2XXVA

Crystal structure of the gluk2 (glur6) m770k lbd dimer in complex with kainate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
248
structure length
248
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPKGSPYRDKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational Flexibility of the Ligand-Binding Domain Dimer in Kainate Receptor Gating and Desensitization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
total genus 85
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxvA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxvA02
4WKMA 4JSDA 1DSNA 4JWOA 5FHMA 2Q2CA 3OSRA 4H67A 4KR5A 1ELJA 3RT8A 1SQYA 1OIBA 1MXUA 2F5XA 1OVBA 4IGTA 3UA8A 4ELQA 1MH4A 3G3HA 3LSXA 1NNTA 1GR2A 4U4XA 2NUVA 2XD3A 3OSQA 2XXQA 1A54A 2ZYMA 4PE5B 5BWJA 1VE4A 1JW5A 5ITPA 5H8QA 4NF5A 3N5LA 4ZEIA 3FVGA 2QMWA 1P1QA 1MQDA 2DYXA 2X26A 3U94A 2NXOA 4QFNA 2DE2A 3M8UA 3OO7A 3HO7A 5DYHA 2I48A 3LSLA 5AA1A 4UACA 4RNSA 1WDNA 2DS9A 4IO6A 1S50A 3TTMA 3ZKLA 3QK6A 1M5CA 3HPIA 2I6EA 4DIGA 4RK9A 1F9BA 3U8QA 1O63A 4OWDA 3SEUA 3CFZA 3TODA 2Y84A 1IQ7A 1Y3PA 4LZ5A 5H8HA 2D5WA 2O7IA 1MPDA 1B0LA 3QUFA 2UVHA 2H98A 2F6GA 1J1NA 1R6ZA 3FVNA 2Y7WA 3I6VA 5I2NB 5ITOA 1YCJA 4ZEKA 3RGYA 1SD3A 4Q30B 3RUMA 3TCFA 2DSFA 2Z8EA 4G2ZA 2OBGA 4FEDA 4R2BA 5I56A 1US5A 4M1VA 2O84X 1Q1KA 2Y7IA 1R1NA 2G93A 2W7YA 3HCQA 3LSWA 4ZEFA 3S9NC 3P7IA 4BDRA 4M4GA 2I0BA 3K00A 1SW4A 4K3FA 4KFQA 1B0HA 1XS5A 2H9BA 3H6UA 4GXAA 3V89B 2DXRA 3H3GA 4G8HA 4QFLA 2H5YA 3TKDA 2V25A 3IX1A 3MZBA 4GFRA 4RY1A 2ZNSA 2DE4A 3D4CA 3MVYA 3Q27A 1Q35A 2HAVA 1LFGA 3PPPA 3VXCA 1B40A 3BBRA 4BDQA 2XXUA 2DXYA 1NNPA 1B7ZA 4R74A 3A09A 1OMPA 2OLBA 1H76A 3LSFB 1ZBMA 3CR9A 3PGFA 1M5DA 4O3BA 4R73A 2XXHA 5DVJA 4DXCA 4U2RA 1CB6A 3PMWA 4ZECA 3H6TA 3CSBA 2HCAA 4G68B 4C0RA 1B58A 3K6VA 3KBRA 4IO7A 3T93B 4N07A 4YMAA 3QAXA 2NWJA 3SEVA 4O3CA 1AL3A 5IKBA 3S9LC 4LP2B 3ONMA 3KFMA 4PFWA 4OMBA 3B6TA 3N94A 1O7TA 2F8DA 2VP1A 3PUWE 4KI0E 3KEIA 2QS3A 4G8MA 3FD3A 4H8IA 1XC1A 3DLNA 1NNKA 4X48A 4X1DA 2IEEA 3RTFB 3USDA 2GHBA 3B6QA 1FTKA 2V3TA 1PB8A 3FVKA 3KN7A 3UORA 4H1XA 3IOVA 3L6GA 2H4IA 4ELOA 1HSEA 2F6PA 4MF3A 3A3CA 2AIXA 5CMBA 2Q8JA 1B9JA 3ZS6A 4ZEDA 4NF6A 2HZLA 4IO2A 3V8XB 1IXCA 1MQIA 3B6WA 4OZ9A 5TP9A 4BDMA 3QYTA 1JQFA 2XX9A 4R6HA 2QPQA 1GV8A 3SKPA 4F22A 1XVXA 4F31B 3PUXE 1MXVA 5KCJB 4NF4A 4F1UA 5AA2A 2I49A 1YAEA 1ZTYA 3THIA 2YJPA 4FJPA 1B5IA 3ODBA 2VD3A 3Q26A 1FTMA 4LA9A 4XKNA 3VVFA 1OQGA 2F34A 3WAEA 2HZKA 1NFTA 2H25A 3O9PA 3PPQA 2ONKE 3OO6A 4GRKA 4YKIA 1DPEA 4G4PA 2O69A 3TQWA 1JEUA 5A5XA 4IGRA 1A7LA 4GVOA 1TWYA 3I5OA 5I57B 2PMSA 1SW2A 1B1HA 3K6UA 3ZKKA 3JYRA 1LGBC 4FORA 2QS4A 5H8HB 3VLWA 1AMFA 1SDXA 4EDPA 1GTKA 4HW8A 1B3HA 1EU8A 1SW1A 3ECRA 3FJ7A 5I57A 1JEVA 3KSJA 3C31A 1AIVA 1FTLA 1EH3A 1B51A 1URGA 1UIUA 4H6DA 4FAJA 3LC8A 3QIMA 2P1SA 4QSEA 4F3PA 3IJOB 4NF8A 3PD8A 1PC3A 3T9HB 1B4HA 3EHUA 4QSDA 3SEWA 1H3DA 3QUJA 1B6HA 4YB6A 2XXRA 3PMVA 2NVUB 3IORA 3RN8A 3PPNA 4JBZA 4NWCA 1DTGA 3RT6B 3U72A 1HSLA 3K6WA 1JVXA 3GBAA 4EQ7A 5CC2A 2Z8DA 4KQPA 5I59B 4TQUQ 4F2OA 1N76A 3PPOA 1JW1A 2ZNUA 4R72A 3SDFA 3E9XA 5ICQA 3IAZA 2ZNTA 4ZDMA 3IL1B 2XXIA 3O6IA 4ESWA 3MVXA 1QJMA 2P0SA 3KOSA 4R9FA 1M5EA 3HSTA 3G3KA 4LQ2A 1A40A 2O51A 3TQLA 5CBRA 1QUJA 5TP9B 1LBBA 3S9MC 1AH5A 1QKAA 3FV2A 4QFPA 1S7YA 1CE2A 5FHOA 1BP5A 5JK4A 1MY3A 2F7AA 2A5TB 2OJTA 1FTOA 4GWOA 5DVFA 2Z8FA 3FATA 1H45A 1PEBA 1LAGE 5TPAA 4LATA 4MFIA 4DE8A 3KGCA 4ECFA 3FASA 5CM6A 1B05A 2VOZA 2UYFA 1TFAA 4E0WA 1VFDA 1NNFA 1A99A 2UVIA 4IY5A 4XIGQ 2RKMA 2D21A 4RA1A 5J1DA 4LZ7A 3TTNA 2PX1A 4FATA 3F11A 1JNFA 2AYSA 3ILTB 5L9SA 1A8EA 4ONYA 1EZ9A 3K4UA 3V83A 1MPBA 1UQWA 4NE4A 2Z22A 3O6GA 4QSCA 3TFLA 2H99A 2ZXTA 3T96B 4NWDA 1QULA 1YTVA 4U23A 3TTLA 5AA3A 4OHNA 3MPKA 1Z7ME 1MDQA 2RC7A 3OO9A 2GHAA 2ESNA 1MQHA 5K2XA 1Z7NE 2DP8A 4U4SA 3MVWA 4QFKA 4RYAA 1A55A 3MVZA 1LB9A 2B3BA 1URDA 4YU0A 2OWSA 3C32A 5H8NB 3MP6A 3RTWB 5KDTA 3IB2A 4HS7A 1QVSA 3IOWA 3LR1A 5I56B 3IOUA 3JZJA 3CG1A 