2XXVA

Crystal structure of the gluk2 (glur6) m770k lbd dimer in complex with kainate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
248
structure length
248
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPKGSPYRDKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational Flexibility of the Ligand-Binding Domain Dimer in Kainate Receptor Gating and Desensitization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
total genus 85
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxvA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxvA02
2O69A 3CG1A 4G77A 5I57B 2QMXA 1NKXA 1N7XA 5DEXB 4BDNA 1B5IA 3I3VA 1MY0A 4YU0A 4GLIA 1SW1A 1S50A 3G3JA 3T9XB 1RYXA 4BDRA 2QS4A 3MZ1A 4ISUA 4ZS9A 4YB5A 4HCYA 2I0BA 5ICTA 3GLBA 3OEKA 3OENA 4KPTA 4EXKA 2GRVA 3LR1A 4MH5A 2OCUA 1R1NA 4ND9A 3Q26A 3C36A 1EU8A 3CSGA 3OO9A 4N07A 4R2BA 3D4GA 4MBPA 3T9UA 4UACA 3O66A 3SDFA 3VLWA 5CBRA 2DYXA 5JTYA 1N0TA 1ELJA 1D3KA 2DWHA 3CI8A 3OXNA 3S2VA 1IIWA 1LAGE 3M3LA 4H5GA 4R6HA 5TP9B 1ATGA 4OMBA 1N84A 1I6AA 3OMBA 1AMFA 3BFUA 4DXCA 3K01A 4YICA 3VV5A 3E13X 1A99A 1VE4A 3EQ1A 1MXYA 1ZLQA 4OEUA 3EN3A 1OLCA 3B6QA 1MPCA 4LONB 3FVNA 4QHQA 4U1OA 4MLQA 3RUMA 3UK4A 4P0GA 3W9WA 4Q30B 2OLBA 1LBBA 1PBPA 1Y1MA 2P0SA 3DELB 1FTLA 3UP9A 4R6KA 3DP8A 2F8DA 1R9QA 3IJOB 1US5A 4XIGQ 5AA4B 4DXUA 2PMSA 3PUWE 1JVXA 2B65A 2V3TA 2XXHA 3I5OA 4NF8A 5TPAB 1D4NA 2UVIA 3N26A 3KN3A 2WKYA 1Y3PA 4DE8A 3FVOA 2CZLA 5I2NB 5H8QB 2XD2A 5I56B 2ZNSA 3QXMA 1J1NA 2A5SA 2KLFA 5ELVA 1B05A 1B52A 1BTJA 1S7YA 4GD5A 2UYFA 2OJTA 4PP0A 4C0RA 5HM4B 4QRZA 5FHOA 3TQWA 1JEUA 3WAEA 2RC9A 5I57A 3V83A 4R9GA 1M5CA 4OVJA 4QSDA 3FD3A 1H43A 4KYEA 4E0WA 3FATA 1NNTA 4RJZA 1LBCA 1LAXA 4JWXA 1SBPA 1GGGA 1UIUA 1DSNA 2Q2CA 4QSCA 2UXAA 3IB2A 2HAUA 4U23A 1T0KA 5BUUA 3IO6A 3H3GA 4E0XA 3PMVA 1MQDA 2O7UA 3BFTA 3FASA 3MJNA 1SW5A 4NE4A 1P1WA 3RT8A 4H5FA 3LSXA 3Q25A 4K3FA 4IO6A 2RC7A 2O84X 1P1NA 1PEBA 1IUDA 4G8NA 4LQ2A 1PB7A 1FTJA 3E3KA 5TPAA 5IAIA 1R9LA 1XVXA 3DP6A 1EZPA 2XXQA 3RNNA 3TTLA 1FQCA 2VD3A 3MP6A 4YKJA 1LLSA 1DTZA 3U92A 3UIFA 5KCJB 2H4IA 5I2NA 3R26A 3UORA 3SEXA 2B3FA 1UIVA 2GH9A 3PU5A 1UTBA 2RCBA 5AA3A 5I58B 4GVOA 3TTNA 4OFJA 2XXVA 4Q5TA 5A5XB 3ECRA 1JNFA 1FW0A 2NOOA 2F6GA 2P1SA 1O7TA 1I6BA 1S9TA 2QS3A 2XX9A 1BP5A 3GBAA 3KBRA 4FE8A 4IGTA 4U21A 3USDA 1B3GA 2V3QA 2G93A 3JV9A 1PB8A 4OERA 1LFIA 4WKMA 4DDDA 1MY4A 2PT2A 1MPDA 3K6VA 3U8QA 4C1TA 3T96B 1B7HA 1FTKA 4U4XA 4EQ9A 4AB6A 4ZE9A 2I58A 3PUYE 1FQDA 1LB9A 4LQ5A 3OD7A 1NNPA 4OXVA 5I59A 4ZEFA 5JK4A 1QKAA 3A09A 3IO4A 3MQ9A 2RC8A 3JYRA 4G68B 5F1QA 5HPQA 4EF2A 4NEDA 1SI1A 3DP4A 2V93A 3LUYA 4THIA 1B0HA 5I56A 5CC2A 1B58A 4RXLA 4JXIA 3TEPA 4ZDMA 1UTBB 1EH3A 2I3WA 1ZTYA 2AIXA 1PC3A 2ZYOA 4P0IA 4QFLA 1CE2A 3HV1A 2RCAA 4GL0A 3TUSA 1Y20A 4MF3A 3RGYA 1ZIUA 3Q27A 3TDJA 3FJGA 5H8HA 4MLVA 3QIMA 3CVGA 3MBPA 4FORA 4ESWA 1URDA 2XXPA 2UVHA 2RF1A 3O6IA 4R75A 4IY5A 5H8FB 4ELQA 5K2XA 4HW8A 1JW5A 5FTHA 4U2RA 1N3WA 1POTA 2ABHA 4F19A 4BDQA 2VP1A 3O9PA 4OZ9A 4XTCQ 2V84A 3PPNA 1VFEA 4F39A 4DCXA 2QJEA 1QW0A 4EUOA 3VVEA 2H25A 2Z22A 4GF8A 5DVIA 2X26A 2XHDA 4KI0E 4IO3A 3G3KA 3B6TA 4ECFA 2O1MA 2XXRA 3PPRA 4JB7A 3MC2A 1QULA 3B6WA 4GXSB 5K2YA 1FQAA 1FCKA 4N6PA 3G3GA 1MXUA 3VFJA 1QUKA 4KD5A 4LA9A 3FUZA 1LFHA 1RYOA 3QUJA 2F7BA 3SEYA 1M5DA 3B7DA 4Q0CA 1OQGA 5DVJA 4F1UA 3ZKKA 1MDP1 2LAOA 4GQOA 3TELA 2YJPA 3D4CA 3GBBA 4OQOA 4X1DA 3K1NA 4UA8A 1BIYA 2E1SA 1CB6A 1I69A 1OQHA 3TMGA 3A3UA 1LCTA 1B4ZA 3K02A 3W15C 2AL4A 5FHMA 2DVZA 1QJMA 3MWBA 3KGCA 5AA2A 5H8NB 5CRYA 1B9JA 3PV0E 1Q1KA 4I62A 1TWYA 3KJ7A 2H9BA 2F6PA 3MUQA 1KWHA 1FTOA 4G68A 5CI5A 4OESA 5HBCA 3W9VA 4KHZE 1M5FA 2Z8DA 1MG1A 3K1MA 4ELRA 3OO8A 3TCGA 4FEDA 4LVQA 2X7QA 3FVGA 3A3CA 4WEDA 2R9JA 4M1VA 4IO7A 4L17A 3T93B 1UTHA 1EZOA 1LCFA 3WAFA 2XX8A 1NH8A 4GWOA 4F31B 5ITPA 3LSFB 3RQTA 2XD3A 3LSLA 1A8FA 5CMKA 3OEMA 4HS7A 3IL1B 2Q8JA 4ELOA 3HSTA 1HSEA 2ZYNA 1WDNA 4I8CA 3PD8A 1YPNA 2OBGA 2NUVA 1TT1A 1VFDA 1D9YA 4IO5A 4KYDA 1POY1 3G3FA 3S9MC 2PX1A 3ODBA 4FJPA 3FV1A 3CR9A 4BLAA 1B0LA 4O3AA 1XT8A 5AA4A 5H8NA 2Z8FA 1B2HA 3TTKA 5CBSA 2PYYA 4XKQA 2OK2A 1LAFE 4ZE8A 1O63A 3M3KA 1B3EA 2DXYA 1A7LA 1SW4A 2Y7IA 3E4RA 3H6UA 1PBQA 4GFRA 3ONMA 3N6UA 2Y7KA 1B3HA 3OSRA 4RYAA 1MQHA 2PVUA 4H8IA 4TOZA 3KOSA 1IXGA 3K00A 4YKKA 1Y1ZA 3TZAA 5AA2D 4XKRA 2ESNA 3CIJA 4I1DA 4NWCA 2BJJX 2DWJA 1FQEA 3C9HA 4GRKA 1IZ1A 3PMXA 4OETA 1EZ9A 2F36A 4ESXA 2X7PA 1QVSA 2DE3A 5EHSA 1UQWA 3IAZA 2GFEA 2HZLA 3UN6A 3SETA 4NF4B 4RK2A 4EQ7A 1QUJA 4H8JA 4PFYA 5AA2B 1URGA 1NMUA 4GXAA 3S9EA 4KCCA 4PE5B 4YB7A 4WXJA 1WVJA 2G29A 1XOCA 1ZMGA 3IR1A 2V3UA 1LSTA 1IQ7A 4NF8B 4F2OA 2Q9TA 3H7MA 3KFMA 1GV8A 3RY3A 5DYHA 4YMBA 1JW1A 3LBSA 1ZBMA 2DSFA 1DOTA 2ZYKA 3V89B 3KG2A 1AIVA 3THIA 4LP2B 1NNKA 5I84A 4FEBA 3VE1B 2HCAA 4DCYA 1Y4CA 3PUXE 3DLNA 1LFGA 4X1BA 1B1XA 1MDQA 4ZEKA 1SYIA 3O6GA 3S9NC 4H6DA 4G4PA 1MXWA 2DOJA 2M8CA 1JETA 1ZJLA 4JBZA 4LZ8A 4C1UA 1DPPA 1H76A 1JQFA 3O97A 1B46A 2I6EA 2O51A 2XX7A 3PPQA 3H6WA 1B4HA 3PPOA 4XKNA 5DVFA 3CFLA 1L5TA 3RTWB 2DS9A 3KSXA 4OEVA 4OTEA 4U1ZA 3SEUA 5CMBA 5LOMA 4Q8RA 3TODA 2VGQA 1JVYA 4X48A 1SYHA 2OWTA 3ZKLA 4F3PA 1ANFA 3MVWA 4XXUA 1P99A 3C31A 3FGSA 5AA1A 1MY3A 2NWJA 3H4ZA 5KDTB 2PBWA 5I58A 2VHAA 3BKIB 4NF6B 3SERA 3L6GA 4U22A 4NF5B 4G68C 2B3BA 5DTBA 2A5TB 3VVFA 5A5XA 1XHYA 2IEEA 4R72A 2O1LA 1H44A 2F5XA 3PPPA 4FAJA 3C35A 4EDPA 2VD2A 2I0CA 3QUFA 3MPLA 3TTRA 1MH4A 5ICQA 1MXVA 2XXXA 2DE2A 1B7UA 1B51A 1DPEA 4IY6A 2R71A 3Q29A 5H8SA 4FATA 4JWYA 2RINA 4OYVA 3OOAA 3H6VA 4ZEBA 3T9HB 3U72A 3MPKA 3G3IA 3UGWA 1MM6A 2ZMBA 4HCWA 5B70A 1M5BA 1B6HA 1H3DA 2O68A 4PETA 5I59B 4IO4A 1MPBA 2GHBA 2OZZA 3BBRA 3E9XA 5L9OA 1US4A 1VSOA 2ZYMA 3MP1A 2DXRA 4ZZEA 4TQUQ 3MZ9A 4AB5A 5I2KA 2QL3A 3K6XA 4M4GA 4Z0IA 1IXIA 3V5AA 2H5YA 1LB8A 1JEVA 2XXIA 1N04A 2YPNA 1N76A 4NF5A 3EHTA 3FVKA 4FIMA 3IOVA 4PQJA 4QF9A 4RPNA 1Y9UA 5H8FA 2AL5A 2REJA 4YB6A 3K0VA 1XC1A 2ZNUA 3M3FA 4TLMB 3VDFA 4N13A 4TLLB 3FIRA 1MRPA 3H6TA 3H03A 3KEIA 4QFNA 3KZGA 3O29A 3IOUA 5EYFA 3K4UA 5B7DA 3VLUA 1IEJA 5AE4A 4OFLA 1XVYA 3QK6A 4ZZAA 1MXZA 2OWSA 2R6GE 2V25A 1XS5A 3O6HA 1Q35A 1Y3QA 3KN7A 2ALUA 3N5LA 1FTMA 5M2VA 3RN8A 4RA1A 2F7CA 2DVCA 1PB9A 3CG3A 5DT6A 3K6UA 3CRBA 2HFBA 3EHUA 4IB2A 1OIBA 1P1QA 1MM7A 1UTHB 3LSWA 4LZ7A 4H0WA 3SEWA 3VXCA 2H99A 4AQ4A 1LGBC 2Q2AA 4EQBA 3PGFA 1USYH 3HHGA 3IK6B 3TQLA 1Z7NE 2XXYA 1P1OA 2THIA 4KQPA 3TCFA 2ONKE 3G3HA 1YAEA 1WODA 2VOZA 4OHNA 2QSXA 3O28A 4ELPA 3K6WA 3EF7A 2F35A 4O3CA 4R6YA 4YAHX 4HTGA 3AXFA 3R7XA 1ZKBA 1D9VA 3T22A 5FHNA 1AOVA 3RT6B 1OVTA 3JZJA 3ZS6A 2CMOA 4EXLA 4G2ZA 4JSDA 2REGA 1GR2A 3IORA 3HO7A 3S9LC 3UA8A 5KCJA 3N6TA 4G8MA 3MP8A 4WEPA 5TU0A 4NF6A 3C32A 2PT1A 3T9VA 5ITOA 1N3XA 1YCJA 2I4BA 3MVYA 3QAXA 4R2FA 4DIGA 3U93A 5JEIA 1SVXB 3VXBA 3CFZA 2F78A 2D21A 3TYHA 1QUIA 4GIZA 3H06B 4F3BA 3CFXA 5FTIA 4GL8A 4EF1A 2ONRA 2HAVA 1A40A 3S4UA 5L8DA 3SKPA 4DXBA 5L9SA 1MY2A 3C33A 3VVDA 4U4SA 5ISUA 1Y3NA 1IXCA 2Y7PA 1TFDA 4YKPA 2AYSA 3TPAA 1R6ZA 3FXRA 1ZU0A 3MW0A 1I6QA 4I9DA 1IXHA 3TAJA 2D3IA 3QSLA 4DLDA 4XKPA 3OELA 4P11A 2Y84A 3FJ7A 4JWOA 3P7IA 2XXUA 4POXA 5H8QA 4F18A 3IB0A 5CM6A 1NFTA 3TTMA 3KOTA 3HN0A 1A54A 3T66A 2HZKA 3FJMA 3FXUA 1USYE 1MQGA 2F97A 1SQYA 2HQ0A 3MVXA 5DEXA 2ANJA 3RPWA 4DZ1A 2UYEA 4Z7EA 1RKMA 1SW2A 2DQVA 2QRYA 2ZNTA 1YTVA 3O2AA 1LAHE 1B32A 1Y4TA 1II5A 1B7ZA 4NMYA 1BLFA 1A55A 2I49A 2E0SA 2FA7A 3OO6A 1IITA 2QS2A 4NTLA 2F34A 2HXWA 1DMBA 2UVJA 3IB1A 4O3BA 4ONYA 4QFKA 4IO2A 1F9BA 2XXWA 1A8EA 1OVBA 2ONSA 5KZTA 1HSLA 1H45A 2QPQA 2Z23A 4OFOA 2FYIA 4H65A 2ZXTA 5JTYB 1O64A 4R74A 3ILTB 3SEVA 3Q28A 1OLAA 1MS7A 3V8XB 1NNFA 4OWDA 3F11A 2DE4A 4IGRA 5EHMA 2GHAA 4F29A 5KDTA 3DM0A 4ZECA 3ILUB 5J1DA 1QKBA 4F3SA 2QMWA 4GOTA 1MXXA 1JW4A 2A5TA 1SD3A 4KR5A 4BDOA 1BKAA 3FZVA 3MZBA 4JDFA 4H1XA 1B1HA 1B40A 4ZEDA 3IX1A 2Q89A 1AL3A 3GXAA 1B3LA 3CSBA 2Y7WA 4YKIA 1GVCA 1AH5A 4BDLA 3PD9A 4NF4A 3I6VA 4YZZA 2DWAA 1TXFA 3KN8A 2Q88A 4BDMA 1B5JA 3KJTA 5CMMA 5CMCA 3IOWA 1DTGA 3K1PA 1MH3A 3IJXB 3U1OA 4QFOA 1URSA 1GTKA 4LATA 4PFTA 4RPOA 2D5WA 2O6AA 2FNCA 1B5HA 2HEUA 3PUVE 3FV2A 4F2QA 4F1YA 4MFIA 3G7WA 1FQBA 3L6HA 2P2AA 2DWIA 1SDXA 2Y7RA 3RTFB 3K2DA 1MY1A 2UVGA 3HPIA 3EPEA 2RKMA 1M5EA 4LZ5A 4RNSA 2YLNA 3LC8A 1SI0A 3R6UA 4JSOA 3IOTA 4RK9A 5H8HB 2H98A 3SESA 4F1VA 2XXTA 1N7WA 1B3FA 3PMWA 1VR5A 2NXOA 2IA4A 4FECA 2W7YA 4H67A 4YMAA 5BWJA 3EHSA 4KYSA 4PFUA 1NH7A 4ZEIA 3HHFA 2QS1A 5L9MA 4KFQA 1FQFA 1MQIA 2Z8EA 3TFLA 3VLVA 2I4CA 4PFWA 3ZSFA 3PUZE 3RLFE 3OSQA 3QYTA 1TFAA 2F7AA 3C4MA 4R73A 4RY1A 2DP8A 4F22A 3MAMA 4G8HA 4F3GA 3N94A 1MQJA 2O7IA 3FXQA 3OO7A 4QSEA 5IKBA 3C34A 1Z7ME 4NWDA 3KSJA 4POWA 3U94A 5I2KB 3M8UA 4QFPA 1NL5A 5TP9A 2NVUB 1PDAA 4KCDA 4LUBA 3HCQA 4OENA 4X9TA 4R9FA 5F7VA 3GZGA 3TKDA 2I48A 3TCHA 2I3VA 1OMPA 1HSJA 1P1UA 3MVZA
