA 4NQ8A 4PDHA 3B50A 4HE0A 4DI3D 2F3BA 5T3JA 4MNPA 1INPA 4PE3A 3KBZA 1FBPA 4N81A 2KQZA 4P56A 1IMDA 4PFBA 4PF8A 1DBZA 4PAFA 4NX1A 1YXIA 1NUWA 1RDXA 1NV3A 4JVIA 1IMBA 1DK4A 5IGAA 5ESYA 4PGPA 3FBPA 5F24A 2ZZVA 5CM6A 2HZLA 4H46A 2HHMA 4X8RA 3CHGA 1NUXA 3NOHA 1FPJA 1FBGA 3LUZA 1IMFA 4O7IA 5IZ1A 4KXPA 1IMEA 2QVRA 1VDWA 3LV0A 4OVPA 1LEVA 4N6DA 5IZ3A 1NUYA 3T1BA 2V4CA 2QFLA 2WEFA 1YZ0A 2PCRA 4P8BA 2FBPA 5LTCA 2JJKA 5LDZA 4NHBA 1K9ZA 2DE4A 1FPEA 4N4UA 4OVTA 2XWOA 4UABA 1LBXA 4F1VA 1FPDA 2F5XA 4N8YA 4NN3A 5A5LA 3EKIA 2L5VA 1RDYA 2B4LA 3SZPA 1IMCA 4MJOA 4NAPA 2MKZA 4HE1A 2DE3A 3RYDA 4AS4A 5I5PA 4GX4A 2CEYA 4MCOA 2Q74A 2DE2A 4N6KA 1FJ6A 4MMPA 1NV7A 1NUZA 2PFYA 5EQ9A 2FIEA 3HFUA 4GX3A 1FPIA 3B8BA 4XF5A 2BJIA 1FBFA 4F1UA 5ET6A 4PBHA 4PBQA 2WYPA 4PFRA 1EYIA 4GWUA 4F19A 1NV0A 4PGNA 1FBHA 3GYYA 4PAKA 2WBDA 1NV4A 5ET8A 4NF0A 2Q8MA 1FJ9A 1FPGA 2DDKA 4I3EA 4IR8A 5EQAA 4N91A 1FPLA 4MNCA 4XEQA 4N17A 4MEVA 4P3LA 3D1RA 1AWBA 1FBDA 1KA0A 1D9QA 1YYZA 1EYKA 3A29A 4MAGA 2VT5A 3PTYA 5EQ7A 5EYGA 4YICA 4GWWA 4OVRA 3U65A 4G61A 4M1VA 2VPNA 3RPLB 5J1DA 3QMFA 4PCDA 1BK4A 5DW8A 4O7MA 3E78A 1K9YA 1FPFA 4MHFA 4FBPA 4PTKA 4MX6A 3W9VA 4I40A 3T0JA 4N15A 1Q9DA 1FRPA 1FPBA 1LBWA 2OWZA 1NV6A 3KC0A 2CZIA 4JVCA 1JP4A 4P9KA 1EYJA 1LBYA 4OVSA 2ZZXA 4YZZA 5ET5A 3RPLA 2VPOA 4GWSA 2Y5KA 4O8MA 4NG7A 5IM2A 4P47A 3MYUA 2XWKA 2CZHA 3BIHA 1FBCA 2QPQA 2GQ1A 4GWYA 2FVZA 4OANA 2Q9TA 3IFAA 3ISPA 4MIJA 4X9TA 4PF6A 3MSTA 4AS5A 2HZKA 5J16A 1CNQA 2WYKA 2DVZA 2WBBA 2CZKA 4JVDA 4MNIA 1G0HA 2B4MA 5I3SA 5JK4A 2XWIA 1FPKA 1SPIA 4DI4B 4PC9A 4XFEA 2KR0A 4HE2A 4N8GA 5EYHA 4PAIA 2V3QA 2HXRA 4X04A 1IMAA 2F3DA 2OX3A 2XA5A 4GBWA 4P1LA 4O94A 1LBVA 1QGXA 1NI9A 4I3YA 2HPGA 2FIXA 4GWZA 5I7IA 4NGUA 1NV5A 3KC1A 4F18A 4GBVA 3W9WA 4H45A 4HCWA 1RDZA 4QXDA 2P3NA 3ROJA 2QVUA 5EQ8A 4PETA 1XI6A 4HXVA 1NV2A 2QVVA 1NV1A 2PFZA 4HCYA 1KZ8A 5FBPA 2XXKA 1FBEA 2ZZWA 3BIGA 4PDDA 4OA4A 2XWVA 2WX9A 2P3VA 4GWXA 1FTAA 4QBAA 2CEXA 5IZZA 2R8TA 1DCUA 4LN5A 3IFCA 2FHYA 3FXBA 1G0IA 3E79A 2Y5LA 4GX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1E A;  4N8Y A;  4MIJ A;  4MAG A;  4NN3 A;  4PF6 A;  4OVQ A;  2HZK A;  4YIC A;  4PFI A;  2WYK A;  4OVR A;  4NQ8 A;  4PDH A;  3B50 A;  4NAP A;  3U65 A;  4MNI A;  4DI3 D;  2VPN A;  4MNP A;  2XWI A;  4PCD A;  4PE3 A;  4DI4 B;  5I5P A;  4O7M A;  4PC9 A;  4XFE A;  2CEY A;  4P56 A;  4MHF A;  4MCO A;  4N8G A;  4PFB A;  4PF8 A;  4N6K A;  4PAI A;  4X04 A;  4MMP A;  4PAF A;  4NX1 A;  2PFY A;  4MX6 A;  2XA5 A;  4N15 A;  4P1L A;  4O94 A;  5IGA A;  2HPG A;  4PGP A;  5CM6 A;  2ZZV A;  4XF5 A;  2HZL A;  5I7I A;  4NGU A;  4X8R A;  4P9K A;  4PBH A;  4PBQ A;  2WYP A;  4PFR