4MBPA 1GGGA 1FQBA 3U1OA 4DCYA 1D3KA 1IZ1A 4UA8A 5CMKA 3PMXA 4NF4B 1R9LA 3CI8A 4G77A 3RPWA 1AOVA 3OELA 4FE8A 5L9MA 3KN3A 4XTCQ 1PBQA 3AXFA 3C34A 1N3XA 1P1OA 4N6PA 2LAOA 3K1PA 4OTEA 1Y3NA 3UN6A 3KOTA 4F2QA 2CZLA 2Q2AA 3CVGA 3DP6A 4NEDA 2XXXA 5F1QA 4F18A 3TMGA 4GL0A 4GLIA 3FIRA 5CI5A 3VVDA 1SYIA 4YKKA 1A8FA 1MH3A 1N04A 2M8CA 3DP8A 4OENA 1QW0A 4OVJA 4OXVA 3OEKA 3KN8A 3N26A 5L8DA 1FQAA 3SEYA 2V84A 2REJA 5FHNA 3Q29A 5B7DA 4FEBA 3K6XA 4RPNA 1Y4CA 2RCBA 4KPTA 1RYXA 4PFYA 2P2AA 4EXLA 1US4A 3RQTA 3T9XB 2RF1A 1OQHA 4I62A 1SI0A 2WKYA 4HTGA 3TTRA 2F36A 3T9VA 2QS1A 1QUKA 2RINA 1QUIA 3TYHA 3S9EA 1Y4TA 5I2NA 2E0SA 3M3KA 3VLUA 1FQFA 5EHMA 3K0VA 4OETA 1N7XA 4BLAA 3IO4A 4R6YA 3GXAA 2B65A 1PB7A 3JV9A 3VDFA 3C9HA 4H0WA 2Q88A 5H8FB 1LFHA 2THIA 2HEUA 2QSXA 5ELVA 4EUOA 1SBPA 1B32A 4C1TA 4KD5A 3IJXB 4WEDA 1MQJA 3SETA 2O1LA 3GZGA 5CBSA 3PV0E 1UTBB 5AA2B 1ATGA 3OO8A 3TUSA 4RK2A 1DTZA 1DPPA 1B3LA 3CRBA 5HBCA 4TOZA 5I2KA 4Q8RA 3RNNA 4YB5A 3HN0A 3KJTA 4LUBA 5DEXA 1D9YA 3Q25A 3MJNA 1N3WA 3MWBA 1WODA 3UGWA 2HXWA 5JTYA 1H43A 3IB0A 4IO5A 3EPEA 3O2AA 2UXAA 5F7VA 4U22A 2VGQA 5H8QB 3BKIB 3FXUA 5TPAB 3OD7A 1LFIA 1BTJA 1ZIUA 3H03A 4GXSB 1B4ZA 1XHYA 3FJGA 2DWIA 1B3GA 4HCYA 4ESXA 1LB8A 2O68A 3FXQA 1OVTA 3PD9A 3KJ7A 1EZOA 4NF8B 1JW4A 3PUYE 1MY2A 4GD5A 3FV1A 4XKQA 4IY6A 4I9DA 1DMBA 3O29A 2E1SA 4R75A 2PT1A 2OWTA 3Q28A 4AQ4A 1P1NA 4PFUA 4ELPA 3S4UA 4F3BA 3SERA 1NMUA 5FTIA 2DQVA 4H5FA 4LZ8A 3VVEA 3HHGA 5CRYA 4AB5A 3MP8A 2QJEA 4THIA 1DOTA 1VR5A 1Y3QA 2ALUA 4C1UA 5I58A 2I0CA 3UP9A 3E13X 4OESA 2UVJA 3FUZA 4QHQA 4EXKA 4U21A 1VFEA 3KG2A 3QXMA 4DDDA 2F78A 4YKPA 2ONRA 3LBSA 4P0GA 1SVXB 3H6WA 4PQJA 3K01A 3G3FA 5DVIA 2GRVA 3OEMA 3GBBA 4GF8A 3H6VA 2ONSA 1ANFA 4IB2A 4PP0A 1II5A 1LLSA 1XT8A 3MQ9A 4O3AA 4EF1A 2CMOA 1N0TA 2VD2A 5A5XB 4YZZA 5DTBA 1QKBA 3U92A 3EHSA 1OLCA 4I8CA 2RCAA 5L9OA 1MM7A 2YPNA 3K1NA 3T66A 1IIWA 4G8NA 1I69A 2RC9A 2XHDA 1MQGA 2QRYA 4KCDA 2PT2A 2XXVA 4X1BA 2F7BA 2FYIA 2XXPA 2ZMBA 3GLBA 2OK2A 3MUQA 2KLFA 4LVQA 4XKPA 3KZGA 4RJZA 4ZZAA 2Y7KA 3LUYA 1IXIA 4G68A 4JB7A 5B70A 3MBPA 1R9QA 1VSOA 4QRZA 4U1OA 1MXXA 3ZSFA 1IXHA 1B7HA 2HAUA 2IA4A 3IB1A 4QF9A 5CMCA 3V5AA 1NKXA 2DWAA 2DOJA 1N84A 2RC8A 2AL4A 2HQ0A 2UVGA 1OLAA 2QS2A 3UK4A 4BDLA 5CMMA 1ZLQA 1FTJA 1LAFE 5I84A 1EZPA 4ZZEA 3MW0A 3DELB 1UIVA 4WXJA 3TPAA 3G3IA 1WVJA 4POXA 1SYHA 4ZS9A 4F1VA 2GH9A 2DWJA 4GQOA 1SW5A 1HSJA 1I6AA 2ZYKA 4IO3A 2G29A 1LAXA 1M5FA 4LQ5A 5KZTA 4F39A 2Z23A 2A5TA 3OMBA 4HCWA 4PETA 4OQOA 1PBPA 5HM4B 5JTYB 2UYEA 4I1DA 4BDOA 4DXUA 2ANJA 2X7PA 2V93A 3FVOA 4NMYA 2I3VA 3ILUB 4OEVA 1MRPA 1FQEA 4NF5B 3TZAA 3S2VA 3IK6B 2QMXA 4FECA 5I2KB 4E0XA 2QL3A 1LCTA 1MY4A 3TELA 1XOCA 2Q89A 3EF7A 1NH7A 3E4RA 3IR1A 2Q9TA 4F3SA 3BFTA 4QFOA 3FXRA 4XKRA 3MZ1A 3BFUA 1JVYA 4ZE8A 3W15C 1POTA 3O97A 5IAIA 1Y20A 5DT6A 2GFEA 2REGA 3MPLA 3SEXA 5LOMA 3C4MA 3CG3A 1NL5A 3N6UA 2I58A 4FIMA 5AA4B 4IO4A 3HHFA 4RPOA 1GVCA 3EQ1A 2XD2A 5AA4A 5H8FA 1LBCA 3KSXA 2ZYOA 5HPQA 1D9VA 3FGSA 4F19A 3O66A 4KHZE 2R71A 3MP1A 5M2VA 3R7XA 4ND9A 3QSLA 1IITA 2V3QA 2OZZA 1RKMA 1BIYA 2Y7RA 4H5GA 4YICA 2PVUA 4G68C 1B46A 1M5BA 4ZEBA 3DP4A 2FNCA 2O6AA 1B3FA 2DVZA 4JDFA 2YLNA 2I4CA 2X7QA 2ABHA 4JWYA 4OFJA 5K2YA 3VE1B 5I59A 5FTHA 4R2FA 4NTLA 1PDAA 1YPNA 3FJMA 3PUZE 1UTBA 1FCKA 4H8JA 4ZE9A 5H8SA 3RLFE 1MS7A 1LSTA 3EN3A 1ZJLA 3D4GA 3O6HA 2F97A 4OYVA 1POY1 1O64A 1B2HA 4ELRA 2PBWA 5ISUA 4EQBA 3PU5A 1LCFA 4DLDA 3G7WA 1FW0A 1B3EA 1L5TA 4OFOA 5ICTA 4JWXA 1B1XA 1B7UA 2R6GE 2DE3A 4TLMB 3WAFA 1TT1A 4YAHX 1MY0A 1IUDA 3FZVA 5AA2D 5EYFA 1URSA 2B3FA 1USYE 1UTHB 3C36A 3R6UA 1Y1ZA 3CFLA 4F29A 4F3GA 1P99A 3K2DA 1MDP1 2Y7PA 3VV5A 4Z7EA 3C35A 3MC2A 4JXIA 1BLFA 1ZKBA 3IOTA 2V3UA 3HV1A 4U1ZA 4EQ9A 2I4BA 2VHAA 2O1MA 3T22A 4MLQA 2FA7A 1MXYA 4DZ1A 3RY3A 3E3KA 4OEUA 3CIJA 1LAHE 4YKJA 4KYDA 4P11A 1FQCA 1T0KA 1MY1A 3W9WA 3CSGA 3L6HA 5H8NA 4NF6B 3VFJA 3OENA 1ZMGA 2OCUA 1B52A 4RXLA 1Y1MA 5AE4A 5KCJA 4N13A 3EHTA 1RYOA 4OERA 2I3WA 4Z0IA 5TU0A 1PB9A 4GL8A 