chains in the Genus database with same CATH superfamily
1NI9A 4G77A 1FJ6A 1N7XA 2VPOA 1B5IA 4BDNA 4GLIA 1SW1A 1RYXA 2QS4A 4HCYA 3OEKA 3OENA 4EXKA 4MH5A 3C36A 4MBPA 4P3LA 3VLWA 2DWHA 3OXNA 1IIWA 1FSAA 1I6AA 3OMBA 2CZHA 3BFUA 4DXCA 3K01A 4YICA 3T0JA 1VE4A 4OEUA 3EN3A 4P47A 1NUYA 4P0GA 2OLBA 1LBBA 4MHFA 3PUWE 2V3TA 4NF8A 2JJKA 2UVIA 4DE8A 1YZ0A 1BK4A 2ZNSA 3QXMA 5I56B 4PP0A 4C0RA 2CZIA 3ROJA 2RC9A 1M5CA 4E0WA 4JWXA 1GGGA 1UIUA 1DSNA 4JVDA 3BFTA 3RT8A 1RDZA 3Q25A 4QBAA 4G8NA 4LQ2A 1EZPA 3RNNA 3TTLA 3MP6A 4YKJA 1YYZA 3R26A 2HPGA 5I58B 2XXVA 5EHSA 2P1SA 1O7TA 1FJ9A 3GBAA 4OERA 1MY4A 3FBPA 3T96B 1FTKA 4EQ9A 3PUYE 1FQDA 1LB9A 5I59A 1XI6A 1FBCA 3IO4A 1LBXA 4O7IA 3SZPA 1B0HA 5CC2A 1B58A 4RXLA 1EH3A 1CNQA 1CE2A 1Y20A 3QIMA 1URDA 2UVHA 4ELQA 4R75A 2XWIA 2KQZA 4OANA 3O9PA 4OZ9A 1VFEA 3IFAA 4F39A 4GF8A 2X26A 4IO3A 1QULA 1FPGA 4LA9A 3QUJA 2F7BA 1M5DA 1OQGA 3B50A 4X1DA 4UA8A 3TMGA 1LCTA 3K02A 2AL4A 2B4LA 5FHMA 3MWBA 1QJMA 3KGCA 5H8NB 3KJ7A 1FTOA 4KHZE 1MG1A 3FVGA 2R9JA 4L17A 1UTHA 2XX8A 2XD3A 1LEVA 1HSEA 2ZZXA 1WDNA 3PD8A 3RGYA 2OBGA 4IO5A 3G3FA 1FPLA 3FV1A 1B0LA 1XT8A 5H8NA 3TTKA 4XKQA 4PFIA 1B3EA 2Y7IA 4U23A 1SW4A 3ONMA 2Y7KA 1B3HA 4H8IA 4NF0A 1IXGA 3K00A 3BIGA 4YKKA 3T1BA 5AA2D 4XKRA 3CIJA 3VXBA 5ET5A 1EYJA 1FQEA 3UN6A 4RK2A 1QUJA 1URGA 2Q9TA 3H7MA 1GV8A 3LBSA 1ZBMA 1AIVA 5I84A 3VE1B 3RPLB 4X1BA 4KXPA 1SYIA 3O6GA 2DOJA 2CEXA 4XFEA 2F3DA 4C1UA 4O94A 1NV7A 3H6WA 2ZZVA 4Q8RA 4GX4A 1SYHA 2OWTA 4XXUA 1P99A 3C31A 2MKZA 3SERA 2IEEA 4N4UA 1H44A 5ICQA 3MPLA 1MXVA 2DE2A 4JWYA 3OOAA 3H6VA 4ZEBA 3MPKA 3G3IA 1LBWA 1H3DA 1US4A 1VSOA 3MP1A 3MZ9A 3K6XA 4M4GA 4Z0IA 3V5AA 5IM2A 1JEVA 2XXIA 1N04A 2AL5A 2REJA 4GWZA 4YB6A 4TLLB 3FIRA 3H6TA 4N91A 4QFNA 1NV4A 3K4UA 3VLUA 1EYKA 4OFLA 3O6HA 4HS7A 2ALUA 1NV6A 4NQ8A 2DVCA 3CG3A 5DT6A 3K6UA 3RPLA 1P1QA 3LSWA 2Q2AA 4EQBA 3IK6B 3G3HA 1KA1A 1WODA 2QSXA 3O28A 4ELPA 3K6WA 4R6YA 2HXRA 1AOVA 5FHNA 4PAKA 4G2ZA 2REGA 3HO7A 2XA5A 3C32A 3T9VA 5ITOA 4DIGA 4DI4B 4GL8A 5L9SA 3C33A 5ISUA 1IMDA 1TFDA 2AYSA 1R6ZA 2VPNA 3FXRA 4JWOA 5H8QA 1NFTA 3KOTA 1A54A 1USYE 2HQ0A 3MVXA 2ANJA 2UYEA 2ZNTA 3O2AA 4P8BA 1Y4TA 1B32A 2FA7A 1IITA 3E78A 1IMAA 2UVJA 4QFKA 1A8EA 2ONSA 4NX1A 2Z23A 4OFOA 1NNFA 3F11A 4IGRA 1MXXA 2CEYA 4KR5A 4BDOA 3MZBA 1B1HA 1AL3A 2Y7WA 4BDLA 1AH5A 4NF4A 1TXFA 3KN8A 3KJTA 5CMCA 5LDZA 3K1PA 3IJXB 4PE3A 1GTKA 4RPOA 2D5WA 2O6AA 2FNCA 4MFIA 2UVGA 3EPEA 3SESA 4RK9A 3PMWA 2WYKA 3MYUA 4PFRA 3EHSA 2Z8EA 3TFLA 3ZSFA 3OSQA 1TFAA 4F22A 4RY1A 4G8HA 3FXQA 2FBPA 3C34A 4POWA 3U94A 5LTCA 4OENA 4R9FA 2I48A 4IR8A 2I3VA 1HSJA 1P1UA 1T0KA 1NKXA 1MY0A 2Q8MA 3MZ1A 4ISUA 4MMPA 1R1NA 4ND9A 3D4GA 3T9UA 5EQ7A 3SDFA 4PAIA 4OVTA 5JTYA 1ELJA 1NV3A 1LAGE 1ATGA 2ZZWA 1AMFA 1MXYA 1ZLQA 1D9QA 1OLCA 3B6QA 4QHQA 4MLQA 3UK4A 1PBPA 3UP9A 1R9QA 2PMSA 3I5OA 1FBDA 1KA0A 1D4NA 3N26A 3KN3A 4QXDA 2XD2A 1J1NA 4GD5A 2UYFA 5FHOA 3TQWA 1JEUA 1FBFA 1H43A 3NOHA 1NNTA 4QSCA 1SBPA 2Q2CA 3IO6A 4E0XA 3PMVA 1MQDA 1SW5A 4NE4A 1FTJA 2P3VA 3E3KA 5IAIA 1XVXA 3DP6A 2XXQA 3UIFA 1FQCA 1LLSA 5KCJB 4N15A 2HHMA 3SEXA 2GH9A 3PU5A 3TTNA 4Q5TA 3ECRA 1FW0A 2NOOA 1I6BA 3T93B 1B3GA 4WKMA 1LFIA 1B7HA 3EKIA 3OD7A 5F24A 4ZEFA 4P56A 3A09A 1SI1A 3DP4A 2V93A 5I56A 2I3WA 2AIXA 2ZYOA 3TUSA 2RCAA 5H8HA 3MBPA 4IY5A 4U2RA 2V4CA 4F19A 5FBPA 2VP1A 4XTCQ 3PPNA 4DCXA 2H25A 5DVIA 3G3KA 4JB7A 4NG7A 3MC2A 4F1YA 5ESYA 1RYOA 3ZKKA 3GBBA 4OQOA 3K1NA 1DK4A 4MIJA 1I69A 1OQHA 2DVZA 5AA2A 1B9JA 3PV0E 1Q1KA 1TWYA 2F6PA 4G68A 4GWUA 3LSLA 3RQTA 4ELOA 3IL1B 3HSTA 2VT5A 2ZYNA 4PGPA 1TT1A 5EQAA 1POY1 3ODBA 3CR9A 2DXYA 1A7LA 4GFRA 3N6UA 3OSRA 2WBBA 2BJJX 2DWJA 4GRKA 5ET6A 4ESXA 1IZ1A 2F36A 1UQWA 3SETA 4NF4B 4KCCA 4YB7A 1WVJA 2G29A 1XOCA 1ZMGA 4O7MA 4X04A 1JW1A 1FTAA 1DOTA 3KG2A 4FEBA 1K9ZA 2HCAA 4DCYA 3E79A 3S9NC 4G4PA 1MXWA 2M8CA 4HE1A 1JQFA 4DLDA 3RTWB 5DVFA 4OEVA 4OTEA 2PFZA 4F3PA 3FGSA 5KDTB 2PBWA 4U22A 4NF5B 4G68C 5A5XA 2O1LA 3PPPA 4N17A 3C35A 2VD2A 1MH4A 3KC0A 2XXXA 1B51A 2R71A 3Q29A 4OYVA 4H46A 1MM6A 1B6HA 4IO4A 2GHBA 3BBRA 3E9XA 5L9OA 4ZZEA 4PGNA 4AB5A 5I2KA 2QL3A 1IXIA 2QFLA 5EQ8A 4NF5A 3EHTA 4NHBA 4QF9A 4PQJA 4RPNA 3K0VA 4TLMB 5T3JA 5IZ3B 3KZGA 3O29A 5AE4A 1DCUA 3QK6A 2R6GE 1XS5A 1Q35A 3N5LA 3RN8A 4MX6A 4RA1A 1OIBA 3SEWA 3VXCA 2H99A 1LGBC 1USYH 3TQLA 4KQPA 2THIA 2ONKE 2VOZA 4OHNA 3EF7A 4YAHX 3AXFA 3R7XA 5IZ1A 1D9VA 3T22A 1OVTA 3JZJA 3ZS6A 2CMOA 4JVIA 3IORA 3S9LC 3UA8A 3HFUA 5EYGA 3MP8A 1NUZA 3U93A 3CFZA 2F78A 3H06B 4MNCA 3CFXA 4EF1A 1NV1A 2HAVA 4DXBA 3VVDA 4MJOA 2F3BA 1IXCA 2Y7PA 4I9DA 3TAJA 2D3IA 3OELA 3P7IA 5CM6A 3IB0A 3TTMA 3FXUA 4N8GA 1MQGA 3RPWA 1SQYA 5KZTA 2L5VA 4I3YA 1SW2A 4NMYA 1FPJA 3OO6A 2E0SA 2QS2A 2F34A 2HXWA 3MSTA 3IB1A 2WEFA 2XXWA 1H45A 5JTYB 2FYIA 2OX3A 2ZXTA 4H65A 3ILTB 3SEVA 1OLAA 3V8XB 4AS5A 4F29A 4OA4A 4ZECA 3ILUB 4JDFA 2Q89A 1GVCA 3CSBA 1B5JA 5CMMA 2XWOA 4X8RA 3U1OA 4PFBA 4QFOA 4BDMA 4LATA 1B5HA 1FQBA 2P2AA 2Y7RA 3RTFB 3K2DA 1MY1A 4LZ5A 4RNSA 4JSOA 2H98A 1NV5A 2R8TA 1VR5A 2W7YA 4H67A 4KYSA 4PFUA 1NH7A 5L9MA 4KFQA 1FQFA 4I3EA 3PUZE 3RLFE 4F3GA 3MAMA 3N94A 1MQJA 4NWDA 1NV2A 5F7VA 2OWSA 4GWYA 3CG1A 5I57B 2QMXA 3I3VA 3T9XB 3G3JA 2I0BA 3GLBA 2WBDA 3LR1A 2OCUA 3Q26A 4N07A 1EU8A 4UACA 3O66A 4PF6A 3CI8A 1NV0A 3S2VA 4N6DA 3KBZA 1N84A 3EQ1A 1A99A 4OVPA 4XF5A 1MPCA 4LONB 2P0SA 4R6KA 3DP8A 2F8DA 3IJOB 1US5A 4XIGQ 4DXUA 5I2NB 2A5SA 5ELVA 2BJIA 1S7YA 4QRZA 3WAEA 3V83A 4R9GA 4NAPA 4QSDA 3FD3A 4KYEA 3FATA 1LBCA 1FBEA 2UXAA 3IB2A 2HAUA 3H3GA 2O7UA 2PCRA 3FASA 3MJNA 4H5FA 3LSXA 2RC7A 2DDKA 1PEBA 2O84X 5TPAA 1R9LA 2VD3A 1DTZA 2H4IA 5I2NA 5I5PA 1UIVA 4GVOA 4OFJA 5A5XB 5FTHA 1S9TA 1BP5A 4FE8A 4U21A 3USDA 1PB8A 4DDDA 2XXKA 3U8QA 4C1TA 4U4XA 4ZE9A 4AB6A 4MEVA 4LQ5A 1NNPA 4OXVA 5HPQA 2RC8A 4G68B 5F1QA 4EF2A 4NEDA 4PAFA 4LN5A 3LUYA 2PFYA 1UTBB 1ZTYA 4P0IA 4QFLA 3HV1A 4GL0A 4HE2A 4MF3A 2FIXA 4MLVA 3CVGA 1FPKA 3D1RA 4ESWA 2RF1A 5H8FB 1IMFA 1POTA 2ABHA 4BDQA 1FBHA 2QJEA 1QW0A 3VVEA 2Z22A 1FRPA 2O1MA 3PPRA 4GXSB 5IGAA 5K2YA 3VFJA 1QUKA 4Q0CA 5DVJA 4F1UA 3TELA 2YJPA 1CB6A 3W15C 4OESA 3W9VA 1M5FA 3K1MA 1FPFA 3OO8A 4FEDA 4LVQA 1EZOA 2Y5LA 4OVRA 3WAFA 5ITPA 3LSFB 1AWBA 3OEMA 4KYDA 1VFDA 1D9YA 4BLAA 5AA4A 2Z8FA 1B2HA 2OK2A 1LAFE 4ZE8A 1PBQA 4TOZA 1MQHA 4I1DA 4AS4A 4OETA 1EZ9A 2X7PA 1QVSA 2DE3A 3IAZA 1FBGA 4PFYA 1NMUA 4GXAA 4PE5B 4WXJA 2V3UA 1LSTA 1IQ7A 4NF8B 4F2OA 3KFMA 5DYHA 4YMBA 2ZYKA 3V89B 4PCDA 4DI3D 3PTYA 1B1XA 4MNIA 1JETA 1ZJLA 4JBZA 1DPPA 3O97A 2I6EA 4XKNA 3LUZA 1L5TA 3PPOA 3CFLA 4U1ZA 5LOMA 2VGQA 1JVYA 4X48A 3ZKLA 1ANFA 1FBPA 5AA1A 1MY3A 2NWJA 3H4ZA 5I58A 2VHAA 3BKIB 3L6GA 3VVFA 5DTBA 1XHYA 1IMCA 4FAJA 1B7UA 1DPEA 5H8SA 4FATA 5ICTA 2RINA 3T9HB 3U72A 2O68A 4PETA 5I59B 1MPBA 3U65A 2QVVA 2H5YA 2P3NA 1LB8A 2YPNA 4HXVA 3FVKA 3RYDA 2KR0A 3M3FA 3VDFA 3H03A 1EYIA 4PDDA 3IOUA 5B7DA 4NN3A 1XVYA 4MCOA 1MXZA 5M2VA 1Y3QA 3CRBA 3EHUA 4IB2A 5CBSA 5IZZA 1MM7A 2FHYA 4H0WA 3PGFA 1NUWA 1Z7NE 2XXYA 1P1OA 3TCFA 2F35A 4O3CA 4N81A 3RT6B 4EXLA 4JSDA 5KCJA 4G8MA 4WEPA 5TU0A 2XWVA 4NF6A 1YCJA 3MVYA 3QAXA 4R2FA 5JEIA 3B8BA 1INPA 1QUIA 4F3BA 2ONRA 1A40A 3S4UA 5L8DA 1Y3NA 4YKPA 3TPAA 3CHGA 3MW0A 1IXHA 3QSLA 3FXBA 4P11A 3FJ7A 2XXUA 2OWZA 3KC1A 3T66A 2HZKA 5ET8A 2F97A 4Z7EA 2DQVA 2QRYA 1YTVA 1LAHE 1B7ZA 1BLFA 2I49A 3GYYA 1DMBA 2CZKA 1QGXA 4IO2A 1F9BA 1OVBA 4R74A 1MS7A 4OWDA 2DE4A 5EHMA 2GHAA 3DM0A 1QKBA 4F3SA 2QMWA 1JW4A 2A5TA 1VDWA 1B40A 3IX1A 4OVQA 2WYPA 3GXAA 1DBZA 1B3LA 4YKIA 4YZZA 1URSA 4PFTA 4DZ1A 4GBWA 3PUVE 2HEUA 3G7WA 3L6HA 2DWIA 1SDXA 2RKMA 1SI0A 3R6UA 4F1VA 5H8HB 2XXTA 1N7WA 4HE0A 1SPIA 4YMAA 5BWJA 3HHFA 4PDHA 3VLVA 4PFWA 4GBVA 5EYHA 3C4MA 2DP8A 5IKBA 4QSEA 1Z7ME 5I2KB 3M8UA 1NL5A 5TP9A 1PDAA 3HCQA 3IFCA 5DW8A 3TKDA 1OMPA 3LV0A 2O69A 5DEXB 4YU0A 1S50A 4BDRA 4ZS9A 4YB5A 5IZ3A 4KPTA 2GRVA 3CSGA 3OO9A 4R2BA 4UABA 5CBRA 2DYXA 1N0TA 4MAGA 1D3KA 3M3LA 4H5GA 4R6HA 5TP9B 4OMBA 2WX9A 3VV5A 3E13X 4P9KA 3FVNA 4U1OA 3RUMA 3W9WA 4Q30B 1Y1MA 3DELB 1FTLA 5AA4B 5A5LA 1JVXA 2B65A 2XXHA 5TPAB 2WKYA 1Y3PA 3FVOA 2CZLA 5H8QB 2KLFA 1B05A 1B52A 1BTJA 5I3SA 2OJTA 5HM4B 4GWSA 5I57A 4OVJA 4RJZA 1LAXA 5BUUA 1LBZA 1P1WA 4K3FA 4HW8A 4IO6A 1P1NA 1IUDA 1JP4A 1PB7A 3U92A 4GWXA 3UORA 5AA3A 2B3FA 1UTBA 2RCBA 1JNFA 2QS3A 2F6GA 2XX9A 3KBRA 5DEXA 4IGTA 3JV9A 2V3QA 2G93A 2PT2A 1MPDA 3K6VA 2I58A 1RDYA 1QKAA 3ISPA 3MQ9A 3JYRA 4THIA 4JXIA 3TEPA 4ZDMA 1PC3A 1ZIUA 3Q27A 4PTKA 3FJGA 3TDJA 4MNPA 1YXIA 4FORA 2XXPA 3O6IA 5K2XA 1JW5A 1N3WA 2V84A 4EUOA 2XHDA 4KI0E 3B6TA 4PC9A 4ECFA 2XXRA 3B6WA 1FQAA 1FCKA 4N6PA 3G3GA 1MXUA 4KD5A 3FUZA 1LFHA 3SEYA 3B7DA 1MDP1 2LAOA 4GQOA 3D4CA 1BIYA 2E1SA 3A3UA 1B4ZA 5CRYA 4I62A 3MUQA 2H9BA 5HBCA 1KWHA 5CI5A 1K9YA 2Z8DA 4ELRA 2X7QA 3A3CA 4WEDA 4M1VA 4IO7A 1LCFA 4GWOA 1NH8A 4F31B 5CMKA 1A8FA 2Q8JA 4O8MA 4I8CA 1YPNA 5JK4A 2NUVA 2PX1A 4FJPA 4O3AA 5I7IA 2PYYA 2FIEA 1O63A 3M3KA 3H6UA 4GX3A 3E4RA 3TCGA 4RYAA 2PVUA 1Q9DA 3KOSA 2Y5KA 1Y1ZA 5ET7A 3TZAA 2ESNA 4NWCA 3C9HA 3PMXA 2GFEA 2HZLA 4EQ7A 4H8JA 4GX6A 2GQ1A 5AA2B 3S9EA 3IR1A 3RY3A 4P1LA 2DSFA 3THIA 4LP2B 1NNKA 1Y4CA 3PUXE 3DLNA 1LFGA 1MDQA 4ZEKA 1IMEA 5EQ9A 4H6DA 4LZ8A 1H76A 1B46A 2O51A 2XX7A 3PPQA 1B4HA 2DS9A 3KSXA 4GWWA 3SEUA 5CMBA 3TODA 3MVWA 4NF6B 2B3BA 2A5TB 3QMFA 1FPEA 4R72A 2F5XA 4EDPA 3QUFA 2I0CA 3TTRA 4IY6A 3UGWA 5B70A 2ZMBA 4HCWA 1M5BA 2OZZA 4I40A 3BIHA 2DXRA 4TQUQ 2B4MA 1N76A 4FIMA 1KZ8A 3IOVA 4PBHA 1Y9UA 5H8FA 1XC1A 2ZNUA 4N13A 4G61A 1MRPA 3KEIA 5EYFA 1IEJA 4ZZAA 2V25A 3KN7A 1FTMA 2F7CA 1PB9A 4FBPA 2HFBA 1UTHB 4LZ7A 4AQ4A 4NGUA 3HHGA 1YAEA 1IMBA 4PBQA 4HTGA 1ZKBA 4JVCA 1GR2A 3N6TA 2PT1A 1LBYA 1N3XA 2I4BA 1SVXB 2D21A 3TYHA 4GIZA 5FTIA 3SKPA 1MY2A 4U4SA 4N8YA 2FVZA 1ZU0A 1I6QA 4XKPA 2Y84A 4POXA 4F18A 4P1EA 3HN0A 3FJMA 2Q74A 2QVUA 1RKMA 1RDXA 1II5A 1A55A 4H45A 4NTLA 4N6KA 4O3BA 4ONYA 1G0HA 1HSLA 2QPQA 1O64A 3Q28A 1FPBA 1G0IA 5KDTA 1LBVA 5J1DA 5J16A 4GOTA 1SD3A 1BKAA 3FZVA 1FPDA 4H1XA 4ZEDA 1FPIA 4XEQA 3PD9A 3I6VA 2DWAA 2QVRA 2Q88A 3IOWA 1DTGA 1MH3A 3A29A 3FV2A 4F2QA 1NUXA 4PF8A 2XWKA 3HPIA 1M5EA 2YLNA 3LC8A 3IOTA 1B3FA 2NXOA 2IA4A 4FECA 4OVSA 4ZEIA 2QS1A 1MQIA 2I4CA 3QYTA 2F7AA 4R73A 3OO7A 2O7IA 3S9MC 3KSJA 2NVUB 4LUBA 4KCDA 4X9TA 3TCHA 3GZGA 2ZYMA 4QFPA 3MVZA
chains in the Genus database with same CATH topology
2O69A 3CG1A 4G77A 5I57B 2QMXA 1NKXA 1N7XA 5DEXB 4BDNA 1B5IA 3I3VA 1MY0A 4YU0A 4GLIA 1SW1A 1S50A 3G3JA 3T9XB 1RYXA 4BDRA 2QS4A 3MZ1A 4ISUA 4ZS9A 4YB5A 4HCYA 2I0BA 5ICTA 3GLBA 3OEKA 3OENA 4KPTA 4EXKA 2GRVA 3LR1A 4MH5A 2OCUA 1R1NA 4ND9A 3Q26A 3C36A 1EU8A 3CSGA 3OO9A 4N07A 4R2BA 3D4GA 4MBPA 3T9UA 4UACA 3O66A 3SDFA 3VLWA 5CBRA 2DYXA 5JTYA 1N0TA 1ELJA 1D3KA 2DWHA 3CI8A 3OXNA 3S2VA 1IIWA 1LAGE 3M3LA 4H5GA 4R6HA 5TP9B 1ATGA 4OMBA 1N84A 1I6AA 3OMBA 1AMFA 3BFUA 4DXCA 3K01A 4YICA 3VV5A 3E13X 1A99A 1VE4A 3EQ1A 1MXYA 1ZLQA 4OEUA 3EN3A 1OLCA 3B6QA 1MPCA 4LONB 3FVNA 4QHQA 4U1OA 4MLQA 3RUMA 3UK4A 4P0GA 3W9WA 4Q30B 2OLBA 1LBBA 1PBPA 1Y1MA 2P0SA 3DELB 1FTLA 3UP9A 4R6KA 3DP8A 2F8DA 1R9QA 3IJOB 1US5A 4XIGQ 5AA4B 4DXUA 2PMSA 3PUWE 1JVXA 2B65A 2V3TA 2XXHA 3I5OA 4NF8A 5TPAB 1D4NA 2UVIA 3N26A 3KN3A 2WKYA 1Y3PA 4DE8A 3FVOA 2CZLA 5I2NB 5H8QB 2XD2A 5I56B 2ZNSA 3QXMA 1J1NA 2A5SA 2KLFA 5ELVA 1B05A 1B52A 1BTJA 1S7YA 4GD5A 2UYFA 2OJTA 4PP0A 4C0RA 5HM4B 4QRZA 5FHOA 3TQWA 1JEUA 3WAEA 2RC9A 5I57A 3V83A 4R9GA 1M5CA 4OVJA 4QSDA 3FD3A 1H43A 4KYEA 4E0WA 3FATA 1NNTA 4RJZA 1LBCA 1LAXA 4JWXA 1SBPA 1GGGA 1UIUA 1DSNA 2Q2CA 4QSCA 2UXAA 3IB2A 2HAUA 4U23A 1T0KA 5BUUA 3IO6A 3H3GA 4E0XA 3PMVA 1MQDA 2O7UA 3BFTA 3FASA 3MJNA 1SW5A 4NE4A 1P1WA 3RT8A 4H5FA 3LSXA 3Q25A 4K3FA 4IO6A 2RC7A 2O84X 1P1NA 1PEBA 1IUDA 4G8NA 4LQ2A 1PB7A 1FTJA 3E3KA 5TPAA 5IAIA 1R9LA 1XVXA 3DP6A 1EZPA 2XXQA 3RNNA 3TTLA 1FQCA 2VD3A 3MP6A 4YKJA 1LLSA 1DTZA 3U92A 3UIFA 5KCJB 2H4IA 5I2NA 3R26A 3UORA 3SEXA 2B3FA 1UIVA 2GH9A 3PU5A 1UTBA 2RCBA 5AA3A 5I58B 4GVOA 3TTNA 4OFJA 2XXVA 4Q5TA 5A5XB 3ECRA 1JNFA 1FW0A 2NOOA 2F6GA 2P1SA 1O7TA 1I6BA 1S9TA 2QS3A 2XX9A 1BP5A 3GBAA 3KBRA 4FE8A 4IGTA 4U21A 3USDA 1B3GA 2V3QA 2G93A 3JV9A 1PB8A 4OERA 1LFIA 4WKMA 4DDDA 1MY4A 2PT2A 1MPDA 3K6VA 3U8QA 4C1TA 3T96B 1B7HA 1FTKA 4U4XA 4EQ9A 4AB6A 4ZE9A 2I58A 3PUYE 1FQDA 1LB9A 4LQ5A 3OD7A 1NNPA 4OXVA 5I59A 4ZEFA 5JK4A 1QKAA 3A09A 3IO4A 3MQ9A 2RC8A 3JYRA 4G68B 5F1QA 5HPQA 4EF2A 4NEDA 1SI1A 3DP4A 2V93A 3LUYA 4THIA 1B0HA 5I56A 5CC2A 1B58A 4RXLA 4JXIA 3TEPA 4ZDMA 1UTBB 1EH3A 2I3WA 1ZTYA 2AIXA 1PC3A 2ZYOA 4P0IA 4QFLA 1CE2A 3HV1A 2RCAA 4GL0A 3TUSA 1Y20A 4MF3A 3RGYA 1ZIUA 3Q27A 3TDJA 3FJGA 5H8HA 4MLVA 3QIMA 3CVGA 3MBPA 4FORA 4ESWA 1URDA 2XXPA 2UVHA 2RF1A 3O6IA 4R75A 4IY5A 5H8FB 4ELQA 5K2XA 4HW8A 1JW5A 5FTHA 4U2RA 1N3WA 1POTA 2ABHA 4F19A 4BDQA 2VP1A 3O9PA 4OZ9A 4XTCQ 2V84A 3PPNA 1VFEA 4F39A 4DCXA 2QJEA 1QW0A 4EUOA 3VVEA 2H25A 2Z22A 4GF8A 5DVIA 2X26A 2XHDA 4KI0E 4IO3A 3G3KA 3B6TA 4ECFA 2O1MA 2XXRA 3PPRA 4JB7A 3MC2A 1QULA 3B6WA 4GXSB 5K2YA 1FQAA 1FCKA 4N6PA 3G3GA 1MXUA 3VFJA 1QUKA 4KD5A 4LA9A 3FUZA 1LFHA 1RYOA 3QUJA 2F7BA 3SEYA 1M5DA 3B7DA 4Q0CA 1OQGA 5DVJA 4F1UA 3ZKKA 1MDP1 2LAOA 4GQOA 3TELA 2YJPA 3D4CA 3GBBA 4OQOA 4X1DA 3K1NA 4UA8A 1BIYA 2E1SA 1CB6A 1I69A 1OQHA 3TMGA 3A3UA 1LCTA 1B4ZA 3K02A 3W15C 2AL4A 5FHMA 2DVZA 1QJMA 3MWBA 3KGCA 5AA2A 5H8NB 5CRYA 1B9JA 3PV0E 1Q1KA 4I62A 1TWYA 3KJ7A 2H9BA 2F6PA 3MUQA 1KWHA 1FTOA 4G68A 5CI5A 4OESA 5HBCA 3W9VA 4KHZE 1M5FA 2Z8DA 1MG1A 3K1MA 4ELRA 3OO8A 3TCGA 4FEDA 4LVQA 2X7QA 3FVGA 3A3CA 4WEDA 2R9JA 4M1VA 4IO7A 4L17A 3T93B 1UTHA 1EZOA 1LCFA 3WAFA 2XX8A 1NH8A 4GWOA 4F31B 5ITPA 3LSFB 3RQTA 2XD3A 3LSLA 1A8FA 5CMKA 3OEMA 4HS7A 3IL1B 2Q8JA 4ELOA 3HSTA 1HSEA 2ZYNA 1WDNA 4I8CA 3PD8A 1YPNA 2OBGA 2NUVA 1TT1A 1VFDA 1D9YA 4IO5A 4KYDA 1POY1 3G3FA 3S9MC 2PX1A 3ODBA 4FJPA 3FV1A 3CR9A 4BLAA 1B0LA 4O3AA 1XT8A 5AA4A 5H8NA 2Z8FA 1B2HA 3TTKA 5CBSA 2PYYA 4XKQA 2OK2A 1LAFE 4ZE8A 1O63A 3M3KA 1B3EA 2DXYA 1A7LA 1SW4A 2Y7IA 3E4RA 3H6UA 1PBQA 4GFRA 3ONMA 3N6UA 2Y7KA 1B3HA 3OSRA 4RYAA 1MQHA 2PVUA 4H8IA 4TOZA 3KOSA 1IXGA 3K00A 4YKKA 1Y1ZA 3TZAA 5AA2D 4XKRA 2ESNA 3CIJA 4I1DA 4NWCA 2BJJX 2DWJA 1FQEA 3C9HA 4GRKA 1IZ1A 3PMXA 4OETA 1EZ9A 2F36A 4ESXA 2X7PA 1QVSA 2DE3A 5EHSA 1UQWA 3IAZA 2GFEA 2HZLA 3UN6A 3SETA 4NF4B 4RK2A 4EQ7A 1QUJA 4H8JA 4PFYA 5AA2B 1URGA 1NMUA 4GXAA 3S9EA 4KCCA 4PE5B 4YB7A 4WXJA 1WVJA 2G29A 1XOCA 1ZMGA 3IR1A 2V3UA 1LSTA 1IQ7A 4NF8B 4F2OA 2Q9TA 3H7MA 3KFMA 1GV8A 3RY3A 5DYHA 4YMBA 1JW1A 3LBSA 1ZBMA 2DSFA 1DOTA 2ZYKA 3V89B 3KG2A 1AIVA 3THIA 4LP2B 1NNKA 5I84A 4FEBA 3VE1B 2HCAA 4DCYA 1Y4CA 3PUXE 3DLNA 1LFGA 4X1BA 1B1XA 1MDQA 4ZEKA 1SYIA 3O6GA 3S9NC 4H6DA 4G4PA 1MXWA 2DOJA 2M8CA 1JETA 1ZJLA 4JBZA 4LZ8A 4C1UA 1DPPA 1H76A 1JQFA 3O97A 1B46A 2I6EA 2O51A 2XX7A 3PPQA 3H6WA 1B4HA 3PPOA 4XKNA 5DVFA 3CFLA 1L5TA 3RTWB 2DS9A 3KSXA 4OEVA 4OTEA 4U1ZA 3SEUA 5CMBA 5LOMA 4Q8RA 3TODA 2VGQA 1JVYA 4X48A 1SYHA 2OWTA 3ZKLA 4F3PA 1ANFA 3MVWA 4XXUA 1P99A 3C31A 3FGSA 5AA1A 1MY3A 2NWJA 3H4ZA 5KDTB 2PBWA 5I58A 2VHAA 3BKIB 4NF6B 3SERA 3L6GA 4U22A 4NF5B 4G68C 2B3BA 5DTBA 2A5TB 3VVFA 5A5XA 1XHYA 2IEEA 4R72A 2O1LA 1H44A 2F5XA 3PPPA 4FAJA 3C35A 4EDPA 2VD2A 2I0CA 3QUFA 3MPLA 3TTRA 1MH4A 5ICQA 1MXVA 2XXXA 2DE2A 1B7UA 1B51A 1DPEA 4IY6A 2R71A 3Q29A 5H8SA 4FATA 4JWYA 2RINA 4OYVA 3OOAA 3H6VA 4ZEBA 3T9HB 3U72A 3MPKA 3G3IA 3UGWA 1MM6A 2ZMBA 4HCWA 5B70A 1M5BA 1B6HA 1H3DA 2O68A 4PETA 5I59B 4IO4A 1MPBA 2GHBA 2OZZA 3BBRA 3E9XA 5L9OA 1US4A 1VSOA 2ZYMA 3MP1A 2DXRA 4ZZEA 4TQUQ 3MZ9A 4AB5A 5I2KA 2QL3A 3K6XA 4M4GA 4Z0IA 1IXIA 3V5AA 2H5YA 1LB8A 1JEVA 2XXIA 1N04A 2YPNA 1N76A 4NF5A 3EHTA 3FVKA 4FIMA 3IOVA 4PQJA 4QF9A 4RPNA 1Y9UA 5H8FA 2AL5A 2REJA 4YB6A 3K0VA 1XC1A 2ZNUA 3M3FA 4TLMB 3VDFA 4N13A 4TLLB 3FIRA 1MRPA 3H6TA 3H03A 3KEIA 4QFNA 3KZGA 3O29A 3IOUA 5EYFA 3K4UA 5B7DA 3VLUA 1IEJA 5AE4A 4OFLA 1XVYA 3QK6A 4ZZAA 1MXZA 2OWSA 2R6GE 2V25A 1XS5A 3O6HA 1Q35A 1Y3QA 3KN7A 2ALUA 3N5LA 1FTMA 5M2VA 3RN8A 4RA1A 2F7CA 2DVCA 1PB9A 3CG3A 5DT6A 3K6UA 3CRBA 2HFBA 3EHUA 4IB2A 1OIBA 1P1QA 1MM7A 1UTHB 3LSWA 4LZ7A 4H0WA 3SEWA 3VXCA 2H99A 4AQ4A 1LGBC 2Q2AA 4EQBA 3PGFA 1USYH 3HHGA 3IK6B 3TQLA 1Z7NE 2XXYA 1P1OA 2THIA 4KQPA 3TCFA 2ONKE 3G3HA 1YAEA 1WODA 2VOZA 4OHNA 2QSXA 3O28A 4ELPA 3K6WA 3EF7A 2F35A 4O3CA 4R6YA 4YAHX 4HTGA 3AXFA 3R7XA 1ZKBA 1D9VA 3T22A 5FHNA 1AOVA 3RT6B 1OVTA 3JZJA 3ZS6A 2CMOA 4EXLA 4G2ZA 4JSDA 2REGA 1GR2A 3IORA 3HO7A 3S9LC 3UA8A 5KCJA 3N6TA 4G8MA 3MP8A 4WEPA 5TU0A 4NF6A 3C32A 2PT1A 3T9VA 5ITOA 1N3XA 1YCJA 2I4BA 3MVYA 3QAXA 4R2FA 4DIGA 3U93A 5JEIA 1SVXB 