A;  4OVS A;  4PET A;  2ZZX A;  4PGN A;  4YZZ A;  2PFZ A;  3GYY A;  4PAK A;  4OVP A;  2XXK A;  2ZZW A;  4NF0 A;  4PDD A;  4N6D A;  4OA4 A;  2XWV A;  2V4C A;  2WX9 A;  2VPO A;  4O8M A;  4P8B A;  2CEX A;  4NG7 A;  5IZZ A;  5LTC A;  4N91 A;  4MNC A;  4P47 A;  5IM2 A;  4XEQ A;  4NHB A;  2XWK A;  4LN5 A;  4N17 A;  4MEV A;  4N4U A;  3FXB A;  4OVT A;  2XWO A;  4UAB A;  4OAN A;  4P3L A; 
#chains in the Genus database with same CATH topology
 5ET7 A;  4P1E A;  1YAE A;  2A5T B;  4OVQ A;  1KA1 A;  3MWB A;  3PGF A;  4LQ5 A;  2Y7K A;  2KLF A;  3PMW A;  4DZ1 A;  4H0W A;  5IZ3 B;  1LBZ A;  1ELJ A;  4PDH A;  2F3B A;  2VOZ A;  3FJM A;  1ZU0 A;  3OD7 A;  2X7Q A;  4MNP A;  4PE3 A;  1FBP A;  2Q89 A;  3G3K A;  4N81 A;  4MLV A;  3H6V A;  4P56 A;  4F3G A;  1QUI A;  3SET A;  4PFB A;  4EF1 A;  1DBZ A;  4NX1 A;  1B4Z A;  3K6X A;  2F35 A;  2NOO A;  5ICQ A;  1IXG A;  4TQU Q;  1NUW A;  1NV3 A;  2XXX A;  2ZMB A;  1IMB A;  3LSF B;  5I84 A;  1CE2 A;  5F24 A;  1N3X A;  1XHY A;  2HHM A;  3KFM A;  4XKQ A;  1T0K A;  1JNF A;  5F7V A;  4ZEK A;  1MQD A;  1QKA A;  4NE4 A;  5IZ1 A;  1JW4 A;  5B70 A;  3S9M C;  3THI A;  4HS7 A;  3PPQ A;  4U1O A;  1VDW A;  4I1D A;  4OVP A;  3C33 A;  2DWJ A;  4WKM A;  1LEV A;  5H8F A;  3C31 A;  3BBR A;  1FQD A;  3UN6 A;  3IX1 A;  1QVS A;  2Z8E A;  5LTC A;  1AIV A;  1QUL A;  1MM7 A;  4NHB A;  1IIT A;  2D5W A;  4RY1 A;  3RT6 B;  1YTV A;  1K9Z A;  4YKI A;  1FPE A;  4OWD A;  4ZS9 A;  2Q2A A;  4OVT A;  3VFJ A;  4RXL A;  3CVG A;  4XKN A;  5KCJ B;  5K2Y A;  3EKI A;  2NXO A;  4YKK A;  4K3F A;  4C0R A;  2F7C A;  5ELV A;  1FQF A;  3FVN A;  3RYD A;  4OFL A;  1QKB A;  2AYS A;  4AS4 A;  1O63 A;  1Q35 A;  1LGB C;  4GX4 A;  4R6H A;  2CEY A;  3OMB A;  3Q26 A;  4POW A;  4OEN A;  4QFL A;  2D3I A;  3E3K A;  1D9V A;  5EQ9 A;  4F1Y A;  3ILU B;  1MH4 A;  4KCD A;  3HFU A;  3PPR A;  5KDT A;  3N94 A;  4GX3 A;  4KYE A;  3B8B A;  2YLN A;  4KFQ A;  3G7W A;  5H8H B;  1Y3P A;  3D4C A;  2E0S A;  1PB9 A;  2QS4 A;  3K6U A;  3MPL A;  4GWU A;  4LVQ A;  4QFO A;  2B3F A;  1I6Q A;  4PFW A;  4PAK A;  5B7D A;  4GXS B;  5L8D A;  3SKP A;  4MLQ A;  3S9E A;  1FJ9 A;  2OJT A;  3B6T A;  4H5G A;  2XXR A;  3HHG A;  2I3W A;  2FNC A;  3OOA A;  3TZA A;  1NMU A;  4BDL A;  2NVU B;  4C1U A;  1Y4C A;  2WKY A;  3VVD A;  2OCU A;  3VE1 B;  5ITP A;  1FBD A;  3C36 A;  4THI A;  4GD5 A;  4MAG A;  5I2K A;  2B3B A;  2VT5 A;  1TWY A;  1LAG E;  4G77 A;  3LSW A;  5CBS A;  3DM0 A;  3TCG A;  2GH9 A;  3FXR A;  4G61 A;  1RKM A;  3HCQ A;  3TEL A;  1BK4 A;  2REG A;  4O7M A;  3T9U A;  3P7I A;  4P11 A;  3SEX A;  2Z23 A;  4NF4 B;  4IO7 A;  4I40 A;  2XXT A;  3T0J A;  3MP8 A;  4BDQ A;  3OEL A;  4H8J A;  1LBC A;  4LP2 B;  1LBW A;  1OIB A;  4LQ2 A;  2CZI A;  4P9K A;  2ABH A;  4JWY A;  4LAT A;  3B6W A;  1HSE A;  1DOT A;  4GWO A;  1SBP A;  4C1T A;  1P1Q A;  3TKD A;  1IUD A;  3IB0 A;  4U21 A;  2HEU A;  3JYR A;  1A99 A;  5ET5 A;  1L5T A;  4G68 B;  1R9Q A;  5IM2 A;  4P47 A;  5I2N A;  1JVY A;  3IL1 B;  4NF6 A;  2GFE A;  5EHM A;  1LCT A;  3I3V A;  3MPK A;  3QUF A;  3PUW E;  3B6Q A;  3MP6 A;  3TAJ A;  2PT1 A;  2ANJ A;  5DEX B;  2FVZ A;  3AXF A;  3HHF A;  4OAN A;  1JVX A;  2RKM A;  3K0V A;  5AA3 A;  3H6U A;  3KSJ A;  4MIJ A;  4P0I A;  4X9T A;  4HW8 A;  1UTH A;  1AMF A;  4NF5 B;  5DTB A;  3TUS A;  4AS5 A;  1SI1 A;  2F7B A;  5J16 A;  3O6G A;  1MDQ A;  2WYK A;  3KZG A;  1B0H A;  3H7M A;  3ZS6 A;  3RY3 A;  4JVD A;  4MNI A;  3QYT A;  4OEV A;  4YU0 A;  4GFR A;  5I3S A;  3IB1 A;  3OEN A;  1B3E A;  1FPK A;  2F6P A;  3UOR A;  4XFE A;  4HE2 A;  2XXU A;  4N8G A;  5ITO A;  4IO3 A;  4X04 A;  1O64 A;  1IMA A;  3TCH A;  1N7W A;  4RYA A;  3SEW A;  4OVJ A;  5I56 B;  3H4Z A;  1H45 A;  3CFZ A;  4DCX A;  1NI9 A;  5L9O A;  3SER A;  2QS2 A;  1NH7 A;  4I3Y A;  4IO2 A;  4GXA A;  2VHA A;  5I7I A;  1VFE A;  1MY3 A;  3R7X A;  1EZO A;  3PMX A;  3W9W A;  3TFL A;  4HCW A;  1PC3 A;  4QXD A;  2PBW A;  2P3N A;  4N07 A;  2HCA A;  3O6I A;  1MQJ A;  3T66 A;  4R9G A;  1HSL A;  2PFZ A;  3VV5 A;  1FTJ A;  4GL8 A;  3IR1 A;  1FBE A;  3B7D A;  4OA4 A;  4ND9 A;  3D4G A;  1FTA A;  3IJX B;  1IXI A;  5H8Q A;  4RK2 A;  2CEX A;  3N26 A;  4NTL A;  2XD3 A;  3G3J A;  5L9M A;  3CI8 A;  1MS7 A;  3FXB A;  2Y5L A;  1I6A A;  1H44 A;  3OO8 A;  1HSJ A;  1A40 A;  1XC1 A;  4H1X A;  3B50 A;  3MC2 A;  4HE0 A;  2Z22 A;  2RC8 A;  4DI3 D;  4ZE9 A;  3L6G A;  5H8N A;  3IOW A;  3EHT A;  1OQG A;  3FVG A;  1INP A;  4QSE A;  4G8H A;  3KBZ A;  1Q1K A;  1IXC A;  3PPN A;  1IMD A;  1B5H A;  1LST A;  2GRV A;  4PF8 A;  3O29 A;  2OLB A;  3RTF B;  3KOS A;  3IO6 A;  3K1N A;  3DP4 A;  2Y7I A;  4WXJ A;  1H76 A;  4G8M A;  4H67 A;  4F22 A;  2XX7 A;  5TPA A;  3VVF A;  4YMB A;  1RDX A;  2R9J A;  3M8U A;  5BWJ A;  1B9J A;  5CM6 A;  3H6T A;  4YKJ A;  1FQB A;  1NUX A;  4YMA A;  1FBG A;  3LUZ A;  2GHA A;  4XTC Q;  1SDX A;  4RK9 A;  2OK2 A;  2A5T A;  3C4M A;  4U2R A;  1URG A;  1VFD A;  3CR9 A;  5IZ3 A;  1NUY A;  4OMB A;  2F78 A;  1B32 A;  4Z7E A;  2QFL A;  2DWH A;  1YZ0 A;  4O3C A;  2FBP A;  2JJK A;  5AA4 B;  2IEE A;  1B58 A;  4TLL B;  4H8I A;  2H4I A;  3LUY A;  4ESX A;  2XWO A;  4UAB A;  1LBX A;  4F2O A;  4F1V A;  4ELQ A;  3N6T A;  4UAC A;  4YKP A;  1EZP A;  4N8Y A;  1LB9 A;  1TFA A;  5A5L A;  3MVX A;  2L5V A;  1MM6 A;  3SZP A;  3TEP A;  2UYF A;  4NAP A;  4YB5 A;  4RA1 