2XXTA

Crystal structure of the gluk2 (glur6) wild-type lbd dimer in complex with kainate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
248
structure length
248
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Conformational Flexibility of the Ligand-Binding Domain Dimer in Kainate Receptor Gating and Desensitization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 81
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxtA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxtA02
4F29A 3O29A 2OJTA 2G93A 4LZ7A 3SERA 1USYH 3SESA 2M8CA 1TFAA 4ZEKA 5ITOA 1SD3A 1ZBMA 3QAXA 2QMWA 2ABHA 2G29A 3LSLA 1B5HA 3M3FA 3BFTA 5CMMA 2OK2A 3PMWA 1B51A 3M3LA 2VP1A 2V3TA 3T9VA 4JSDA 4G4PA 2REJA 1Y20A 2DSFA 1LAXA 2ZYKA 1B05A 5ISUA 4R2BA 4OWDA 4EF1A 4IY6A 5AA2B 3V8XB 1LCTA 3QUJA 3RT6B 2ZMBA 5F7VA 4FEBA 3F11A 1VFDA 1DTZA 1XVXA 4ZEBA 3EF7A 4JWXA 1LB9A 2B65A 5TP9B 1Y4CA 3ODBA 4OFJA 3QSLA 4OFOA 3EHSA 3FJMA 1UTBA 1UQWA 3PMXA 1OMPA 2D21A 4DIGA 2ZYOA 5DVJA 1FTOA 2V84A 1Z7NE 2DWAA 1MDP1 4LA9A 3H6VA 1FTKA 1JW4A 4G68A 1LAGE 2Z8FA 4R6YA 1B1HA 4ZS9A 3TTLA 3BKIB 3KEIA 4U21A 4ESWA 3CFLA 1R6ZA 4DCYA 3ZS6A 4F19A 4ZDMA 1MRPA 3VDFA 1D9VA 3QIMA 4GWOA 4TQUQ 4ZEDA 4JWYA 3IO4A 3MZBA 1VR5A 2IA4A 1USYE 5F1QA 4I62A 2Y7IA 2F5XA 3EQ1A 1T0KA 3TYHA 1PB8A 2YLNA 3IOUA 1FQFA 1JQFA 1N84A 1ELJA 3RGYA 5DYHA 1AIVA 5I2KA 4KCDA 4NEDA 3RLFE 4QHQA 2O7UA 5I56A 2ALUA 2UYEA 2OBGA 1P1QA 3S2VA 2YJPA 1MPBA 3CSGA 4E0XA 2DQVA 3KJ7A 3L6HA 3MJNA 3B7DA 5KCJB 4IO5A 2I3WA 2QS2A 1FQAA 1FCKA 3CFZA 2ZNUA 1N3WA 5H8SA 3TPAA 1B5IA 3VVDA 4NF4A 2RC7A 3KN7A 4OZ9A 4UA8A 3QYTA 3VFJA 5H8FA 4XKNA 3V83A 3E4RA 4NTLA 4KPTA 2UVGA 2F8DA 3ECRA 1Z7ME 3MVZA 4DXUA 4DCXA 2QL3A 1LFIA 2Y7RA 4OYVA 3C34A 2RINA 1FQEA 1LBBA 4THIA 4PFUA 2DVZA 2XXVA 1M5FA 3PU5A 3EN3A 4NF5A 4RPNA 1Y3QA 4ZE9A 2B3FA 3KJTA 1IUDA 4YKPA 4RA1A 4E0WA 2DXRA 3IOWA 3IOVA 2VHAA 5H8HA 3C32A 4XTCQ 4MLVA 4PETA 3TQWA 3OSQA 1XOCA 4F3BA 3K2DA 2H9BA 1N04A 2HZLA 4PFYA 2DS9A 3S4UA 5CM6A 4H5FA 1QW0A 3IJOB 1N3XA 1B40A 5K2XA 1A8EA 3VV5A 2I0CA 4DE8A 5A5XB 1NH7A 3T9UA 3K6VA 1OLCA 2HCAA 4G8HA 4GVOA 2UVIA 4LATA 4H8JA 1POTA 1B32A 3G7WA 3K00A 2F6PA 1A99A 3BBRA 1NNFA 4WEDA 1JEUA 3DELB 4HW8A 3K1MA 4NE4A 4F2OA 4RXLA 4U1OA 2ESNA 2Y7WA 3W9VA 3DP4A 2GH9A 1IXIA 5TU0A 2O69A 2E1SA 4F22A 3MAMA 1MDQA 3K6WA 5ICTA 3U1OA 3IX1A 3O66A 4H0WA 4O3CA 3RUMA 3V89B 1SYHA 4RPOA 4IY5A 4NF6B 1HSEA 1Q35A 1MQGA 1ZTYA 1YPNA 2AL4A 2D3IA 3K6XA 2OCUA 3O28A 2Z8DA 4YKIA 5I84A 3KBRA 5I57B 2V3UA 4NWCA 5ELVA 1BKAA 2XXYA 3KZGA 4F39A 4BDQA 5JTYB 1QKBA 1AMFA 2ONSA 1UTHA 3PV0E 1IZ1A 3K1NA 2QRYA 3IOTA 4RJZA 2X7QA 3HHGA 1H76A 4WEPA 4EXLA 1MXZA 3KN8A 3UK4A 3N5LA 3HV1A 1PB9A 1MPDA 1LAFE 4O3BA 1B4HA 2O1MA 3SDFA 4GQOA 4X1BA 5EHMA 2PMSA 4MBPA 2DE4A 4QF9A 4LONB 2O51A 4JWOA 4G77A 1EZPA 4ONYA 4G8NA 1MY0A 3C31A 4U4SA 4GLIA 4OHNA 1H3DA 1OQHA 2X7PA 2REGA 1HSJA 4OVJA 4M4GA 5AE4A 4C0RA 3MP6A 1US5A 2KLFA 3TZAA 1Y3PA 1H43A 2V93A 3MZ9A 2H5YA 2XX7A 4FECA 3LSWA 5I58B 4QFKA 1Y1MA 3H6UA 1LFGA 3U93A 3T9HB 2A5TB 3LC8A 5L8DA 1B4ZA 4BDMA 5HPQA 2Q88A 3KSXA 4G2ZA 1MG1A 2I4CA 3U92A 1WVJA 2F6GA 3H03A 1JNFA 3E9XA 4YB6A 3GXAA 2RCBA 4F1YA 2I58A 1F9BA 4G68C 4ZEFA 1Y9UA 2ZNSA 2F7CA 3T66A 4OXVA 3MVYA 2H98A 4KCCA 4GL0A 2DVCA 3FJGA 2Q8JA 5TPAA 3GBBA 1B46A 4R9FA 2X26A 1B7ZA 5ICQA 1B7UA 4RYAA 3VE1B 3A09A 4OESA 5L9SA 1GR2A 4F31B 3MP8A 1A8FA 4L17A 5LOMA 1LGBC 4F3PA 1XC1A 3PPQA 1I6QA 3FXUA 2RCAA 1II5A 1XT8A 1XHYA 3ILTB 4N6PA 1MXUA 3MVWA 3HCQA 4FJPA 1URGA 2XXXA 4KYDA 1DPEA 2H4IA 4QSCA 4Q5TA 3TCGA 2QS3A 4HCWA 2DXYA 3CG1A 3RNNA 4QFNA 3W15C 3FV1A 1HSLA 5DVFA 3D4GA 3IORA 4ZZAA 4KD5A 4FEDA 1KWHA 1Q1KA 4LP2B 1JEVA 4RY1A 3E3KA 3BFUA 4U22A 1L5TA 2PBWA 2I3VA 3O2AA 3LSXA 4I8CA 3UA8A 3FGSA 1MM7A 1IITA 1URSA 3QUFA 3TMGA 1I69A 3JV9A 3ZKKA 4RK2A 2XXIA 4KYEA 1P1NA 2OZZA 4AB5A 1VFEA 3HHFA 2R71A 1D9YA 1OVTA 3CSBA 4FAJA 4C1UA 4OENA 2AYSA 2PX1A 2HAUA 2I49A 2XXRA 1YCJA 4GD5A 3I3VA 2VD3A 3VLWA 3B6WA 4LQ2A 4NF5B 3GZGA 3C4MA 3FVNA 4OETA 3RPWA 1AH5A 2XXHA 4LVQA 3FASA 3N6UA 3KGCA 3U94A 1PC3A 4IO6A 5H8QA 4KQPA 1FTLA 2CZLA 4NF8B 2XXTA 4OQOA 4BDRA 3FIRA 4YAHX 1Y4TA 1B0LA 2R9JA 4F1VA 1B0HA 3AXFA 4HTGA 5FTHA 2XXQA 2Y7PA 1I6AA 2QJEA 3S9LC 4EUOA 1YAEA 5TP9A 4YKKA 2ZNTA 4F1UA 3UGWA 1PB7A 4ELQA 2AL5A 3IJXB 4JBZA 3S9MC 1B3EA 3SEVA 1MXXA 2E0SA 4H67A 1GVCA 2P0SA 4QFPA 5I2NB 2H25A 5DEXB 3QK6A 5BUUA 3SKPA 5AA4B 3MPKA 3SETA 4BDOA 1CE2A 2RF1A 1URDA 2Q2CA 2O84X 1LB8A 5CBRA 2RC8A 2UYFA 5H8NB 1OVBA 1LFHA 3H7MA 4POWA 1JW1A 1MY2A 2DOJA 3PUXE 3TFLA 3PUWE 2VD2A 3ZKLA 2NUVA 3PPRA 3PUVE 4GXAA 5K2YA 4IO7A 3KG2A 1LBCA 1MPCA 4N07A 1WDNA 2PT2A 4P11A 4U1ZA 1SYIA 4UACA 1MH4A 5KDTB 3U72A 3H4ZA 3VLVA 3PPNA 3T9XB 4XKPA 3M3KA 1S9TA 4EQ7A 1QUKA 4DXBA 3FVOA 4BLAA 4IO3A 2HAVA 1MY4A 5KCJA 4FORA 3OXNA 3RN8A 3K02A 3A3CA 3IR1A 1UTHB 3VXCA 3WAEA 3M8UA 1O63A 3UORA 4JDFA 2XX9A 4OFLA 1NKXA 2QMXA 1NNKA 4KR5A 1P99A 2GHBA 2HQ0A 2GRVA 1B3FA 2HFBA 5B70A 4R74A 4X9TA 1SQYA 2O7IA 1JVXA 4U23A 5FTIA 3LSFB 1GV8A 2H99A 3OOAA 2Q9TA 3C35A 1N7WA 4OTEA 2NXOA 5JK4A 5FHNA 1AL3A 1XS5A 2UVHA 3N6TA 1UIVA 2R6GE 3CI8A 1LSTA 3MWBA 3EHTA 1SVXB 3HO7A 3EHUA 4U2RA 3UIFA 4R75A 1TT1A 2LAOA 1B7HA 1D4NA 3PPOA 4IO2A 1SDXA 3RY3A 5I59B 4JXIA 4O3AA 4Z7EA 1ZLQA 3QXMA 4QSDA 5DTBA 4TLLB 4GF8A 2QSXA 2ZXTA 1M5CA 1MS7A 1PBQA 4GIZA 1ZIUA 1ZMGA 2HEUA 3OD7A 4LQ5A 4PFTA 5CC2A 3TTMA 4YU0A 3TEPA 1I6BA 4ELRA 2O1LA 4OEVA 4F3SA 1FW0A 3G3HA 4RNSA 1MY3A 3SEWA 2DWJA 5HM4B 5A5XA 4LZ8A 4PFWA 4XKRA 2B3BA 4R2FA 2XHDA 3OO8A 2DYXA 2F78A 3ZSFA 2Z23A 1BLFA 3SEUA 1O7TA 4ISUA 2F35A 4F2QA 1TXFA 3KOSA 4Z0IA 3I6VA 1SW2A 5CMCA 4LZ5A 4Q30B 3UN6A 3B6TA 4ELPA 3Q27A 1MXWA 1PDAA 3G3GA 1RYXA 1IXCA 2I4BA 5HBCA 1DOTA 4AB6A 3C9HA 3H06B 5L9OA 3CVGA 3USDA 3ILUB 3PD9A 3FD3A 1UIUA 3RT8A 4GFRA 1R1NA 3G3KA 3H6TA 3THIA 4LUBA 4EQBA 1QUJA 4NF6A 3OEKA 2RKMA 4POXA 1UTBB 4MH5A 2DWIA 1JVYA 3O9PA 4EQ9A 1B9JA 3KFMA 2Q2AA 3G3FA 3O6IA 2NVUB 1VE4A 4PP0A 2PVUA 4YZZA 4H6DA 4ZE8A 1BTJA 3JZJA 4BDNA 5JTYA 4G68B 5FHOA 3OO7A 3DM0A 3PUYE 1A40A 3EPEA 4EF2A 1BIYA 4EXKA 4EDPA 2XD2A 1JETA 2Z22A 1QKAA 1XVYA 4K3FA 1VSOA 2NWJA 3IL1B 1H44A 3FVGA 4YKJA 4JB7A 5EYFA 4R6KA 3PPPA 1NL5A 3FXQA 4MFIA 5CRYA 1PBPA 1A7LA 4JSOA 1A55A 1MM6A 5I2KB 3TTNA 4XIGQ 1FTMA 4H1XA 1N76A 1US4A 1ATGA 3LR1A 4P0IA 2F7AA 3B6QA 1M5EA 3RTWB 3TCFA 5I56B 3IB0A 5H8QB 1EH3A 2Z8EA 4GL8A 1FQDA 5I58A 3PD8A 3R6UA 2A5TA 3RTFB 2DE3A 3KSJA 1NNTA 4X1DA 1B1XA 3MP1A 3OO9A 4NF4B 1S7YA 2Y7KA 3TDJA 3TCHA 1B3LA 4YB7A 3MBPA 4R73A 5H8FB 4XKQA 1LLSA 1OLAA 1TWYA 3P7IA 2OLBA 3T96B 2V25A 5B7DA 1WODA 3WAFA 3VLUA 2XXUA 3V5AA 4OERA 4KYSA 3S9NC 3H3GA 5KZTA 1DPPA 1MXYA 3KN3A 4MLQA 4BDLA 1OIBA 3CG3A 4ELOA 2PT1A 2WKYA 4P0GA 1MQIA 5EHSA 1ANFA 4NWDA 3PUZE 1BP5A 5CI5A 1OQGA 3FJ7A 3C33A 2GFEA 3T93B 3IAZA 4KI0E 5H8HB 1IQ7A 3HPIA 2P1SA 1N7XA 2DE2A 3O6HA 3ONMA 2DP8A 2QPQA 2NOOA 3K6UA 5CBSA 4IB2A 3VXBA 5AA2A 4PQJA 4DXCA 3U8QA 4X48A 3VVEA 2I0BA 3K0VA 1YTVA 3GBAA 1IIWA 3TKDA 4U4XA 1GGGA 3CRBA 1B3HA 3KOTA 3SEXA 4H8IA 1MY1A 1QULA 1QVSA 1EU8A 1RYOA 1DSNA 2CMOA 2FYIA 3TTRA 3RQTA 5FHMA 1SI0A 3FUZA 3L6GA 2YPNA 3MC2A 3Q29A 3N94A 4GRKA 2ONRA 3IB1A 5J1DA 4HCYA 5DVIA 4KFQA 2BJJX 1FQCA 3DP6A 5DT6A 1SI1A 3TODA 1B5JA 3G3IA 4ESXA 2PYYA 1SW5A 3K01A 4YB5A 3TELA 2Q89A 2A5SA 3T22A 2THIA 5IAIA 1LCFA 3MZ1A 2XD3A 4TOZA 3CR9A 2UXAA 3HSTA 3SEYA 2HZKA 3CIJA 4PE5B 2I6EA 4R72A 5ITPA 3O6GA 3HN0A 1R9LA 4IGTA 4ZEIA 1QUIA 3OEMA 4Q8RA 4YMAA 1IXGA 1IXHA 5AA1A 1P1WA 1ZU0A 3Q25A 5L9MA 3MUQA 4R9GA 3PGFA 3FXRA 3R7XA 4DDDA 5AA2D 2ZYNA 2XXWA 2GHAA 4ND9A 3TTKA 1H45A 3MW0A 3LUYA 2FA7A 2W7YA 4Q0CA 3G3JA 3O97A 4NF8A 2DWHA 1NMUA 1DTGA 2V3QA 3DP8A 4ZZEA 2QS1A 2D5WA 3OMBA 4I1DA 4FE8A 2FNCA 4DLDA 4MF3A 3GLBA 4OMBA 2QS4A 3UP9A 3R26A 4I9DA 1SBPA 1QJMA 3MQ9A 2O6AA 3D4CA 1GTKA 1MQDA 3Q28A 1R9QA 3OENA 3K4UA 1ZJLA 2VOZA 2ZYMA 1NNPA 1D3KA 1JW5A 4R6HA 1NH8A 1P1OA 1CB6A 1PEBA 4NMYA 3MPLA 3MVXA 2VGQA 1M5DA 2I48A 2HXWA 4YMBA 1B58A 5IKBA 2IEEA 3A3UA 3W9WA 1TFDA 1Y3NA 1IEJA 2XX8A 3TQLA 5I2NA 4WKMA 5DEXA 5AA4A 4ECFA 2ONKE 2RC9A 4HS7A 1J1NA 4QSEA 4QRZA 5AA3A 3FATA 1B2HA 1EZ9A 4IGRA 5H8NA 1M5BA 3JYRA 3I5OA 1SW4A 1RKMA 4AQ4A 2F7BA 3TAJA 5M2VA 3Q26A 2F97A 4F3GA 4QFOA 4OEUA 3DLNA 4GOTA 4F18A 5CMBA 3C36A 1B52A 2P2AA 3FZVA 1P1UA 3IB2A 1AOVA 4C1TA 1MQHA 1MH3A 3IO6A 4KHZE 5KDTA 3IK6B 1POY1 5JEIA 1Y1ZA 3N26A 4RK9A 4IO4A 3S9EA 1MXVA 2AIXA 4H5GA 2ANJA 1N0TA 1FQBA 4H65A 5TPAB 1MQJA 4FATA 4GXSB 1NFTA 4QFLA 3FV2A 4N13A 1FTJA 1A54A 2XXPA 3OO6A 3OELA 5CMKA 4DZ1A 1O64A 3LBSA 4WXJA 1SW1A 3H6WA 3E13X 1B3GA 4ZECA 3FVKA 1EZOA 4XXUA 1ZKBA 4FIMA 2OWSA 4G8MA 2Y84A 2OWTA 2F36A 4M1VA 4TLMB 1DMBA 1S50A 2F34A 1LAHE 2UVJA 3CFXA 1B6HA 4YICA 2O68A 3OSRA 3K1PA 5BWJA 5I59A 3PMVA 3VVFA 5I57A 3TUSA