3VXBA 3CFZA 2F78A 2D21A 3TYHA 1QUIA 4GIZA 3H06B 4F3BA 3CFXA 5FTIA 4GL8A 4EF1A 2ONRA 2HAVA 1A40A 3S4UA 5L8DA 3SKPA 4DXBA 5L9SA 1MY2A 3C33A 3VVDA 4U4SA 5ISUA 1Y3NA 1IXCA 2Y7PA 1TFDA 4YKPA 2AYSA 3TPAA 1R6ZA 3FXRA 1ZU0A 3MW0A 1I6QA 4I9DA 1IXHA 3TAJA 2D3IA 3QSLA 4DLDA 4XKPA 3OELA 4P11A 2Y84A 3FJ7A 4JWOA 3P7IA 2XXUA 4POXA 5H8QA 4F18A 3IB0A 5CM6A 1NFTA 3TTMA 3KOTA 3HN0A 1A54A 3T66A 2HZKA 3FJMA 3FXUA 1USYE 1MQGA 2F97A 1SQYA 2HQ0A 3MVXA 5DEXA 2ANJA 3RPWA 4DZ1A 2UYEA 4Z7EA 1RKMA 1SW2A 2DQVA 2QRYA 2ZNTA 1YTVA 3O2AA 1LAHE 1B32A 1Y4TA 1II5A 1B7ZA 4NMYA 1BLFA 1A55A 2I49A 2E0SA 2FA7A 3OO6A 1IITA 2QS2A 4NTLA 2F34A 2HXWA 1DMBA 2UVJA 3IB1A 4O3BA 4ONYA 4QFKA 4IO2A 1F9BA 2XXWA 1A8EA 1OVBA 2ONSA 5KZTA 1HSLA 1H45A 2QPQA 2Z23A 4OFOA 2FYIA 4H65A 2ZXTA 5JTYB 1O64A 4R74A 3ILTB 3SEVA 3Q28A 1OLAA 1MS7A 3V8XB 1NNFA 4OWDA 3F11A 2DE4A 4IGRA 5EHMA 2GHAA 4F29A 5KDTA 3DM0A 4ZECA 3ILUB 5J1DA 1QKBA 4F3SA 2QMWA 4GOTA 1MXXA 1JW4A 2A5TA 1SD3A 4KR5A 4BDOA 1BKAA 3FZVA 3MZBA 4JDFA 4H1XA 1B1HA 1B40A 4ZEDA 3IX1A 2Q89A 1AL3A 3GXAA 1B3LA 3CSBA 2Y7WA 4YKIA 1GVCA 1AH5A 4BDLA 3PD9A 4NF4A 3I6VA 4YZZA 2DWAA 1TXFA 3KN8A 2Q88A 4BDMA 1B5JA 3KJTA 5CMMA 5CMCA 3IOWA 1DTGA 3K1PA 1MH3A 3IJXB 3U1OA 4QFOA 1URSA 1GTKA 4LATA 4PFTA 4RPOA 2D5WA 2O6AA 2FNCA 1B5HA 2HEUA 3PUVE 3FV2A 4F2QA 4F1YA 4MFIA 3G7WA 1FQBA 3L6HA 2P2AA 2DWIA 1SDXA 2Y7RA 3RTFB 3K2DA 1MY1A 2UVGA 3HPIA 3EPEA 2RKMA 1M5EA 4LZ5A 4RNSA 2YLNA 3LC8A 1SI0A 3R6UA 4JSOA 3IOTA 4RK9A 5H8HB 2H98A 3SESA 4F1VA 2XXTA 1N7WA 1B3FA 3PMWA 1VR5A 2NXOA 2IA4A 4FECA 2W7YA 4H67A 4YMAA 5BWJA 3EHSA 4KYSA 4PFUA 1NH7A 4ZEIA 3HHFA 2QS1A 5L9MA 4KFQA 1FQFA 1MQIA 2Z8EA 3TFLA 3VLVA 2I4CA 4PFWA 3ZSFA 3PUZE 3RLFE 3OSQA 3QYTA 1TFAA 2F7AA 3C4MA 4R73A 4RY1A 2DP8A 4F22A 3MAMA 4G8HA 4F3GA 3N94A 1MQJA 2O7IA 3FXQA 3OO7A 4QSEA 5IKBA 3C34A 1Z7ME 4NWDA 3KSJA 4POWA 3U94A 5I2KB 3M8UA 4QFPA 1NL5A 5TP9A 2NVUB 1PDAA 4KCDA 4LUBA 3HCQA 4OENA 4X9TA 4R9FA 5F7VA 3GZGA 3TKDA 2I48A 3TCHA 2I3VA 1OMPA 1HSJA 1P1UA 3MVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O69 A;  3CG1 A;  4G77 A;  5I57 B;  2QMX A;  1NKX A;  1N7X A;  5DEX B;  4BDN A;  1B5I A;  3I3V A;  1MY0 A;  4YU0 A;  4GLI A;  1SW1 A;  1S50 A;  3G3J A;  3T9X B;  1RYX A;  4BDR A;  2QS4 A;  3MZ1 A;  4ISU A;  4ZS9 A;  4YB5 A;  4HCY A;  2I0B A;  5ICT A;  3GLB A;  3OEK A;  3OEN A;  4KPT A;  4EXK A;  2GRV A;  3LR1 A;  4MH5 A;  2OCU A;  1R1N A;  4ND9 A;  3Q26 A;  3C36 A;  1EU8 A;  3CSG A;  3OO9 A;  4N07 A;  4R2B A;  3D4G A;  4MBP A;  3T9U A;  4UAC A;  3O66 A;  3SDF A;  3VLW A;  5CBR A;  2DYX A;  5JTY A;  1N0T A;  1ELJ A;  1D3K A;  2DWH A;  3CI8 A;  3OXN A;  3S2V A;  1IIW A;  1LAG E;  3M3L A;  4H5G A;  4R6H A;  5TP9 B;  1ATG A;  4OMB A;  1N84 A;  1I6A A;  3OMB A;  1AMF A;  3BFU A;  4DXC A;  3K01 A;  4YIC A;  3VV5 A;  3E13 X;  1A99 A;  1VE4 A;  3EQ1 A;  1MXY A;  1ZLQ A;  4OEU A;  3EN3 A;  1OLC A;  3B6Q A;  1MPC A;  4LON B;  3FVN A;  4QHQ A;  4U1O A;  4MLQ A;  3RUM A;  3UK4 A;  4P0G A;  3W9W A;  4Q30 B;  2OLB A;  1LBB A;  1PBP A;  1Y1M A;  2P0S A;  3DEL B;  1FTL A;  3UP9 A;  4R6K A;  3DP8 A;  2F8D A;  1R9Q A;  3IJO B;  1US5 A;  4XIG Q;  5AA4 B;  4DXU A;  2PMS A;  3PUW E;  1JVX A;  2B65 A;  2V3T A;  2XXH A;  3I5O A;  4NF8 A;  5TPA B;  1D4N A;  2UVI A;  3N26 A;  3KN3 A;  2WKY A;  1Y3P A;  4DE8 A;  3FVO A;  2CZL A;  5I2N B;  5H8Q B;  2XD2 A;  5I56 B;  2ZNS A;  3QXM A;  1J1N A;  2A5S A;  2KLF A;  5ELV A;  1B05 A;  1B52 A;  1BTJ A;  1S7Y A;  4GD5 A;  2UYF A;  2OJT A;  4PP0 A;  4C0R A;  5HM4 B;  4QRZ A;  5FHO A;  3TQW A;  1JEU A;  3WAE A;  2RC9 A;  5I57 A;  3V83 A;  4R9G A;  1M5C A;  4OVJ A;  4QSD A;  3FD3 A;  1H43 A;  4KYE A;  4E0W A;  3FAT A;  1NNT A;  4RJZ A;  1LBC A;  1LAX A;  4JWX A;  1SBP A;  1GGG A;  1UIU A;  1DSN A;  2Q2C A;  4QSC A;  2UXA A;  3IB2 A;  2HAU A;  4U23 A;  1T0K A;  5BUU A;  3IO6 A;  3H3G A;  4E0X A;  3PMV A;  1MQD A;  2O7U A;  3BFT A;  3FAS A;  3MJN A;  1SW5 A;  4NE4 A;  1P1W A;  3RT8 A;  4H5F A;  3LSX A;  3Q25 A;  4K3F A;  4IO6 A;  2RC7 A;  2O84 X;  1P1N A;  1PEB A;  1IUD A;  4G8N A;  4LQ2 A;  1PB7 A;  1FTJ A;  3E3K A;  5TPA A;  5IAI A;  1R9L A;  1XVX A;  3DP6 A;  1EZP A;  2XXQ A;  3RNN A;  3TTL A;  1FQC A;  2VD3 A;  3MP6 A;  4YKJ A;  1LLS A;  1DTZ A;  3U92 A;  3UIF A;  5KCJ B;  2H4I A;  5I2N A;  3R26 A;  3UOR A;  3SEX A;  2B3F A;  1UIV A;  2GH9 A;  3PU5 A;  1UTB A;  2RCB A;  5AA3 A;  5I58 B;  4GVO A;  3TTN A;  4OFJ A;  2XXV A;  4Q5T A;  5A5X B;  3ECR A;  1JNF A;  1FW0 A;  2NOO A;  2F6G A;  2P1S A;  1O7T A;  1I6B A;  1S9T A;  2QS3 A;  2XX9 A;  1BP5 A;  3GBA A;  3KBR A;  4FE8 A;  4IGT A;  4U21 A;  3USD A;  1B3G A;  2V3Q A;  2G93 A;  3JV9 A;  1PB8 A;  4OER A;  1LFI A;  4WKM A;  4DDD A;  1MY4 A;  2PT2 A;  1MPD A;  3K6V A;  3U8Q A;  4C1T A;  3T96 B;  1B7H A;  1FTK A;  4U4X A;  4EQ9 A;  4AB6 A;  4ZE9 A;  2I58 A;  3PUY E;  1FQD A;  1LB9 A;  4LQ5 A;  3OD7 A;  1NNP A;  4OXV A;  5I59 A;  4ZEF A;  5JK4 A;  1QKA A;  3A09 A;  3IO4 A;  3MQ9 A;  2RC8 A;  3JYR A;  4G68 B;  5F1Q A;  5HPQ A;  4EF2 A;  4NED A;  1SI1 A;  3DP4 A;  2V93 A;  3LUY A;  4THI A;  1B0H A;  5I56 A;  5CC2 A;  1B58 A;  4RXL A;  4JXI A;  3TEP A;  4ZDM A;  1UTB B;  1EH3 A;  2I3W A;  1ZTY A;  2AIX A;  1PC3 A;  2ZYO A;  4P0I A;  4QFL A;  1CE2 A;  3HV1 A;  2RCA A;  4GL0 A;  3TUS A;  1Y20 A;  4MF3 A;  3RGY A;  1ZIU A;  3Q27 A;  3TDJ A;  3FJG A;  5H8H A;  4MLV A;  3QIM A;  3CVG A;  3MBP A;  4FOR A;  4ESW A;  1URD A;  2XXP A;  2UVH A;  2RF1 A;  3O6I A;  4R75 A;  4IY5 A;  5H8F B;  4ELQ A;  5K2X A;  4HW8 A;  1JW5 A;  5FTH A;  4U2R A;  1N3W A;  1POT A;  2ABH A;  4F19 A;  4BDQ A;  2VP1 A;  3O9P A;  4OZ9 A;  4XTC Q;  2V84 A;  3PPN A;  1VFE A;  4F39 A;  4DCX A;  2QJE A;  1QW0 A;  4EUO A;  3VVE A;  2H25 A;  2Z22 A;  4GF8 A;  5DVI A;  2X26 A;  2XHD A;  4KI0 E;  4IO3 A;  3G3K A;  3B6T A;  4ECF A;  2O1M A;  2XXR A;  3PPR A;  4JB7 A;  3MC2 A;  1QUL A;  3B6W A;  4GXS B;  5K2Y A;  1FQA A;  1FCK A;  4N6P A;  3G3G A;  1MXU A;  3VFJ A;  1QUK A;  4KD5 A;  4LA9 A;  3FUZ A;  1LFH A;  1RYO A;  3QUJ A;  2F7B A;  3SEY A;  1M5D A;  3B7D A;  4Q0C A;  1OQG A;  5DVJ A;  4F1U A;  3ZKK A;  1MDP 1;  2LAO A;  4GQO A;  3TEL A;  2YJP A;  3D4C A;  3GBB A;  4OQO A;  4X1D A;  3K1N A;  4UA8 A;  1BIY A;  2E1S A;  1CB6 A;  1I69 A;  1OQH A;  3TMG A;  3A3U A;  1LCT A;  1B4Z A;  3K02 A;  3W15 C;  2AL4 A;  5FHM A;  2DVZ A;  1QJM A;  3MWB A;  3KGC A;  5AA2 A;  5H8N B;  5CRY A;  1B9J A;  3PV0 E;  1Q1K A;  4I62 A;  1TWY A;  3KJ7 A;  2H9B A;  2F6P A;  3MUQ A;  1KWH A;  1FTO A;  4G68 A;  5CI5 A;  4OES A;  5HBC A;  3W9V A;  4KHZ E;  1M5F A;  2Z8D A;  1MG1 A;  3K1M A;  4ELR A;  3OO8 A;  3TCG A;  4FED A;  4LVQ A;  2X7Q A;  3FVG A;  3A3C A;  4WED A;  2R9J A;  4M1V A;  4IO7 A;  4L17 A;  3T93 B;  1UTH A;  1EZO A;  1LCF A;  3WAF A;  2XX8 A;  1NH8 A;  4GWO A;  4F31 B;  5ITP A;  3LSF B;  3RQT A;  2XD3 A;  3LSL A;  1A8F A;  5CMK A;  3OEM A;  4HS7 A;  3IL1 B;  2Q8J A;  4ELO A;  3HST A;  1HSE A;  2ZYN A;  1WDN A;  4I8C A;  3PD8 A;  1YPN A;  2OBG A;  2NUV A;  1TT1 A;  1VFD A;  1D9Y A;  4IO5 A;  4KYD A;  1POY 1;  3G3F A;  3S9M C;  2PX1 A;  3ODB A;  4FJP A;  3FV1 A;  3CR9 A;  4BLA A;  1B0L A;  4O3A A;  1XT8 A;  5AA4 A;  5H8N A;  2Z8F A;  1B2H A;  3TTK A;  5CBS A;  2PYY A;  4XKQ A;  2OK2 A;  1LAF E;  4ZE8 A;  1O63 A;  3M3K A;  1B3E A;  2DXY A;  1A7L A;  1SW4 A;  2Y7I A;  3E4R A;  3H6U A;  1PBQ A;  4GFR A;  3ONM A;  3N6U A;  2Y7K A;  1B3H A;  3OSR A;  4RYA A;  1MQH A;  2PVU A;  4H8I A;  4TOZ A;  3KOS A;  1IXG A;  3K00 A;  4YKK A;  1Y1Z A;  3TZA A;  5AA2 D;  4XKR A;  2ESN A;  3CIJ A;  4I1D A;  4NWC A;  2BJJ X;  2DWJ A;  1FQE A;  3C9H A;  4GRK A;  1IZ1 A;  3PMX A;  4OET A;  1EZ9 A;  2F36 A;  4ESX A;  2X7P A;  1QVS A;  2DE3 A;  5EHS A;  1UQW A;  3IAZ A;  2GFE A;  2HZL A;  3UN6 A;  3SET A;  4NF4 B;  4RK2 A;  4EQ7 A;  1QUJ A;  4H8J A;  4PFY A;  5AA2 B;  1URG A;  1NMU A;  4GXA A;  3S9E A;  4KCC A;  4PE5 B;  4YB7 A;  4WXJ A;  1WVJ A;  2G29 A;  1XOC A;  1ZMG A;  3IR1 A;  2V3U A;  1LST A;  1IQ7 A;  4NF8 B;  4F2O A;  2Q9T A;  3H7M A;  3KFM A;  1GV8 A;  3RY3 A;  5DYH A;  4YMB A;  1JW1 A;  3LBS A;  1ZBM A;  2DSF A;  1DOT A;  2ZYK A;  3V89 B;  3KG2 A;  1AIV A;  3THI A;  4LP2 B;  1NNK A;  5I84 A;  4FEB A;  3VE1 B;  2HCA A;  4DCY A;  1Y4C A;  3PUX E;  