1NH8A 3MAMA 3OXNA 3SESA 1BKAA 1P1WA 1I6QA 1P1UA 3M3LA 1MXZA 3IO6A 1MG1A 4PFTA 3TAJA 4WEPA 4X9TA 5JEIA 3B7DA 4MH5A 1MPCA 2XX8A 3PUVE 4ISUA 2D3IA 4KYEA 3R26A 4P0IA 3TCGA 3N6TA 4R9GA 3UIFA 2XXYA 4TLLB 2BJJX 3H06B 1H44A 3K02A 1I6BA 1KWHA 3DM0A 1D4NA 1IXGA 1SI1A 2R9JA 3OOAA 2AL5A 4DCXA 1USYH 3M3FA 3G3JA 3C33A 4GOTA 4DXBA 2A5SA 3K1MA 1XVYA 4XXUA 3VLVA 2F7CA 5DEXB 1TXFA 2O7UA 2HFBA 2XX7A 3H7MA 3TCHA 3TEPA 3TTKA 3VXBA 2F35A 1FQDA 1UTHA 2XXWA 3U93A 3G3GA 1MM6A 1S9TA 2DVCA 3H4ZA 3MZ9A 1Y9UA 3I3VA 3O28A 4KCCA 3A3UA 4KYSA 1IEJA 4LONB 4POWA 5EHSA 2ZYNA 4BDNA 4GIZA 5BUUA 4JSOA 3W9VA 4YB7A 2PYYA 2XXTA 1TFDA 4R6KA 1B5JA 1MXWA 4MLVA 4Q0CA 2DWHA 3T9UA 4F1YA 5I58B 5KDTB 2NOOA 3PPRA 3TDJA 4AB6A 1JETA 1N7WA 1ZU0A 4EF2A 4Q5TA 1B5HA 3CFXA 4L17A 4H65A 4OFLA 4YMBA
chains in the Genus database with same CATH superfamily
4JSDA 3RT8A 4ELQA 1MXUA 3BIGA 5ITPA 2QMWA 3LV0A 3HO7A 3A29A 3QK6A 2I6EA 3SEUA 1IQ7A 1Y3PA 1FPFA 2O7IA 3QUFA 4GXAA 3RGYA 3TCFA 1Q1KA 1R1NA 4ZEFA 4G61A 1KA1A 4K3FA 1K9ZA 4KFQA 3H6UA 2DXRA 4QFLA 4G8HA 4JVDA 3ROJA 3MVYA 2XXUA 2DXYA 1OMPA 3LSFB 3CR9A 3PGFA 1M5DA 4O3BA 2HCAA 4C0RA 3K6VA 2BJIA 4O3CA 4PFWA 2ZZWA 3N94A 4KI0E 3KEIA 4G8MA 1EYKA 1XC1A 3DLNA 1NNKA 4X1DA 3USDA 2IEEA 1PB8A 3KN7A 3UORA 4H1XA 1FPEA 1HSEA 2F6PA 4MF3A 5A5LA 3ZS6A 2AIXA 4ZEDA 1NV5A 4P8BA 1LBVA 4N81A 2I49A 3THIA 4LA9A 3W9VA 2VD3A 1FTMA 3VVFA 5IZ3B 2ONKE 1DPEA 1JP4A 4G4PA 4IGRA 1A7LA 4PTKA 2XXKA 4HE2A 5I57B 1NUZA 1B1HA 3CHGA 1AMFA 1SDXA 4HW8A 1B3HA 1EU8A 3ECRA 1JEVA 4MNIA 1FTLA 1B51A 5EQ8A 1UIUA 3QIMA 1NV0A 3IJOB 3SEWA 4JBZA 3RT6B 3U72A 4EQ7A 2P0SA 3KOSA 1XI6A 3TQLA 5IZ3A 5TP9B 1LBBA 1QKAA 3FV2A 4MCOA 5FHOA 5JK4A 2A5TB 3FATA 1FPLA 1H45A 1PEBA 1LAGE 5TPAA 4MFIA 4DE8A 5H8FA 2WYKA 3KGCA 3FASA 2VOZA 3T1BA 2D21A 5L9SA 1FJ6A 1MPBA 4NE4A 1FBHA 3O6GA 4N15A 2ZXTA 1Z7ME 3LUZA 3MVWA 2B3BA 4YU0A 3MP6A 4IR8A 4MBPA 5T3JA 1D3KA 4NF4B 1R9LA 1AOVA 3OELA 4XTCQ 1PBQA 3AXFA 1Y3NA 1NV6A 4F2QA 2XXXA 1IMCA 2FIXA 3FIRA 5CI5A 3VVDA 1MH3A 2M8CA 3N26A 3Q29A 4MAGA 3K6XA 1Y4CA 2RCBA 4KPTA 1US4A 4PFIA 1OQHA 1QUKA 2RINA 3S9EA 1Y4TA 3M3KA 1K9YA 5EHMA 3K0VA 1LBZA 1PB7A 3JV9A 1LFHA 2Q88A 2THIA 5ELVA 4GWYA 3IJXB 1MQJA 4O94A 3SETA 1UTBB 1DTZA 3CRBA 1B3LA 5HBCA 1EYIA 4TOZA 3RNNA 3KJTA 4LUBA 4LN5A 3IB0A 2UXAA 4U22A 5H8QB 1LFIA 3H03A 4GXSB 1B4ZA 3FJGA 4HCYA 2O68A 3KJ7A 1EZOA 4NF8B 1JW4A 5IZZA 2XWVA 1DMBA 4OA4A 3Q28A 2CZHA 2DQVA 4H5FA 4P9KA 3MP8A 2QJEA 4MIJA 2F78A 4YKPA 3KBZA 3LBSA 5IM2A 3G3FA 5DVIA 1XT8A 4O3AA 1N0TA 2VD2A 5A5XB 5DTBA 3EHSA 4G8NA 5IZ1A 4KCDA 2XXVA 1R9QA 1IXHA 2HAUA 2IA4A 3IB1A 4PGNA 1NKXA 1N84A 2UVGA 1OLAA 1ZLQA 3MW0A 4I3EA 4POXA 4ZS9A 2DWJA 1HSJA 4LQ5A 4NN3A 4F39A 1YYZA 4HCWA 5JTYB 2V93A 3ILUB 4I40A 4OEVA 1MRPA 3IK6B 5I2KB 3TELA 1LCTA 2Q89A 3EF7A 3E4RA 3IR1A 3BFTA 3FXRA 1JVYA 5DT6A 2GFEA 3KC1A 3C4MA 3CG3A 1NL5A 4FIMA 4IO4A 4MEVA 2XD2A 1LBCA 5HPQA 4F19A 5M2VA 2V3QA 2PVUA 1FBEA 2DVZA 5FTHA 3PUZE 1LSTA 2F97A 2PBWA 4EQBA 4DLDA 1B3EA 1L5TA 1IUDA 5AA2D 1RDYA 2PCRA 3CFLA 3C35A 3MC2A 1ZKBA 3HV1A 2I4BA 3T22A 3RY3A 3E3KA 1LAHE 3W9WA 1B52A 5KCJA 4N13A 4Z0IA 1NH8A 3OXNA 4PFTA 3TAJA 4WEPA 4X9TA 3B7DA 4KYEA 2XXYA 4TLLB 2BJJX 4GWUA 3DM0A 3HFUA 5LOMA 3K1MA 3VLVA 3H7MA 3TEPA 3VXBA 1MM6A 1S9TA 2DVCA 3H4ZA 4LONB 1Y9UA 4POWA 2KR0A 1IEJA 2PYYA 4R6KA 4MLVA 4F1YA 3PPRA 4L17A 4H65A 4OFLA 4JWOA 2XWKA 4KR5A 1SQYA 2F5XA 1OVBA 1MH4A 1VDWA 1VE4A 1BK4A 1JW5A 1MQDA 2X26A 4FBPA 5DYHA 2I48A 3LSLA 3KC0A 4RK9A 1F9BA 3U8QA 5LTCA 4LZ5A 2D5WA 1MPDA 2F6GA 3FVNA 4ZEKA 4G2ZA 2CEYA 4R2BA 3HCQA 3LSWA 3P7IA 1B0HA 2H9BA 5I7IA 3H3GA 1NUYA 2H5YA 2ZNSA 3PPPA 3BBRA 4XFEA 1B7ZA 4R74A 5DVJA 4DXCA 3CSBA 3SEVA 3S9LC 3B6TA 3PUWE 2QS3A 4H8IA 3RTFB 2GHBA 3B6QA 1FTKA 2V3TA 1B9JA 2HZLA 3V8XB 1MQIA 4OZ9A 3SKPA 1GV8A 4F22A 2PFYA 4F31B 5EQAA 1MXVA 2HPGA 5AA2A 4FJPA 1B5IA 3Q26A 1OQGA 3TQWA 1JEUA 4GVOA 2PMSA 1SW2A 4DDDA 1YZ0A 1LGBC 2QS4A 2XA5A 1SW1A 3FJ7A 5I57A 1EH3A 4QSEA 4F3PA 4NF8A 3T9HB 2OWZA 1B4HA 3EHUA 3RN8A 