chains in the Genus database with same CATH superfamily
4F29A 3O29A 2OJTA 2G93A 4LZ7A 3SERA 4AS5A 1USYH 3SESA 2M8CA 1TFAA 1K9ZA 1KA1A 4ZEKA 3RYDA 1FBEA 5ITOA 4OVRA 1SD3A 1ZBMA 3QAXA 2QMWA 2ABHA 1RDXA 2G29A 3LSLA 1B5HA 3M3FA 4MNCA 3BFTA 5CMMA 2OK2A 3PMWA 1B51A 3M3LA 5ESYA 1NV2A 3D1RA 2VP1A 2V3TA 3T9VA 4JSDA 4G4PA 2REJA 1Y20A 2DSFA 1LAXA 2HXRA 2ZYKA 1B05A 4N17A 5ISUA 4R2BA 4OWDA 4P1LA 4P9KA 4EF1A 4IY6A 5AA2B 3V8XB 1LCTA 1NV4A 3QUJA 2PFZA 3RT6B 2ZMBA 5F7VA 4FEBA 3F11A 1VFDA 1DTZA 1FBDA 3RPLB 4X04A 1XVXA 4ZEBA 4PAIA 3EF7A 4JWXA 3LV0A 1LB9A 2B65A 5TP9B 1Y4CA 1FPKA 3ODBA 4OFJA 3QSLA 4OFOA 3EHSA 3FJMA 1UTBA 1UQWA 3PMXA 1OMPA 2D21A 4DIGA 2ZYOA 5DVJA 1FTOA 2V84A 1Z7NE 2DWAA 1MDP1 5A5LA 2P3VA 4LA9A 3H6VA 1FTKA 1JW4A 4HE1A 4G68A 1LAGE 2Z8FA 2DDKA 4R6YA 1B1HA 4ZS9A 3TTLA 4PBQA 3BKIB 3KEIA 4U21A 4ESWA 5LDZA 3CFLA 2XWIA 2CZHA 1R6ZA 1IMEA 4DCYA 3ZS6A 5I7IA 4F19A 4ZDMA 1MRPA 3MYUA 3VDFA 1D9VA 3QIMA 4GWOA 4TQUQ 4ZEDA 4JWYA 3IO4A 3MZBA 1VR5A 2IA4A 1USYE 5F1QA 4I62A 1FJ9A 2Y7IA 2F5XA 3EQ1A 1T0KA 3TYHA 4PGPA 1PB8A 2YLNA 3IOUA 4P56A 1FQFA 1JQFA 1N84A 1ELJA 3RGYA 5DYHA 1AIVA 5I2KA 4KCDA 4NEDA 1FBGA 3RLFE 4QHQA 4JVCA 4GWSA 2O7UA 5I56A 2ALUA 2UYEA 2OBGA 1P1QA 3S2VA 2YJPA 4QBAA 1MPBA 3CSGA 4E0XA 2DQVA 2WEFA 3KJ7A 3L6HA 3MJNA 3B7DA 4N81A 5KCJB 4IO5A 2I3WA 2QS2A 1FQAA 1FCKA 3KBZA 3CFZA 2ZNUA 1N3WA 5H8SA 3TPAA 1B5IA 3VVDA 4NF4A 2RC7A 3KN7A 4OZ9A 4UA8A 3QYTA 3VFJA 5H8FA 4XKNA 3V83A 3E4RA 1FBCA 4NTLA 3BIHA 4KPTA 2UVGA 1AWBA 2VPOA 2F8DA 1DCUA 4PFRA 3ECRA 1Z7ME 3MVZA 4DXUA 4DCXA 2QL3A 1LFIA 2Y7RA 2Y5KA 4OYVA 3C34A 2RINA 1FQEA 1LBBA 1YXIA 4MAGA 4THIA 2CEXA 4PFUA 2DVZA 2XXVA 1M5FA 3PU5A 3EN3A 4NF5A 3ROJA 4RPNA 1Y3QA 4ZE9A 2B3FA 4PCDA 3KJTA 1IUDA 4YKPA 4RA1A 4E0WA 2DXRA 3IOWA 3IOVA 5EQ9A 2VHAA 5H8HA 3U65A 3C32A 4XTCQ 3IFCA 4MLVA 4PETA 3TQWA 3OSQA 1XOCA 4F3BA 3K2DA 2H9BA 1N04A 2HZLA 4PFYA 2DS9A 3S4UA 5CM6A 4H5FA 1QW0A 2OX3A 3IJOB 1N3XA 5IM2A 1B40A 5K2XA 1A8EA 3VV5A 2I0CA 4DE8A 5A5XB 3CHGA 1NH7A 3T9UA 3K6VA 1OLCA 2HCAA 4G8HA 4GVOA 2UVIA 4LATA 4H8JA 1FPIA 4N91A 1FBHA 2WBBA 1POTA 1B32A 3G7WA 3K00A 2F6PA 1A99A 1YZ0A 3BBRA 1NNFA 4WEDA 1JEUA 3DELB 4HW8A 3K1MA 4NE4A 4F2OA 1LBZA 4RXLA 4U1OA 2ESNA 2Y7WA 3W9VA 3DP4A 2GH9A 1IXIA 5TU0A 2O69A 2E1SA 4F22A 3MAMA 3QMFA 1MDQA 3K6WA 5ICTA 3U1OA 3IX1A 3O66A 4H0WA 1NUZA 4O3CA 3RUMA 3A29A 3V89B 1SYHA 4NN3A 3ISPA 2XWVA 4RPOA 4IY5A 4NF6B 3HFUA 1HSEA 1Q35A 1MQGA 1NV5A 1ZTYA 1YPNA 2AL4A 2D3IA 3K6XA 2OCUA 3O28A 2Z8DA 4YKIA 5FBPA 5I84A 3KBRA 5I57B 2V3UA 4NWCA 2QFLA 1RDZA 5ELVA 1BKAA 2XXYA 3KZGA 2WX9A 4F39A 4BDQA 2VPNA 5JTYB 1QKBA 5ET5A 2QVUA 1AMFA 2ONSA 5IZ1A 1UTHA 3PV0E 1IZ1A 3K1NA 2QRYA 3IOTA 4MCOA 4RJZA 2X7QA 3MSTA 3HHGA 1H76A 4WEPA 4P47A 4EXLA 1MXZA 3KN8A 3UK4A 1NUWA 3N5LA 3HV1A 1PB9A 1MPDA 1LAFE 4O3BA 1B4HA 5LTCA 2O1MA 3SDFA 4GQOA 4X1BA 5EHMA 2PMSA 4MBPA 2DE4A 4QF9A 4LONB 2O51A 4JWOA 4G77A 1EZPA 4ONYA 4G8NA 1MY0A 3C31A 4U4SA 1JP4A 4GLIA 4OHNA 2BJIA 1H3DA 1OQHA 2X7PA 2CZIA 2REGA 1HSJA 4OVJA 4M4GA 5AE4A 4C0RA 3MP6A 2VT5A 1US5A 2KLFA 3TZAA 1Y3PA 4OA4A 4IR8A 1H43A 2V93A 3MZ9A 2H5YA 2XX7A 4FECA 3LSWA 5I58B 4QFKA 1Y1MA 3H6UA 1LFGA 3U93A 3T9HB 2A5TB 3LC8A 5L8DA 1B4ZA 4BDMA 5HPQA 2Q88A 3KSXA 4G2ZA 1MG1A 2I4CA 3U92A 2WYPA 1WVJA 2F6GA 3H03A 1JNFA 3E9XA 4YB6A 3GXAA 2RCBA 2QVVA 4F1YA 2WYKA 2I58A 1F9BA 2XWKA 4G68C 4ZEFA 4OANA 1Y9UA 2ZNSA 2Q74A 2F7CA 3T66A 3T1BA 4OXVA 3MVYA 2H98A 4KCCA 2FHYA 5DW8A 4GL0A 2DVCA 3FJGA 4GX6A 2Q8JA 5TPAA 3GBBA 1B46A 4R9FA 2X26A 4PAFA 1B7ZA 5ICQA 1CNQA 2CZKA 1B7UA 1NV0A 4FBPA 4RYAA 1LBWA 3VE1B 1DK4A 3A09A 4OESA 5L9SA 1GR2A 3MP8A 1A8FA 4L17A 4F31B 5LOMA 3T0JA 1LGBC 4F3PA 1XC1A 3PPQA 1I6QA 3FXUA 3NOHA 2RCAA 1II5A 4N6KA 1XT8A 1XHYA 3ILTB 4N6PA 1MXUA 3MVWA 3HCQA 4JVIA 4FJPA 1URGA 2XXXA 4KYDA 1DPEA 2H4IA 4QSCA 4Q5TA 3TCGA 2QS3A 4HCWA 2DXYA 3CG1A 3RNNA 4QFNA 2HHMA 3W15C 3FV1A 1HSLA 5DVFA 3D4GA 3IORA 4ZZAA 4KD5A 4FEDA 1Q1KA 1KWHA 4LP2B 1JEVA 4RY1A 3E3KA 3BFUA 2ZZVA 4U22A 1L5TA 2PBWA 4H45A 2I3VA 3O2AA 1IMDA 3LSXA 4I8CA 3UA8A 3FGSA 1MM7A 1FSAA 1IITA 1URSA 3QUFA 3TMGA 5IZ3B 4PC9A 1I69A 3JV9A 3ZKKA 4RK2A 2XXIA 4KYEA 1P1NA 2OZZA 4AB5A 5I5PA 1VFEA 3HHFA 4PAKA 2R71A 4DI3D 1D9YA 1OVTA 3CSBA 4FAJA 4C1UA 4OENA 2AYSA 2PX1A 2QVRA 2HAUA 2I49A 2XXRA 1YCJA 4GD5A 3I3VA 2VD3A 3VLWA 3B6WA 4MJOA 4LQ2A 4NF5B 3GZGA 3C4MA 3FVNA 4OETA 1FPEA 3RPWA 1AH5A 1EYJA 1LBVA 2XXHA 4LVQA 3FASA 3N6UA 3KGCA 3U94A 1PC3A 4IO6A 5H8QA 4KQPA 1FTLA 2CZLA 4NF8B 2XXTA 4OQOA 4BDRA 3FIRA 4YAHX 1Y4TA 1B0LA 2R9JA 4F1VA 3LUZA 3GYYA 3E79A 1B0HA 3AXFA 4HTGA 5FTHA 4G61A 1FPLA 3RPLA 2ZZXA 2XXQA 2Y7PA 1I6AA 5ET6A 2QJEA 3S9LC 4EUOA 1YAEA 1G0HA 5TP9A 4YKKA 4OVTA 2ZNTA 2HPGA 4PDHA 4F1UA 3UGWA 1PB7A 4ELQA 2AL5A 3IJXB 4JBZA 5EQ7A 3S9MC 1B3EA 3SEVA 1MXXA 2E0SA 4H67A 1GVCA 2P0SA 4QFPA 5I2NB 2H25A 5DEXB 3QK6A 3SKPA 5AA4B 5BUUA 3MPKA 3SETA 4BDOA 1CE2A 4NHBA 1LEVA 2RF1A 1URDA 2Q2CA 1KA0A 1QGXA 2O84X 1LB8A 5CBRA 2RC8A 2UYFA 5H8NB 1OVBA 4NG7A 1LFHA 3H7MA 4POWA 1JW1A 1MY2A 4NAPA 2DOJA 3PUXE 3TFLA 3PUWE 2VD2A 3ZKLA 2NUVA 3PPRA 3PUVE 4GXAA 5K2YA 4IO7A 3KG2A 1LBCA 1MPCA 4N07A 4O94A 1WDNA 1VDWA 1EYKA 1Q9DA 2PT2A 4P11A 4U1ZA 1SYIA 4UACA 1MH4A 5KDTB 3U72A 3H4ZA 3VLVA 3PPNA 3T9XB 3PTYA 4XKPA 3M3KA 1S9TA 4P1EA 5ET8A 4EQ7A 1QUKA 4DXBA 2P3NA 3FVOA 4BLAA 4IO3A 2HAVA 1MY4A 5KCJA 5EYGA 4FORA 3OXNA 3RN8A 3K02A 3A3CA 4OVPA 3IR1A 1UTHB 3VXCA 3WAEA 1XI6A 3M8UA 1O63A 3UORA 4JDFA 1NV6A 2XX9A 4OFLA 1NKXA 2QMXA 1NNKA 4KR5A 1NUXA 1IMAA 1P99A 2GHBA 2HQ0A 2GRVA 1B3FA 1FPBA 4PTKA 2HFBA 5B70A 4R74A 4X9TA 1SQYA 1FPJA 4O7IA 3BIGA 4PDDA 2O7IA 1JVXA 4U23A 5FTIA 3LSFB 1GV8A 2H99A 4MX6A 3OOAA 2Q9TA 3C35A 1N7WA 4OTEA 2NXOA 2FIXA 4O8MA 4OVSA 5JK4A 5FHNA 1AL3A 1XS5A 2UVHA 4I40A 3N6TA 1IMCA 1UIVA 2R6GE 3CI8A 2FBPA 1LSTA 3MWBA 3EHTA 1SVXB 3HO7A 3EHUA 4U2RA 3UIFA 4R75A 1TT1A 2L5VA 2LAOA 4N8GA 1B7HA 4LN5A 1D4NA 1FPDA 3PPOA 4IO2A 1FPGA 2B4MA 1SDXA 3RY3A 5I59B 4JXIA 5F24A 4O3AA 4Z7EA 1ZLQA 3EKIA 3QXMA 4QSDA 5DTBA 4TLLB 3KC0A 4GF8A 2QSXA 2ZXTA 1M5CA 1MS7A 1PBQA 4GIZA 1ZIUA 1ZMGA 2HEUA 3OD7A 4LQ5A 4PFTA 5CC2A 4MHFA 3TTMA 4YU0A 5EQ8A 3TEPA 1I6BA 4HE2A 4ELRA 2V4CA 2O1LA 4OEVA 4F3SA 1FW0A 3G3HA 4RNSA 2F3BA 1MY3A 4HXVA 3SEWA 2DWJA 5HM4B 2F3DA 5A5XA 4LZ8A 4PFWA 4XKRA 4UABA 2B3BA 4R2FA 2XHDA 3OO8A 2B4LA 2DYXA 2F78A 4OVQA 3ZSFA 4GWWA 1FJ6A 5ET7A 2Z23A 1BLFA 3SEUA 1O7TA 4ISUA 4PF8A 2F35A 4F2QA 1TXFA 3KOSA 4Z0IA 3I6VA 1SW2A 5CMCA 4LZ5A 4Q30B 3UN6A 3B6TA 4ELPA 3Q27A 1MXWA 1PDAA 3G3GA 2XXKA 1RYXA 1IXCA 2I4BA 5HBCA 1DOTA 1YYZA 4PF6A 4XFEA 4AB6A 3C9HA 3H06B 5L9OA 1FPFA 3CVGA 4PBHA 3USDA 2GQ1A 3ILUB 3PD9A 3FD3A 5J16A 1UIUA 3RT8A 4GFRA 1R1NA 3G3KA 4N4UA 2Y5LA 3H6TA 3THIA 4LUBA 4EQBA 1QUJA 4NF6A 3OEKA 2RKMA 5EYHA 4PE3A 4POXA 1UTBB 4MH5A 2DWIA 1JVYA 3O9PA 4EQ9A 1B9JA 3KFMA 4P8BA 3FBPA 2Q2AA 3G3FA 3O6IA 2NVUB 1VE4A 4PP0A 2PVUA 4YZZA 4H6DA 4ZE8A 1BTJA 3JZJA 4BDNA 5JTYA 4G68B 5FHOA 3OO7A 3DM0A 3PUYE 3SZPA 2KR0A 1A40A 3EPEA 4PGNA 4EF2A 1NV3A 1BIYA 4H46A 1NV7A 4EXKA 4EDPA 2XD2A 1JETA 2Z22A 4XEQA 1QKAA 2R8TA 4PFBA 1XVYA 4K3FA 1VSOA 2NWJA 3IL1B 1H44A 3FVGA 4YKJA 4GWYA 2WBDA 4JB7A 5EYFA 4R6KA 3PPPA 1NL5A 3FXQA 4MFIA 5CRYA 1PBPA 1A7LA 4JSOA 1A55A 1MM6A 5I2KB 2FIEA 3TTNA 4XIGQ 1FTMA 4DI4B 4H1XA 1N76A 1US4A 1ATGA 3LR1A 4P0IA 2F7AA 3B6QA 1M5EA 3RTWB 2OWZA 3TCFA 5I56B 3B50A 3IB0A 5H8QB 1EH3A 2Z8EA 4GL8A 4X8RA 1FQDA 5I58A 3PD8A 2FVZA 3R6UA 4N15A 2A5TA 5I3SA 3RTFB 2DE3A 2CEYA 3KSJA 4XF5A 1NNTA 4X1DA 1B1XA 3MP1A 3OO9A 4NF4B 1FRPA 1S7YA 2Y7KA 3TDJA 3TCHA 1B3LA 4YB7A 3MBPA 4R73A 5H8FB 4XKQA 1LLSA 1OLAA 1TWYA 3P7IA 2OLBA 3T96B 4NX1A 2V25A 5B7DA 4GX3A 4MMPA 1WODA 4NF0A 3WAFA 3VLUA 2XXUA 3V5AA 4OERA 4MIJA 4KYSA 3S9NC 3H3GA 5KZTA 5T3JA 1DPPA 1MXYA 3KN3A 4MLQA 4BDLA 1EYIA 1OIBA 3CG3A 4ELOA 2PT1A 2WKYA 4P0GA 1MQIA 5EHSA 1ANFA 4NWDA 3PUZE 1BP5A 5CI5A 1OQGA 3FJ7A 1RDYA 1INPA 3C33A 2GFEA 3T93B 4O7MA 3IAZA 4KI0E 4N8YA 5H8HB 1IQ7A 4N6DA 3HPIA 2P1SA 1N7XA 2DE2A 3O6HA 3ONMA 2DP8A 2QPQA 2NOOA 3K6UA 5CBSA 4IB2A 3VXBA 5AA2A 4PQJA 4DXCA 3U8QA 4X48A 3VVEA 2I0BA 3K0VA 1YTVA 3GBAA 1IIWA 