3DLN A;  1LFG A;  4X1B A;  1B1X A;  1MDQ A;  4ZEK A;  1SYI A;  3O6G A;  3S9N C;  4H6D A;  4G4P A;  1MXW A;  2DOJ A;  2M8C A;  1JET A;  1ZJL A;  4JBZ A;  4LZ8 A;  4C1U A;  1DPP A;  1H76 A;  1JQF A;  3O97 A;  1B46 A;  2I6E A;  2O51 A;  2XX7 A;  3PPQ A;  3H6W A;  1B4H A;  3PPO A;  4XKN A;  5DVF A;  3CFL A;  1L5T A;  3RTW B;  2DS9 A;  3KSX A;  4OEV A;  4OTE A;  4U1Z A;  3SEU A;  5CMB A;  5LOM A;  4Q8R A;  3TOD A;  2VGQ A;  1JVY A;  4X48 A;  1SYH A;  2OWT A;  3ZKL A;  4F3P A;  1ANF A;  3MVW A;  4XXU A;  1P99 A;  3C31 A;  3FGS A;  5AA1 A;  1MY3 A;  2NWJ A;  3H4Z A;  5KDT B;  2PBW A;  5I58 A;  2VHA A;  3BKI B;  4NF6 B;  3SER A;  3L6G A;  4U22 A;  4NF5 B;  4G68 C;  2B3B A;  5DTB A;  2A5T B;  3VVF A;  5A5X A;  1XHY A;  2IEE A;  4R72 A;  2O1L A;  1H44 A;  2F5X A;  3PPP A;  4FAJ A;  3C35 A;  4EDP A;  2VD2 A;  2I0C A;  3QUF A;  3MPL A;  3TTR A;  1MH4 A;  5ICQ A;  1MXV A;  2XXX A;  2DE2 A;  1B7U A;  1B51 A;  1DPE A;  4IY6 A;  2R71 A;  3Q29 A;  5H8S A;  4FAT A;  4JWY A;  2RIN A;  4OYV A;  3OOA A;  3H6V A;  4ZEB A;  3T9H B;  3U72 A;  3MPK A;  3G3I A;  3UGW A;  1MM6 A;  2ZMB A;  4HCW A;  5B70 A;  1M5B A;  1B6H A;  1H3D A;  2O68 A;  4PET A;  5I59 B;  4IO4 A;  1MPB A;  2GHB A;  2OZZ A;  3BBR A;  3E9X A;  5L9O A;  1US4 A;  1VSO A;  2ZYM A;  3MP1 A;  2DXR A;  4ZZE A;  4TQU Q;  3MZ9 A;  4AB5 A;  5I2K A;  2QL3 A;  3K6X A;  4M4G A;  4Z0I A;  1IXI A;  3V5A A;  2H5Y A;  1LB8 A;  1JEV A;  2XXI A;  1N04 A;  2YPN A;  1N76 A;  4NF5 A;  3EHT A;  3FVK A;  4FIM A;  3IOV A;  4PQJ A;  4QF9 A;  4RPN A;  1Y9U A;  5H8F A;  2AL5 A;  2REJ A;  4YB6 A;  3K0V A;  1XC1 A;  2ZNU A;  3M3F A;  4TLM B;  3VDF A;  4N13 A;  4TLL B;  3FIR A;  1MRP A;  3H6T A;  3H03 A;  3KEI A;  4QFN A;  3KZG A;  3O29 A;  3IOU A;  5EYF A;  3K4U A;  5B7D A;  3VLU A;  1IEJ A;  5AE4 A;  4OFL A;  1XVY A;  3QK6 A;  4ZZA A;  1MXZ A;  2OWS A;  2R6G E;  2V25 A;  1XS5 A;  3O6H A;  1Q35 A;  1Y3Q A;  3KN7 A;  2ALU A;  3N5L A;  1FTM A;  5M2V A;  3RN8 A;  4RA1 A;  2F7C A;  2DVC A;  1PB9 A;  3CG3 A;  5DT6 A;  3K6U A;  3CRB A;  2HFB A;  3EHU A;  4IB2 A;  1OIB A;  1P1Q A;  1MM7 A;  1UTH B;  3LSW A;  4LZ7 A;  4H0W A;  3SEW A;  3VXC A;  2H99 A;  4AQ4 A;  1LGB C;  2Q2A A;  4EQB A;  3PGF A;  1USY H;  3HHG A;  3IK6 B;  3TQL A;  1Z7N E;  2XXY A;  1P1O A;  2THI A;  4KQP A;  3TCF A;  2ONK E;  3G3H A;  1YAE A;  1WOD A;  2VOZ A;  4OHN A;  2QSX A;  3O28 A;  4ELP A;  3K6W A;  3EF7 A;  2F35 A;  4O3C A;  4R6Y A;  4YAH X;  4HTG A;  3AXF A;  3R7X A;  1ZKB A;  1D9V A;  3T22 A;  5FHN A;  1AOV A;  3RT6 B;  1OVT A;  3JZJ A;  3ZS6 A;  2CMO A;  4EXL A;  4G2Z A;  4JSD A;  2REG A;  1GR2 A;  3IOR A;  3HO7 A;  3S9L C;  3UA8 A;  5KCJ A;  3N6T A;  4G8M A;  3MP8 A;  4WEP A;  5TU0 A;  4NF6 A;  3C32 A;  2PT1 A;  3T9V A;  5ITO A;  1N3X A;  1YCJ A;  2I4B A;  3MVY A;  3QAX A;  4R2F A;  4DIG A;  3U93 A;  5JEI A;  1SVX B;  3VXB A;  3CFZ A;  2F78 A;  2D21 A;  3TYH A;  1QUI A;  4GIZ A;  3H06 B;  4F3B A;  3CFX A;  5FTI A;  4GL8 A;  4EF1 A;  2ONR A;  2HAV A;  1A40 A;  3S4U A;  5L8D A;  3SKP A;  4DXB A;  5L9S A;  1MY2 A;  3C33 A;  3VVD A;  4U4S A;  5ISU A;  1Y3N A;  1IXC A;  2Y7P A;  1TFD A;  4YKP A;  2AYS A;  3TPA A;  1R6Z A;  3FXR A;  1ZU0 A;  3MW0 A;  1I6Q A;  4I9D A;  1IXH A;  3TAJ A;  2D3I A;  3QSL A;  4DLD A;  4XKP A;  3OEL A;  4P11 A;  2Y84 A;  3FJ7 A;  4JWO A;  3P7I A;  2XXU A;  4POX A;  5H8Q A;  4F18 A;  3IB0 A;  5CM6 A;  1NFT A;  3TTM A;  3KOT A;  3HN0 A;  1A54 A;  3T66 A;  2HZK A;  3FJM A;  3FXU A;  1USY E;  1MQG A;  2F97 A;  1SQY A;  2HQ0 A;  3MVX A;  5DEX A;  2ANJ A;  3RPW A;  4DZ1 A;  2UYE A;  4Z7E A;  1RKM A;  1SW2 A;  2DQV A;  2QRY A;  2ZNT A;  1YTV A;  3O2A A;  1LAH E;  1B32 A;  1Y4T A;  1II5 A;  1B7Z A;  4NMY A;  1BLF A;  1A55 A;  2I49 A;  2E0S A;  2FA7 A;  3OO6 A;  1IIT A;  2QS2 A;  4NTL A;  2F34 A;  2HXW A;  1DMB A;  2UVJ A;  3IB1 A;  4O3B A;  4ONY A;  4QFK A;  4IO2 A;  1F9B A;  2XXW A;  1A8E A;  1OVB A;  2ONS A;  5KZT A;  1HSL A;  1H45 A;  2QPQ A;  2Z23 A;  4OFO A;  2FYI A;  4H65 A;  2ZXT A;  5JTY B;  1O64 A;  4R74 A;  3ILT B;  3SEV A;  3Q28 A;  1OLA A;  1MS7 A;  3V8X B;  1NNF A;  4OWD A;  3F11 A;  2DE4 A;  4IGR A;  5EHM A;  2GHA A;  4F29 A;  5KDT A;  3DM0 A;  4ZEC A;  3ILU B;  5J1D A;  1QKB A;  4F3S A;  2QMW A;  4GOT A;  1MXX A;  1JW4 A;  2A5T A;  1SD3 A;  4KR5 A;  4BDO A;  1BKA A;  3FZV A;  3MZB A;  4JDF A;  4H1X A;  1B1H A;  1B40 A;  4ZED A;  3IX1 A;  2Q89 A;  1AL3 A;  3GXA A;  1B3L A;  3CSB A;  2Y7W A;  4YKI A;  1GVC A;  1AH5 A;  4BDL A;  3PD9 A;  4NF4 A;  3I6V A;  4YZZ A;  2DWA A;  1TXF A;  3KN8 A;  2Q88 A;  4BDM A;  1B5J A;  3KJT A;  5CMM A;  5CMC A;  3IOW A;  1DTG A;  3K1P A;  1MH3 A;  3IJX B;  3U1O A;  4QFO A;  1URS A;  1GTK A;  4LAT A;  4PFT A;  4RPO A;  2D5W A;  2O6A A;  2FNC A;  1B5H A;  2HEU A;  3PUV E;  3FV2 A;  4F2Q A;  4F1Y A;  4MFI A;  3G7W A;  1FQB A;  3L6H A;  2P2A A;  2DWI A;  1SDX A;  2Y7R A;  3RTF B;  3K2D A;  1MY1 A;  2UVG A;  3HPI A;  3EPE A;  2RKM A;  1M5E A;  4LZ5 A;  4RNS A;  2YLN A;  3LC8 A;  1SI0 A;  3R6U A;  4JSO A;  3IOT A;  4RK9 A;  5H8H B;  2H98 A;  3SES A;  4F1V A;  2XXT A;  1N7W A;  1B3F A;  3PMW A;  1VR5 A;  2NXO A;  2IA4 A;  4FEC A;  2W7Y A;  4H67 A;  4YMA A;  5BWJ A;  3EHS A;  4KYS A;  4PFU A;  1NH7 A;  4ZEI A;  3HHF A;  2QS1 A;  5L9M A;  4KFQ A;  1FQF A;  1MQI A;  2Z8E A;  3TFL A;  3VLV A;  2I4C A;  4PFW A;  3ZSF A;  3PUZ E;  3RLF E;  3OSQ A;  3QYT A;  1TFA A;  2F7A A;  3C4M A;  4R73 A;  4RY1 A;  2DP8 A;  4F22 A;  3MAM A;  4G8H A;  4F3G A;  3N94 A;  1MQJ A;  2O7I A;  3FXQ A;  3OO7 A;  4QSE A;  5IKB A;  3C34 A;  1Z7M E;  4NWD A;  3KSJ A;  4POW A;  3U94 A;  5I2K B;  3M8U A;  4QFP A;  1NL5 A;  5TP9 A;  2NVU B;  1PDA A;  4KCD A;  4LUB A;  3HCQ A;  4OEN A;  4X9T A;  4R9F A;  5F7V A;  3GZG A;  3TKD A;  2I48 A;  3TCH A;  2I3V A;  1OMP A;  1HSJ A;  1P1U A;  3MVZ A; 
#chains in the Genus database with same CATH topology
 1NI9 A;  4G77 A;  1FJ6 A;  1N7X A;  2VPO A;  1B5I A;  4BDN A;  4GLI A;  1SW1 A;  1RYX A;  2QS4 A;  4HCY A;  3OEK A;  3OEN A;  4EXK A;  4MH5 A;  3C36 A;  4MBP A;  4P3L A;  3VLW A;  2DWH A;  3OXN A;  1IIW A;  1FSA A;  1I6A A;  3OMB A;  2CZH A;  3BFU A;  4DXC A;  3K01 A;  4YIC A;  3T0J A;  1VE4 A;  4OEU A;  3EN3 A;  4P47 A;  1NUY A;  4P0G A;  2OLB A;  1LBB A;  4MHF A;  3PUW E;  2V3T A;  4NF8 A;  2JJK A;  2UVI A;  4DE8 A;  1YZ0 A;  1BK4 A;  2ZNS A;  3QXM A;  5I56 B;  4PP0 A;  4C0R A;  2CZI A;  3ROJ A;  2RC9 A;  1M5C A;  4E0W A;  4JWX A;  1GGG A;  1UIU A;  1DSN A;  4JVD A;  3BFT A;  3RT8 A;  1RDZ A;  3Q25 A;  4QBA A;  4G8N A;  4LQ2 A;  1EZP A;  3RNN A;  3TTL A;  3MP6 A;  4YKJ A;  1YYZ A;  3R26 A;  2HPG A;  5I58 B;  2XXV A;  5EHS A;  2P1S A;  1O7T A;  1FJ9 A;  3GBA A;  4OER A;  1MY4 A;  3FBP A;  3T96 B;  1FTK A;  4EQ9 A;  3PUY E;  1FQD A;  1LB9 A;  5I59 A;  1XI6 A;  1FBC A;  3IO4 A;  1LBX A;  4O7I A;  3SZP A;  1B0H A;  5CC2 A;  1B58 A;  4RXL A;  1EH3 A;  1CNQ A;  1CE2 A;  1Y20 A;  3QIM A;  1URD A;  2UVH A;  4ELQ A;  4R75 A;  2XWI A;  2KQZ A;  4OAN A;  3O9P A;  4OZ9 A;  1VFE A;  3IFA A;  4F39 A;  4GF8 A;  2X26 A;  4IO3 A;  1QUL A;  1FPG A;  4LA9 A;  3QUJ A;  2F7B A;  1M5D A;  1OQG A;  3B50 A;  4X1D A;  4UA8 A;  3TMG A;  1LCT A;  3K02 A;  2AL4 A;  2B4L A;  5FHM A;  3MWB A;  1QJM A;  3KGC A;  5H8N B;  3KJ7 A;  1FTO A;  4KHZ E;  1MG1 A;  3FVG A;  2R9J A;  4L17 A;  1UTH A;  2XX8 A;  2XD3 A;  1LEV A;  1HSE A;  2ZZX A;  1WDN A;  3PD8 A;  3RGY A;  2OBG A;  4IO5 A;  3G3F A;  1FPL A;  3FV1 A;  1B0L A;  1XT8 A;  5H8N A;  3TTK A;  4XKQ A;  4PFI A;  1B3E A;  2Y7I A;  4U23 A;  1SW4 A;  3ONM A;  2Y7K A;  1B3H A;  4H8I A;  4NF0 A;  1IXG A;  3K00 A;  3BIG A;  4YKK A;  3T1B A;  5AA2 D;  4XKR A;  3CIJ A;  3VXB A;  5ET5 A;  1EYJ A;  1FQE A;  3UN6 A;  4RK2 A;  1QUJ A;  1URG A;  2Q9T A;  3H7M A;  1GV8 A;  3LBS A;  1ZBM A;  1AIV A;  5I84 A;  3VE1 B;  3RPL B;  4X1B A;  4KXP A;  1SYI A;  3O6G A;  2DOJ A;  2CEX A;  4XFE A;  2F3D A;  4C1U A;  4O94 A;  1NV7 A;  3H6W A;  2ZZV A;  4Q8R A;  4GX4 A;  1SYH A;  2OWT A;  4XXU A;  1P99 A;  3C31 A;  2MKZ A;  3SER A;  2IEE A;  4N4U A;  1H44 A;  5ICQ A;  3MPL A;  1MXV A;  2DE2 A;  4JWY A;  3OOA A;  3H6V A;  4ZEB A;  3MPK A;  3G3I A;  1LBW A;  1H3D A;  1US4 A;  1VSO A;  3MP1 A;  3MZ9 A;  3K6X A;  