1B6HA 2XXRA 1EYJA 3PPNA 3K6WA 1JVXA 3GBAA 2Z8DA 5I59B 1N76A 3PPOA 4R72A 3IAZA 2ZNTA 1LBYA 3IL1B 1QJMA 3HSTA 3G3KA 4LQ2A 2O51A 5CBRA 4PBQA 4N8GA 4QFPA 1CE2A 1BP5A 1MY3A 2F7AA 2OJTA 4GWOA 5DVFA 4MX6A 2DDKA 4ECFA 1FBDA 4E0WA 1NNFA 4IY5A 2UVIA 2L5VA 1IMBA 3TTNA 3F11A 2QVRA 2AYSA 3K4UA 1UQWA 2FHYA 2Z22A 4QSCA 3TFLA 1QULA 3TTLA 3MPKA 2GHAA 5K2XA 1Z7NE 2DP8A 4U4SA 4GWXA 1A55A 2OWSA 5KDTA 1LBWA 1FQBA 3U1OA 5CMKA 1DCUA 3CI8A 4FE8A 4N6PA 1N3XA 1P1OA 2LAOA 3K1PA 3TMGA 4GLIA 4JVIA 1SYIA 1A8FA 2B4MA 3OEKA 4HE0A 4NHBA 4FEBA 3T9XB 4I62A 3TYHA 2E0SA 1IMFA 4X8RA 2OX3A 3VDFA 4H0WA 5H8FB 2QSXA 4HE1A 4EUOA 1B32A 3OO8A 4RK2A 3HN0A 1D9YA 3Q25A 3MJNA 1N3WA 2HXWA 1H43A 3EPEA 5F7VA 5TPAB 2WYPA 1B3GA 1OVTA 2XWIA 3PUYE 3FV1A 3O29A 2PT1A 4F3BA 3S4UA 4AB5A 4PDDA 1VR5A 1Y3QA 4C1UA 5I58A 4OESA 3FUZA 3QXMA 2ONRA 4P0GA 3GBBA 3H6VA 2ONSA 1II5A 1NI9A 4PAFA 3MSTA 2CMOA 1YXIA 1QKBA 4I8CA 4NQ8A 5L9OA 3T66A 2QRYA 2PT2A 4X1BA 3QMFA 2F7BA 2FYIA 2XXPA 3GLBA 2CZKA 2OK2A 2KLFA 2VT5A 4XKPA 3KZGA 4JB7A 4G68A 5B70A 4QRZA 3ZSFA 4QF9A 3V5AA 2HQ0A 5CMMA 5I84A 4WXJA 1KA0A 1RDZA 1SW5A 1I6AA 2ZYKA 1LAXA 1M5FA 2Z23A 4OVSA 3OMBA 4OQOA 1PBPA 2UYEA 4BDOA 4DXUA 3TZAA 4GX3A 2QMXA 4E0XA 2QL3A 1MY4A 1XOCA 2Q9TA 4O7MA 4QFOA 1NV2A 3MZ1A 3BFUA 4XKRA 3W15C 5IAIA 3MPLA 3E78A 3HHFA 4RPOA 5AA4A 3KSXA 2ZYOA 3FGSA 2WX9A 2R71A 3MP1A 4ND9A 1NV3A 3QSLA 1RKMA 1BIYA 4YICA 4ZEBA 4G68C 1B46A 1B3FA 2I4CA 5K2YA 1YPNA 5I3SA 4PAIA 3EN3A 4OVPA 2P3VA 3D4GA 4GWSA 1RDXA 1B1XA 4TLMB 2DE3A 5EQ9A 4YAHX 1MY0A 3FZVA 3D1RA 4GX6A 1USYE 4F3GA 3K2DA 2Y7PA 4JXIA 3SZPA 1MXYA 4OEUA 3CIJA 1T0KA 2JJKA 4PAKA 3VFJA 4NF6B 1FPDA 3EHTA 1RYOA 4GX4A 1PB9A 3SESA 1KZ8A 1I6QA 1P1UA 1MG1A 4OVQA 1MPCA 4ISUA 3TCGA 3H06B 1KWHA 1D4NA 1SI1A 2AL5A 1USYH 2HFBA 3TCHA 5ESYA 2F35A 1UTHA 2XXWA 3G3GA 4DI3D 4KCCA 3A3UA 1FPGA 4KYSA 2GQ1A 2ZYNA 4GIZA 4JSOA 2XXTA 1MXWA 4Q0CA 5KDTB 5I58B 4AB6A 1N7WA 1ZU0A 4MJOA 2WBBA 4WKMA 1DSNA 5FHMA 4H67A 1OIBA 3UA8A 3IFCA 2NUVA 4P1LA 4MMPA 2QVUA 2ZYMA 4PF6A 1FTAA 4NF5A 3N5LA 4ZEIA 2DYXA 3U94A 3M8UA 3OO7A 4N6KA 4UACA 4RNSA 1WDNA 3ZKLA 1M5CA 3HPIA 4OWDA 2R8TA 3CFZA 2Y84A 2H98A 2Y7WA 5ITOA 1YCJA 3RUMA 1SD3A 2DSFA 2Z8EA 1FPKA 4FEDA 5I56A 1US5A 2O84X 2G93A 3S9NC 3K00A 1SW4A 1XS5A 3V89B 3B8BA 4NX1A 2V25A 4GFRA 4RY1A 3TKDA 2DE4A 3D4CA 1Q35A 2HAVA 3VXCA 1B40A 4BDQA 1NNPA 3A09A 1NV1A 2Q8MA 1ZBMA 2XXHA 4ZECA 3PMWA 3H6TA 1B58A 4N07A 2FBPA 5IKBA 4LP2B 1O7TA 5LDZA 3FD3A 4X48A 5IGAA 3RPLA 3L6GA 2H4IA 4ELOA 3A3CA 2Q8JA 5CMBA 4IO2A 3B6WA 4BDMA 3QYTA 2XX9A 4R6HA 1XVXA 1FBCA 3E79A 5KCJB 4NF4A 4F1UA 1ZTYA 2HZKA 1NFTA 3PPQA 4YKIA 1NV4A 2O69A 1AWBA 4O7IA 4YMAA 4FORA 2WBDA 4EDPA 1GTKA 3C31A 1AIVA 4FAJA 3LC8A 2P1SA 3PD8A 1PC3A 4QSDA 3QUJA 4I3YA 2NVUB 4YB6A 3PMVA 4PCDA 3IORA 4NWCA 1DTGA 4OANA 1NV7A 4KQPA 4F2OA 5ICQA 1JW1A 2VPNA 4X04A 3E9XA 2XXIA 4KXPA 3FBPA 1M5EA 1A40A 3S9MC 3BIHA 1S7YA 1FTOA 4XF5A 5CM6A 1TFAA 1VFDA 1A99A 4RA1A 4FATA 3ILTB 1A8EA 4ONYA 2H99A 3T96B 3OO9A 4PFBA 1MQHA 4RYAA 1URDA 3RTWB 4HS7A 3IOWA 3LR1A 3IOUA 3CG1A 1GGGA 1IZ1A 5I5PA 1QGXA 4QBAA 3RPWA 5L9MA 3KN3A 4N6DA 3C34A 4OTEA 4UABA 1FBGA 3KOTA 4F18A 3CVGA 2Q2AA 3DP6A 4NEDA 4GL0A 4YKKA 4XEQA 4OVJA 4OENA 1QW0A 4OXVA 3KN8A 5L8DA 1FQAA 3SEYA 2V84A 2REJA 1RYXA 4PFYA 2P2AA 4EXLA 2RF1A 4P56A 5I2NA 3VLUA 4OETA 1N7XA 3IO4A 2XWOA 4R6YA 3C9HA 4KD5A 4WEDA 1LEVA 3PV0E 3TUSA 1DPPA 4Q8RA 5DEXA 3MWBA 1WODA 3UGWA 4IO5A 2VGQA 3FXUA 1ZIUA 4PE3A 1XHYA 4ESXA 1LB8A 4GD5A 4XKQA 4IY6A 2E1SA 4PDHA 4AQ4A 4ELPA 4PFUA 4O8MA 3SERA 5FTIA 4LZ8A 3VVEA 3HHGA 5CRYA 2ALUA 2I0CA 3UP9A 4EXKA 4U21A 3KG2A 1FBPA 2CZIA 3OEMA 4PP0A 1LLSA 1FPBA 2FVZA 3U92A 1OLCA 2RCAA 1MM7A 2YPNA 3K1NA 1IIWA 1I69A 2RC9A 1MQGA 4OVRA 2ZMBA 4MNCA 4ZZAA 1IMDA 2Y7KA 3LUYA 3MBPA 4U1OA 1MXXA 1B7HA 5CMCA 2DWAA 1Q9DA 2AL4A 4BDLA 2QS2A 3UK4A 3U65A 1FTJA 1LAFE 4PBHA 3DELB 3TPAA 3G3IA 1WVJA 1SYHA 2G29A 2Y5KA 2A5TA 4PETA 2ANJA 2X7PA 3FVOA 4NMYA 2I3VA 4N17A 1NH7A 4F3SA 3O97A 1Y20A 5AA4B 2I58A 3EQ1A 1D9VA 