1KZ8A 2PFYA 3TKDA 4U4XA 1GGGA 3CRBA 1B3HA 3KOTA 3SEXA 4H8IA 1MY1A 1QULA 1QVSA 4MEVA 1EU8A 1RYOA 1DSNA 2CMOA 2FYIA 3TTRA 3RQTA 1IMFA 5FHMA 1SI0A 3FUZA 3L6GA 2YPNA 3MC2A 3Q29A 1NI9A 3N94A 2MKZA 4GRKA 2ONRA 3IB1A 5J1DA 4HCYA 5DVIA 4KFQA 2BJJX 4I3EA 1FQCA 3DP6A 2XWOA 5DT6A 1SI1A 5IZ3A 3TODA 1B5JA 3G3IA 3FXBA 4ESXA 2PYYA 1SW5A 3K01A 4YB5A 3TELA 2Q89A 2A5SA 3T22A 2THIA 5IAIA 1LCFA 3MZ1A 4KXPA 2XD3A 4TOZA 3CR9A 1LBYA 2UXAA 3HSTA 3SEYA 1IMBA 1SPIA 2HZKA 3CIJA 4PE5B 2I6EA 4R72A 5ITPA 3O6GA 3HN0A 1R9LA 4IGTA 4ZEIA 1QUIA 3OEMA 4Q8RA 4YMAA 1IXGA 1IXHA 1D9QA 5IZZA 5AA1A 3IFAA 2XA5A 1P1WA 1ZU0A 3Q25A 5L9MA 3MUQA 4R9GA 3PGFA 3FXRA 3R7XA 4DDDA 5AA2D 2ZYNA 4QXDA 2XXWA 4I3YA 2PCRA 5IGAA 2GHAA 4ND9A 3TTKA 1H45A 3MW0A 3LUYA 2FA7A 2W7YA 1NV1A 2Q8MA 4Q0CA 3G3JA 1DBZA 3O97A 4NF8A 2DWHA 1NMUA 1DTGA 2V3QA 3DP8A 4ZZEA 2QS1A 2D5WA 3OMBA 4GX4A 4I1DA 4FE8A 2FNCA 4DLDA 4MF3A 4NQ8A 3GLBA 4OMBA 1FTAA 2QS4A 3UP9A 3R26A 4MNIA 4GWUA 4I9DA 1SBPA 1QJMA 2JJKA 3MQ9A 2O6AA 3D4CA 1GTKA 1MQDA 4HE0A 3Q28A 1R9QA 1NUYA 3OENA 3K4UA 1ZJLA 2VOZA 2ZYMA 1NNPA 1D3KA 1JW5A 4R6HA 1NH8A 4JVDA 1P1OA 1CB6A 1G0IA 1PEBA 4NMYA 3MPLA 3MVXA 2VGQA 1M5DA 2I48A 2HXWA 4YMBA 1B58A 5IKBA 4GBWA 2IEEA 3A3UA 3W9WA 3E78A 1TFDA 1Y3NA 1IEJA 2XX8A 3TQLA 5I2NA 4WKMA 5DEXA 5AA4A 4ECFA 1K9YA 2ONKE 1FBPA 2RC9A 4HS7A 1J1NA 4QSEA 4QRZA 5AA3A 3FATA 1B2HA 1EZ9A 4IGRA 5H8NA 1M5BA 3JYRA 3I5OA 1SW4A 1RKMA 4AQ4A 2F7BA 3TAJA 5M2VA 3Q26A 2F97A 4F3GA 4NGUA 2KQZA 4QFOA 4OEUA 5EQAA 3DLNA 4GOTA 4F18A 5CMBA 3C36A 1B52A 2P2AA 3FZVA 1P1UA 3IB2A 1AOVA 4C1TA 1MQHA 1MH3A 3IO6A 4KHZE 5KDTA 3IK6B 1POY1 4GWZA 5JEIA 3KC1A 1Y1ZA 3N26A 4RK9A 4IO4A 4PFIA 3S9EA 1MXVA 2AIXA 3B8BA 4H5GA 2ANJA 1N0TA 1FQBA 4H65A 5TPAB 1MQJA 4FATA 4GXSB 1NFTA 4QFLA 3FV2A 4N13A 1FTJA 1A54A 2XXPA 3OO6A 3OELA 5CMKA 4DZ1A 1O64A 3LBSA 4WXJA 1SW1A 3H6WA 3E13X 1B3GA 4ZECA 4GBVA 3FVKA 4P3LA 1EZOA 4XXUA 1ZKBA 4FIMA 1LBXA 2OWSA 4MNPA 4G8MA 4AS4A 1BK4A 2Y84A 2OWTA 2F36A 4M1VA 1FBFA 4TLMB 1DMBA 1S50A 2F34A 1LAHE 2UVJA 3CFXA 1B6HA 4YICA 4GWXA 2O68A 3OSRA 2ZZWA 3K1PA 5BWJA 5I59A 3PMVA 3VVFA 5I57A 3TUSA
chains in the Genus database with same CATH topology
4F29A 3O29A 2OJTA 2G93A 4LZ7A 3SERA 1USYH 3SESA 2M8CA 1TFAA 4ZEKA 5ITOA 1SD3A 1ZBMA 3QAXA 2QMWA 2ABHA 2G29A 3LSLA 1B5HA 3M3FA 3BFTA 5CMMA 2OK2A 3PMWA 1B51A 3M3LA 2VP1A 2V3TA 3T9VA 4JSDA 4G4PA 2REJA 1Y20A 2DSFA 1LAXA 2ZYKA 1B05A 5ISUA 4R2BA 4OWDA 4EF1A 4IY6A 5AA2B 3V8XB 1LCTA 3QUJA 3RT6B 2ZMBA 5F7VA 4FEBA 3F11A 1VFDA 1DTZA 1XVXA 4ZEBA 3EF7A 4JWXA 1LB9A 2B65A 5TP9B 1Y4CA 3ODBA 4OFJA 3QSLA 4OFOA 3EHSA 3FJMA 1UTBA 1UQWA 3PMXA 1OMPA 2D21A 4DIGA 2ZYOA 5DVJA 1FTOA 2V84A 1Z7NE 2DWAA 1MDP1 4LA9A 3H6VA 1FTKA 1JW4A 4G68A 1LAGE 2Z8FA 4R6YA 1B1HA 4ZS9A 3TTLA 3BKIB 3KEIA 4U21A 4ESWA 3CFLA 1R6ZA 4DCYA 3ZS6A 4F19A 4ZDMA 1MRPA 3VDFA 1D9VA 3QIMA 4GWOA 4TQUQ 4ZEDA 4JWYA 3IO4A 3MZBA 1VR5A 2IA4A 1USYE 5F1QA 4I62A 2Y7IA 2F5XA 3EQ1A 1T0KA 3TYHA 1PB8A 2YLNA 3IOUA 1FQFA 1JQFA 1N84A 1ELJA 3RGYA 5DYHA 1AIVA 5I2KA 4KCDA 4NEDA 3RLFE 4QHQA 2O7UA 5I56A 2ALUA 2UYEA 2OBGA 1P1QA 3S2VA 2YJPA 1MPBA 3CSGA 4E0XA 2DQVA 3KJ7A 3L6HA 3MJNA 3B7DA 5KCJB 4IO5A 2I3WA 2QS2A 1FQAA 1FCKA 3CFZA 2ZNUA 1N3WA 5H8SA 3TPAA 1B5IA 3VVDA 4NF4A 2RC7A 3KN7A 4OZ9A 4UA8A 3QYTA 3VFJA 5H8FA 4XKNA 3V83A 3E4RA 4NTLA 4KPTA 2UVGA 2F8DA 3ECRA 1Z7ME 3MVZA 4DXUA 4DCXA 2QL3A 1LFIA 2Y7RA 4OYVA 3C34A 2RINA 1FQEA 1LBBA 4THIA 4PFUA 2DVZA 2XXVA 1M5FA 3PU5A 3EN3A 4NF5A 4RPNA 1Y3QA 4ZE9A 2B3FA 3KJTA 1IUDA 4YKPA 4RA1A 4E0WA 2DXRA 3IOWA 3IOVA 2VHAA 5H8HA 3C32A 4XTCQ 4MLVA 4PETA 3TQWA 3OSQA 1XOCA 4F3BA 3K2DA 2H9BA 1N04A 2HZLA 4PFYA 2DS9A 3S4UA 5CM6A 4H5FA 1QW0A 3IJOB 1N3XA 1B40A 5K2XA 1A8EA 3VV5A 2I0CA 4DE8A 5A5XB 1NH7A 3T9UA 3K6VA 1OLCA 2HCAA 4G8HA 4GVOA 2UVIA 4LATA 4H8JA 1POTA 1B32A 3G7WA 3K00A 2F6PA 1A99A 3BBRA 1NNFA 4WEDA 1JEUA 3DELB 4HW8A 3K1MA 4NE4A 4F2OA 4RXLA 4U1OA 2ESNA 2Y7WA 3W9VA 3DP4A 2GH9A 1IXIA 5TU0A 2O69A 2E1SA 4F22A 3MAMA 1MDQA 3K6WA 5ICTA 3U1OA 3IX1A 3O66A 4H0WA 4O3CA 3RUMA 3V89B 1SYHA 4RPOA 4IY5A 4NF6B 1HSEA 1Q35A 1MQGA 1ZTYA 1YPNA 2AL4A 2D3IA 3K6XA 2OCUA 3O28A 2Z8DA 4YKIA 5I84A 3KBRA 5I57B 2V3UA 4NWCA 5ELVA 1BKAA 2XXYA 3KZGA 4F39A 4BDQA 5JTYB 1QKBA 1AMFA 2ONSA 1UTHA 3PV0E 1IZ1A 3K1NA 2QRYA 3IOTA 4RJZA 2X7QA 3HHGA 1H76A 4WEPA 4EXLA 1MXZA 3KN8A 3UK4A 3N5LA 3HV1A 1PB9A 1MPDA 1LAFE 4O3BA 1B4HA 2O1MA 3SDFA 4GQOA 4X1BA 5EHMA 2PMSA 4MBPA 2DE4A 4QF9A 4LONB 2O51A 4JWOA 4G77A 1EZPA 4ONYA 4G8NA 1MY0A 3C31A 4U4SA 4GLIA 4OHNA 1H3DA 1OQHA 2X7PA 2REGA 1HSJA 4OVJA 4M4GA 5AE4A 4C0RA 3MP6A 1US5A 2KLFA 3TZAA 1Y3PA 1H43A 2V93A 3MZ9A 2H5YA 2XX7A 4FECA 3LSWA 5I58B 4QFKA 1Y1MA 3H6UA 1LFGA 3U93A 3T9HB 2A5TB 3LC8A 5L8DA 1B4ZA 4BDMA 5HPQA 2Q88A 3KSXA 4G2ZA 1MG1A 2I4CA 3U92A 1WVJA 2F6GA 3H03A 1JNFA 3E9XA 4YB6A 3GXAA 2RCBA 4F1YA 2I58A 1F9BA 4G68C 4ZEFA 1Y9UA 2ZNSA 2F7CA 3T66A 4OXVA 3MVYA 2H98A 4KCCA 4GL0A 2DVCA 3FJGA 2Q8JA 5TPAA 3GBBA 1B46A 4R9FA 2X26A 1B7ZA 5ICQA 1B7UA 4RYAA 3VE1B 3A09A 4OESA 5L9SA 1GR2A 4F31B 3MP8A 1A8FA 4L17A 5LOMA 1LGBC 4F3PA 1XC1A 3PPQA 1I6QA 3FXUA 2RCAA 1II5A 1XT8A 1XHYA 3ILTB 4N6PA 1MXUA 3MVWA 3HCQA 4FJPA 1URGA 2XXXA 4KYDA 1DPEA 2H4IA 4QSCA 4Q5TA 3TCGA 2QS3A 4HCWA 2DXYA 3CG1A 3RNNA 4QFNA 3W15C 3FV1A 1HSLA 5DVFA 3D4GA 3IORA 4ZZAA 4KD5A 4FEDA 1KWHA 1Q1KA 4LP2B 1JEVA 4RY1A 3E3KA 3BFUA 4U22A 1L5TA 2PBWA 2I3VA 3O2AA 3LSXA 4I8CA 3UA8A 3FGSA 1MM7A 1IITA 1URSA 3QUFA 3TMGA 1I69A 3JV9A 3ZKKA 4RK2A 2XXIA 4KYEA 1P1NA 2OZZA 4AB5A 1VFEA 3HHFA 2R71A 1D9YA 1OVTA 3CSBA 4FAJA 4C1UA 4OENA 2AYSA 2PX1A 2HAUA 2I49A 2XXRA 1YCJA 4GD5A 3I3VA 2VD3A 3VLWA 3B6WA 4LQ2A 4NF5B 3GZGA 3C4MA 3FVNA 4OETA 3RPWA 1AH5A 2XXHA 4LVQA 3FASA 3N6UA 3KGCA 3U94A 1PC3A 4IO6A 5H8QA 4KQPA 1FTLA 2CZLA 4NF8B 2XXTA 4OQOA 4BDRA 3FIRA 4YAHX 1Y4TA 1B0LA 2R9JA 4F1VA 1B0HA 3AXFA 4HTGA 5FTHA 2XXQA 2Y7PA 1I6AA 2QJEA 3S9LC 4EUOA 1YAEA 5TP9A 4YKKA 2ZNTA 4F1UA 3UGWA 1PB7A 4ELQA 2AL5A 3IJXB 4JBZA 3S9MC 1B3EA 3SEVA 1MXXA 2E0SA 4H67A 1GVCA 2P0SA 4QFPA 5I2NB 2H25A 5DEXB 3QK6A 5BUUA 3SKPA 5AA4B 3MPKA 3SETA 4BDOA 1CE2A 2RF1A 1URDA 2Q2CA 2O84X 1LB8A 5CBRA 2RC8A 2UYFA 5H8NB 1OVBA 1LFHA 3H7MA 4POWA 1JW1A 1MY2A 2DOJA 3PUXE 3TFLA 3PUWE 2VD2A 3ZKLA 2NUVA 3PPRA 3PUVE 4GXAA 5K2YA 4IO7A 3KG2A 1LBCA 1MPCA 4N07A 1WDNA 2PT2A 4P11A 4U1ZA 1SYIA 4UACA 1MH4A 5KDTB 3U72A 3H4ZA 3VLVA 3PPNA 3T9XB 4XKPA 3M3KA 1S9TA 4EQ7A 1QUKA 4DXBA 3FVOA 4BLAA 4IO3A 2HAVA 1MY4A 5KCJA 4FORA 3OXNA 3RN8A 3K02A 3A3CA 3IR1A 1UTHB 3VXCA 3WAEA 3M8UA 1O63A 3UORA 4JDFA 2XX9A 4OFLA 1NKXA 2QMXA 1NNKA 4KR5A 1P99A 2GHBA 2HQ0A 2GRVA 1B3FA 2HFBA 5B70A 4R74A 4X9TA 1SQYA 2O7IA 1JVXA 4U23A 5FTIA 3LSFB 1GV8A 2H99A 3OOAA 2Q9TA 3C35A 1N7WA 4OTEA 2NXOA 5JK4A 5FHNA 1AL3A 1XS5A 2UVHA 3N6TA 1UIVA 2R6GE 3CI8A 1LSTA 3MWBA 3EHTA 1SVXB 3HO7A 3EHUA 4U2RA 3UIFA 4R75A 1TT1A 2LAOA 1B7HA 1D4NA 3PPOA 4IO2A 1SDXA 3RY3A 5I59B 4JXIA 4O3AA 4Z7EA 1ZLQA 3QXMA 4QSDA 5DTBA 4TLLB 4GF8A 2QSXA 2ZXTA 1M5CA 1MS7A 1PBQA 4GIZA 1ZIUA 1ZMGA 2HEUA 3OD7A 4LQ5A 4PFTA 5CC2A 3TTMA 4YU0A 3TEPA 1I6BA 4ELRA 2O1LA 4OEVA 4F3SA 1FW0A 3G3HA 4RNSA 1MY3A 3SEWA 2DWJA 5HM4B 5A5XA 4LZ8A 4PFWA 4XKRA 2B3BA 4R2FA 2XHDA 3OO8A 2DYXA 2F78A 3ZSFA 2Z23A 1BLFA 3SEUA 1O7TA 4ISUA 2F35A 4F2QA 1TXFA 3KOSA 4Z0IA 3I6VA 1SW2A 5CMCA 4LZ5A 4Q30B 3UN6A 3B6TA 4ELPA 3Q27A 1MXWA 1PDAA 3G3GA 1RYXA 1IXCA 2I4BA 5HBCA 1DOTA 4AB6A 3C9HA 3H06B 5L9OA 3CVGA 3USDA 3ILUB 3PD9A 3FD3A 1UIUA 3RT8A 4GFRA 1R1NA 3G3KA 3H6TA 3THIA 4LUBA 4EQBA 1QUJA 4NF6A 3OEKA 2RKMA 4POXA 1UTBB 4MH5A 2DWIA 1JVYA 3O9PA 4EQ9A 1B9JA 3KFMA 2Q2AA 3G3FA 3O6IA 2NVUB 1VE4A 4PP0A 2PVUA 4YZZA 4H6DA 4ZE8A 1BTJA 3JZJA 4BDNA 5JTYA 4G68B 5FHOA 3OO7A 3DM0A 3PUYE 1A40A 3EPEA 4EF2A 1BIYA 4EXKA 4EDPA 2XD2A 1JETA 2Z22A 1QKAA 1XVYA 4K3FA 1VSOA 2NWJA 3IL1B 1H44A 3FVGA 4YKJA 4JB7A 5EYFA 4R6KA 3PPPA 1NL5A 3FXQA 4MFIA 5CRYA 1PBPA 1A7LA 4JSOA 1A55A 1MM6A 5I2KB 3TTNA 4XIGQ 1FTMA 4H1XA 1N76A 1US4A 1ATGA 3LR1A 4P0IA 2F7AA 3B6QA 1M5EA 3RTWB 3TCFA 5I56B 3IB0A 5H8QB 1EH3A 2Z8EA 4GL8A 1FQDA 5I58A 3PD8A 3R6UA 2A5TA 3RTFB 2DE3A 3KSJA 1NNTA 4X1DA 1B1XA 3MP1A 3OO9A 4NF4B 1S7YA 2Y7KA 3TDJA 3TCHA 1B3LA 4YB7A 3MBPA 4R73A 5H8FB 4XKQA 1LLSA 1OLAA 1TWYA 3P7IA 2OLBA 3T96B 2V25A 5B7DA 1WODA 3WAFA 3VLUA 2XXUA 3V5AA 4OERA 4KYSA 3S9NC 3H3GA 5KZTA 1DPPA 1MXYA 3KN3A 4MLQA 4BDLA 1OIBA 3CG3A 4ELOA 2PT1A 2WKYA 4P0GA 1MQIA 5EHSA 1ANFA 4NWDA 3PUZE 1BP5A 5CI5A 1OQGA 