A;  2MKZ A;  1MXY A;  4HE1 A;  1URS A;  4PFU A;  4FAJ A;  3M3L A;  3MQ9 A;  1S50 A;  2AL5 A;  3K02 A;  1B7U A;  1BTJ A;  2Q74 A;  2DE2 A;  1FJ6 A;  1II5 A;  1B3F A;  3GBA A;  3A09 A;  4MMP A;  3LR1 A;  2PFY A;  4LUB A;  1P1W A;  1USY E;  4DIG A;  3G3G A;  1R1N A;  3UGW A;  2DP8 A;  4Q0C A;  5AA2 D;  4EQ7 A;  3IO4 A;  1FBF A;  4ISU A;  4PBH A;  2ONR A;  5K2X A;  4PFR A;  2F97 A;  4F19 A;  1NV0 A;  4F29 A;  4KYD A;  5KCJ A;  4G4P A;  2QMX A;  2V3T A;  3I6V A;  5CC2 A;  2Q8M A;  4EDP A;  1FPG A;  1P1O A;  4XIG Q;  4PQJ A;  2QRY A;  1B7Z A;  1FQE A;  4JSD A;  1USY H;  5HM4 B;  4N91 A;  3U72 A;  2I0B A;  3N6U A;  4N17 A;  5I59 B;  3O66 A;  3D1R A;  1KA0 A;  3OO6 A;  1PDA A;  1LFG A;  3GBB A;  4QSC A;  1YYZ A;  3CSG A;  5EYG A;  2O1M A;  1MY0 A;  4OVR A;  3RPL B;  5H8H A;  2ZNS A;  4PCD A;  1PB7 A;  1R6Z A;  2H99 A;  3E78 A;  1K9Y A;  2G93 A;  4ZEB A;  2DWI A;  4H6D A;  2H25 A;  5KZT A;  3LSL A;  4OET A;  1Y4T A;  3ZKK A;  3RGY A;  2HFB A;  4DXU A;  2OZZ A;  4N15 A;  4FEC A;  1Q9D A;  2QJE A;  2Y84 A;  1FRP A;  4I62 A;  1FPB A;  2VD2 A;  2OWZ A;  2UYE A;  3TMG A;  3KC0 A;  1Y9U A;  3SEV A;  2X7P A;  3Q27 A;  2XXI A;  1JW5 A;  4NWC A;  1EYJ A;  4Q5T A;  4OVS A;  3H03 A;  3G3H A;  4QFP A;  1FTM A;  3KJT A;  4U22 A;  2O69 A;  5H8S A;  3ECR A;  4AB6 A;  4ZEF A;  1WVJ A;  3QSL A;  4IB2 A;  1XS5 A;  3F11 A;  1QUJ A;  3MYU A;  2R71 A;  2XWK A;  5TP9 B;  1EZ9 A;  4RNS A;  3RT8 A;  3M3F A;  4GWY A;  3I5O A;  4DLD A;  3KG2 A;  2Q9T A;  1LFH A;  4NF4 A;  4RPO A;  3MST A;  3KN3 A;  1S9T A;  2HZK A;  1VSO A;  1N76 A;  2ZNT A;  3EF7 A;  3MZ1 A;  1GVC A;  1LB8 A;  2WBB A;  2HQ0 A;  2CZL A;  3RQT A;  5FHN A;  1RYX A;  4NED A;  3PUZ E;  2ZXT A;  3K1M A;  3MUQ A;  4O3A A;  4MBP A;  1DPE A;  2KR0 A;  5HPQ A;  1M5E A;  1N0T A;  3IB2 A;  3CFX A;  1IEJ A;  3S2V A;  2V3Q A;  5AA2 B;  1LBB A;  1LAF E;  3T9V A;  3UIF A;  3T22 A;  4Z0I A;  2XA5 A;  2Z8F A;  2V84 A;  1UIV A;  1H3D A;  3MVW A;  2OWS A;  4G68 A;  1QGX A;  4E0X A;  2HPG A;  4R73 A;  5AA1 A;  3U8Q A;  4IY5 A;  2FIX A;  4GWZ A;  4NGU A;  4GBV A;  1UTB B;  5I57 B;  1GGG A;  1YPN A;  1RDZ A;  2PVU A;  5DEX A;  4NMY A;  2UVJ A;  3U92 A;  1LFI A;  2QVV A;  4KR5 A;  1NV1 A;  3FJ7 A;  3LBS A;  4F3S A;  1H43 A;  3OO7 A;  1B6H A;  4NF5 A;  4BLA A;  3ZSF A;  2XXP A;  4FIM A;  3BIG A;  1B3G A;  2OBG A;  5FTH A;  3SES A;  2E1S A;  5A5X B;  2V93 A;  1XVX A;  4OEU A;  2PMS A;  4MF3 A;  1QJM A;  2I6E A;  3BKI B;  4KHZ E;  1AOV A;  2I49 A;  3TQL A;  2OWT A;  1QUK A;  3Q29 A;  3E79 A;  3QMF A;  1A54 A;  3K00 A;  1FSA A;  5EHS A;  5I56 A;  3MVY A;  4JXI A;  1EH3 A;  3G3I A;  3IOR