5ET6A 1FSAA 3R7XA 1M5BA 3DP4A 4JDFA 2X7QA 1PDAA 4H8JA 5H8SA 4QXDA 4NAPA 3O6HA 1ZJLA 4ELRA 4H45A 3PU5A 3G7WA 1FW0A 5J16A 4OFOA 2R6GE 5ET8A 1TT1A 5EYFA 1URSA 1UTHB 2F3DA 3IOTA 4U1ZA 2VHAA 2O1MA 4MLQA 2FA7A 4P11A 1MY1A 3CSGA 3L6HA 5H8NA 2OCUA 1Y1MA 5AE4A 4OERA 2I3WA 4GL8A 3MAMA 3IO6A 4MH5A 3PUVE 4P0IA 4NF0A 3N6TA 4R9GA 3UIFA 3K02A 1H44A 1I6BA 1IXGA 2R9JA 4DCXA 3G3JA 4GOTA 1XVYA 4XXUA 2F7CA 5DEXB 2XX7A 2KQZA 3O28A 4ESWA 4BDNA 4YB7A 1TFDA 2DWHA 3TDJA 4EF2A 1JETA 4Q5TA 3CFXA 1FBFA 2Q2CA 3OSRA 1ELJA 4IGTA 3G3HA 3LSXA 1NNTA 1GR2A 4U4XA 2XD3A 3OSQA 2XXQA 1A54A 4PE5B 5BWJA 5H8QA 3FVGA 1P1QA 2VPOA 2NXOA 4QFNA 2DE2A 5AA1A 2DS9A 4IO6A 1S50A 3TTMA 4DIGA 1O63A 2CEXA 1G0HA 5H8HA 1B0LA 2UVHA 1J1NA 1R6ZA 2Y5LA 4PC9A 3I6VA 5I2NB 4Q30B 2OBGA 4M1VA 4N91A 2Y7IA 2W7YA 4BDRA 4M4GA 2I0BA 3IX1A 3MZBA 5ET7A 3Q27A 4N4UA 1LFGA 2OLBA 3FXBA 1H76A 4R73A 4U2RA 1CB6A 4G68B 3KBRA 4IO7A 4DI4B 3T93B 3QAXA 2NWJA 1SPIA 1AL3A 4JVCA 3ONMA 3KFMA 4NG7A 2QFLA 4OMBA 2F8DA 2VP1A 4H46A 5ISUA 4GWZA 3FVKA 3GYYA 5F24A 5FBPA 3IOVA 3MYUA 4NF6A 2B4LA 1IXCA 5TP9A 1JQFA 3PTYA 2QPQA 3PUXE 1YAEA 2YJPA 4XKNA 3ODBA 3WAEA 2F34A 2HXRA 2H25A 3O9PA 1DK4A 3OO6A 4GRKA 5A5XA 1TWYA 3I5OA 3K6UA 1FPIA 3ZKKA 3JYRA 5H8HB 3VLWA 2V4CA 3KSJA 1URGA 4H6DA 1H3DA 4AS4A 4N8YA 5CC2A 1HSLA 4TQUQ 2ZNUA 3SDFA 4ZDMA 3O6IA 5EYHA 3MVXA 4R9FA 4HXVA 1QUJA 1AH5A 2Z8FA 4LATA 1B05A 2UYFA 4XIGQ 2RKMA 1D9QA 5J1DA 4LZ7A 1G0IA 1LBXA 2PX1A 1JNFA 3V83A 1EZ9A 4PFRA 4NWDA 1YTVA 4U23A 5AA3A 4OHNA 4GWWA 1MDQA 2RC7A 2ESNA 4QFKA 3MVZA 1LB9A 3C32A 5H8NB 5DW8A 3IB2A 1QVSA 5I56B 3JZJA 4DCYA 4UA8A 3ISPA 3PMXA 5EQ7A 4G77A 4P1EA 3UN6A 3RYDA 2CZLA 5F1QA 2PFZA 1N04A 3DP8A 5FHNA 4RPNA 3RQTA 1INPA 1SI0A 2WKYA 4HTGA 4MHFA 3TTRA 2F36A 3T9VA 2QS1A 1QUIA 1FQFA 4BLAA 3GXAA 2B65A 2HEUA 2FIEA 1SBPA 4C1TA 4PGPA 2O1LA 3GZGA 5CBSA 5AA2B 1ATGA 5I2KA 4YB5A 5JTYA 3O2AA 3T0JA 3BKIB 3OD7A 4OVTA 1BTJA 2P3NA 1NUWA 2DWIA 3FXQA 3PD9A 1MY2A 1IMAA 4I9DA 4R75A 2OWTA 4MNPA 1P1NA 1NMUA 2Q74A 4THIA 1DOTA 3E13X 2UVJA 4QHQA 1VFEA 1SVXB 3H6WA 4PQJA 3K01A 2GRVA 4GF8A 1IMEA 5B7DA 1ANFA 4IB2A 1FJ9A 1NUXA 4EF1A 3MQ9A 2WEFA 4AS5A 4YZZA 3IFAA 2XHDA 4LVQA 3MUQA 4RJZA 1IXIA 1VSOA 2DOJA 2RC8A 1EZPA 4ZZEA 4P47A 1UIVA 4PF8A 4F1VA 2GH9A 4GQOA 4IO3A 2MKZA 5HM4B 1FPJA 4I1DA 1FRPA 4NF5B 1FQEA 3S2VA 4FECA 2ZZXA 3NOHA 4ZE8A 1POTA 4NGUA 5ET5A 2REGA 3SEXA 3N6UA 3B50A 2QVVA 1GVCA 3O66A 3RPLB 4KHZE 1IITA 2OZZA 2Y7RA 4H5GA 2FNCA 2O6AA 2YLNA 5I59A 4JWYA 2ABHA 3VE1B 4OFJA 3EKIA 4R2FA 4NTLA 3FJMA 1UTBA 1FCKA 4ZE9A 3RLFE 1MS7A 4OYVA 1POY1 1O64A 1B2HA 1LCFA 5ICTA 4P3LA 4JWXA 4GBVA 1B7UA 3WAFA 3R6UA 2B3FA 3C36A 1Y1ZA 4F29A 1P99A 1MDP1 3VV5A 2F3BA 4Z7EA 4EQ9A 1BLFA 2V3UA 4DZ1A 4YKJA 2ZZVA 1CNQA 4KYDA 1FQCA 3OENA 1ZMGA 4RXLA 5TU0A 1BKAA 5EYGA 1P1WA 3M3LA 1MXZA 4GBWA 2HHMA 5JEIA 2XX8A 2D3IA 3R26A 3OOAA 1DBZA 4DXBA 3M3FA 3C33A 2A5SA 1TXFA 2O7UA 3TTKA 1FQDA 3U93A 3TODA 3MZ9A 3I3VA 5KZTA 5BUUA 5EHSA 1B5JA 3T9UA 2NOOA 1B5HA 4YMBA
chains in the Genus database with same CATH topology
4WKMA 4JSDA 1DSNA 4JWOA 5FHMA 2Q2CA 3OSRA 4H67A 4KR5A 1ELJA 3RT8A 1SQYA 1OIBA 1MXUA 2F5XA 1OVBA 4IGTA 3UA8A 4ELQA 1MH4A 3G3HA 3LSXA 1NNTA 1GR2A 4U4XA 2NUVA 2XD3A 3OSQA 2XXQA 1A54A 2ZYMA 4PE5B 5BWJA 1VE4A 1JW5A 5ITPA 5H8QA 4NF5A 3N5LA 4ZEIA 3FVGA 2QMWA 1P1QA 1MQDA 2DYXA 2X26A 3U94A 2NXOA 4QFNA 2DE2A 3M8UA 3OO7A 3HO7A 5DYHA 2I48A 3LSLA 5AA1A 4UACA 4RNSA 1WDNA 2DS9A 4IO6A 1S50A 3TTMA 3ZKLA 3QK6A 1M5CA 3HPIA 2I6EA 4DIGA 4RK9A 1F9BA 3U8QA 1O63A 4OWDA 3SEUA 3CFZA 3TODA 2Y84A 1IQ7A 1Y3PA 4LZ5A 5H8HA 2D5WA 2O7IA 1MPDA 1B0LA 3QUFA 2UVHA 2H98A 2F6GA 1J1NA 1R6ZA 3FVNA 2Y7WA 3I6VA 5I2NB 5ITOA 1YCJA 4ZEKA 3RGYA 1SD3A 4Q30B 3RUMA 3TCFA 2DSFA 2Z8EA 4G2ZA 2OBGA 4FEDA 4R2BA 5I56A 1US5A 4M1VA 2O84X 1Q1KA 2Y7IA 1R1NA 2G93A 2W7YA 3HCQA 3LSWA 4ZEFA 3S9NC 3P7IA 4BDRA 4M4GA 2I0BA 3K00A 1SW4A 4K3FA 4KFQA 1B0HA 1XS5A 2H9BA 3H6UA 4GXAA 3V89B 2DXRA 3H3GA 4G8HA 4QFLA 2H5YA 3TKDA 2V25A 3IX1A 3MZBA 4GFRA 4RY1A 