3FJ7A 3C33A 2GFEA 3T93B 3IAZA 4KI0E 5H8HB 1IQ7A 3HPIA 2P1SA 1N7XA 2DE2A 3O6HA 3ONMA 2DP8A 2QPQA 2NOOA 3K6UA 5CBSA 4IB2A 3VXBA 5AA2A 4PQJA 4DXCA 3U8QA 4X48A 3VVEA 2I0BA 3K0VA 1YTVA 3GBAA 1IIWA 3TKDA 4U4XA 1GGGA 3CRBA 1B3HA 3KOTA 3SEXA 4H8IA 1MY1A 1QULA 1QVSA 1EU8A 1RYOA 1DSNA 2CMOA 2FYIA 3TTRA 3RQTA 5FHMA 1SI0A 3FUZA 3L6GA 2YPNA 3MC2A 3Q29A 3N94A 4GRKA 2ONRA 3IB1A 5J1DA 4HCYA 5DVIA 4KFQA 2BJJX 1FQCA 3DP6A 5DT6A 1SI1A 3TODA 1B5JA 3G3IA 4ESXA 2PYYA 1SW5A 3K01A 4YB5A 3TELA 2Q89A 2A5SA 3T22A 2THIA 5IAIA 1LCFA 3MZ1A 2XD3A 4TOZA 3CR9A 2UXAA 3HSTA 3SEYA 2HZKA 3CIJA 4PE5B 2I6EA 4R72A 5ITPA 3O6GA 3HN0A 1R9LA 4IGTA 4ZEIA 1QUIA 3OEMA 4Q8RA 4YMAA 1IXGA 1IXHA 5AA1A 1P1WA 1ZU0A 3Q25A 5L9MA 3MUQA 4R9GA 3PGFA 3FXRA 3R7XA 4DDDA 5AA2D 2ZYNA 2XXWA 2GHAA 4ND9A 3TTKA 1H45A 3MW0A 3LUYA 2FA7A 2W7YA 4Q0CA 3G3JA 3O97A 4NF8A 2DWHA 1NMUA 1DTGA 2V3QA 3DP8A 4ZZEA 2QS1A 2D5WA 3OMBA 4I1DA 4FE8A 2FNCA 4DLDA 4MF3A 3GLBA 4OMBA 2QS4A 3UP9A 3R26A 4I9DA 1SBPA 1QJMA 3MQ9A 2O6AA 3D4CA 1GTKA 1MQDA 3Q28A 1R9QA 3OENA 3K4UA 1ZJLA 2VOZA 2ZYMA 1NNPA 1D3KA 1JW5A 4R6HA 1NH8A 1P1OA 1CB6A 1PEBA 4NMYA 3MPLA 3MVXA 2VGQA 1M5DA 2I48A 2HXWA 4YMBA 1B58A 5IKBA 2IEEA 3A3UA 3W9WA 1TFDA 1Y3NA 1IEJA 2XX8A 3TQLA 5I2NA 4WKMA 5DEXA 5AA4A 4ECFA 2ONKE 2RC9A 4HS7A 1J1NA 4QSEA 4QRZA 5AA3A 3FATA 1B2HA 1EZ9A 4IGRA 5H8NA 1M5BA 3JYRA 3I5OA 1SW4A 1RKMA 4AQ4A 2F7BA 3TAJA 5M2VA 3Q26A 2F97A 4F3GA 4QFOA 4OEUA 3DLNA 4GOTA 4F18A 5CMBA 3C36A 1B52A 2P2AA 3FZVA 1P1UA 3IB2A 1AOVA 4C1TA 1MQHA 1MH3A 3IO6A 4KHZE 5KDTA 3IK6B 1POY1 5JEIA 1Y1ZA 3N26A 4RK9A 4IO4A 3S9EA 1MXVA 2AIXA 4H5GA 2ANJA 1N0TA 1FQBA 4H65A 5TPAB 1MQJA 4FATA 4GXSB 1NFTA 4QFLA 3FV2A 4N13A 1FTJA 1A54A 2XXPA 3OO6A 3OELA 5CMKA 4DZ1A 1O64A 3LBSA 4WXJA 1SW1A 3H6WA 3E13X 1B3GA 4ZECA 3FVKA 1EZOA 4XXUA 1ZKBA 4FIMA 2OWSA 4G8MA 2Y84A 2OWTA 2F36A 4M1VA 4TLMB 1DMBA 1S50A 2F34A 1LAHE 2UVJA 3CFXA 1B6HA 4YICA 2O68A 3OSRA 3K1PA 5BWJA 5I59A 3PMVA 3VVFA 5I57A 3TUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F29 A;  3O29 A;  2OJT A;  2G93 A;  4LZ7 A;  3SER A;  1USY H;  3SES A;  2M8C A;  1TFA A;  4ZEK A;  5ITO A;  1SD3 A;  1ZBM A;  3QAX A;  2QMW A;  2ABH A;  2G29 A;  3LSL A;  1B5H A;  3M3F A;  3BFT A;  5CMM A;  2OK2 A;  3PMW A;  1B51 A;  3M3L A;  2VP1 A;  2V3T A;  3T9V A;  4JSD A;  4G4P A;  2REJ A;  1Y20 A;  2DSF A;  1LAX A;  2ZYK A;  1B05 A;  5ISU A;  4R2B A;  4OWD A;  4EF1 A;  4IY6 A;  5AA2 B;  3V8X B;  1LCT A;  3QUJ A;  3RT6 B;  2ZMB A;  5F7V A;  4FEB A;  3F11 A;  1VFD A;  1DTZ A;  1XVX A;  4ZEB A;  3EF7 A;  4JWX A;  1LB9 A;  2B65 A;  5TP9 B;  1Y4C A;  3ODB A;  4OFJ A;  3QSL A;  4OFO A;  3EHS A;  3FJM A;  1UTB A;  1UQW A;  3PMX A;  1OMP A;  2D21 A;  4DIG A;  2ZYO A;  5DVJ A;  1FTO A;  2V84 A;  1Z7N E;  2DWA A;  1MDP 1;  4LA9 A;  3H6V A;  1FTK A;  1JW4 A;  4G68 A;  1LAG E;  2Z8F A;  4R6Y A;  1B1H A;  4ZS9 A;  3TTL A;  3BKI B;  3KEI A;  4U21 A;  4ESW A;  3CFL A;  1R6Z A;  4DCY A;  3ZS6 A;  4F19 A;  4ZDM A;  1MRP A;  3VDF A;  1D9V A;  3QIM A;  4GWO A;  4TQU Q;  4ZED A;  4JWY A;  3IO4 A;  3MZB A;  1VR5 A;  2IA4 A;  1USY E;  5F1Q A;  4I62 A;  2Y7I A;  2F5X A;  3EQ1 A;  1T0K A;  3TYH A;  1PB8 A;  2YLN A;  3IOU A;  1FQF A;  1JQF A;  1N84 A;  1ELJ A;  3RGY A;  5DYH A;  1AIV A;  5I2K A;  4KCD A;  4NED A;  3RLF E;  4QHQ A;  2O7U A;  5I56 A;  2ALU A;  2UYE A;  2OBG A;  1P1Q A;  3S2V A;  2YJP A;  1MPB A;  3CSG A;  4E0X A;  2DQV A;  3KJ7 A;  3L6H A;  3MJN A;  3B7D A;  5KCJ B;  4IO5 A;  2I3W A;  2QS2 A;  1FQA A;  1FCK A;  3CFZ A;  2ZNU A;  1N3W A;  5H8S A;  3TPA A;  1B5I A;  3VVD A;  4NF4 A;  2RC7 A;  3KN7 A;  4OZ9 A;  4UA8 A;  3QYT A;  3VFJ A;  5H8F A;  4XKN A;  3V83 A;  3E4R A;  4NTL A;  4KPT A;  2UVG A;  2F8D A;  3ECR A;  1Z7M E;  3MVZ A;  4DXU A;  4DCX A;  2QL3 A;  1LFI A;  2Y7R A;  4OYV A;  3C34 A;  2RIN A;  1FQE A;  1LBB A;  4THI A;  4PFU A;  2DVZ A;  2XXV A;  1M5F A;  3PU5 A;  3EN3 A;  4NF5 A;  4RPN A;  1Y3Q A;  4ZE9 A;  2B3F A;  3KJT A;  1IUD A;  4YKP A;  4RA1 A;  4E0W A;  2DXR A;  3IOW A;  3IOV A;  2VHA A;  5H8H A;  3C32 A;  4XTC Q;  4MLV A;  4PET A;  3TQW A;  3OSQ A;  1XOC A;  4F3B A;  3K2D A;  2H9B A;  1N04 A;  2HZL A;  4PFY A;  2DS9 A;  3S4U A;  5CM6 A;  4H5F A;  1QW0 A;  3IJO B;  1N3X A;  1B40 A;  5K2X A;  1A8E A;  3VV5 A;  2I0C A;  4DE8 A;  5A5X B;  1NH7 A;  3T9U A;  3K6V A;  1OLC A;  2HCA A;  4G8H A;  4GVO A;  2UVI A;  4LAT A;  4H8J A;  1POT A;  1B32 A;  3G7W A;  3K00 A;  2F6P A;  1A99 A;  3BBR A;  1NNF A;  4WED A;  1JEU A;  3DEL B;  4HW8 A;  3K1M A;  4NE4 A;  4F2O A;  4RXL A;  4U1O A;  2ESN A;  2Y7W A;  3W9V A;  3DP4 A;  2GH9 A;  1IXI A;  5TU0 A;  2O69 A;  2E1S A;  4F22 A;  3MAM A;  1MDQ A;  3K6W A;  5ICT A;  3U1O A;  3IX1 A;  3O66 A;  4H0W A;  4O3C A;  3RUM A;  3V89 B;  1SYH A;  4RPO A;  4IY5 A;  4NF6 B;  1HSE A;  1Q35 A;  1MQG A;  1ZTY A;  1YPN A;  2AL4 A;  2D3I A;  3K6X A;  2OCU A;  3O28 A;  2Z8D A;  4YKI A;  5I84 A;  3KBR A;  5I57 B;  2V3U A;  4NWC A;  5ELV A;  1BKA A;  2XXY A;  3KZG A;  4F39 A;  4BDQ A;  5JTY B;  1QKB A;  1AMF A;  2ONS A;  1UTH A;  3PV0 E;  1IZ1 A;  3K1N A;  2QRY A;  3IOT A;  4RJZ A;  2X7Q A;  3HHG A;  1H76 A;  4WEP A;  4EXL A;  1MXZ A;  3KN8 A;  3UK4 A;  3N5L A;  3HV1 A;  1PB9 A;  1MPD A;  1LAF E;  4O3B A;  1B4H A;  2O1M A;  3SDF A;  4GQO A;  4X1B A;  5EHM A;  2PMS A;  4MBP A;  2DE4 A;  4QF9 A;  4LON B;  2O51 A;  4JWO A;  4G77 A;  1EZP A;  4ONY A;  4G8N A;  1MY0 A;  3C31 A;  4U4S A;  4GLI A;  4OHN A;  1H3D A;  1OQH A;  2X7P A;  2REG A;  1HSJ A;  4OVJ A;  4M4G A;  5AE4 A;  4C0R A;  3MP6 A;  1US5 A;  2KLF A;  3TZA A;  1Y3P A;  1H43 A;  2V93 A;  3MZ9 A;  2H5Y A;  2XX7 A;  4FEC A;  3LSW A;  5I58 B;  4QFK A;  1Y1M A;  3H6U A;  1LFG A;  3U93 A;  3T9H B;  2A5T B;  3LC8 A;  5L8D A;  1B4Z A;  4BDM A;  5HPQ A;  2Q88 A;  3KSX A;  4G2Z A;  1MG1 A;  2I4C A;  3U92 A;  1WVJ A;  2F6G A;  3H03 A;  1JNF A;  3E9X A;  4YB6 A;  3GXA A;  2RCB A;  4F1Y A;  2I58 A;  1F9B A;  4G68 C;  4ZEF A;  1Y9U A;  2ZNS A;  2F7C A;  3T66 A;  4OXV A;  3MVY A;  2H98 A;  4KCC A;  4GL0 A;  2DVC A;  3FJG A;  2Q8J A;  5TPA A;  3GBB A;  1B46 A;  4R9F A;  2X26 A;  1B7Z A;  5ICQ A;  1B7U A;  4RYA A;  3VE1 B;  3A09 A;  4OES A;  5L9S A;  1GR2 A;  4F31 B;  3MP8 A;  1A8F A;  4L17 A;  5LOM A;  1LGB C;  4F3P A;  1XC1 A;  3PPQ A;  1I6Q A;  3FXU A;  2RCA A;  1II5 A;  1XT8 A;  1XHY A;  3ILT B;  4N6P A;  1MXU A;  3MVW A;  3HCQ A;  4FJP A;  1URG A;  2XXX A;  4KYD A;  1DPE A;  2H4I A;  4QSC A;  4Q5T A;  3TCG A;  2QS3 A;  4HCW A;  2DXY A;  3CG1 A;  3RNN A;  4QFN A;  3W15 C;  3FV1 A;  1HSL A;  5DVF A;  3D4G A;  3IOR A;  4ZZA A;  4KD5 A;  4FED A;  1KWH A;  1Q1K A;  4LP2 B;  1JEV A;  4RY1 A;  3E3K A;  3BFU A;  4U22 A;  1L5T A;  2PBW A;  2I3V A;  3O2A A;  3LSX A;  4I8C A;  3UA8 A;  3FGS A;  1MM7 A;  1IIT A;  1URS A;  3QUF A;  3TMG A;  1I69 A;  3JV9 A;  3ZKK A;  4RK2 A;  2XXI A;  4KYE A;  1P1N A;  2OZZ A;  4AB5 A;  1VFE A;  3HHF A;  2R71 A;  1D9Y A;  1OVT A;  3CSB A;  4FAJ A;  4C1U A;  4OEN A;  2AYS A;  2PX1 A;  2HAU A;  2I49 A;  2XXR A;  1YCJ A;  4GD5 A;  3I3V A;  2VD3 A;  3VLW A;  3B6W A;  4LQ2 A;  4NF5 B;  3GZG A;  3C4M A;  3FVN A;  4OET A;  3RPW A;  1AH5 A;  2XXH A;  4LVQ A;  3FAS A;  3N6U A;  3KGC A;  3U94 A;  1PC3 A;  4IO6 A;  5H8Q A;  4KQP A;  1FTL A;  2CZL A;  4NF8 B;  2XXT A;  4OQO A;  4BDR A;  3FIR A;  4YAH X;  1Y4T A;  1B0L A;  2R9J A;  4F1V A;  1B0H A;  3AXF A;  4HTG A;  5FTH A;  2XXQ A;  2Y7P A;  1I6A A;  2QJE A;  3S9L C;  4EUO A;  1YAE A;  5TP9 A;  4YKK A;  2ZNT A;  4F1U A;  3UGW A;  1PB7 A;  4ELQ A;  2AL5 A;  3IJX B;  4JBZ A;  3S9M C;  1B3E A;  3SEV A;  1MXX A;  2E0S A;  4H67 A;  1GVC A;  2P0S A;  4QFP A;  5I2N B;  2H25 A;  5DEX B;  3QK6 A;  5BUU A;  3SKP A;  5AA4 B;  3MPK A;  3SET A;  4BDO A;  1CE2 A;  2RF1 A;  1URD A;  2Q2C A;  2O84 X;  1LB8 A;  5CBR A;  2RC8 A;  2UYF A;  5H8N B;  1OVB A;  1LFH A;  3H7M A;  4POW A;  1JW1 A;  1MY2 A;  2DOJ A;  3PUX E;  3TFL A;  3PUW E;  2VD2 A;  3ZKL A;  2NUV A;  3PPR A;  3PUV E;  4GXA A;  5K2Y A;  4IO7 A;  3KG2 A;  1LBC A;  1MPC A;  4N07 A;  1WDN A;  2PT2 A;  4P11 A;  4U1Z A;  1SYI A;  4UAC A;  1MH4 A;  5KDT B;  3U72 A;  3H4Z A;  3VLV A;  3PPN A;  3T9X B;  4XKP A;  3M3K A;  1S9T A;  4EQ7 A;  1QUK A;  4DXB A;  3FVO A;  4BLA A;  4IO3 A;  2HAV A;  1MY4 