4M4G A;  4Z0I A;  3V5A A;  5IM2 A;  1JEV A;  2XXI A;  1N04 A;  2AL5 A;  2REJ A;  4GWZ A;  4YB6 A;  4TLL B;  3FIR A;  3H6T A;  4N91 A;  4QFN A;  1NV4 A;  3K4U A;  3VLU A;  1EYK A;  4OFL A;  3O6H A;  4HS7 A;  2ALU A;  1NV6 A;  4NQ8 A;  2DVC A;  3CG3 A;  5DT6 A;  3K6U A;  3RPL A;  1P1Q A;  3LSW A;  2Q2A A;  4EQB A;  3IK6 B;  3G3H A;  1KA1 A;  1WOD A;  2QSX A;  3O28 A;  4ELP A;  3K6W A;  4R6Y A;  2HXR A;  1AOV A;  5FHN A;  4PAK A;  4G2Z A;  2REG A;  3HO7 A;  2XA5 A;  3C32 A;  3T9V A;  5ITO A;  4DIG A;  4DI4 B;  4GL8 A;  5L9S A;  3C33 A;  5ISU A;  1IMD A;  1TFD A;  2AYS A;  1R6Z A;  2VPN A;  3FXR A;  4JWO A;  5H8Q A;  1NFT A;  3KOT A;  1A54 A;  1USY E;  2HQ0 A;  3MVX A;  2ANJ A;  2UYE A;  2ZNT A;  3O2A A;  4P8B A;  1Y4T A;  1B32 A;  2FA7 A;  1IIT A;  3E78 A;  1IMA A;  2UVJ A;  4QFK A;  1A8E A;  2ONS A;  4NX1 A;  2Z23 A;  4OFO A;  1NNF A;  3F11 A;  4IGR A;  1MXX A;  2CEY A;  4KR5 A;  4BDO A;  3MZB A;  1B1H A;  1AL3 A;  2Y7W A;  4BDL A;  1AH5 A;  4NF4 A;  1TXF A;  3KN8 A;  3KJT A;  5CMC A;  5LDZ A;  3K1P A;  3IJX B;  4PE3 A;  1GTK A;  4RPO A;  2D5W A;  2O6A A;  2FNC A;  4MFI A;  2UVG A;  3EPE A;  3SES A;  4RK9 A;  3PMW A;  2WYK A;  3MYU A;  4PFR A;  3EHS A;  2Z8E A;  3TFL A;  3ZSF A;  3OSQ A;  1TFA A;  4F22 A;  4RY1 A;  4G8H A;  3FXQ A;  2FBP A;  3C34 A;  4POW A;  3U94 A;  5LTC A;  4OEN A;  4R9F A;  2I48 A;  4IR8 A;  2I3V A;  1HSJ A;  1P1U A;  1T0K A;  1NKX A;  1MY0 A;  2Q8M A;  3MZ1 A;  4ISU A;  4MMP A;  1R1N A;  4ND9 A;  3D4G A;  3T9U A;  5EQ7 A;  3SDF A;  4PAI A;  4OVT A;  5JTY A;  1ELJ A;  1NV3 A;  1LAG E;  1ATG A;  2ZZW A;  1AMF A;  1MXY A;  1ZLQ A;  1D9Q A;  1OLC A;  3B6Q A;  4QHQ A;  4MLQ A;  3UK4 A;  1PBP A;  3UP9 A;  1R9Q A;  2PMS A;  3I5O A;  1FBD A;  1KA0 A;  1D4N A;  3N26 A;  3KN3 A;  4QXD A;  2XD2 A;  1J1N A;  4GD5 A;  2UYF A;  5FHO A;  3TQW A;  1JEU A;  1FBF A;  1H43 A;  3NOH A;  1NNT A;  4QSC A;  1SBP A;  2Q2C A;  3IO6 A;  4E0X A;  3PMV A;  1MQD A;  1SW5 A;  4NE4 A;  1FTJ A;  2P3V A;  3E3K A;  5IAI A;  1XVX A;  3DP6 A;  2XXQ A;  3UIF A;  1FQC A;  1LLS A;  5KCJ B;  4N15 A;  2HHM A;  3SEX A;  2GH9 A;  3PU5 A;  3TTN A;  4Q5T A;  3ECR A;  1FW0 A;  2NOO A;  1I6B A;  3T93 B;  1B3G A;  4WKM A;  1LFI A;  1B7H A;  3EKI A;  3OD7 A;  5F24 A;  4ZEF A;  4P56 A;  3A09 A;  1SI1 A;  3DP4 A;  2V93 A;  5I56 A;  2I3W A;  2AIX A;  2ZYO A;  3TUS A;  2RCA A;  5H8H A;  3MBP A;  4IY5 A;  4U2R A;  2V4C A;  4F19 A;  5FBP A;  2VP1 A;  4XTC Q;  3PPN A;  4DCX A;  2H25 A;  5DVI A;  3G3K A;  4JB7 A;  4NG7 A;  3MC2 A;  4F1Y A;  5ESY A;  1RYO A;  3ZKK A;  3GBB A;  4OQO A;  3K1N A;  1DK4 A;  4MIJ A;  1I69 A;  1OQH A;  2DVZ A;  5AA2 A;  1B9J A;  3PV0 E;  1Q1K A;  1TWY A;  2F6P A;  4G68 A;  4GWU A;  3LSL A;  3RQT A;  4ELO A;  3IL1 B;  3HST A;  2VT5 A;  2ZYN A;  4PGP A;  1TT1 A;  5EQA A;  1POY 1;  3ODB A;  3CR9 A;  2DXY A;  1A7L A;  4GFR A;  3N6U A;  3OSR A;  2WBB A;  2BJJ X;  2DWJ A;  4GRK A;  5ET6 A;  4ESX A;  1IZ1 A;  2F36 A;  1UQW A;  3SET A;  4NF4 B;  4KCC A;  4YB7 A;  1WVJ A;  2G29 A;  1XOC A;  1ZMG A;  4O7M A;  4X04 A;  1JW1 A;  1FTA A;  1DOT A;  3KG2 A;  4FEB A;  1K9Z A;  2HCA A;  4DCY A;  3E79 A;  3S9N C;  4G4P A;  1MXW A;  2M8C A;  4HE1 A;  1JQF A;  4DLD A;  3RTW B;  5DVF A;  4OEV A;  4OTE A;  2PFZ A;  4F3P A;  3FGS A;  5KDT B;  2PBW A;  4U22 A;  4NF5 B;  4G68 C;  5A5X A;  2O1L A;  3PPP A;  4N17 A;  3C35 A;  2VD2 A;  1MH4 A;  3KC0 A;  2XXX A;  1B51 A;  2R71 A;  3Q29 A;  4OYV A;  4H46 A;  1MM6 A;  1B6H A;  4IO4 A;  2GHB A;  3BBR A;  3E9X A;  5L9O A;  4ZZE A;  4PGN A;  4AB5 A;  5I2K A;  2QL3 A;  1IXI A;  2QFL A;  5EQ8 A;  4NF5 A;  3EHT A;  4NHB A;  4QF9 A;  4PQJ A;  4RPN A;  3K0V A;  4TLM B;  5T3J A;  5IZ3 B;  3KZG A;  3O29 A;  5AE4 A;  1DCU A;  3QK6 A;  2R6G E;  1XS5 A;  1Q35 A;  3N5L A;  3RN8 A;  4MX6 A;  4RA1 A;  1OIB A;  3SEW A;  3VXC A;  2H99 A;  1LGB C;  1USY H;  3TQL A;  4KQP A;  2THI A;  2ONK E;  2VOZ A;  4OHN A;  3EF7 A;  4YAH X;  3AXF A;  3R7X A;  5IZ1 A;  1D9V A;  3T22 A;  1OVT A;  3JZJ A;  3ZS6 A;  2CMO A;  4JVI A;  3IOR A;  3S9L C;  3UA8 A;  3HFU A;  5EYG A;  3MP8 A;  1NUZ A;  3U93 A;  3CFZ A;  2F78 A;  3H06 B;  4MNC A;  3CFX A;  4EF1 A;  1NV1 A;  2HAV A;  4DXB A;  3VVD A;  4MJO A;  2F3B A;  1IXC A;  2Y7P A;  4I9D A;  3TAJ A;  2D3I A;  3OEL A;  3P7I A;  5CM6 A;  3IB0 A;  3TTM A;  3FXU A;  4N8G A;  1MQG A;  3RPW A;  1SQY A;  5KZT A;  2L5V A;  4I3Y A;  1SW2 A;  4NMY A;  1FPJ A;  3OO6 A;  2E0S A;  2QS2 A;  2F34 A;  2HXW A;  3MST A;  3IB1 A;  2WEF A;  2XXW A;  1H45 A;  5JTY B;  2FYI A;  2OX3 A;  2ZXT A;  4H65 A;  3ILT B;  3SEV A;  1OLA A;  3V8X B;  4AS5 A;  4F29 A;  4OA4 A;  4ZEC A;  3ILU B;  4JDF A;  2Q89 A;  1GVC A;  3CSB A;  1B5J A;  5CMM A;  2XWO A;  4X8R A;  3U1O A;  4PFB A;  4QFO A;  4BDM A;  4LAT A;  1B5H A;  1FQB A;  2P2A A;  2Y7R A;  3RTF B;  3K2D A;  1MY1 A;  4LZ5 A;  4RNS A;  4JSO A;  2H98 A;  1NV5 A;  2R8T A;  1VR5 A;  2W7Y A;  4H67 A;  4KYS A;  4PFU A;  1NH7 A;  5L9M A;  4KFQ A;  1FQF A;  4I3E A;  3PUZ E;  3RLF E;  4F3G A;  3MAM A;  3N94 A;  1MQJ A;  4NWD A;  1NV2 A;  5F7V A;  2OWS A;  4GWY A;  3CG1 A;  5I57 B;  2QMX A;  3I3V A;  3T9X B;  3G3J A;  2I0B A;  3GLB A;  2WBD A;  3LR1 A;  2OCU A;  3Q26 A;  4N07 A;  1EU8 A;  4UAC A;  3O66 A;  4PF6 A;  3CI8 A;  1NV0 A;  3S2V A;  4N6D A;  3KBZ A;  1N84 A;  3EQ1 A;  1A99 A;  4OVP A;  4XF5 A;  1MPC A;  4LON B;  2P0S A;  4R6K A;  3DP8 A;  2F8D A;  3IJO B;  1US5 A;  4XIG Q;  4DXU A;  5I2N B;  2A5S A;  5ELV A;  2BJI A;  1S7Y A;  4QRZ A;  3WAE A;  3V83 A;  4R9G A;  4NAP A;  4QSD A;  3FD3 A;  4KYE A;  3FAT A;  1LBC A;  1FBE A;  2UXA A;  3IB2 A;  2HAU A;  3H3G A;  2O7U A;  2PCR A;  3FAS A;  3MJN A;  4H5F A;  3LSX A;  2RC7 A;  2DDK A;  1PEB A;  2O84 X;  5TPA A;  1R9L A;  2VD3 A;  1DTZ A;  2H4I A;  5I2N A;  5I5P A;  1UIV A;  4GVO A;  4OFJ A;  5A5X B;  5FTH A;  1S9T A;  1BP5 A;  4FE8 A;  4U21 A;  3USD A;  1PB8 A;  4DDD A;  2XXK A;  3U8Q A;  4C1T A;  4U4X A;  4ZE9 A;  4AB6 A;  4MEV A;  4LQ5 A;  1NNP A;  4OXV A;  5HPQ A;  2RC8 A;  4G68 B;  5F1Q A;  4EF2 A;  4NED A;  4PAF A;  4LN5 A;  3LUY A;  2PFY A;  1UTB B;  1ZTY A;  4P0I A;  4QFL A;  3HV1 A;  4GL0 A;  4HE2 A;  4MF3 A;  2FIX A;  4MLV A;  3CVG A;  1FPK A;  3D1R A;  4ESW A;  2RF1 A;  5H8F B;  1IMF A;  1POT A;  2ABH A;  4BDQ A;  1FBH A;  2QJE A;  1QW0 A;  3VVE A;  2Z22 A;  1FRP A;  2O1M A;  3PPR A;  4GXS B;  5IGA A;  5K2Y A;  3VFJ A;  1QUK A;  4Q0C A;  5DVJ A;  4F1U A;  3TEL A;  2YJP A;  1CB6 A;  3W15 C;  4OES A;  3W9V A;  1M5F A;  3K1M A;  1FPF A;  3OO8 A;  4FED A;  4LVQ A;  1EZO A;  2Y5L A;  4OVR A;  3WAF A;  5ITP A;  3LSF B;  1AWB A;  3OEM A;  4KYD A;  1VFD A;  1D9Y A;  4BLA A;  5AA4 A;  2Z8F A;  1B2H A;  2OK2 A;  1LAF E;  4ZE8 A;  1PBQ A;  4TOZ A;  1MQH A;  4I1D A;  4AS4 A;  4OET A;  1EZ9 A;  2X7P A;  1QVS A;  2DE3 A;  3IAZ A;  1FBG A;  4PFY A;  1NMU A;  4GXA A;  4PE5 B;  4WXJ A;  2V3U A;  1LST A;  1IQ7 A;  4NF8 B;  4F2O A;  3KFM A;  5DYH A;  4YMB A;  2ZYK A;  3V89 B;  4PCD A;  4DI3 D;  3PTY A;  1B1X A;  4MNI A;  1JET A;  1ZJL A;  4JBZ A;  1DPP A;  3O97 A;  2I6E A;  4XKN A;  3LUZ A;  1L5T A;  3PPO A;  3CFL A;  4U1Z A;  5LOM A;  2VGQ A;  1JVY A;  4X48 A;  3ZKL A;  1ANF A;  1FBP A;  5AA1 A;  1MY3 A;  2NWJ A;  3H4Z A;  5I58 A;  2VHA A;  3BKI B;  3L6G A;  3VVF A;  5DTB A;  1XHY A;  1IMC A;  4FAJ A;  1B7U A;  1DPE A;  5H8S A;  4FAT A;  5ICT A;  2RIN A;  3T9H B;  3U72 A;  2O68 A;  4PET A;  5I59 B;  1MPB A;  3U65 A;  2QVV A;  2H5Y A;  2P3N A;  1LB8 A;  2YPN A;  4HXV A;  3FVK A;  3RYD A;  2KR0 A;  3M3F A;  3VDF A;  3H03 A;  1EYI A;  4PDD A;  3IOU A;  5B7D A;  4NN3 A;  1XVY A;  4MCO A;  1MXZ A;  5M2V A;  1Y3Q A;  3CRB A;  3EHU A;  4IB2 A;  5CBS A;  5IZZ A;  1MM7 A;  2FHY A;  4H0W A;  3PGF A;  1NUW A;  1Z7N E;  2XXY A;  1P1O A;  3TCF A;  2F35 A;  4O3C A;  4N81 A;  3RT6 B;  4EXL A;  4JSD A;  5KCJ A;  4G8M A;  4WEP A;  5TU0 A;  2XWV A;  4NF6 A;  1YCJ A;  3MVY A;  3QAX A;  4R2F A;  5JEI A;  3B8B A;  1INP A;  1QUI A;  4F3B A;  2ONR A;  1A40 A;  3S4U A;  5L8D A;  1Y3N A;  4YKP A;  3TPA A;  3CHG A;  3MW0 A;  1IXH A;  3QSL A;  3FXB A;  4P11 A;  3FJ7 A;  2XXU A;  2OWZ A;  3KC1 A;  3T66 A;  2HZK A;  5ET8 A;  2F97 A;  4Z7E A;  2DQV A;  2QRY A;  1YTV A;  1LAH E;  1B7Z A;  1BLF