2ZNSA 2DE4A 3D4CA 3MVYA 3Q27A 1Q35A 2HAVA 1LFGA 3PPPA 3VXCA 1B40A 3BBRA 4BDQA 2XXUA 2DXYA 1NNPA 1B7ZA 4R74A 3A09A 1OMPA 2OLBA 1H76A 3LSFB 1ZBMA 3CR9A 3PGFA 1M5DA 4O3BA 4R73A 2XXHA 5DVJA 4DXCA 4U2RA 1CB6A 3PMWA 4ZECA 3H6TA 3CSBA 2HCAA 4G68B 4C0RA 1B58A 3K6VA 3KBRA 4IO7A 3T93B 4N07A 4YMAA 3QAXA 2NWJA 3SEVA 4O3CA 1AL3A 5IKBA 3S9LC 4LP2B 3ONMA 3KFMA 4PFWA 4OMBA 3B6TA 3N94A 1O7TA 2F8DA 2VP1A 3PUWE 4KI0E 3KEIA 2QS3A 4G8MA 3FD3A 4H8IA 1XC1A 3DLNA 1NNKA 4X48A 4X1DA 2IEEA 3RTFB 3USDA 2GHBA 3B6QA 1FTKA 2V3TA 1PB8A 3FVKA 3KN7A 3UORA 4H1XA 3IOVA 3L6GA 2H4IA 4ELOA 1HSEA 2F6PA 4MF3A 3A3CA 2AIXA 5CMBA 2Q8JA 1B9JA 3ZS6A 4ZEDA 4NF6A 2HZLA 4IO2A 3V8XB 1IXCA 1MQIA 3B6WA 4OZ9A 5TP9A 4BDMA 3QYTA 1JQFA 2XX9A 4R6HA 2QPQA 1GV8A 3SKPA 4F22A 1XVXA 4F31B 3PUXE 1MXVA 5KCJB 4NF4A 4F1UA 5AA2A 2I49A 1YAEA 1ZTYA 3THIA 2YJPA 4FJPA 1B5IA 3ODBA 2VD3A 3Q26A 1FTMA 4LA9A 4XKNA 3VVFA 1OQGA 2F34A 3WAEA 2HZKA 1NFTA 2H25A 3O9PA 3PPQA 2ONKE 3OO6A 4GRKA 4YKIA 1DPEA 4G4PA 2O69A 3TQWA 1JEUA 5A5XA 4IGRA 1A7LA 4GVOA 1TWYA 3I5OA 5I57B 2PMSA 1SW2A 1B1HA 3K6UA 3ZKKA 3JYRA 1LGBC 4FORA 2QS4A 5H8HB 3VLWA 1AMFA 1SDXA 4EDPA 1GTKA 4HW8A 1B3HA 1EU8A 1SW1A 3ECRA 3FJ7A 5I57A 1JEVA 3KSJA 3C31A 1AIVA 1FTLA 1EH3A 1B51A 1URGA 1UIUA 4H6DA 4FAJA 3LC8A 3QIMA 2P1SA 4QSEA 4F3PA 3IJOB 4NF8A 3PD8A 1PC3A 3T9HB 1B4HA 3EHUA 4QSDA 3SEWA 1H3DA 3QUJA 1B6HA 4YB6A 2XXRA 3PMVA 2NVUB 3IORA 3RN8A 3PPNA 4JBZA 4NWCA 1DTGA 3RT6B 3U72A 1HSLA 3K6WA 1JVXA 3GBAA 4EQ7A 5CC2A 2Z8DA 4KQPA 5I59B 4TQUQ 4F2OA 1N76A 3PPOA 1JW1A 2ZNUA 4R72A 3SDFA 3E9XA 5ICQA 3IAZA 2ZNTA 4ZDMA 3IL1B 2XXIA 3O6IA 4ESWA 3MVXA 1QJMA 2P0SA 3KOSA 4R9FA 1M5EA 3HSTA 3G3KA 4LQ2A 1A40A 2O51A 3TQLA 5CBRA 1QUJA 5TP9B 1LBBA 3S9MC 1AH5A 1QKAA 3FV2A 4QFPA 1S7YA 1CE2A 5FHOA 1BP5A 5JK4A 1MY3A 2F7AA 2A5TB 2OJTA 1FTOA 4GWOA 5DVFA 2Z8FA 3FATA 1H45A 1PEBA 1LAGE 5TPAA 4LATA 4MFIA 4DE8A 3KGCA 4ECFA 3FASA 5CM6A 1B05A 2VOZA 2UYFA 1TFAA 4E0WA 1VFDA 1NNFA 1A99A 2UVIA 4IY5A 4XIGQ 2RKMA 2D21A 4RA1A 5J1DA 4LZ7A 3TTNA 2PX1A 4FATA 3F11A 1JNFA 2AYSA 3ILTB 5L9SA 1A8EA 4ONYA 1EZ9A 3K4UA 3V83A 1MPBA 1UQWA 4NE4A 2Z22A 3O6GA 4QSCA 3TFLA 2H99A 2ZXTA 3T96B 4NWDA 1QULA 1YTVA 4U23A 3TTLA 5AA3A 4OHNA 3MPKA 1Z7ME 1MDQA 2RC7A 3OO9A 2GHAA 2ESNA 1MQHA 5K2XA 1Z7NE 2DP8A 4U4SA 3MVWA 4QFKA 4RYAA 1A55A 3MVZA 1LB9A 2B3BA 1URDA 4YU0A 2OWSA 3C32A 5H8NB 3MP6A 3RTWB 5KDTA 3IB2A 4HS7A 1QVSA 3IOWA 3LR1A 5I56B 3IOUA 3JZJA 3CG1A 4MBPA 1GGGA 1FQBA 3U1OA 4DCYA 1D3KA 1IZ1A 4UA8A 5CMKA 3PMXA 4NF4B 1R9LA 3CI8A 4G77A 3RPWA 1AOVA 3OELA 4FE8A 5L9MA 3KN3A 4XTCQ 1PBQA 3AXFA 3C34A 1N3XA 1P1OA 4N6PA 2LAOA 3K1PA 4OTEA 1Y3NA 3UN6A 3KOTA 4F2QA 2CZLA 2Q2AA 3CVGA 3DP6A 4NEDA 2XXXA 5F1QA 4F18A 3TMGA 4GL0A 4GLIA 3FIRA 5CI5A 3VVDA 1SYIA 4YKKA 1A8FA 1MH3A 1N04A 2M8CA 3DP8A 4OENA 1QW0A 4OVJA 4OXVA 3OEKA 3KN8A 3N26A 5L8DA 1FQAA 3SEYA 2V84A 2REJA 5FHNA 3Q29A 5B7DA 4FEBA 3K6XA 4RPNA 1Y4CA 2RCBA 4KPTA 1RYXA 4PFYA 2P2AA 4EXLA 1US4A 3RQTA 3T9XB 2RF1A 1OQHA 4I62A 1SI0A 2WKYA 4HTGA 3TTRA 2F36A 3T9VA 2QS1A 1QUKA 2RINA 1QUIA 3TYHA 3S9EA 1Y4TA 5I2NA 2E0SA 3M3KA 3VLUA 1FQFA 5EHMA 3K0VA 4OETA 1N7XA 4BLAA 3IO4A 4R6YA 3GXAA 2B65A 1PB7A 3JV9A 3VDFA 3C9HA 4H0WA 2Q88A 5H8FB 1LFHA 2THIA 2HEUA 2QSXA 5ELVA 4EUOA 1SBPA 1B32A 4C1TA 4KD5A 3IJXB 4WEDA 1MQJA 3SETA 2O1LA 3GZGA 5CBSA 3PV0E 1UTBB 5AA2B 1ATGA 3OO8A 3TUSA 4RK2A 1DTZA 1DPPA 1B3LA 3CRBA 5HBCA 4TOZA 5I2KA 4Q8RA 3RNNA 4YB5A 3HN0A 3KJTA 4LUBA 5DEXA 1D9YA 3Q25A 3MJNA 1N3WA 3MWBA 1WODA 3UGWA 2HXWA 5JTYA 1H43A 3IB0A 4IO5A 3EPEA 3O2AA 2UXAA 5F7VA 4U22A 2VGQA 5H8QB 3BKIB 3FXUA 5TPAB 3OD7A 1LFIA 1BTJA 1ZIUA 3H03A 4GXSB 1B4ZA 1XHYA 3FJGA 2DWIA 1B3GA 4HCYA 4ESXA 1LB8A 2O68A 3FXQA 1OVTA 3PD9A 3KJ7A 1EZOA 4NF8B 1JW4A 3PUYE 1MY2A 4GD5A 3FV1A 4XKQA 4IY6A 4I9DA 1DMBA 3O29A 2E1SA 4R75A 2PT1A 2OWTA 3Q28A 4AQ4A 1P1NA 4PFUA 4ELPA 3S4UA 4F3BA 3SERA 1NMUA 5FTIA 2DQVA 4H5FA 4LZ8A 3VVEA 3HHGA 5CRYA 4AB5A 3MP8A 2QJEA 4THIA 1DOTA 1VR5A 1Y3QA 2ALUA 4C1UA 5I58A 2I0CA 