A;  5KCJ A;  4FOR A;  3OXN A;  3RN8 A;  3K02 A;  3A3C A;  3IR1 A;  1UTH B;  3VXC A;  3WAE A;  3M8U A;  1O63 A;  3UOR A;  4JDF A;  2XX9 A;  4OFL A;  1NKX A;  2QMX A;  1NNK A;  4KR5 A;  1P99 A;  2GHB A;  2HQ0 A;  2GRV A;  1B3F A;  2HFB A;  5B70 A;  4R74 A;  4X9T A;  1SQY A;  2O7I A;  1JVX A;  4U23 A;  5FTI A;  3LSF B;  1GV8 A;  2H99 A;  3OOA A;  2Q9T A;  3C35 A;  1N7W A;  4OTE A;  2NXO A;  5JK4 A;  5FHN A;  1AL3 A;  1XS5 A;  2UVH A;  3N6T A;  1UIV A;  2R6G E;  3CI8 A;  1LST A;  3MWB A;  3EHT A;  1SVX B;  3HO7 A;  3EHU A;  4U2R A;  3UIF A;  4R75 A;  1TT1 A;  2LAO A;  1B7H A;  1D4N A;  3PPO A;  4IO2 A;  1SDX A;  3RY3 A;  5I59 B;  4JXI A;  4O3A A;  4Z7E A;  1ZLQ A;  3QXM A;  4QSD A;  5DTB A;  4TLL B;  4GF8 A;  2QSX A;  2ZXT A;  1M5C A;  1MS7 A;  1PBQ A;  4GIZ A;  1ZIU A;  1ZMG A;  2HEU A;  3OD7 A;  4LQ5 A;  4PFT A;  5CC2 A;  3TTM A;  4YU0 A;  3TEP A;  1I6B A;  4ELR A;  2O1L A;  4OEV A;  4F3S A;  1FW0 A;  3G3H A;  4RNS A;  1MY3 A;  3SEW A;  2DWJ A;  5HM4 B;  5A5X A;  4LZ8 A;  4PFW A;  4XKR A;  2B3B A;  4R2F A;  2XHD A;  3OO8 A;  2DYX A;  2F78 A;  3ZSF A;  2Z23 A;  1BLF A;  3SEU A;  1O7T A;  4ISU A;  2F35 A;  4F2Q A;  1TXF A;  3KOS A;  4Z0I A;  3I6V A;  1SW2 A;  5CMC A;  4LZ5 A;  4Q30 B;  3UN6 A;  3B6T A;  4ELP A;  3Q27 A;  1MXW A;  1PDA A;  3G3G A;  1RYX A;  1IXC A;  2I4B A;  5HBC A;  1DOT A;  4AB6 A;  3C9H A;  3H06 B;  5L9O A;  3CVG A;  3USD A;  3ILU B;  3PD9 A;  3FD3 A;  1UIU A;  3RT8 A;  4GFR A;  1R1N A;  3G3K A;  3H6T A;  3THI A;  4LUB A;  4EQB A;  1QUJ A;  4NF6 A;  3OEK A;  2RKM A;  4POX A;  1UTB B;  4MH5 A;  2DWI A;  1JVY A;  3O9P A;  4EQ9 A;  1B9J A;  3KFM A;  2Q2A A;  3G3F A;  3O6I A;  2NVU B;  1VE4 A;  4PP0 A;  2PVU A;  4YZZ A;  4H6D A;  4ZE8 A;  1BTJ A;  3JZJ A;  4BDN A;  5JTY A;  4G68 B;  5FHO A;  3OO7 A;  3DM0 A;  3PUY E;  1A40 A;  3EPE A;  4EF2 A;  1BIY A;  4EXK A;  4EDP A;  2XD2 A;  1JET A;  2Z22 A;  1QKA A;  1XVY A;  4K3F A;  1VSO A;  2NWJ A;  3IL1 B;  1H44 A;  3FVG A;  4YKJ A;  4JB7 A;  5EYF A;  4R6K A;  3PPP A;  1NL5 A;  3FXQ A;  4MFI A;  5CRY A;  1PBP A;  1A7L A;  4JSO A;  1A55 A;  1MM6 A;  5I2K B;  3TTN A;  4XIG Q;  1FTM A;  4H1X A;  1N76 A;  1US4 A;  1ATG A;  3LR1 A;  4P0I A;  2F7A A;  3B6Q A;  1M5E A;  3RTW B;  3TCF A;  5I56 B;  3IB0 A;  5H8Q B;  1EH3 A;  2Z8E A;  4GL8 A;  1FQD A;  5I58 A;  3PD8 A;  3R6U A;  2A5T A;  3RTF B;  2DE3 A;  3KSJ A;  1NNT A;  4X1D A;  1B1X A;  3MP1 A;  3OO9 A;  4NF4 B;  1S7Y A;  2Y7K A;  3TDJ A;  3TCH A;  1B3L A;  4YB7 A;  3MBP A;  4R73 A;  5H8F B;  4XKQ A;  1LLS A;  1OLA A;  1TWY A;  3P7I A;  2OLB A;  3T96 B;  2V25 A;  5B7D A;  1WOD A;  3WAF A;  3VLU A;  2XXU A;  3V5A A;  4OER A;  4KYS A;  3S9N C;  3H3G A;  5KZT A;  1DPP A;  1MXY A;  3KN3 A;  4MLQ A;  4BDL A;  1OIB A;  3CG3 A;  4ELO A;  2PT1 A;  2WKY A;  4P0G A;  1MQI A;  5EHS A;  1ANF A;  4NWD A;  3PUZ E;  1BP5 A;  5CI5 A;  1OQG A;  3FJ7 A;  3C33 A;  2GFE A;  3T93 B;  3IAZ A;  4KI0 E;  5H8H B;  1IQ7 A;  3HPI A;  2P1S A;  1N7X A;  2DE2 A;  3O6H A;  3ONM A;  2DP8 A;  2QPQ A;  2NOO A;  3K6U A;  5CBS A;  4IB2 A;  3VXB A;  5AA2 A;  4PQJ A;  4DXC A;  3U8Q A;  4X48 A;  3VVE A;  2I0B A;  3K0V A;  1YTV A;  3GBA A;  1IIW A;  3TKD A;  4U4X A;  1GGG A;  3CRB A;  1B3H A;  3KOT A;  3SEX A;  4H8I A;  1MY1 A;  1QUL A;  1QVS A;  1EU8 A;  1RYO A;  1DSN A;  2CMO A;  2FYI A;  3TTR A;  3RQT A;  5FHM A;  1SI0 A;  3FUZ A;  3L6G A;  2YPN A;  3MC2 A;  3Q29 A;  3N94 A;  4GRK A;  2ONR A;  3IB1 A;  5J1D A;  4HCY A;  5DVI A;  4KFQ A;  2BJJ X;  1FQC A;  3DP6 A;  5DT6 A;  1SI1 A;  3TOD A;  1B5J A;  3G3I A;  4ESX A;  2PYY A;  1SW5 A;  3K01 A;  4YB5 A;  3TEL A;  2Q89 A;  2A5S A;  3T22 A;  2THI A;  5IAI A;  1LCF A;  3MZ1 A;  2XD3 A;  4TOZ A;  3CR9 A;  2UXA A;  3HST A;  3SEY A;  2HZK A;  3CIJ A;  4PE5 B;  2I6E A;  4R72 A;  5ITP A;  3O6G A;  3HN0 A;  1R9L A;  4IGT A;  4ZEI A;  1QUI A;  3OEM A;  4Q8R A;  4YMA A;  1IXG A;  1IXH A;  5AA1 A;  1P1W A;  1ZU0 A;  3Q25 A;  5L9M A;  3MUQ A;  4R9G A;  3PGF A;  3FXR A;  3R7X A;  4DDD A;  5AA2 D;  2ZYN A;  2XXW A;  2GHA A;  4ND9 A;  3TTK A;  1H45 A;  3MW0 A;  3LUY A;  2FA7 A;  2W7Y A;  4Q0C A;  3G3J A;  3O97 A;  4NF8 A;  2DWH A;  1NMU A;  1DTG A;  2V3Q A;  3DP8 A;  4ZZE A;  2QS1 A;  2D5W A;  3OMB A;  4I1D A;  4FE8 A;  2FNC A;  4DLD A;  4MF3 A;  3GLB A;  4OMB A;  2QS4 A;  3UP9 A;  3R26 A;  4I9D A;  1SBP A;  1QJM A;  3MQ9 A;  2O6A A;  3D4C A;  1GTK A;  1MQD A;  3Q28 A;  1R9Q A;  3OEN A;  3K4U A;  1ZJL A;  2VOZ A;  2ZYM A;  1NNP A;  1D3K A;  1JW5 A;  4R6H A;  1NH8 A;  1P1O A;  1CB6 A;  1PEB A;  4NMY A;  3MPL A;  3MVX A;  2VGQ A;  1M5D A;  2I48 A;  2HXW A;  4YMB A;  1B58 A;  5IKB A;  2IEE A;  3A3U A;  3W9W A;  1TFD A;  1Y3N A;  1IEJ A;  2XX8 A;  3TQL A;  5I2N A;  4WKM A;  5DEX A;  5AA4 A;  4ECF A;  2ONK E;  2RC9 A;  4HS7 A;  1J1N A;  4QSE A;  4QRZ A;  5AA3 A;  3FAT A;  1B2H A;  1EZ9 A;  4IGR A;  5H8N A;  1M5B A;  3JYR A;  3I5O A;  1SW4 A;  1RKM A;  4AQ4 A;  2F7B A;  3TAJ A;  5M2V A;  3Q26 A;  2F97 A;  4F3G A;  4QFO A;  4OEU A;  3DLN A;  4GOT A;  4F18 A;  5CMB A;  3C36 A;  1B52 A;  2P2A A;  3FZV A;  1P1U A;  3IB2 A;  1AOV A;  4C1T A;  1MQH A;  1MH3 A;  3IO6 A;  4KHZ E;  5KDT A;  3IK6 B;  1POY 1;  5JEI A;  1Y1Z A;  3N26 A;  4RK9 A;  4IO4 A;  3S9E A;  1MXV A;  2AIX A;  4H5G A;  2ANJ A;  1N0T A;  1FQB A;  4H65 A;  5TPA B;  1MQJ A;  4FAT A;  4GXS B;  1NFT A;  4QFL A;  3FV2 A;  4N13 A;  1FTJ A;  1A54 A;  2XXP A;  3OO6 A;  3OEL A;  5CMK A;  4DZ1 A;  1O64 A;  3LBS A;  4WXJ A;  1SW1 A;  3H6W A;  3E13 X;  1B3G A;  4ZEC A;  3FVK A;  1EZO A;  4XXU A;  1ZKB A;  4FIM A;  2OWS A;  4G8M A;  2Y84 A;  2OWT A;  2F36 A;  4M1V A;  4TLM B;  1DMB A;  1S50 A;  2F34 A;  1LAH E;  2UVJ A;  3CFX A;  1B6H A;  4YIC A;  2O68 A;  3OSR A;  3K1P A;  5BWJ A;  5I59 A;  3PMV A;  3VVF A;  5I57 A;  3TUS A; 
#chains in the Genus database with same CATH topology
 4F29 A;  3O29 A;  2OJT A;  2G93 A;  4LZ7 A;  3SER A;  4AS5 A;  1USY H;  3SES A;  2M8C A;  1TFA A;  1K9Z A;  1KA1 A;  4ZEK A;  3RYD A;  1FBE A;  5ITO A;  4OVR A;  1SD3 A;  1ZBM A;  3QAX A;  2QMW A;  2ABH A;  1RDX A;  2G29 A;  3LSL A;  1B5H A;  3M3F A;  4MNC A;  3BFT A;  5CMM A;  2OK2 A;  3PMW A;  1B51 A;  3M3L A;  5ESY A;  1NV2 A;  3D1R A;  2VP1 A;  2V3T A;  3T9V A;  4JSD A;  4G4P A;  2REJ A;  1Y20 A;  2DSF A;  1LAX A;  2HXR A;  2ZYK A;  1B05 A;  4N17 A;  5ISU A;  4R2B A;  4OWD A;  4P1L A;  4P9K A;  4EF1 A;  4IY6 A;  5AA2 B;  3V8X B;  1LCT A;  1NV4 A;  3QUJ A;  2PFZ A;  3RT6 B;  2ZMB A;  5F7V A;  4FEB A;  3F11 A;  1VFD A;  1DTZ A;  1FBD A;  3RPL B;  4X04 A;  1XVX A;  4ZEB A;  4PAI A;  3EF7 A;  4JWX A;  3LV0 A;  1LB9 A;  2B65 A;  5TP9 B;  1Y4C A;  1FPK A;  3ODB A;  4OFJ A;  3QSL A;  4OFO A;  3EHS A;  3FJM A;  1UTB A;  1UQW A;  3PMX A;  1OMP A;  2D21 A;  4DIG A;  2ZYO A;  5DVJ A;  1FTO A;  2V84 A;  1Z7N E;  2DWA A;  1MDP 1;  5A5L A;  2P3V A;  4LA9 A;  3H6V A;  1FTK A;  1JW4 A;  4HE1 A;  4G68 A;  1LAG E;  2Z8F A;  2DDK A;  4R6Y A;  1B1H A;  4ZS9 A;  3TTL A;  4PBQ A;  3BKI B;  3KEI A;  4U21 A;  4ESW A;  5LDZ A;  3CFL A;  2XWI A;  2CZH A;  1R6Z A;  1IME A;  4DCY A;  3ZS6 A;  5I7I A;  4F19 A;  4ZDM A;  1MRP A;  3MYU A;  3VDF A;  1D9V A;  3QIM A;  4GWO A;  4TQU Q;  4ZED A;  4JWY A;  3IO4 A;  3MZB A;  1VR5 A;  2IA4 A;  1USY E;  5F1Q A;  4I62 A;  1FJ9 A;  2Y7I A;  2F5X A;  3EQ1 A;  1T0K A;  3TYH A;  4PGP A;  1PB8 A;  2YLN A;  3IOU A;  4P56 A;  1FQF A;  1JQF A;  1N84 A;  1ELJ A;  3RGY A;  5DYH A;  1AIV A;  5I2K A;  4KCD A;  4NED A;  1FBG A;  3RLF E;  4QHQ A;  4JVC A;  4GWS A;  2O7U A;  5I56 A;  2ALU A;  2UYE A;  2OBG A;  1P1Q A;  3S2V A;  2YJP A;  4QBA A;  1MPB A;  3CSG A;  4E0X A;  2DQV A;  2WEF A;  3KJ7 A;  3L6H A;  3MJN A;  3B7D A;  4N81 A;  5KCJ B;  4IO5 A;  2I3W A;  2QS2 A;  1FQA A;  1FCK A;  3KBZ A;  3CFZ A;  2ZNU A;  1N3W A;  5H8S A;  3TPA A;  1B5I A;  3VVD A;  4NF4 A;  2RC7 A;  3KN7 A;  4OZ9 A;  4UA8 A;  3QYT A;  3VFJ A;  5H8F A;  4XKN A;  3V83 A;  3E4R A;  1FBC A;  4NTL A;  3BIH A;  4KPT A;  2UVG A;  1AWB A;  2VPO A;  2F8D A;  1DCU A;  4PFR A;  3ECR A;  1Z7M E;  3MVZ A;  4DXU A;  4DCX A;  2QL3 A;  1LFI A;  2Y7R A;  2Y5K A;  4OYV A;  3C34 A;  2RIN A;  1FQE A;  1LBB A;  1YXI A;  4MAG A;  4THI A;  2CEX A;  4PFU A;  2DVZ A;  2XXV