A;  2I49 A;  3GYY A;  1DMB A;  2CZK A;  1QGX A;  4IO2 A;  1F9B A;  1OVB A;  4R74 A;  1MS7 A;  4OWD A;  2DE4 A;  5EHM A;  2GHA A;  3DM0 A;  1QKB A;  4F3S A;  2QMW A;  1JW4 A;  2A5T A;  1VDW A;  1B40 A;  3IX1 A;  4OVQ A;  2WYP A;  3GXA A;  1DBZ A;  1B3L A;  4YKI A;  4YZZ A;  1URS A;  4PFT A;  4DZ1 A;  4GBW A;  3PUV E;  2HEU A;  3G7W A;  3L6H A;  2DWI A;  1SDX A;  2RKM A;  1SI0 A;  3R6U A;  4F1V A;  5H8H B;  2XXT A;  1N7W A;  4HE0 A;  1SPI A;  4YMA A;  5BWJ A;  3HHF A;  4PDH A;  3VLV A;  4PFW A;  4GBV A;  5EYH A;  3C4M A;  2DP8 A;  5IKB A;  4QSE A;  1Z7M E;  5I2K B;  3M8U A;  1NL5 A;  5TP9 A;  1PDA A;  3HCQ A;  3IFC A;  5DW8 A;  3TKD A;  1OMP A;  3LV0 A;  2O69 A;  5DEX B;  4YU0 A;  1S50 A;  4BDR A;  4ZS9 A;  4YB5 A;  5IZ3 A;  4KPT A;  2GRV A;  3CSG A;  3OO9 A;  4R2B A;  4UAB A;  5CBR A;  2DYX A;  1N0T A;  4MAG A;  1D3K A;  3M3L A;  4H5G A;  4R6H A;  5TP9 B;  4OMB A;  2WX9 A;  3VV5 A;  3E13 X;  4P9K A;  3FVN A;  4U1O A;  3RUM A;  3W9W A;  4Q30 B;  1Y1M A;  3DEL B;  1FTL A;  5AA4 B;  5A5L A;  1JVX A;  2B65 A;  2XXH A;  5TPA B;  2WKY A;  1Y3P A;  3FVO A;  2CZL A;  5H8Q B;  2KLF A;  1B05 A;  1B52 A;  1BTJ A;  5I3S A;  2OJT A;  5HM4 B;  4GWS A;  5I57 A;  4OVJ A;  4RJZ A;  1LAX A;  5BUU A;  1LBZ A;  1P1W A;  4K3F A;  4HW8 A;  4IO6 A;  1P1N A;  1IUD A;  1JP4 A;  1PB7 A;  3U92 A;  4GWX A;  3UOR A;  5AA3 A;  2B3F A;  1UTB A;  2RCB A;  1JNF A;  2QS3 A;  2F6G A;  2XX9 A;  3KBR A;  5DEX A;  4IGT A;  3JV9 A;  2V3Q A;  2G93 A;  2PT2 A;  1MPD A;  3K6V A;  2I58 A;  1RDY A;  1QKA A;  3ISP A;  3MQ9 A;  3JYR A;  4THI A;  4JXI A;  3TEP A;  4ZDM A;  1PC3 A;  1ZIU A;  3Q27 A;  4PTK A;  3FJG A;  3TDJ A;  4MNP A;  1YXI A;  4FOR A;  2XXP A;  3O6I A;  5K2X A;  1JW5 A;  1N3W A;  2V84 A;  4EUO A;  2XHD A;  4KI0 E;  3B6T A;  4PC9 A;  4ECF A;  2XXR A;  3B6W A;  1FQA A;  1FCK A;  4N6P A;  3G3G A;  1MXU A;  4KD5 A;  3FUZ A;  1LFH A;  3SEY A;  3B7D A;  1MDP 1;  2LAO A;  4GQO A;  3D4C A;  1BIY A;  2E1S A;  3A3U A;  1B4Z A;  5CRY A;  4I62 A;  3MUQ A;  2H9B A;  5HBC A;  1KWH A;  5CI5 A;  1K9Y A;  2Z8D A;  4ELR A;  2X7Q A;  3A3C A;  4WED A;  4M1V A;  4IO7 A;  1LCF A;  4GWO A;  1NH8 A;  4F31 B;  5CMK A;  1A8F A;  2Q8J A;  4O8M A;  4I8C A;  1YPN A;  5JK4 A;  2NUV A;  2PX1 A;  4FJP A;  4O3A A;  5I7I A;  2PYY A;  2FIE A;  1O63 A;  3M3K A;  3H6U A;  4GX3 A;  3E4R A;  3TCG A;  4RYA A;  2PVU A;  1Q9D A;  3KOS A;  2Y5K A;  1Y1Z A;  5ET7 A;  3TZA A;  2ESN A;  4NWC A;  3C9H A;  3PMX A;  2GFE A;  2HZL A;  4EQ7 A;  4H8J A;  4GX6 A;  2GQ1 A;  5AA2 B;  3S9E A;  3IR1 A;  3RY3 A;  4P1L A;  2DSF A;  3THI A;  4LP2 B;  1NNK A;  1Y4C A;  3PUX E;  3DLN A;  1LFG A;  1MDQ A;  4ZEK A;  1IME A;  5EQ9 A;  4H6D A;  4LZ8 A;  1H76 A;  1B46 A;  2O51 A;  2XX7 A;  3PPQ A;  1B4H A;  2DS9 A;  3KSX A;  4GWW A;  3SEU A;  5CMB A;  3TOD A;  3MVW A;  4NF6 B;  2B3B A;  2A5T B;  3QMF A;  1FPE A;  4R72 A;  2F5X A;  4EDP A;  3QUF A;  2I0C A;  3TTR A;  4IY6 A;  3UGW A;  5B70 A;  2ZMB A;  4HCW A;  1M5B A;  2OZZ A;  4I40 A;  3BIH A;  2DXR A;  4TQU Q;  2B4M A;  1N76 A;  4FIM A;  1KZ8 A;  3IOV A;  4PBH A;  1Y9U A;  5H8F A;  1XC1 A;  2ZNU A;  4N13 A;  4G61 A;  1MRP A;  3KEI A;  5EYF A;  1IEJ A;  4ZZA A;  2V25 A;  3KN7 A;  1FTM A;  2F7C A;  1PB9 A;  4FBP A;  2HFB A;  1UTH B;  4LZ7 A;  4AQ4 A;  4NGU A;  3HHG A;  1YAE A;  1IMB A;  4PBQ A;  4HTG A;  1ZKB A;  4JVC A;  1GR2 A;  3N6T A;  2PT1 A;  1LBY A;  1N3X A;  2I4B A;  1SVX B;  2D21 A;  3TYH A;  4GIZ A;  5FTI A;  3SKP A;  1MY2 A;  4U4S A;  4N8Y A;  2FVZ A;  1ZU0 A;  1I6Q A;  4XKP A;  2Y84 A;  4POX A;  4F18 A;  4P1E A;  3HN0 A;  3FJM A;  2Q74 A;  2QVU A;  1RKM A;  1RDX A;  1II5 A;  1A55 A;  4H45 A;  4NTL A;  4N6K A;  4O3B A;  4ONY A;  1G0H A;  1HSL A;  2QPQ A;  1O64 A;  3Q28 A;  1FPB A;  1G0I A;  5KDT A;  1LBV A;  5J1D A;  5J16 A;  4GOT A;  1SD3 A;  1BKA A;  3FZV A;  1FPD A;  4H1X A;  4ZED A;  1FPI A;  4XEQ A;  3PD9 A;  3I6V A;  2DWA A;  2QVR A;  2Q88 A;  3IOW A;  1DTG A;  1MH3 A;  3A29 A;  3FV2 A;  4F2Q A;  1NUX A;  4PF8 A;  2XWK A;  3HPI A;  1M5E A;  2YLN A;  3LC8 A;  3IOT A;  1B3F A;  2NXO A;  2IA4 A;  4FEC A;  4OVS A;  4ZEI A;  2QS1 A;  1MQI A;  2I4C A;  3QYT A;  2F7A A;  4R73 A;  3OO7 A;  2O7I A;  3S9M C;  3KSJ A;  2NVU B;  4LUB A;  4KCD A;  4X9T A;  3TCH A;  3GZG A;  2ZYM A;  4QFP A;  3MVZ A; 
#chains in the Genus database with same CATH homology
 2O69 A;  3CG1 A;  4G77 A;  5I57 B;  2QMX A;  1NKX A;  1N7X A;  5DEX B;  4BDN A;  1B5I A;  3I3V A;  1MY0 A;  4YU0 A;  4GLI A;  1SW1 A;  1S50 A;  3G3J A;  3T9X B;  1RYX A;  4BDR A;  2QS4 A;  3MZ1 A;  4ISU A;  4ZS9 A;  4YB5 A;  4HCY A;  2I0B A;  5ICT A;  3GLB A;  3OEK A;  3OEN A;  4KPT A;  4EXK A;  2GRV A;  3LR1 A;  4MH5 A;  2OCU A;  1R1N A;  4ND9 A;  3Q26 A;  3C36 A;  1EU8 A;  3CSG A;  3OO9 A;  4N07 A;  4R2B A;  3D4G A;  4MBP A;  3T9U A;  4UAC A;  3O66 A;  3SDF A;  3VLW A;  5CBR A;  2DYX A;  5JTY A;  1N0T A;  1ELJ A;  1D3K A;  2DWH A;  3CI8 A;  3OXN A;  3S2V A;  1IIW A;  1LAG E;  3M3L A;  4H5G A;  4R6H A;  5TP9 B;  1ATG A;  4OMB A;  1N84 A;  1I6A A;  3OMB A;  1AMF A;  3BFU A;  4DXC A;  3K01 A;  4YIC A;  3VV5 A;  3E13 X;  1A99 A;  1VE4 A;  3EQ1 A;  1MXY A;  1ZLQ A;  4OEU A;  3EN3 A;  1OLC A;  3B6Q A;  1MPC A;  4LON B;  3FVN A;  4QHQ A;  4U1O A;  4MLQ A;  3RUM A;  3UK4 A;  4P0G A;  3W9W A;  4Q30 B;  2OLB A;  1LBB A;  1PBP A;  1Y1M A;  2P0S A;  3DEL B;  1FTL A;  3UP9 A;  4R6K A;  3DP8 A;  2F8D A;  1R9Q A;  3IJO B;  1US5 A;  4XIG Q;  5AA4 B;  4DXU A;  2PMS A;  3PUW E;  1JVX A;  2B65 A;  2V3T A;  2XXH A;  3I5O A;  4NF8 A;  5TPA B;  1D4N A;  2UVI A;  3N26 A;  3KN3 A;  2WKY A;  1Y3P A;  4DE8 A;  3FVO A;  2CZL A;  5I2N B;  5H8Q B;  2XD2 A;  5I56 B;  2ZNS A;  3QXM A;  1J1N A;  2A5S A;  2KLF A;  5ELV A;  1B05 A;  1B52 A;  1BTJ A;  1S7Y A;  4GD5 A;  2UYF A;  2OJT A;  4PP0 A;  4C0R A;  5HM4 B;  4QRZ A;  5FHO A;  3TQW A;  1JEU A;  3WAE A;  2RC9 A;  5I57 A;  3V83 A;  4R9G A;  1M5C A;  4OVJ A;  4QSD A;  3FD3 A;  1H43 A;  4KYE A;  4E0W A;  3FAT A;  1NNT A;  4RJZ A;  1LBC A;  1LAX A;  4JWX A;  1SBP A;  1GGG A;  1UIU A;  1DSN A;  2Q2C A;  4QSC A;  2UXA A;  3IB2 A;  2HAU A;  4U23 A;  1T0K A;  5BUU A;  3IO6 A;  3H3G A;  4E0X A;  3PMV A;  1MQD A;  2O7U A;  3BFT A;  3FAS A;  3MJN A;  1SW5 A;  4NE4 A;  1P1W A;  3RT8 A;  4H5F A;  3LSX A;  3Q25 A;  4K3F A;  4IO6 A;  2RC7 A;  2O84 X;  1P1N A;  1PEB A;  1IUD A;  4G8N A;  4LQ2 A;  1PB7 A;  1FTJ A;  3E3K A;  5TPA A;  5IAI A;  1R9L A;  1XVX A;  3DP6 A;  1EZP A;  2XXQ A;  3RNN A;  3TTL A;  1FQC A;  2VD3 A;  3MP6 A;  4YKJ A;  1LLS A;  1DTZ A;  3U92 A;  3UIF A;  5KCJ B;  2H4I A;  5I2N A;  3R26 A;  3UOR A;  3SEX A;  2B3F A;  1UIV A;  2GH9 A;  3PU5 A;  1UTB A;  2RCB A;  5AA3 A;  5I58 B;  4GVO A;  3TTN A;  4OFJ A;  2XXV A;  4Q5T A;  5A5X B;  3ECR A;  1JNF A;  1FW0 A;  2NOO A;  2F6G A;  2P1S A;  1O7T A;  1I6B A;  1S9T A;  2QS3 A;  2XX9 A;  1BP5 A;  3GBA A;  3KBR A;  4FE8 A;  4IGT A;  4U21 A;  3USD A;  1B3G A;  2V3Q A;  2G93 A;  3JV9 A;  1PB8 A;  4OER A;  1LFI A;  4WKM A;  4DDD A;  1MY4 A;  2PT2 A;  1MPD A;  3K6V A;  3U8Q A;  4C1T A;  3T96 B;  1B7H A;  1FTK A;  4U4X A;  4EQ9 A;  4AB6 A;  4ZE9 A;  2I58 A;  3PUY E;  1FQD A;  1LB9 A;  4LQ5 A;  3OD7 A;  1NNP A;  4OXV A;  5I59 A;  4ZEF A;  5JK4 A;  1QKA A;  3A09 A;  3IO4 A;  3MQ9 A;  2RC8 A;  3JYR A;  4G68 B;  5F1Q A;  5HPQ A;  4EF2 A;  4NED A;  1SI1 A;  3DP4 A;  2V93 A;  3LUY A;  4THI A;  1B0H A;  5I56 A;  5CC2 A;  1B58 A;  4RXL A;  4JXI A;  3TEP A;  4ZDM A;  1UTB B;  1EH3 A;  2I3W A;  1ZTY A;  2AIX A;  1PC3 A;  2ZYO A;  4P0I A;  4QFL A;  1CE2 A;  3HV1 A;  2RCA A;  4GL0 A;  3TUS A;  1Y20 A;  4MF3 A;  3RGY A;  1ZIU A;  3Q27 A;  3TDJ A;  3FJG A;  5H8H A;  4MLV A;  3QIM A;  3CVG A;  3MBP A;  4FOR A;  4ESW A;  1URD A;  2XXP A;  2UVH A;  2RF1 A;  3O6I A;  4R75 A;  4IY5 A;  5H8F B;  4ELQ A;  5K2X A;  4HW8 A;  1JW5 A;  5FTH A;  4U2R A;  1N3W A;  1POT A;  2ABH A;  4F19 A;  4BDQ A;  2VP1 A;  3O9P A;  4OZ9 A;  4XTC Q;  2V84 A;  3PPN A;  1VFE A;  4F39 A;  4DCX A;  2QJE A;  1QW0 A;  4EUO A;  3VVE A;  2H25 A;  2Z22 A;  4GF8 A;  5DVI A;  2X26 A;  2XHD A;  4KI0 E;  4IO3 A;  3G3K A;  3B6T A;  4ECF A;  2O1M A;  2XXR A;  3PPR A;  4JB7 A;  3MC2 A;  1QUL A;  3B6W A;  4GXS B;  5K2Y A;  1FQA A;  