3UP9A 3E13X 4OESA 2UVJA 3FUZA 4QHQA 4EXKA 4U21A 1VFEA 3KG2A 3QXMA 4DDDA 2F78A 4YKPA 2ONRA 3LBSA 4P0GA 1SVXB 3H6WA 4PQJA 3K01A 3G3FA 5DVIA 2GRVA 3OEMA 3GBBA 4GF8A 3H6VA 2ONSA 1ANFA 4IB2A 4PP0A 1II5A 1LLSA 1XT8A 3MQ9A 4O3AA 4EF1A 2CMOA 1N0TA 2VD2A 5A5XB 4YZZA 5DTBA 1QKBA 3U92A 3EHSA 1OLCA 4I8CA 2RCAA 5L9OA 1MM7A 2YPNA 3K1NA 3T66A 1IIWA 4G8NA 1I69A 2RC9A 2XHDA 1MQGA 2QRYA 4KCDA 2PT2A 2XXVA 4X1BA 2F7BA 2FYIA 2XXPA 2ZMBA 3GLBA 2OK2A 3MUQA 2KLFA 4LVQA 4XKPA 3KZGA 4RJZA 4ZZAA 2Y7KA 3LUYA 1IXIA 4G68A 4JB7A 5B70A 3MBPA 1R9QA 1VSOA 4QRZA 4U1OA 1MXXA 3ZSFA 1IXHA 1B7HA 2HAUA 2IA4A 3IB1A 4QF9A 5CMCA 3V5AA 1NKXA 2DWAA 2DOJA 1N84A 2RC8A 2AL4A 2HQ0A 2UVGA 1OLAA 2QS2A 3UK4A 4BDLA 5CMMA 1ZLQA 1FTJA 1LAFE 5I84A 1EZPA 4ZZEA 3MW0A 3DELB 1UIVA 4WXJA 3TPAA 3G3IA 1WVJA 4POXA 1SYHA 4ZS9A 4F1VA 2GH9A 2DWJA 4GQOA 1SW5A 1HSJA 1I6AA 2ZYKA 4IO3A 2G29A 1LAXA 1M5FA 4LQ5A 5KZTA 4F39A 2Z23A 2A5TA 3OMBA 4HCWA 4PETA 4OQOA 1PBPA 5HM4B 5JTYB 2UYEA 4I1DA 4BDOA 4DXUA 2ANJA 2X7PA 2V93A 3FVOA 4NMYA 2I3VA 3ILUB 4OEVA 1MRPA 1FQEA 4NF5B 3TZAA 3S2VA 3IK6B 2QMXA 4FECA 5I2KB 4E0XA 2QL3A 1LCTA 1MY4A 3TELA 1XOCA 2Q89A 3EF7A 1NH7A 3E4RA 3IR1A 2Q9TA 4F3SA 3BFTA 4QFOA 3FXRA 4XKRA 3MZ1A 3BFUA 1JVYA 4ZE8A 3W15C 1POTA 3O97A 5IAIA 1Y20A 5DT6A 2GFEA 2REGA 3MPLA 3SEXA 5LOMA 3C4MA 3CG3A 1NL5A 3N6UA 2I58A 4FIMA 5AA4B 4IO4A 3HHFA 4RPOA 1GVCA 3EQ1A 2XD2A 5AA4A 5H8FA 1LBCA 3KSXA 2ZYOA 5HPQA 1D9VA 3FGSA 4F19A 3O66A 4KHZE 2R71A 3MP1A 5M2VA 3R7XA 4ND9A 3QSLA 1IITA 2V3QA 2OZZA 1RKMA 1BIYA 2Y7RA 4H5GA 4YICA 2PVUA 4G68C 1B46A 1M5BA 4ZEBA 3DP4A 2FNCA 2O6AA 1B3FA 2DVZA 4JDFA 2YLNA 2I4CA 2X7QA 2ABHA 4JWYA 4OFJA 5K2YA 3VE1B 5I59A 5FTHA 4R2FA 4NTLA 1PDAA 1YPNA 3FJMA 3PUZE 1UTBA 1FCKA 4H8JA 4ZE9A 5H8SA 3RLFE 1MS7A 1LSTA 3EN3A 1ZJLA 3D4GA 3O6HA 2F97A 4OYVA 1POY1 1O64A 1B2HA 4ELRA 2PBWA 5ISUA 4EQBA 3PU5A 1LCFA 4DLDA 3G7WA 1FW0A 1B3EA 1L5TA 4OFOA 5ICTA 4JWXA 1B1XA 1B7UA 2R6GE 2DE3A 4TLMB 3WAFA 1TT1A 4YAHX 1MY0A 1IUDA 3FZVA 5AA2D 5EYFA 1URSA 2B3FA 1USYE 1UTHB 3C36A 3R6UA 1Y1ZA 3CFLA 4F29A 4F3GA 1P99A 3K2DA 1MDP1 2Y7PA 3VV5A 4Z7EA 3C35A 3MC2A 4JXIA 1BLFA 1ZKBA 3IOTA 2V3UA 3HV1A 4U1ZA 4EQ9A 2I4BA 2VHAA 2O1MA 3T22A 4MLQA 2FA7A 1MXYA 4DZ1A 3RY3A 3E3KA 4OEUA 3CIJA 1LAHE 4YKJA 4KYDA 4P11A 1FQCA 1T0KA 1MY1A 3W9WA 3CSGA 3L6HA 5H8NA 4NF6B 3VFJA 3OENA 1ZMGA 2OCUA 1B52A 4RXLA 1Y1MA 5AE4A 5KCJA 4N13A 3EHTA 1RYOA 4OERA 2I3WA 4Z0IA 5TU0A 1PB9A 4GL8A 1NH8A 3MAMA 3OXNA 3SESA 1BKAA 1P1WA 1I6QA 1P1UA 3M3LA 1MXZA 3IO6A 1MG1A 4PFTA 3TAJA 4WEPA 4X9TA 5JEIA 3B7DA 4MH5A 1MPCA 2XX8A 3PUVE 4ISUA 2D3IA 4KYEA 3R26A 4P0IA 3TCGA 3N6TA 4R9GA 3UIFA 2XXYA 4TLLB 2BJJX 3H06B 1H44A 3K02A 1I6BA 1KWHA 3DM0A 1D4NA 1IXGA 1SI1A 2R9JA 3OOAA 2AL5A 4DCXA 1USYH 3M3FA 3G3JA 3C33A 4GOTA 4DXBA 2A5SA 3K1MA 1XVYA 4XXUA 3VLVA 2F7CA 5DEXB 1TXFA 2O7UA 2HFBA 2XX7A 3H7MA 3TCHA 3TEPA 3TTKA 3VXBA 2F35A 1FQDA 1UTHA 2XXWA 3U93A 3G3GA 1MM6A 1S9TA 2DVCA 3H4ZA 3MZ9A 1Y9UA 3I3VA 3O28A 4KCCA 3A3UA 4KYSA 1IEJA 4LONB 4POWA 5EHSA 2ZYNA 4BDNA 4GIZA 5BUUA 4JSOA 3W9VA 4YB7A 2PYYA 2XXTA 1TFDA 4R6KA 1B5JA 1MXWA 4MLVA 4Q0CA 2DWHA 3T9UA 4F1YA 5I58B 5KDTB 2NOOA 3PPRA 3TDJA 4AB6A 1JETA 1N7WA 1ZU0A 4EF2A 4Q5TA 1B5HA 3CFXA 4L17A 4H65A 4OFLA 4YMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WKM A;  4JSD A;  1DSN A;  4JWO A;  5FHM A;  2Q2C A;  3OSR A;  4H67 A;  4KR5 A;  1ELJ A;  3RT8 A;  1SQY A;  1OIB A;  1MXU A;  2F5X A;  1OVB A;  4IGT A;  3UA8 A;  4ELQ A;  1MH4 A;  3G3H A;  3LSX A;  1NNT A;  1GR2 A;  4U4X A;  2NUV A;  2XD3 A;  3OSQ A;  2XXQ A;  1A54 A;  2ZYM A;  4PE5 B;  5BWJ A;  1VE4 A;  1JW5 A;  5ITP A;  5H8Q A;  4NF5 A;  3N5L A;  4ZEI A;  3FVG A;  2QMW A;  1P1Q A;  1MQD A;  2DYX A;  2X26 A;  3U94 A;  2NXO A;  4QFN A;  2DE2 A;  3M8U A;  3OO7 A;  3HO7 A;  5DYH A;  2I48 A;  3LSL A;  5AA1 A;  4UAC A;  4RNS A;  1WDN A;  2DS9 A;  4IO6 A;  1S50 A;  3TTM A;  3ZKL A;  3QK6 A;  1M5C A;  3HPI A;  2I6E A;  4DIG A;  4RK9 A;  1F9B A;  3U8Q A;  