A;  1M5F A;  3PU5 A;  3EN3 A;  4NF5 A;  3ROJ A;  4RPN A;  1Y3Q A;  4ZE9 A;  2B3F A;  4PCD A;  3KJT A;  1IUD A;  4YKP A;  4RA1 A;  4E0W A;  2DXR A;  3IOW A;  3IOV A;  5EQ9 A;  2VHA A;  5H8H A;  3U65 A;  3C32 A;  4XTC Q;  3IFC A;  4MLV A;  4PET A;  3TQW A;  3OSQ A;  1XOC A;  4F3B A;  3K2D A;  2H9B A;  1N04 A;  2HZL A;  4PFY A;  2DS9 A;  3S4U A;  5CM6 A;  4H5F A;  1QW0 A;  2OX3 A;  3IJO B;  1N3X A;  5IM2 A;  1B40 A;  5K2X A;  1A8E A;  3VV5 A;  2I0C A;  4DE8 A;  5A5X B;  3CHG A;  1NH7 A;  3T9U A;  3K6V A;  1OLC A;  2HCA A;  4G8H A;  4GVO A;  2UVI A;  4LAT A;  4H8J A;  1FPI A;  4N91 A;  1FBH A;  2WBB A;  1POT A;  1B32 A;  3G7W A;  3K00 A;  2F6P A;  1A99 A;  1YZ0 A;  3BBR A;  1NNF A;  4WED A;  1JEU A;  3DEL B;  4HW8 A;  3K1M A;  4NE4 A;  4F2O A;  1LBZ A;  4RXL A;  4U1O A;  2ESN A;  2Y7W A;  3W9V A;  3DP4 A;  2GH9 A;  1IXI A;  5TU0 A;  2O69 A;  2E1S A;  4F22 A;  3MAM A;  3QMF A;  1MDQ A;  3K6W A;  5ICT A;  3U1O A;  3IX1 A;  3O66 A;  4H0W A;  1NUZ A;  4O3C A;  3RUM A;  3A29 A;  3V89 B;  1SYH A;  4NN3 A;  3ISP A;  2XWV A;  4RPO A;  4IY5 A;  4NF6 B;  3HFU A;  1HSE A;  1Q35 A;  1MQG A;  1NV5 A;  1ZTY A;  1YPN A;  2AL4 A;  2D3I A;  3K6X A;  2OCU A;  3O28 A;  2Z8D A;  4YKI A;  5FBP A;  5I84 A;  3KBR A;  5I57 B;  2V3U A;  4NWC A;  2QFL A;  1RDZ A;  5ELV A;  1BKA A;  2XXY A;  3KZG A;  2WX9 A;  4F39 A;  4BDQ A;  2VPN A;  5JTY B;  1QKB A;  5ET5 A;  2QVU A;  1AMF A;  2ONS A;  5IZ1 A;  1UTH A;  3PV0 E;  1IZ1 A;  3K1N A;  2QRY A;  3IOT A;  4MCO A;  4RJZ A;  2X7Q A;  3MST A;  3HHG A;  1H76 A;  4WEP A;  4P47 A;  4EXL A;  1MXZ A;  3KN8 A;  3UK4 A;  1NUW A;  3N5L A;  3HV1 A;  1PB9 A;  1MPD A;  1LAF E;  4O3B A;  1B4H A;  5LTC A;  2O1M A;  3SDF A;  4GQO A;  4X1B A;  5EHM A;  2PMS A;  4MBP A;  2DE4 A;  4QF9 A;  4LON B;  2O51 A;  4JWO A;  4G77 A;  1EZP A;  4ONY A;  4G8N A;  1MY0 A;  3C31 A;  4U4S A;  1JP4 A;  4GLI A;  4OHN A;  2BJI A;  1H3D A;  1OQH A;  2X7P A;  2CZI A;  2REG A;  1HSJ A;  4OVJ A;  4M4G A;  5AE4 A;  4C0R A;  3MP6 A;  2VT5 A;  1US5 A;  2KLF A;  3TZA A;  1Y3P A;  4OA4 A;  4IR8 A;  1H43 A;  2V93 A;  3MZ9 A;  2H5Y A;  2XX7 A;  4FEC A;  3LSW A;  5I58 B;  4QFK A;  1Y1M A;  3H6U A;  1LFG A;  3U93 A;  3T9H B;  2A5T B;  3LC8 A;  5L8D A;  1B4Z A;  4BDM A;  5HPQ A;  2Q88 A;  3KSX A;  4G2Z A;  1MG1 A;  2I4C A;  3U92 A;  2WYP A;  1WVJ A;  2F6G A;  3H03 A;  1JNF A;  3E9X A;  4YB6 A;  3GXA A;  2RCB A;  2QVV A;  4F1Y A;  2WYK A;  2I58 A;  1F9B A;  2XWK A;  4G68 C;  4ZEF A;  4OAN A;  1Y9U A;  2ZNS A;  2Q74 A;  2F7C A;  3T66 A;  3T1B A;  4OXV A;  3MVY A;  2H98 A;  4KCC A;  2FHY A;  5DW8 A;  4GL0 A;  2DVC A;  3FJG A;  4GX6 A;  2Q8J A;  5TPA A;  3GBB A;  1B46 A;  4R9F A;  2X26 A;  4PAF A;  1B7Z A;  5ICQ A;  1CNQ A;  2CZK A;  1B7U A;  1NV0 A;  4FBP A;  4RYA A;  1LBW A;  3VE1 B;  1DK4 A;  3A09 A;  4OES A;  5L9S A;  1GR2 A;  3MP8 A;  1A8F A;  4L17 A;  4F31 B;  5LOM A;  3T0J A;  1LGB C;  4F3P A;  1XC1 A;  3PPQ A;  1I6Q A;  3FXU A;  3NOH A;  2RCA A;  1II5 A;  4N6K A;  1XT8 A;  1XHY A;  3ILT B;  4N6P A;  1MXU A;  3MVW A;  3HCQ A;  4JVI A;  4FJP A;  1URG A;  2XXX A;  4KYD A;  1DPE A;  2H4I A;  4QSC A;  4Q5T A;  3TCG A;  2QS3 A;  4HCW A;  2DXY A;  3CG1 A;  3RNN A;  4QFN A;  2HHM A;  3W15 C;  3FV1 A;  1HSL A;  5DVF A;  3D4G A;  3IOR A;  4ZZA A;  4KD5 A;  4FED A;  1Q1K A;  1KWH A;  4LP2 B;  1JEV A;  4RY1 A;  3E3K A;  3BFU A;  2ZZV A;  4U22 A;  1L5T A;  2PBW A;  4H45 A;  2I3V A;  3O2A A;  1IMD A;  3LSX A;  4I8C A;  3UA8 A;  3FGS A;  1MM7 A;  1FSA A;  1IIT A;  1URS A;  3QUF A;  3TMG A;  5IZ3 B;  4PC9 A;  1I69 A;  3JV9 A;  3ZKK A;  4RK2 A;  2XXI A;  4KYE A;  1P1N A;  2OZZ A;  4AB5 A;  5I5P A;  1VFE A;  3HHF A;  4PAK A;  2R71 A;  4DI3 D;  1D9Y A;  1OVT A;  3CSB A;  4FAJ A;  4C1U A;  4OEN A;  2AYS A;  2PX1 A;  2QVR A;  2HAU A;  2I49 A;  2XXR A;  1YCJ A;  4GD5 A;  3I3V A;  2VD3 A;  3VLW A;  3B6W A;  4MJO A;  4LQ2 A;  4NF5 B;  3GZG A;  3C4M A;  3FVN A;  4OET A;  1FPE A;  3RPW A;  1AH5 A;  1EYJ A;  1LBV A;  2XXH A;  4LVQ A;  3FAS A;  3N6U A;  3KGC A;  3U94 A;  1PC3 A;  4IO6 A;  5H8Q A;  4KQP A;  1FTL A;  2CZL A;  4NF8 B;  2XXT A;  4OQO A;  4BDR A;  3FIR A;  4YAH X;  1Y4T A;  1B0L A;  2R9J A;  4F1V A;  3LUZ A;  3GYY A;  3E79 A;  1B0H A;  3AXF A;  4HTG A;  5FTH A;  4G61 A;  1FPL A;  3RPL A;  2ZZX A;  2XXQ A;  2Y7P A;  1I6A A;  5ET6 A;  2QJE A;  3S9L C;  4EUO A;  1YAE A;  1G0H A;  5TP9 A;  4YKK A;  4OVT A;  2ZNT A;  2HPG A;  4PDH A;  4F1U A;  3UGW A;  1PB7 A;  4ELQ A;  2AL5 A;  3IJX B;  4JBZ A;  5EQ7 A;  3S9M C;  1B3E A;  3SEV A;  1MXX A;  2E0S A;  4H67 A;  1GVC A;  2P0S A;  4QFP A;  5I2N B;  2H25 A;  5DEX B;  3QK6 A;  3SKP A;  5AA4 B;  5BUU A;  3MPK A;  3SET A;  4BDO A;  1CE2 A;  4NHB A;  1LEV A;  2RF1 A;  1URD A;  2Q2C A;  1KA0 A;  1QGX A;  2O84 X;  1LB8 A;  5CBR A;  2RC8 A;  2UYF A;  5H8N B;  1OVB A;  4NG7 A;  1LFH A;  3H7M A;  4POW A;  1JW1 A;  1MY2 A;  4NAP A;  2DOJ A;  3PUX E;  3TFL A;  3PUW E;  2VD2 A;  3ZKL A;  2NUV A;  3PPR A;  3PUV E;  4GXA A;  5K2Y A;  4IO7 A;  3KG2 A;  1LBC A;  1MPC A;  4N07 A;  4O94 A;  1WDN A;  1VDW A;  1EYK A;  1Q9D A;  2PT2 A;  4P11 A;  4U1Z A;  1SYI A;  4UAC A;  1MH4 A;  5KDT B;  3U72 A;  3H4Z A;  3VLV A;  3PPN A;  3T9X B;  3PTY A;  4XKP A;  3M3K A;  1S9T A;  4P1E A;  5ET8 A;  4EQ7 A;  1QUK A;  4DXB A;  2P3N A;  3FVO A;  4BLA A;  4IO3 A;  2HAV A;  1MY4 A;  5KCJ A;  5EYG A;  4FOR A;  3OXN A;  3RN8 A;  3K02 A;  3A3C A;  4OVP A;  3IR1 A;  1UTH B;  3VXC A;  3WAE A;  1XI6 A;  3M8U A;  1O63 A;  3UOR A;  4JDF A;  1NV6 A;  2XX9 A;  4OFL A;  1NKX A;  2QMX A;  1NNK A;  4KR5 A;  1NUX A;  1IMA A;  1P99 A;  2GHB A;  2HQ0 A;  2GRV A;  1B3F A;  1FPB A;  4PTK A;  2HFB A;  5B70 A;  4R74 A;  4X9T A;  1SQY A;  1FPJ A;  4O7I A;  3BIG A;  4PDD A;  2O7I A;  1JVX A;  4U23 A;  5FTI A;  3LSF B;  1GV8 A;  2H99 A;  4MX6 A;  3OOA A;  2Q9T A;  3C35 A;  1N7W A;  4OTE A;  2NXO A;  2FIX A;  4O8M A;  4OVS A;  5JK4 A;  5FHN A;  1AL3 A;  1XS5 A;  2UVH A;  4I40 A;  3N6T A;  1IMC A;  1UIV A;  2R6G E;  3CI8 A;  2FBP A;  1LST A;  3MWB A;  3EHT A;  1SVX B;  3HO7 A;  3EHU A;  4U2R A;  3UIF A;  4R75 A;  1TT1 A;  2L5V A;  2LAO A;  4N8G A;  1B7H A;  4LN5 A;  1D4N A;  1FPD A;  3PPO A;  4IO2 A;  1FPG A;  2B4M A;  1SDX A;  3RY3 A;  5I59 B;  4JXI A;  5F24 A;  4O3A A;  4Z7E A;  1ZLQ A;  3EKI A;  3QXM A;  4QSD A;  5DTB A;  4TLL B;  3KC0 A;  4GF8 A;  2QSX A;  2ZXT A;  1M5C A;  1MS7 A;  1PBQ A;  4GIZ A;  1ZIU A;  1ZMG A;  2HEU A;  3OD7 A;  4LQ5 A;  4PFT A;  5CC2 A;  4MHF A;  3TTM A;  4YU0 A;  5EQ8 A;  3TEP A;  1I6B A;  4HE2 A;  4ELR A;  2V4C A;  2O1L A;  4OEV A;  4F3S A;  1FW0 A;  3G3H A;  4RNS A;  2F3B A;  1MY3 A;  4HXV A;  3SEW A;  2DWJ A;  5HM4 B;  2F3D A;  5A5X A;  4LZ8 A;  4PFW A;  4XKR A;  4UAB A;  2B3B A;  4R2F A;  2XHD A;  3OO8 A;  2B4L A;  2DYX A;  2F78 A;  4OVQ A;  3ZSF A;  4GWW A;  1FJ6 A;  5ET7 A;  2Z23 A;  1BLF A;  3SEU A;  1O7T A;  4ISU A;  4PF8 A;  2F35 A;  4F2Q A;  1TXF A;  3KOS A;  4Z0I A;  3I6V A;  1SW2 A;  5CMC A;  4LZ5 A;  4Q30 B;  3UN6 A;  3B6T A;  4ELP A;  3Q27 A;  1MXW A;  1PDA A;  3G3G A;  2XXK A;  1RYX A;  1IXC A;  2I4B A;  5HBC A;  1DOT A;  1YYZ A;  4PF6 A;  4XFE A;  4AB6 A;  3C9H A;  3H06 B;  5L9O A;  1FPF A;  3CVG A;  4PBH A;  3USD A;  2GQ1 A;  3ILU B;  3PD9 A;  3FD3 A;  5J16 A;  1UIU A;  3RT8 A;  4GFR A;  1R1N A;  3G3K A;  4N4U A;  2Y5L A;  3H6T A;  3THI A;  4LUB A;  4EQB A;  1QUJ A;  4NF6 A;  3OEK A;  2RKM A;  5EYH A;  4PE3 A;  4POX A;  1UTB B;  4MH5 A;  2DWI A;  1JVY A;  3O9P A;  4EQ9 A;  1B9J A;  3KFM A;  4P8B A;  3FBP A;  2Q2A A;  3G3F A;  3O6I A;  2NVU B;  1VE4 A;  4PP0 A;  2PVU A;  4YZZ A;  4H6D A;  4ZE8 A;  1BTJ A;  3JZJ A;  4BDN A;  5JTY A;  4G68 B;  5FHO A;  3OO7 A;  3DM0 A;  3PUY E;  3SZP A;  2KR0 A;  1A40 A;  3EPE A;  4PGN A;  4EF2 A;  1NV3 A;  1BIY A;  4H46 A;  1NV7 A;  4EXK A;  4EDP A;  2XD2 A;  1JET A;  2Z22 A;  4XEQ A;  1QKA A;  2R8T A;  4PFB A;  1XVY A;  4K3F A;  1VSO A;  2NWJ A;  3IL1 B;  1H44 A;  3FVG A;  4YKJ A;  4GWY A;  2WBD A;  4JB7 A;  5EYF A;  4R6K A;  3PPP A;  1NL5 A;  3FXQ A;  4MFI A;  5CRY A;  1PBP A;  1A7L A;  4JSO A;  1A55 A;  1MM6 A;  5I2K B;  2FIE A;  3TTN A;  4XIG Q;  1FTM A;  4DI4 B;  4H1X A;  1N76 A;  1US4 A;  1ATG A;  3LR1 A;  4P0I A;  