A;  4PFI A;  2HAV A;  3TTM A;  2Q8J A;  4NQ8 A;  4OQO A;  2VD3 A;  5F1Q A;  3EHU A;  3MJN A;  4KYS A;  4QFK A;  1B4H A;  1IXH A;  3MAM A;  1DTZ A;  3MVZ A;  1MY4 A;  3M3K A;  2I58 A;  2KQZ A;  1XOC A;  1P1N A;  2HXW A;  1NH8 A;  5DVJ A;  4KD5 A;  4QSD A;  2PT2 A;  4F31 B;  3EN3 A;  3ZKL A;  1YXI A;  3JZJ A;  1FW0 A;  3FXQ A;  1FQA A;  3IK6 B;  5IGA A;  5ESY A;  3EHS A;  5JTY A;  2YJP A;  4PGP A;  3FBP A;  4H46 A;  2XXQ A;  4X8R A;  1POY 1;  1FPJ A;  1IZ1 A;  4LON B;  4ZDM A;  1SVX B;  3ONM A;  4BDN A;  4O7I A;  1KWH A;  3R26 A;  1ZBM A;  1B52 A;  4OHN A;  4KXP A;  1SW2 A;  3LSX A;  2F36 A;  2QVR A;  3PPP A;  3UP9 A;  3LV0 A;  4LZ7 A;  1I6B A;  1JET A;  4N6D A;  3FZV A;  3N5L A;  2WEF A;  5HBC A;  4G8N A;  3MP1 A;  4P8B A;  1OVT A;  5LDZ A;  3KOT A;  2VP1 A;  3IAZ A;  1NKX A;  1N7X A;  2DE4 A;  1SW1 A;  1Z7M E;  1DPP A;  4KI0 E;  3CIJ A;  3WAF A;  2XX8 A;  3CG1 A;  3S9N C;  4QHQ A;  4NN3 A;  3Q28 A;  2UVG A;  3W15 C;  2CMO A;  2B4L A;  4M4G A;  3HST A;  5JTY B;  1DSN A;  4MJO A;  4NF8 B;  3K01 A;  1TFD A;  1D3K A;  2YPN A;  4H5F A;  1N84 A;  1ZLQ A;  3T9H B;  2UXA A;  3RPW A;  1MY1 A;  3V83 A;  1US5 A;  2RF1 A;  4MCO A;  2O7I A;  1F9B A;  3IOT A;  3FVO A;  4JBZ A;  1NV7 A;  2ALU A;  3FV1 A;  4ONY A;  1NUZ A;  4R75 A;  3DLN A;  1BP5 A;  4OER A;  2F7A A;  1YCJ A;  2FIE A;  2G29 A;  2BJJ X;  3O6H A;  2I48 A;  1O7T A;  1MQI A;  3IOV A;  4R2F A;  1S7Y A;  3O9P A;  3DP8 A;  4KQP A;  5AA4 A;  1B40 A;  3MZB A;  5ICT A;  4EXK A;  4H65 A;  4PBQ A;  4R6K A;  2WYP A;  1DMB A;  2O68 A;  5EYF A;  3R6U A;  3G3F A;  3OEK A;  5JEI A;  1PBP A;  2PX1 A;  1NV4 A;  5ET8 A;  4GOT A;  1NL5 A;  1IIW A;  3PUV E;  4NF0 A;  1PBQ A;  1ZIU A;  1MXW A;  4LA9 A;  1Y1Z A;  1MXU A;  4ZEI A;  4XKR A;  1SI0 A;  3O97 A;  1A8F A;  4IR8 A;  1NNP A;  4JSO A;  1N3W A;  4UA8 A;  4BDO A;  3FD3 A;  2P2A A;  2LAO A;  1FPL A;  4XEQ A;  1OLA A;  2NWJ A;  3S4U A;  4O3B A;  4MEV A;  4EF2 A;  4R9F A;  4ZZE A;  4P3L A;  1AWB A;  2DSF A;  2ZYN A;  3A29 A;  3V5A A;  3OSQ A;  3PUY E;  5EQ7 A;  3UK4 A;  3KGC A;  4FED A;  4E0W A;  4GWW A;  1A8E A;  3BFT A;  2QS1 A;  2PYY A;  2DS9 A;  5J1D A;  1BKA A;  2XXY A;  5ISU A;  1SYI A;  3OSR A;  3QIM A;  1MRP A;  5I58 B;  5DW8 A;  2Y7R A;  3VVE A;  1FPF A;  2RC9 A;  4X1D A;  4FBP A;  4JWX A;  4PTK A;  3ODB A;  1P99 A;  4MX6 A;  3HN0 A;  4L17 A;  4G68 C;  1OLC A;  3W9V A;  3KBR A;  4DXC A;  5CMB A;  4FJP A;  4PFT A;  4GQO A;  1TT1 A;  1LAX A;  3CG3 A;  1FTL A;  1UIU A;  4MH5 A;  1NV6 A;  2H9B A;  2DXR A;  3BFU A;  3IOU A;  1JP4 A;  5I59 A;  2ZZX A;  3H6W A;  3E13 X;  4FOR A;  1ZMG A;  4QFN A;  4YZZ A;  5DVF