1FCK A;  4N6P A;  3G3G A;  1MXU A;  3VFJ A;  1QUK A;  4KD5 A;  4LA9 A;  3FUZ A;  1LFH A;  1RYO A;  3QUJ A;  2F7B A;  3SEY A;  1M5D A;  3B7D A;  4Q0C A;  1OQG A;  5DVJ A;  4F1U A;  3ZKK A;  1MDP 1;  2LAO A;  4GQO A;  3TEL A;  2YJP A;  3D4C A;  3GBB A;  4OQO A;  4X1D A;  3K1N A;  4UA8 A;  1BIY A;  2E1S A;  1CB6 A;  1I69 A;  1OQH A;  3TMG A;  3A3U A;  1LCT A;  1B4Z A;  3K02 A;  3W15 C;  2AL4 A;  5FHM A;  2DVZ A;  1QJM A;  3MWB A;  3KGC A;  5AA2 A;  5H8N B;  5CRY A;  1B9J A;  3PV0 E;  1Q1K A;  4I62 A;  1TWY A;  3KJ7 A;  2H9B A;  2F6P A;  3MUQ A;  1KWH A;  1FTO A;  4G68 A;  5CI5 A;  4OES A;  5HBC A;  3W9V A;  4KHZ E;  1M5F A;  2Z8D A;  1MG1 A;  3K1M A;  4ELR A;  3OO8 A;  3TCG A;  4FED A;  4LVQ A;  2X7Q A;  3FVG A;  3A3C A;  4WED A;  2R9J A;  4M1V A;  4IO7 A;  4L17 A;  3T93 B;  1UTH A;  1EZO A;  1LCF A;  3WAF A;  2XX8 A;  1NH8 A;  4GWO A;  4F31 B;  5ITP A;  3LSF B;  3RQT A;  2XD3 A;  3LSL A;  1A8F A;  5CMK A;  3OEM A;  4HS7 A;  3IL1 B;  2Q8J A;  4ELO A;  3HST A;  1HSE A;  2ZYN A;  1WDN A;  4I8C A;  3PD8 A;  1YPN A;  2OBG A;  2NUV A;  1TT1 A;  1VFD A;  1D9Y A;  4IO5 A;  4KYD A;  1POY 1;  3G3F A;  3S9M C;  2PX1 A;  3ODB A;  4FJP A;  3FV1 A;  3CR9 A;  4BLA A;  1B0L A;  4O3A A;  1XT8 A;  5AA4 A;  5H8N A;  2Z8F A;  1B2H A;  3TTK A;  5CBS A;  2PYY A;  4XKQ A;  2OK2 A;  1LAF E;  4ZE8 A;  1O63 A;  3M3K A;  1B3E A;  2DXY A;  1A7L A;  1SW4 A;  2Y7I A;  3E4R A;  3H6U A;  1PBQ A;  4GFR A;  3ONM A;  3N6U A;  2Y7K A;  1B3H A;  3OSR A;  4RYA A;  1MQH A;  2PVU A;  4H8I A;  4TOZ A;  3KOS A;  1IXG A;  3K00 A;  4YKK A;  1Y1Z A;  3TZA A;  5AA2 D;  4XKR A;  2ESN A;  3CIJ A;  4I1D A;  4NWC A;  2BJJ X;  2DWJ A;  1FQE A;  3C9H A;  4GRK A;  1IZ1 A;  3PMX A;  4OET A;  1EZ9 A;  2F36 A;  4ESX A;  2X7P A;  1QVS A;  2DE3 A;  5EHS A;  1UQW A;  3IAZ A;  2GFE A;  2HZL A;  3UN6 A;  3SET A;  4NF4 B;  4RK2 A;  4EQ7 A;  1QUJ A;  4H8J A;  4PFY A;  5AA2 B;  1URG A;  1NMU A;  4GXA A;  3S9E A;  4KCC A;  4PE5 B;  4YB7 A;  4WXJ A;  1WVJ A;  2G29 A;  1XOC A;  1ZMG A;  3IR1 A;  2V3U A;  1LST A;  1IQ7 A;  4NF8 B;  4F2O A;  2Q9T A;  3H7M A;  3KFM A;  1GV8 A;  3RY3 A;  5DYH A;  4YMB A;  1JW1 A;  3LBS A;  1ZBM A;  2DSF A;  1DOT A;  2ZYK A;  3V89 B;  3KG2 A;  1AIV A;  3THI A;  4LP2 B;  1NNK A;  5I84 A;  4FEB A;  3VE1 B;  2HCA A;  4DCY A;  1Y4C A;  3PUX E;  3DLN A;  1LFG A;  4X1B A;  1B1X A;  1MDQ A;  4ZEK A;  1SYI A;  3O6G A;  3S9N C;  4H6D A;  4G4P A;  1MXW A;  2DOJ A;  2M8C A;  1JET A;  1ZJL A;  4JBZ A;  4LZ8 A;  4C1U A;  1DPP A;  1H76 A;  1JQF A;  3O97 A;  1B46 A;  2I6E A;  2O51 A;  2XX7 A;  3PPQ A;  3H6W A;  1B4H A;  3PPO A;  4XKN A;  5DVF A;  3CFL A;  1L5T A;  3RTW B;  2DS9 A;  3KSX A;  4OEV A;  4OTE A;  4U1Z A;  3SEU A;  5CMB A;  5LOM A;  4Q8R A;  3TOD A;  2VGQ A;  1JVY A;  4X48 A;  1SYH A;  2OWT A;  3ZKL A;  4F3P A;  1ANF A;  3MVW A;  4XXU A;  1P99 A;  3C31 A;  3FGS A;  5AA1 A;  1MY3 A;  2NWJ A;  3H4Z A;  5KDT B;  2PBW A;  5I58 A;  2VHA A;  3BKI B;  4NF6 B;  3SER A;  3L6G A;  4U22 A;  4NF5 B;  4G68 C;  2B3B A;  5DTB A;  2A5T B;  3VVF A;  5A5X A;  1XHY A;  2IEE A;  4R72 A;  2O1L A;  1H44 A;  2F5X A;  3PPP A;  4FAJ A;  3C35 A;  4EDP A;  2VD2 A;  2I0C A;  3QUF A;  3MPL A;  3TTR A;  1MH4 A;  5ICQ A;  1MXV A;  2XXX A;  2DE2 A;  1B7U A;  1B51 A;  1DPE A;  4IY6 A;  2R71 A;  3Q29 A;  5H8S A;  4FAT A;  4JWY A;  2RIN A;  4OYV A;  3OOA A;  3H6V A;  4ZEB A;  3T9H B;  3U72 A;  3MPK A;  3G3I A;  3UGW A;  1MM6 A;  2ZMB A;  4HCW A;  5B70 A;  1M5B A;  1B6H A;  1H3D A;  2O68 A;  4PET A;  5I59 B;  4IO4 A;  1MPB A;  2GHB A;  2OZZ A;  3BBR A;  3E9X A;  5L9O A;  1US4 A;  1VSO A;  2ZYM A;  3MP1 A;  2DXR A;  4ZZE A;  4TQU Q;  3MZ9 A;  4AB5 A;  5I2K A;  2QL3 A;  3K6X A;  4M4G A;  4Z0I A;  1IXI A;  3V5A A;  2H5Y A;  1LB8 A;  1JEV A;  2XXI A;  1N04 A;  2YPN A;  1N76 A;  4NF5 A;  3EHT A;  3FVK A;  4FIM A;  3IOV A;  4PQJ A;  4QF9 A;  4RPN A;  1Y9U A;  5H8F A;  2AL5 A;  2REJ A;  4YB6 A;  3K0V A;  1XC1 A;  2ZNU A;  3M3F A;  4TLM B;  3VDF A;  4N13 A;  4TLL B;  3FIR A;  1MRP A;  3H6T A;  3H03 A;  3KEI A;  4QFN A;  3KZG A;  3O29 A;  3IOU A;  5EYF A;  3K4U A;  5B7D A;  3VLU A;  1IEJ A;  5AE4 A;  4OFL A;  1XVY A;  3QK6 A;  4ZZA A;  1MXZ A;  2OWS A;  2R6G E;  2V25 A;  1XS5 A;  3O6H A;  1Q35 A;  1Y3Q A;  3KN7 A;  2ALU A;  3N5L A;  1FTM A;  5M2V A;  3RN8 A;  4RA1 A;  2F7C A;  2DVC A;  1PB9 A;  3CG3 A;  5DT6 A;  3K6U A;  3CRB A;  2HFB A;  3EHU A;  4IB2 A;  1OIB A;  1P1Q A;  1MM7 A;  1UTH B;  3LSW A;  4LZ7 A;  4H0W A;  3SEW A;  3VXC A;  2H99 A;  4AQ4 A;  1LGB C;  2Q2A A;  4EQB A;  3PGF A;  1USY H;  3HHG A;  3IK6 B;  3TQL A;  1Z7N E;  2XXY A;  1P1O A;  2THI A;  4KQP A;  3TCF A;  2ONK E;  3G3H A;  1YAE A;  1WOD A;  2VOZ A;  4OHN A;  2QSX A;  3O28 A;  4ELP A;  3K6W A;  3EF7 A;  2F35 A;  4O3C A;  4R6Y A;  4YAH X;  4HTG A;  3AXF A;  3R7X A;  1ZKB A;  1D9V A;  3T22 A;  5FHN A;  1AOV A;  3RT6 B;  1OVT A;  3JZJ A;  3ZS6 A;  2CMO A;  4EXL A;  4G2Z A;  4JSD A;  2REG A;  1GR2 A;  3IOR A;  3HO7 A;  3S9L C;  3UA8 A;  5KCJ A;  3N6T A;  4G8M A;  3MP8 A;  4WEP A;  5TU0 A;  4NF6 A;  3C32 A;  2PT1 A;  3T9V A;  5ITO A;  1N3X A;  1YCJ A;  2I4B A;  3MVY A;  3QAX A;  4R2F A;  4DIG A;  3U93 A;  5JEI A;  1SVX B;  3VXB A;  3CFZ A;  2F78 A;  2D21 A;  3TYH A;  1QUI A;  4GIZ A;  3H06 B;  4F3B A;  3CFX A;  5FTI A;  4GL8 A;  4EF1 A;  2ONR A;  2HAV A;  1A40 A;  3S4U A;  5L8D A;  3SKP A;  4DXB A;  5L9S A;  1MY2 A;  3C33 A;  3VVD A;  4U4S A;  5ISU A;  1Y3N A;  1IXC A;  2Y7P A;  1TFD A;  4YKP A;  2AYS A;  3TPA A;  1R6Z A;  3FXR A;  1ZU0 A;  3MW0 A;  1I6Q A;  4I9D A;  1IXH A;  3TAJ A;  2D3I A;  3QSL A;  4DLD A;  4XKP A;  3OEL A;  4P11 A;  2Y84 A;  3FJ7 A;  4JWO A;  3P7I A;  2XXU A;  4POX A;  5H8Q A;  4F18 A;  3IB0 A;  5CM6 A;  1NFT A;  3TTM A;  3KOT A;  3HN0 A;  1A54 A;  3T66 A;  2HZK A;  3FJM A;  3FXU A;  1USY E;  1MQG A;  2F97 A;  1SQY A;  2HQ0 A;  3MVX A;  5DEX A;  2ANJ A;  3RPW A;  4DZ1 A;  2UYE A;  4Z7E A;  1RKM A;  1SW2 A;  2DQV A;  2QRY A;  2ZNT A;  1YTV A;  3O2A A;  1LAH E;  1B32 A;  1Y4T A;  1II5 A;  1B7Z A;  4NMY A;  1BLF A;  1A55 A;  2I49 A;  2E0S A;  2FA7 A;  3OO6 A;  1IIT A;  2QS2 A;  4NTL A;  2F34 A;  2HXW A;  1DMB A;  2UVJ A;  3IB1 A;  4O3B A;  4ONY A;  4QFK A;  4IO2 A;  1F9B A;  2XXW A;  1A8E A;  1OVB A;  2ONS A;  5KZT A;  1HSL A;  1H45 A;  2QPQ A;  2Z23 A;  4OFO A;  2FYI A;  4H65 A;  2ZXT A;  5JTY B;  1O64 A;  4R74 A;  3ILT B;  3SEV A;  3Q28 A;  1OLA A;  1MS7 A;  3V8X B;  1NNF A;  4OWD A;  3F11 A;  2DE4 A;  4IGR A;  5EHM A;  2GHA A;  4F29 A;  5KDT A;  3DM0 A;  4ZEC A;  3ILU B;  5J1D A;  1QKB A;  4F3S A;  2QMW A;  4GOT A;  1MXX A;  1JW4 A;  2A5T A;  1SD3 A;  4KR5 A;  4BDO A;  1BKA A;  3FZV A;  3MZB A;  4JDF A;  4H1X A;  1B1H A;  1B40 A;  4ZED A;  3IX1 A;  2Q89 A;  1AL3 A;  3GXA A;  1B3L A;  3CSB A;  2Y7W A;  4YKI A;  1GVC A;  1AH5 A;  4BDL A;  3PD9 A;  4NF4 A;  3I6V A;  4YZZ A;  2DWA A;  1TXF A;  3KN8 A;  2Q88 A;  4BDM A;  1B5J A;  3KJT A;  5CMM A;  5CMC A;  3IOW A;  1DTG A;  3K1P A;  1MH3 A;  3IJX B;  3U1O A;  4QFO A;  1URS A;  1GTK A;  4LAT A;  4PFT A;  4RPO A;  2D5W A;  2O6A A;  2FNC A;  1B5H A;  2HEU A;  3PUV E;  3FV2 A;  4F2Q A;  4F1Y A;  4MFI A;  3G7W A;  1FQB A;  3L6H A;  2P2A A;  2DWI A;  1SDX A;  2Y7R A;  3RTF B;  3K2D A;  1MY1 A;  2UVG A;  3HPI A;  3EPE A;  2RKM A;  1M5E A;  4LZ5 A;  4RNS A;  2YLN A;  3LC8 A;  1SI0 A;  3R6U A;  4JSO A;  3IOT A;  4RK9 A;  5H8H B;  2H98 A;  3SES A;  4F1V A;  2XXT A;  1N7W A;  1B3F A;  3PMW A;  1VR5 A;  2NXO A;  2IA4 A;  4FEC A;  2W7Y A;  4H67 A;  4YMA A;  5BWJ A;  3EHS A;  4KYS A;  4PFU A;  1NH7 A;  4ZEI A;  3HHF A;  2QS1 A;  5L9M A;  4KFQ A;  1FQF A;  1MQI A;  2Z8E A;  3TFL A;  3VLV A;  2I4C A;  4PFW A;  3ZSF A;  3PUZ E;  3RLF E;  3OSQ A;  3QYT A;  1TFA A;  2F7A A;  3C4M A;  4R73 A;  4RY1 A;  2DP8 A;  4F22 A;  3MAM A;  4G8H A;  4F3G A;  3N94 A;  1MQJ A;  2O7I A;  3FXQ A;  3OO7 A;  4QSE A;  5IKB A;  3C34 A;  1Z7M E;  4NWD A;  3KSJ A;  4POW A;  3U94 A;  5I2K B;  3M8U A;  4QFP A;  1NL5 A;  5TP9 A;  2NVU B;  1PDA A;  4KCD A;  4LUB A;  3HCQ A;  4OEN A;  4X9T A;  4R9F A;  5F7V A;  3GZG A;  3TKD A;  2I48 A;  3TCH A;  2I3V A;  1OMP A;  1HSJ A;  1P1U A;  3MVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...