2F7A A;  3B6Q A;  1M5E A;  3RTW B;  2OWZ A;  3TCF A;  5I56 B;  3B50 A;  3IB0 A;  5H8Q B;  1EH3 A;  2Z8E A;  4GL8 A;  4X8R A;  1FQD A;  5I58 A;  3PD8 A;  2FVZ A;  3R6U A;  4N15 A;  2A5T A;  5I3S A;  3RTF B;  2DE3 A;  2CEY A;  3KSJ A;  4XF5 A;  1NNT A;  4X1D A;  1B1X A;  3MP1 A;  3OO9 A;  4NF4 B;  1FRP A;  1S7Y A;  2Y7K A;  3TDJ A;  3TCH A;  1B3L A;  4YB7 A;  3MBP A;  4R73 A;  5H8F B;  4XKQ A;  1LLS A;  1OLA A;  1TWY A;  3P7I A;  2OLB A;  3T96 B;  4NX1 A;  2V25 A;  5B7D A;  4GX3 A;  4MMP A;  1WOD A;  4NF0 A;  3WAF A;  3VLU A;  2XXU A;  3V5A A;  4OER A;  4MIJ A;  4KYS A;  3S9N C;  3H3G A;  5KZT A;  5T3J A;  1DPP A;  1MXY A;  3KN3 A;  4MLQ A;  4BDL A;  1EYI A;  1OIB A;  3CG3 A;  4ELO A;  2PT1 A;  2WKY A;  4P0G A;  1MQI A;  5EHS A;  1ANF A;  4NWD A;  3PUZ E;  1BP5 A;  5CI5 A;  1OQG A;  3FJ7 A;  1RDY A;  1INP A;  3C33 A;  2GFE A;  3T93 B;  4O7M A;  3IAZ A;  4KI0 E;  4N8Y A;  5H8H B;  1IQ7 A;  4N6D A;  3HPI A;  2P1S A;  1N7X A;  2DE2 A;  3O6H A;  3ONM A;  2DP8 A;  2QPQ A;  2NOO A;  3K6U A;  5CBS A;  4IB2 A;  3VXB A;  5AA2 A;  4PQJ A;  4DXC A;  3U8Q A;  4X48 A;  3VVE A;  2I0B A;  3K0V A;  1YTV A;  3GBA A;  1IIW A;  1KZ8 A;  2PFY A;  3TKD A;  4U4X A;  1GGG A;  3CRB A;  1B3H A;  3KOT A;  3SEX A;  4H8I A;  1MY1 A;  1QUL A;  1QVS A;  4MEV A;  1EU8 A;  1RYO A;  1DSN A;  2CMO A;  2FYI A;  3TTR A;  3RQT A;  1IMF A;  5FHM A;  1SI0 A;  3FUZ A;  3L6G A;  2YPN A;  3MC2 A;  3Q29 A;  1NI9 A;  3N94 A;  2MKZ A;  4GRK A;  2ONR A;  3IB1 A;  5J1D A;  4HCY A;  5DVI A;  4KFQ A;  2BJJ X;  4I3E A;  1FQC A;  3DP6 A;  2XWO A;  5DT6 A;  1SI1 A;  5IZ3 A;  3TOD A;  1B5J A;  3G3I A;  3FXB A;  4ESX A;  2PYY A;  1SW5 A;  3K01 A;  4YB5 A;  3TEL A;  2Q89 A;  2A5S A;  3T22 A;  2THI A;  5IAI A;  1LCF A;  3MZ1 A;  4KXP A;  2XD3 A;  4TOZ A;  3CR9 A;  1LBY A;  2UXA A;  3HST A;  3SEY A;  1IMB A;  1SPI A;  2HZK A;  3CIJ A;  4PE5 B;  2I6E A;  4R72 A;  5ITP A;  3O6G A;  3HN0 A;  1R9L A;  4IGT A;  4ZEI A;  1QUI A;  3OEM A;  4Q8R A;  4YMA A;  1IXG A;  1IXH A;  1D9Q A;  5IZZ A;  5AA1 A;  3IFA A;  2XA5 A;  1P1W A;  1ZU0 A;  3Q25 A;  5L9M A;  3MUQ A;  4R9G A;  3PGF A;  3FXR A;  3R7X A;  4DDD A;  5AA2 D;  2ZYN A;  4QXD A;  2XXW A;  4I3Y A;  2PCR A;  5IGA A;  2GHA A;  4ND9 A;  3TTK A;  1H45 A;  3MW0 A;  3LUY A;  2FA7 A;  2W7Y A;  1NV1 A;  2Q8M A;  4Q0C A;  3G3J A;  1DBZ A;  3O97 A;  4NF8 A;  2DWH A;  1NMU A;  1DTG A;  2V3Q A;  3DP8 A;  4ZZE A;  2QS1 A;  2D5W A;  3OMB A;  4GX4 A;  4I1D A;  4FE8 A;  2FNC A;  4DLD A;  4MF3 A;  4NQ8 A;  3GLB A;  4OMB A;  1FTA A;  2QS4 A;  3UP9 A;  3R26 A;  4MNI A;  4GWU A;  4I9D A;  1SBP A;  1QJM A;  2JJK A;  3MQ9 A;  2O6A A;  3D4C A;  1GTK A;  1MQD A;  4HE0 A;  3Q28 A;  1R9Q A;  1NUY A;  3OEN A;  3K4U A;  1ZJL A;  2VOZ A;  2ZYM A;  1NNP A;  1D3K A;  1JW5 A;  4R6H A;  1NH8 A;  4JVD A;  1P1O A;  1CB6 A;  1G0I A;  1PEB A;  4NMY A;  3MPL A;  3MVX A;  2VGQ A;  1M5D A;  2I48 A;  2HXW A;  4YMB A;  1B58 A;  5IKB A;  4GBW A;  2IEE A;  3A3U A;  3W9W A;  3E78 A;  1TFD A;  1Y3N A;  1IEJ A;  2XX8 A;  3TQL A;  5I2N A;  4WKM A;  5DEX A;  5AA4 A;  4ECF A;  1K9Y A;  2ONK E;  1FBP A;  2RC9 A;  4HS7 A;  1J1N A;  4QSE A;  4QRZ A;  5AA3 A;  3FAT A;  1B2H A;  1EZ9 A;  4IGR A;  5H8N A;  1M5B A;  3JYR A;  3I5O A;  1SW4 A;  1RKM A;  4AQ4 A;  2F7B A;  3TAJ A;  5M2V A;  3Q26 A;  2F97 A;  4F3G A;  4NGU A;  2KQZ A;  4QFO A;  4OEU A;  5EQA A;  3DLN A;  4GOT A;  4F18 A;  5CMB A;  3C36 A;  1B52 A;  2P2A A;  3FZV A;  1P1U A;  3IB2 A;  1AOV A;  4C1T A;  1MQH A;  1MH3 A;  3IO6 A;  4KHZ E;  5KDT A;  3IK6 B;  1POY 1;  4GWZ A;  5JEI A;  3KC1 A;  1Y1Z A;  3N26 A;  4RK9 A;  4IO4 A;  4PFI A;  3S9E A;  1MXV A;  2AIX A;  3B8B A;  4H5G A;  2ANJ A;  1N0T A;  1FQB A;  4H65 A;  5TPA B;  1MQJ A;  4FAT A;  4GXS B;  1NFT A;  4QFL A;  3FV2 A;  4N13 A;  1FTJ A;  1A54 A;  2XXP A;  3OO6 A;  3OEL A;  5CMK A;  4DZ1 A;  1O64 A;  3LBS A;  4WXJ A;  1SW1 A;  3H6W A;  3E13 X;  1B3G A;  4ZEC A;  4GBV A;  3FVK A;  4P3L A;  1EZO A;  4XXU A;  1ZKB A;  4FIM A;  1LBX A;  2OWS A;  4MNP A;  4G8M A;  4AS4 A;  1BK4 A;  2Y84 A;  2OWT A;  2F36 A;  4M1V A;  1FBF A;  4TLM B;  1DMB A;  1S50 A;  2F34 A;  1LAH E;  2UVJ A;  3CFX A;  1B6H A;  4YIC A;  4GWX A;  2O68 A;  3OSR A;  2ZZW A;  3K1P A;  5BWJ A;  5I59 A;  3PMV A;  3VVF A;  5I57 A;  3TUS A; 
#chains in the Genus database with same CATH homology
 4F29 A;  3O29 A;  2OJT A;  2G93 A;  4LZ7 A;  3SER A;  1USY H;  3SES A;  2M8C A;  1TFA A;  4ZEK A;  5ITO A;  1SD3 A;  1ZBM A;  3QAX A;  2QMW A;  2ABH A;  2G29 A;  3LSL A;  1B5H A;  3M3F A;  3BFT A;  5CMM A;  2OK2 A;  3PMW A;  1B51 A;  3M3L A;  2VP1 A;  2V3T A;  3T9V A;  4JSD A;  4G4P A;  2REJ A;  1Y20 A;  2DSF A;  1LAX A;  2ZYK A;  1B05 A;  5ISU A;  4R2B A;  4OWD A;  4EF1 A;  4IY6 A;  5AA2 B;  3V8X B;  1LCT A;  3QUJ A;  3RT6 B;  2ZMB A;  5F7V A;  4FEB A;  3F11 A;  1VFD A;  1DTZ A;  1XVX A;  4ZEB A;  3EF7 A;  4JWX A;  1LB9 A;  2B65 A;  5TP9 B;  1Y4C A;  3ODB A;  4OFJ A;  3QSL A;  4OFO A;  3EHS A;  3FJM A;  1UTB A;  1UQW A;  3PMX A;  1OMP A;  2D21 A;  4DIG A;  2ZYO A;  5DVJ A;  1FTO A;  2V84 A;  1Z7N E;  2DWA A;  1MDP 1;  4LA9 A;  3H6V A;  1FTK A;  1JW4 A;  4G68 A;  1LAG E;  2Z8F A;  4R6Y A;  1B1H A;  4ZS9 A;  3TTL A;  3BKI B;  3KEI A;  4U21 A;  4ESW A;  3CFL A;  1R6Z A;  4DCY A;  3ZS6 A;  4F19 A;  4ZDM A;  1MRP A;  3VDF A;  1D9V A;  3QIM A;  4GWO A;  4TQU Q;  4ZED A;  4JWY A;  3IO4 A;  3MZB A;  1VR5 A;  2IA4 A;  1USY E;  5F1Q A;  4I62 A;  2Y7I A;  2F5X A;  3EQ1 A;  1T0K A;  3TYH A;  1PB8 A;  2YLN A;  3IOU A;  1FQF A;  1JQF A;  1N84 A;  1ELJ A;  3RGY A;  5DYH A;  1AIV A;  5I2K A;  4KCD A;  4NED A;  3RLF E;  4QHQ A;  2O7U A;  5I56 A;  2ALU A;  2UYE A;  2OBG A;  1P1Q A;  3S2V A;  2YJP A;  1MPB A;  3CSG A;  4E0X A;  2DQV A;  3KJ7 A;  3L6H A;  3MJN A;  3B7D A;  5KCJ B;  4IO5 A;  2I3W A;  2QS2 A;  1FQA A;  1FCK A;  3CFZ A;  2ZNU A;  1N3W A;  5H8S A;  3TPA A;  1B5I A;  3VVD A;  4NF4 A;  2RC7 A;  3KN7 A;  4OZ9 A;  4UA8 A;  3QYT A;  3VFJ A;  5H8F A;  4XKN A;  3V83 A;  3E4R A;  4NTL A;  4KPT A;  2UVG A;  2F8D A;  3ECR A;  1Z7M E;  3MVZ A;  4DXU A;  4DCX A;  2QL3 A;  1LFI A;  2Y7R A;  4OYV A;  3C34 A;  2RIN A;  1FQE A;  1LBB A;  4THI A;  4PFU A;  2DVZ A;  2XXV A;  1M5F A;  3PU5 A;  3EN3 A;  4NF5 A;  4RPN A;  1Y3Q A;  4ZE9 A;  2B3F A;  3KJT A;  1IUD A;  4YKP A;  4RA1 A;  4E0W A;  2DXR A;  3IOW A;  3IOV A;  2VHA A;  5H8H A;  3C32 A;  4XTC Q;  4MLV A;  4PET A;  3TQW A;  3OSQ A;  1XOC A;  4F3B A;  3K2D A;  2H9B A;  1N04 A;  2HZL A;  4PFY A;  2DS9 A;  3S4U A;  5CM6 A;  4H5F A;  1QW0 A;  3IJO B;  1N3X A;  1B40 A;  5K2X A;  1A8E A;  3VV5 A;  2I0C A;  4DE8 A;  5A5X B;  1NH7 A;  3T9U A;  3K6V A;  1OLC A;  2HCA A;  4G8H A;  4GVO A;  2UVI A;  4LAT A;  4H8J A;  1POT A;  1B32 A;  3G7W A;  3K00 A;  2F6P A;  1A99 A;  3BBR A;  1NNF A;  4WED A;  1JEU A;  3DEL B;  4HW8 A;  3K1M A;  4NE4 A;  4F2O A;  4RXL A;  4U1O A;  2ESN A;  2Y7W A;  3W9V A;  3DP4 A;  2GH9 A;  1IXI A;  5TU0 A;  2O69 A;  2E1S A;  4F22 A;  3MAM A;  1MDQ A;  3K6W A;  5ICT A;  3U1O A;  3IX1 A;  3O66 A;  4H0W A;  4O3C A;  3RUM A;  3V89 B;  1SYH A;  4RPO A;  4IY5 A;  4NF6 B;  1HSE A;  1Q35 A;  1MQG A;  1ZTY A;  1YPN A;  2AL4 A;  2D3I A;  3K6X A;  2OCU A;  3O28 A;  2Z8D A;  4YKI A;  5I84 A;  3KBR A;  5I57 B;  2V3U A;  4NWC A;  5ELV A;  1BKA A;  2XXY A;  3KZG A;  4F39 A;  4BDQ A;  5JTY B;  1QKB A;  1AMF A;  2ONS A;  1UTH A;  3PV0 E;  1IZ1 A;  3K1N A;  2QRY A;  3IOT A;  4RJZ A;  2X7Q A;  3HHG A;  1H76 A;  4WEP A;  4EXL A;  1MXZ A;  3KN8 A;  3UK4 A;  3N5L A;  3HV1 A;  1PB9 A;  1MPD A;  1LAF E;  4O3B A;  1B4H A;  2O1M A;  3SDF A;  4GQO A;  4X1B A;  5EHM A;  2PMS A;  4MBP A;  2DE4 A;  4QF9 A;  4LON B;  2O51 A;  4JWO A;  4G77 A;  1EZP A;  4ONY A;  4G8N A;  1MY0 A;  3C31 A;  4U4S A;  4GLI A;  4OHN A;  1H3D A;  1OQH A;  2X7P A;  2REG A;  1HSJ A;  4OVJ A;  4M4G A;  5AE4 A;  4C0R A;  3MP6 A;  1US5 A;  2KLF A;  3TZA A;  1Y3P A;  1H43 A;  2V93 A;  3MZ9 A;  2H5Y A;  2XX7 A;  4FEC A;  3LSW A;  5I58 B;  4QFK A;  1Y1M A;  3H6U A;  1LFG A;  3U93 A;  3T9H B;  2A5T B;  3LC8 A;  5L8D A;  1B4Z A;  4BDM A;  5HPQ A;  2Q88 A;  3KSX A;  4G2Z A;  1MG1 A;  2I4C A;  3U92 A;  1WVJ A;  2F6G A;  3H03 A;  1JNF A;  3E9X A;  4YB6 A;  3GXA A;  2RCB A;  4F1Y A;  2I58 A;  1F9B A;  4G68 C;  4ZEF A;  1Y9U A;  2ZNS A;  2F7C A;  3T66 A;  4OXV A;  3MVY A;  2H98 A;  4KCC A;  4GL0 A;  2DVC A;  3FJG A;  2Q8J A;  5TPA A;  3GBB A;  1B46 A;  4R9F A;  2X26 A;  1B7Z A;  5ICQ A;  1B7U A;  4RYA A;  3VE1 B;  3A09 A;  4OES A;  5L9S A;  1GR2 A;  4F31 B;  3MP8 A;  1A8F A;  4L17 A;  5LOM A;  1LGB C;  4F3P A;  1XC1 A;  3PPQ A;  1I6Q A;  3FXU A;  2RCA A;  1II5 A;  1XT8 A;  1XHY A;  3ILT B;  4N6P A;  1MXU A;  3MVW A;  3HCQ A;  4FJP A;  1URG A;  2XXX A;  4KYD A;  1DPE A;  2H4I A;  4QSC A;  4Q5T A;  3TCG A;  2QS3 A;  4HCW A;  2DXY A;  3CG1 A;  3RNN A;  4QFN A;  3W15 C;  3FV1 A;  1HSL A;  5DVF A;  3D4G A;  3IOR A;  4ZZA A;  4KD5 A;  4FED A;  1KWH A;  1Q1K A;  4LP2 B;  1JEV A;  4RY1 A;  3E3K A;  3BFU A;  4U22 A;  1L5T A;  2PBW A;  2I3V A;  3O2A A;  3LSX A;  4I8C A;  3UA8 A;  3FGS A;  1MM7 A;  1IIT A;  1URS A;  3QUF A;  3TMG A;  1I69 A;  3JV9 A;  3ZKK A;  4RK2 A;  2XXI A;  4KYE A;  1P1N A;  2OZZ A;  4AB5 A;  1VFE A;  3HHF A;  2R71 A;  1D9Y A;  1OVT A;  3CSB A;  4FAJ A;  4C1U A;  4OEN A;  2AYS A;  2PX1 A;  2HAU A;  2I49 A;  2XXR A;  1YCJ A;  4GD5 A;  3I3V A;  2VD3 A;  3VLW A;  3B6W A;  4LQ2 A;  4NF5 B;  3GZG A;  3C4M A;  3FVN A;  4OET A;  3RPW A;  1AH5 A;  2XXH A;  4LVQ A;  3FAS A;  3N6U A;  3KGC A;  3U94 A;  1PC3 A;  4IO6 A;  5H8Q A;  4KQP A;  1FTL A;  2CZL A;  4NF8 B;  2XXT A;  4OQO A;  4BDR A;  3FIR A;  4YAH X;  1Y4T A;  1B0L A;  2R9J A;  4F1V A;  1B0H A;  3AXF A;  4HTG A;  5FTH A;  2XXQ A;  2Y7P A;  1I6A A;  2QJE A;  3S9L C;  4EUO A;  1YAE A;  5TP9 A;  4YKK A;  2ZNT A;  4F1U A;  3UGW A;  1PB7 A;  4ELQ A;  2AL5 A;  3IJX B;  4JBZ A;  3S9M C;  1B3E A;  3SEV A;  1MXX A;  2E0S A;  4H67 A;  1GVC A;  2P0S A;  4QFP A;  5I2N B;  2H25 A;  5DEX B;  3QK6 A;  5BUU A;  3SKP A;  5AA4 B;  3MPK A;  3SET A;  4BDO A;  1CE2 A;  2RF1 A;  1URD A;  2Q2C A;  2O84 X;  1LB8 A;  5CBR A;  2RC8 A;  2UYF A;  5H8N B;  1OVB A;  1LFH A;  3H7M A;  4POW A;  1JW1 A;  1MY2 A;  2DOJ A;  3PUX E;  3TFL A;  3PUW E;  2VD2 A;  3ZKL A;  2NUV A;  3PPR A;  3PUV E;  4GXA A;  5K2Y A;  4IO7 A;  3KG2 A;  1LBC A;  1MPC A;  4N07 A;  1WDN A;  2PT2 A;  4P11 A;  4U1Z A;  1SYI A;  4UAC A;  1MH4 A;  5KDT B;  3U72 A;  3H4Z A;  3VLV A;  3PPN A;  3T9X B;  4XKP A;  3M3K A;  1S9T A;  4EQ7 A;  1QUK A;  4DXB A;  3FVO A;  4BLA A;  4IO3 A;  2HAV A;  1MY4 A;  5KCJ A;  4FOR A;  3OXN A;  3RN8 A;  3K02 A;  3A3C A;  3IR1 A;  1UTH B;  3VXC A;  3WAE A;  3M8U A;  1O63 A;  3UOR A;  4JDF A;  2XX9 A;  4OFL A;  1NKX A;  2QMX A;  1NNK A;  4KR5 A;  1P99 A;  2GHB A;  2HQ0 A;  2GRV A;  1B3F A;  2HFB A;  5B70 A;  4R74 A;  4X9T A;  1SQY A;  2O7I A;  1JVX A;  4U23 A;  5FTI A;  3LSF B;  1GV8 A;  2H99 A;  3OOA A;  2Q9T A;  3C35 A;  1N7W A;  4OTE A;  2NXO A;  5JK4 A;  5FHN A;  1AL3 A;  1XS5 A;  2UVH A;  3N6T A;  1UIV A;  2R6G E;  3CI8 A;  1LST A;  3MWB A;  3EHT A;  1SVX B;  3HO7 A;  3EHU A;  4U2R A;  3UIF A;  4R75 A;  1TT1 A;  2LAO A;  1B7H A;  1D4N A;  3PPO A;  4IO2 A;  1SDX A;  3RY3 A;  5I59 B;  4JXI A;  4O3A A;  4Z7E A;  1ZLQ A;  3QXM A;  4QSD A;  5DTB A;  4TLL B;  4GF8 A;  2QSX A;  2ZXT A;  1M5C A;  1MS7 A;  1PBQ A;  4GIZ A;  1ZIU A;  1ZMG A;  2HEU A;  3OD7 A;  4LQ5 A;  4PFT A;  5CC2 A;  3TTM A;  4YU0 A;  3TEP A;  1I6B A;  4ELR A;  2O1L A;  4OEV A;  4F3S A;  1FW0 A;  3G3H A;  4RNS A;  1MY3 A;  3SEW A;  2DWJ A;  5HM4 B;  5A5X A;  4LZ8 A;  4PFW A;  4XKR A;  2B3B A;  4R2F A;  2XHD A;  3OO8 A;  2DYX A;  2F78 A;  3ZSF A;  2Z23 A;  1BLF A;  3SEU A;  1O7T A;  4ISU A;  2F35 A;  4F2Q A;  1TXF A;  3KOS A;  4Z0I A;  3I6V A;  1SW2 A;  5CMC A;  4LZ5 A;  4Q30 B;  3UN6 A;  3B6T A;  4ELP A;  3Q27 A;  1MXW A;  1PDA A;  3G3G A;  1RYX A;  1IXC A;  2I4B A;  5HBC A;  1DOT A;  4AB6 A;  3C9H A;  3H06 B;  5L9O A;  3CVG A;  3USD A;  3ILU B;  3PD9 A;  3FD3 A;  1UIU A;  3RT8 A;  4GFR A;  1R1N A;  3G3K A;  3H6T A;  3THI A;  4LUB A;  4EQB A;  1QUJ A;  4NF6 A;  3OEK A;  2RKM A;  4POX A;  1UTB B;  4MH5 A;  2DWI A;  1JVY A;  3O9P A;  4EQ9 A;  1B9J A;  3KFM A;  2Q2A A;  3G3F A;  3O6I A;  2NVU B;  1VE4 A;  4PP0 A;  2PVU A;  4YZZ A;  4H6D A;  4ZE8 A;  1BTJ A;  3JZJ A;  4BDN A;  5JTY A;  4G68 B;  5FHO A;  3OO7 A;  3DM0 A;  3PUY E;  1A40 A;  3EPE A;  4EF2 A;  1BIY A;  4EXK A;  4EDP A;  2XD2 A;  1JET A;  2Z22 A;  1QKA A;  1XVY A;  4K3F A;  1VSO A;  2NWJ A;  3IL1 B;  1H44 A;  3FVG A;  4YKJ A;  4JB7 A;  5EYF A;  4R6K A;  3PPP A;  1NL5 A;  3FXQ A;  4MFI A;  5CRY A;  1PBP A;  1A7L A;  4JSO A;  1A55 A;  1MM6 A;  5I2K B;  3TTN A;  4XIG Q;  1FTM A;  4H1X A;  1N76 A;  1US4 A;  1ATG A;  3LR1 A;  4P0I A;  2F7A A;  3B6Q A;  1M5E A;  3RTW B;  3TCF A;  5I56 B;  3IB0 A;  5H8Q B;  1EH3 A;  2Z8E A;  4GL8 A;  1FQD A;  5I58 A;  3PD8 A;  3R6U A;  2A5T A;  3RTF B;  2DE3 A;  3KSJ A;  1NNT A;  4X1D A;  1B1X A;  3MP1 A;  3OO9 A;  4NF4 B;  1S7Y A;  2Y7K A;  3TDJ A;  3TCH A;  1B3L A;  4YB7 A;  3MBP A;  4R73 A;  5H8F B;  4XKQ A;  1LLS A;  1OLA A;  1TWY A;  3P7I A;  2OLB A;  3T96 B;  2V25 A;  5B7D A;  1WOD A;  3WAF A;  3VLU A;  2XXU A;  3V5A A;  4OER A;  4KYS A;  3S9N C;  3H3G A;  5KZT A;  1DPP A;  1MXY A;  3KN3 A;  4MLQ A;  4BDL A;  1OIB A;  3CG3 A;  4ELO A;  2PT1 A;  2WKY A;  4P0G A;  1MQI A;  5EHS A;  1ANF A;  4NWD A;  3PUZ E;  1BP5 A;  5CI5 A;  1OQG A;  3FJ7 A;  3C33 A;  2GFE A;  3T93 B;  3IAZ A;  4KI0 E;  5H8H B;  1IQ7 A;  3HPI A;  2P1S A;  1N7X A;  2DE2 A;  3O6H A;  3ONM A;  2DP8 A;  2QPQ A;  2NOO A;  3K6U A;  5CBS A;  4IB2 A;  3VXB A;  5AA2 A;  4PQJ A;  4DXC A;  3U8Q A;  4X48 A;  3VVE A;  2I0B A;  3K0V A;  1YTV A;  3GBA A;  1IIW A;  3TKD A;  4U4X A;  1GGG A;  3CRB A;  1B3H A;  3KOT A;  3SEX A;  4H8I A;  1MY1 A;  1QUL A;  1QVS A;  1EU8 A;  1RYO A;  1DSN A;  2CMO A;  2FYI A;  3TTR A;  3RQT A;  5FHM A;  1SI0 A;  3FUZ A;  3L6G A;  2YPN A;  3MC2 A;  3Q29 A;  3N94 A;  4GRK A;  2ONR A;  3IB1 A;  5J1D A;  4HCY A;  5DVI A;  4KFQ A;  2BJJ X;  1FQC A;  3DP6 A;  5DT6 A;  1SI1 A;  3TOD A;  1B5J A;  3G3I A;  4ESX A;  2PYY A;  1SW5 A;  3K01 A;  4YB5 A;  3TEL A;  2Q89 A;  2A5S A;  3T22 A;  2THI A;  5IAI A;  1LCF A;  3MZ1 A;  2XD3 A;  4TOZ A;  3CR9 A;  2UXA A;  3HST A;  3SEY A;  2HZK A;  3CIJ A;  4PE5 B;  2I6E A;  4R72 A;  5ITP A;  3O6G A;  3HN0 A;  1R9L A;  4IGT A;  4ZEI A;  1QUI A;  3OEM A;  4Q8R A;  4YMA A;  1IXG A;  1IXH A;  5AA1 A;  1P1W A;  1ZU0 A;  3Q25 A;  5L9M A;  3MUQ A;  4R9G A;  3PGF A;  3FXR A;  3R7X A;  4DDD A;  5AA2 D;  2ZYN A;  2XXW A;  2GHA A;  4ND9 A;  3TTK A;  1H45 A;  3MW0 A;  3LUY A;  2FA7 A;  2W7Y A;  4Q0C A;  3G3J A;  3O97 A;  4NF8 A;  2DWH A;  1NMU A;  1DTG A;  2V3Q A;  3DP8 A;  4ZZE A;  2QS1 A;  2D5W A;  3OMB A;  4I1D A;  4FE8 A;  2FNC A;  4DLD A;  4MF3 A;  3GLB A;  4OMB A;  2QS4 A;  3UP9 A;  3R26 A;  4I9D A;  1SBP A;  1QJM A;  3MQ9 A;  2O6A A;  3D4C A;  1GTK A;  1MQD A;  3Q28 A;  1R9Q A;  3OEN A;  3K4U A;  1ZJL A;  2VOZ A;  2ZYM A;  1NNP A;  1D3K A;  1JW5 A;  4R6H A;  1NH8 A;  1P1O A;  1CB6 A;  1PEB A;  4NMY A;  3MPL A;  3MVX A;  2VGQ A;  1M5D A;  2I48 A;  2HXW A;  4YMB A;  1B58 A;  5IKB A;  2IEE A;  3A3U A;  3W9W A;  1TFD A;  1Y3N A;  1IEJ A;  2XX8 A;  3TQL A;  5I2N A;  4WKM A;  5DEX A;  5AA4 A;  4ECF A;  2ONK E;  2RC9 A;  4HS7 A;  1J1N A;  4QSE A;  4QRZ A;  5AA3 A;  3FAT A;  1B2H A;  1EZ9 A;  4IGR A;  5H8N A;  1M5B A;  3JYR A;  3I5O A;  1SW4 A;  1RKM A;  4AQ4 A;  2F7B A;  3TAJ A;  5M2V A;  3Q26 A;  2F97 A;  4F3G A;  4QFO A;  4OEU A;  3DLN A;  4GOT A;  4F18 A;  5CMB A;  3C36 A;  1B52 A;  2P2A A;  3FZV A;  1P1U A;  3IB2 A;  1AOV A;  4C1T A;  1MQH A;  1MH3 A;  3IO6 A;  4KHZ E;  5KDT A;  3IK6 B;  1POY 1;  5JEI A;  1Y1Z A;  3N26 A;  4RK9 A;  4IO4 A;  3S9E A;  1MXV A;  2AIX A;  4H5G A;  2ANJ A;  1N0T A;  1FQB A;  4H65 A;  5TPA B;  1MQJ A;  4FAT A;  4GXS B;  1NFT A;  4QFL A;  3FV2 A;  4N13 A;  1FTJ A;  1A54 A;  2XXP A;  3OO6 A;  3OEL A;  5CMK A;  4DZ1 A;  1O64 A;  3LBS A;  4WXJ A;  1SW1 A;  3H6W A;  3E13 X;  1B3G A;  4ZEC A;  3FVK A;  1EZO A;  4XXU A;  1ZKB A;  4FIM A;  2OWS A;  4G8M A;  2Y84 A;  2OWT A;  2F36 A;  4M1V A;  4TLM B;  1DMB A;  1S50 A;  2F34 A;  1LAH E;  2UVJ A;  3CFX A;  1B6H A;  4YIC A;  2O68 A;  3OSR A;  3K1P A;  5BWJ A;  5I59 A;  3PMV A;  3VVF A;  5I57 A;  3TUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...