A;  4LZ5 A;  1US4 A;  1Y20 A;  1AL3 A;  1B51 A;  3GZG A;  3KN7 A;  1FQC A;  2HAU A;  2AL4 A;  3FAT A;  3K4U A;  3T96 B;  4OFO A;  4ZEC A;  4X48 A;  1ATG A;  3RPL A;  2VPO A;  4GWS A;  2Y5K A;  4O8M A;  1B05 A;  1P1U A;  1DTG A;  4NG7 A;  3O2A A;  3TTK A;  3KJ7 A;  4DCY A;  2QPQ A;  4MFI A;  1MXX A;  5L9S A;  4N13 A;  3USD A;  3IFA A;  5TU0 A;  4PFY A;  3TOD A;  3ISP A;  1B5J A;  3PD8 A;  2W7Y A;  4PF6 A;  3QAX A;  3K6W A;  4OZ9 A;  1MDP 1;  3FV2 A;  1CNQ A;  4QF9 A;  2DVZ A;  4RPN A;  1J1N A;  5CI5 A;  4F3P A;  2RCA A;  1NFT A;  2VGQ A;  2ZYM A;  3TYH A;  2XWI A;  3U94 A;  1SPI A;  4DI4 B;  2RC7 A;  4R2B A;  3VDF A;  1B1X A;  5EYH A;  2XXW A;  1MH3 A;  4IGT A;  2HXR A;  2RIN A;  3RUM A;  3U1O A;  2F3D A;  2QSX A;  2UVI A;  4GBW A;  1MXZ A;  1LBV A;  3CRB A;  2O51 A;  4FEB A;  2ZNU A;  4H45 A;  5TP9 A;  2NUV A;  4GIZ A;  2THI A;  3ROJ A;  1XT8 A;  2QVU A;  4PET A;  4PP0 A;  1XI6 A;  1GR2 A;  4HXV A;  4YB6 A;  1NV2 A;  2P0S A;  3PPO A;  2V25 A;  2O1L A;  5CMK A;  2DWA A;  1KZ8 A;  1M5B A;  2XXK A;  2ZZW A;  2F8D A;  4PDD A;  1A7L A;  1MXV A;  2XWV A;  2X26 A;  4GWX A;  4XKP A;  3LC8 A;  1MPB A;  1TXF A;  3EQ1 A;  3OEM A;  3Q25 A;  5IZZ A;  3K2D A;  5DVI A;  4OXV A;  3E4R A;  2R8T A;  2DQV A;  1B1H A;  3IFC A;  1Y3N A;  4KPT A;  5AA2 A;  4GX6 A;  3GLB A;  1OMP A;  4ELR A;  3QXM A;  1B0L A;  2O84 X;  3FXU A;  4Q30 B;  3OXN A;  5H8F B;  2H5Y A;  4IGR A;  4U23 A;  4GVO A;  3TPA A;  1UTB A;  1MPD A;  5I57 A;  4EXL A;  4JB7 A;  5T3J A;  2ESN A;  3C32 A;  3DEL B;  1POT A;  4GRK A;  4R72 A;  1ANF A;  1LLS A;  4OFJ A;  4PAF A;  4ZED A;  5A5X A;  3HV1 A;  2I4B A;  2Q2C A;  4JVI A;  1DK4 A;  3DP6 A;  3FVK A;  2XHD A;  2ZZV A;  2HZL A;  4IY6 A;  3CHG A;  3NOH A;  1Y1M A;  4P0G A;  4ECF A;  1IMF A;  1NNF A;  4U4X A;  1IME A;  4FAT A;  3FAS A;  1XVY A;  2RCB A;  3VLU A;  1SW4 A;  5FHO A;  4EQB A;  3L6H A;  3T1B A;  4TLM B;  2V4C A;  1A55 A;  5KDT B;  4NWD A;  4U1Z A;  2PCR A;  4ZE8 A;  2QMW A;  3O28 A;  1WOD A;  1MG1 A;  4QRZ A;  1JW1 A;  1MY2 A;  4LZ8 A;  2Y7W A;  4OTE A;  4N4U A;  1B46 A;  4IO5 A;  1D4N A;  4BDR A;  1B2H A;  1FPD A;  2F5X A;  1RDY A;  5M2V A;  3SEU A;  1IMC A;  1LCF A;  4GF8 A;  1MQH A;  1UQW A;  1ZKB A;  2DE3 A;  4DDD A;  2O7U A;  2DVC A;  2I4C A;  2ONS A;  5I5P A;  2FA7 A;  1JEV A;  3QK6 A;  1GTK A;  3PUX E;  2XD2 A;  4N6K A;  2Q88 A;  3V89 B;  3RN8 A;  5I2K B;  1B3H A;  4R74 A;  1WDN A;  1FPI A;  5FTI A;  4RJZ A;  1Z7N E;  4XF5 A;  4N6P A;  2F34 A;  3U93 A;  2QL3 A;  2BJI A;  3C9H A;  1SQY A;  3KN8 A;  4F1U A;  5ET6 A;  4AQ4 A;  1PB8 A;  5FHM A;  1EYI A;  1Y3Q A;  2I3V A;  3WAE A;  3RLF E;  4PGN A;  2ZYO A;  1FBH A;  3GYY A;  2WBD A;  4X1B A;  3RNN A;  2UVH A;  4ELO A;  1ZJL A;  2DDK A;  3CFL A;  4I3E A;  3KEI A;  3K6V A;  4NF8 A;  3FJG A;  4GL0 A;  5EQA A;  3TDJ A;  3TQW A;  1BIY A;  4MNC A;  2F6G A;  5BUU A;  2ZYK A;  4GLI A;  3S9L C;  4U4S A;  4OES A;  1IQ7 A;  1D9Q A;  3C34 A;  1EYK A;  1CB6 A;  2DYX A;  3C35 A;  3PTY A;  2V3U A;  4YIC A;  2O6A A;  5IKB A;  3PMV A;  3U65 A;  4M1V A;  2XXH A;  3PV0 E;  2VPN A;  3KSX A;  1MQG A;  3A3U A;  2Y7P A;  5I2N B;  3GXA A;  4NF6 B;  3TCF A;  5CRY A;  4AB5 A;  3T93 B;  3JV9 A;  3E9X A;  4MHF A;  5CMC A;  4EQ9 A;  4R6Y A;  1BLF A;  1URD A;  1SYH A;  4XXU A;  4HTG A;  3OO9 A;  3MW0 A;  4JWO A;  4DE8 A;  1PEB A;  3FIR A;  1UTH B;  4POX A;  4I8C A;  3UA8 A;  1RYO A;  4JVC A;  2REJ A;  3TTL A;  1LBY A;  4WED A;  2IA4 A;  3VLW A;  4IO6 A;  1MPC A;  2M8C A;  1OQH A;  4OYV A;  2DXY A;  2Z8D A;  2DOJ A;  5I58 A;  5IAI A;  5AE4 A;  2CZH A;  4F2Q A;  2D21 A;  5DYH A;  3BIH A;  1FBC A;  4YAH X;  1I69 A;  2GHB A;  2GQ1 A;  3VXC A;  2FYI A;  5DT6 A;  2XXV A;  3FGS A;  1B5I A;  1FTK A;  1SD3 A;  4KCC A;  2A5S A;  3MZ9 A;  1VE4 A;  2P1S A;  3FUZ A;  4I9D A;  2CZK A;  3MBP A;  4DXB A;  1G0H A;  1SW5 A;  5H8Q B;  2B4M A;  2B65 A;  3TTN A;  4G2Z A;  2ONK E;  4F3B A;  5JK4 A;  3A3C A;  1N04 A;  5LOM A;  1B7H A;  4PC9 A;  3SEY A;  4F39 A;  3CSB A;  1FCK A;  4PAI A;  1B3L A;  2I0C A;  4WEP A;  1OVB A;  2OX3 A;  3VXB A;  2H98 A;  1JEU A;  4P1L A;  4O94 A;  1LAH E;  1M5C A;  4Q8R A;  5CBR A;  3TTR A;  1NV5 A;  3KC1 A;  3PD9 A;  4F18 A;  1JQF A;  5H8N B;  1NNK A;  1EU8 A;  3QUJ A;  4FE8 A;  1M5D A;  5EQ8 A;  4BDM A;  1M5F A;  4ELP A;  2QS3 A;  4HCY A;  4IO4 A;  1AH5 A;  3SDF A;  5FBP A;  2AIX A;  3V8X B;  1GV8 A;  1ZTY A;  3HPI A;  5TPA B;  3H3G A;  4TOZ A;  2XX9 A;  2WX9 A;  4YB7 A;  1NNT A;  3VLV A;  1QW0 A;  2P3V A;  3EPE A;  4EUO A;  4PE5 B;  3K1P A;  4ESW A;  4QBA A;  4ZZA A;  3HO7 A;  1FTO A;  3IJO B;  3RTW B;  1D9Y A;  1VR5 A;  1DCU A;  4LN5 A;  3ILT B;  4JDF A;  3PU5 A;  1R9L A;  2FHY A;  1G0I A;  5CMM A;  3H06 B;  2R6G E;  3T9X B; 
#chains in the Genus database with same CATH homology
 5ET7 A;  4P1E A;  1FSA A;  4OVQ A;  1KA1 A;  4PFI A;  5IZ3 B;  1LBZ A;  4NQ8 A;  4PDH A;  3B50 A;  4HE0 A;  4DI3 D;  2F3B A;  5T3J A;  4MNP A;  1INP A;  4PE3 A;  3KBZ A;  1FBP A;  4N81 A;  2KQZ A;  4P56 A;  1IMD A;  4PFB A;  4PF8 A;  1DBZ A;  4PAF A;  4NX1 A;  1YXI A;  1NUW A;  1RDX A;  1NV3 A;  4JVI A;  1IMB A;  1DK4 A;  5IGA A;  5ESY A;  4PGP A;  3FBP A;  5F24 A;  2ZZV A;  5CM6 A;  2HZL A;  4H46 A;  2HHM A;  4X8R A;  3CHG A;  1NUX A;  3NOH A;  1FPJ A;  1FBG A;  3LUZ A;  1IMF A;  4O7I A;  5IZ1 A;  4KXP A;  1IME A;  2QVR A;  1VDW A;  3LV0 A;  4OVP A;  1LEV A;  4N6D A;  5IZ3 A;  1NUY A;  3T1B A;  2V4C A;  2QFL A;  2WEF A;  1YZ0 A;  2PCR A;  4P8B A;  2FBP A;  5LTC A;  2JJK A;  5LDZ A;  4NHB A;  1K9Z A;  2DE4 A;  1FPE A;  4N4U A;  4OVT A;  2XWO A;  4UAB A;  1LBX A;  4F1V A;  1FPD A;  2F5X A;  4N8Y A;  4NN3 A;  5A5L A;  3EKI A;  2L5V A;  1RDY A;  2B4L A;  3SZP A;  1IMC A;  4MJO A;  4NAP A;  2MKZ A;  4HE1 A;  2DE3 A;  3RYD A;  4AS4 A;  5I5P A;  4GX4 A;  2CEY A;  4MCO A;  2Q74 A;  2DE2 A;  4N6K A;  1FJ6 A;  4MMP A;  1NV7 A;  1NUZ A;  2PFY A;  5EQ9 A;  2FIE A;  3HFU A;  4GX3 A;  1FPI A;  3B8B A;  4XF5 A;  2BJI A;  1FBF A;  4F1U A;  5ET6 A;  4PBH A;  4PBQ A;  2WYP A;  4PFR A;  1EYI A;  4GWU A;  4F19 A;  1NV0 A;  4PGN A;  1FBH A;  3GYY A;  4PAK A;  2WBD A;  1NV4 A;  5ET8 A;  4NF0 A;  2Q8M A;  1FJ9 A;  1FPG A;  2DDK A;  4I3E A;  4IR8 A;  5EQA A;  4N91 A;  1FPL A;  4MNC A;  4XEQ A;  4N17 A;  4MEV A;  4P3L A;  3D1R A;  1AWB A;  1FBD A;  1KA0 A;  1D9Q A;  1YYZ A;  1EYK A;  3A29 A;  4MAG A;  2VT5 A;  3PTY A;  5EQ7 A;  5EYG A;  4YIC A;  4GWW A;  4OVR A;  3U65 A;  4G61 A;  4M1V A;  2VPN A;  3RPL B;  5J1D A;  3QMF A;  4PCD A;  1BK4 A;  5DW8 A;  4O7M A;  3E78 A;  1K9Y A;  1FPF A;  4MHF A;  4FBP A;  4PTK A;  4MX6 A;  3W9V A;  4I40 A;  3T0J A;  4N15 A;  1Q9D A;  1FRP A;  1FPB A;  1LBW A;  2OWZ A;  1NV6 A;  3KC0 A;  2CZI A;  4JVC A;  1JP4 A;  4P9K A;  1EYJ A;  1LBY A;  4OVS A;  2ZZX A;  4YZZ A;  5ET5 A;  3RPL A;  2VPO A;  4GWS A;  2Y5K A;  4O8M A;  4NG7 A;  5IM2 A;  4P47 A;  3MYU A;  2XWK A;  2CZH A;  3BIH A;  1FBC A;  2QPQ A;  2GQ1 A;  4GWY A;  2FVZ A;  4OAN A;  2Q9T A;  3IFA A;  3ISP A;  4MIJ A;  4X9T A;  4PF6 A;  3MST A;  4AS5 A;  2HZK A;  5J16 A;  1CNQ A;  2WYK A;  2DVZ A;  2WBB A;  2CZK A;  4JVD A;  4MNI A;  1G0H A;  2B4M A;  5I3S A;  5JK4 A;  2XWI A;  1FPK A;  1SPI A;  4DI4 B;  4PC9 A;  4XFE A;  2KR0 A;  4HE2 A;  4N8G A;  5EYH A;  4PAI A;  2V3Q A;  2HXR A;  4X04 A;  1IMA A;  2F3D A;  2OX3 A;  2XA5 A;  4GBW A;  4P1L A;  4O94 A;  1LBV A;  1QGX A;  1NI9 A;  4I3Y A;  2HPG A;  2FIX A;  4GWZ A;  5I7I A;  4NGU A;  1NV5 A;  3KC1 A;  4F18 A;  4GBV A;  3W9W A;  4H45 A;  4HCW A;  1RDZ A;  4QXD A;  2P3N A;  3ROJ A;  2QVU A;  5EQ8 A;  4PET A;  1XI6 A;  4HXV A;  1NV2 A;  2QVV A;  1NV1 A;  2PFZ A;  4HCY A;  1KZ8 A;  5FBP A;  2XXK A;  1FBE A;  2ZZW A;  3BIG A;  4PDD A;  4OA4 A;  2XWV A;  2WX9 A;  2P3V A;  4GWX A;  1FTA A;  4QBA A;  2CEX A;  5IZZ A;  2R8T A;  1DCU A;  4LN5 A;  3IFC A;  2FHY A;  3FXB A;  1G0I A;  3E79 A;  2Y5L A;  4GX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...