1O63 A;  4OWD A;  3SEU A;  3CFZ A;  3TOD A;  2Y84 A;  1IQ7 A;  1Y3P A;  4LZ5 A;  5H8H A;  2D5W A;  2O7I A;  1MPD A;  1B0L A;  3QUF A;  2UVH A;  2H98 A;  2F6G A;  1J1N A;  1R6Z A;  3FVN A;  2Y7W A;  3I6V A;  5I2N B;  5ITO A;  1YCJ A;  4ZEK A;  3RGY A;  1SD3 A;  4Q30 B;  3RUM A;  3TCF A;  2DSF A;  2Z8E A;  4G2Z A;  2OBG A;  4FED A;  4R2B A;  5I56 A;  1US5 A;  4M1V A;  2O84 X;  1Q1K A;  2Y7I A;  1R1N A;  2G93 A;  2W7Y A;  3HCQ A;  3LSW A;  4ZEF A;  3S9N C;  3P7I A;  4BDR A;  4M4G A;  2I0B A;  3K00 A;  1SW4 A;  4K3F A;  4KFQ A;  1B0H A;  1XS5 A;  2H9B A;  3H6U A;  4GXA A;  3V89 B;  2DXR A;  3H3G A;  4G8H A;  4QFL A;  2H5Y A;  3TKD A;  2V25 A;  3IX1 A;  3MZB A;  4GFR A;  4RY1 A;  2ZNS A;  2DE4 A;  3D4C A;  3MVY A;  3Q27 A;  1Q35 A;  2HAV A;  1LFG A;  3PPP A;  3VXC A;  1B40 A;  3BBR A;  4BDQ A;  2XXU A;  2DXY A;  1NNP A;  1B7Z A;  4R74 A;  3A09 A;  1OMP A;  2OLB A;  1H76 A;  3LSF B;  1ZBM A;  3CR9 A;  3PGF A;  1M5D A;  4O3B A;  4R73 A;  2XXH A;  5DVJ A;  4DXC A;  4U2R A;  1CB6 A;  3PMW A;  4ZEC A;  3H6T A;  3CSB A;  2HCA A;  4G68 B;  4C0R A;  1B58 A;  3K6V A;  3KBR A;  4IO7 A;  3T93 B;  4N07 A;  4YMA A;  3QAX A;  2NWJ A;  3SEV A;  4O3C A;  1AL3 A;  5IKB A;  3S9L C;  4LP2 B;  3ONM A;  3KFM A;  4PFW A;  4OMB A;  3B6T A;  3N94 A;  1O7T A;  2F8D A;  2VP1 A;  3PUW E;  4KI0 E;  3KEI A;  2QS3 A;  4G8M A;  3FD3 A;  4H8I A;  1XC1 A;  3DLN A;  1NNK A;  4X48 A;  4X1D A;  2IEE A;  3RTF B;  3USD A;  2GHB A;  3B6Q A;  1FTK A;  2V3T A;  1PB8 A;  3FVK A;  3KN7 A;  3UOR A;  4H1X A;  3IOV A;  3L6G A;  2H4I A;  4ELO A;  1HSE A;  2F6P A;  4MF3 A;  3A3C A;  2AIX A;  5CMB A;  2Q8J A;  1B9J A;  3ZS6 A;  4ZED A;  4NF6 A;  2HZL A;  4IO2 A;  3V8X B;  1IXC A;  1MQI A;  3B6W A;  4OZ9 A;  5TP9 A;  4BDM A;  3QYT A;  1JQF A;  2XX9 A;  4R6H A;  2QPQ A;  1GV8 A;  3SKP A;  4F22 A;  1XVX A;  4F31 B;  3PUX E;  1MXV A;  5KCJ B;  4NF4 A;  4F1U A;  5AA2 A;  2I49 A;  1YAE A;  1ZTY A;  3THI A;  2YJP A;  4FJP A;  1B5I A;  3ODB A;  2VD3 A;  3Q26 A;  1FTM A;  4LA9 A;  4XKN A;  3VVF A;  1OQG A;  2F34 A;  3WAE A;  2HZK A;  1NFT A;  2H25 A;  3O9P A;  3PPQ A;  2ONK E;  3OO6 A;  4GRK A;  4YKI A;  1DPE A;  4G4P A;  2O69 A;  3TQW A;  1JEU A;  5A5X A;  4IGR A;  1A7L A;  4GVO A;  1TWY A;  3I5O A;  5I57 B;  2PMS A;  1SW2 A;  1B1H A;  3K6U A;  3ZKK A;  3JYR A;  1LGB C;  4FOR A;  2QS4 A;  5H8H B;  3VLW A;  1AMF A;  1SDX A;  4EDP A;  1GTK A;  4HW8 A;  1B3H A;  1EU8 A;  1SW1 A;  3ECR A;  3FJ7 A;  5I57 A;  1JEV A;  3KSJ A;  3C31 A;  1AIV A;  1FTL A;  1EH3 A;  1B51 A;  1URG A;  1UIU A;  4H6D A;  4FAJ A;  3LC8 A;  3QIM A;  2P1S A;  4QSE A;  4F3P A;  3IJO B;  4NF8 A;  3PD8 A;  1PC3 A;  3T9H B;  1B4H A;  3EHU A;  4QSD A;  3SEW A;  1H3D A;  3QUJ A;  1B6H A;  4YB6 A;  2XXR A;  3PMV A;  2NVU B;  3IOR A;  3RN8 A;  3PPN A;  4JBZ A;  4NWC A;  1DTG A;  3RT6 B;  3U72 A;  1HSL A;  3K6W A;  1JVX A;  3GBA A;  4EQ7 A;  5CC2 A;  2Z8D A;  4KQP A;  5I59 B;  4TQU Q;  4F2O A;  1N76 A;  3PPO A;  1JW1 A;  2ZNU A;  4R72 A;  3SDF A;  3E9X A;  5ICQ A;  3IAZ A;  2ZNT A;  4ZDM A;  3IL1 B;  2XXI A;  3O6I A;  4ESW A;  3MVX A;  1QJM A;  2P0S A;  3KOS A;  4R9F A;  1M5E A;  3HST A;  3G3K A;  4LQ2 A;  1A40 A;  2O51 A;  3TQL A;  5CBR A;  1QUJ A;  5TP9 B;  1LBB A;  3S9M C;  1AH5 A;  1QKA A;  3FV2 A;  4QFP A;  1S7Y A;  1CE2 A;  5FHO A;  1BP5 A;  5JK4 A;  1MY3 A;  2F7A A;  2A5T B;  2OJT A;  1FTO A;  4GWO A;  5DVF A;  2Z8F A;  3FAT A;  1H45 A;  1PEB A;  1LAG E;  5TPA A;  4LAT A;  4MFI A;  4DE8 A;  3KGC A;  4ECF A;  3FAS A;  5CM6 A;  1B05 A;  2VOZ A;  2UYF A;  1TFA A;  4E0W A;  1VFD A;  1NNF A;  1A99 A;  2UVI A;  4IY5 A;  4XIG Q;  2RKM A;  2D21 A;  4RA1 A;  5J1D A;  4LZ7 A;  3TTN A;  2PX1 A;  4FAT A;  3F11 A;  1JNF A;  2AYS A;  3ILT B;  5L9S A;  1A8E A;  4ONY A;  1EZ9 A;  3K4U A;  3V83 A;  1MPB A;  1UQW A;  4NE4 A;  2Z22 A;  3O6G A;  4QSC A;  3TFL A;  2H99 A;  2ZXT A;  3T96 B;  4NWD A;  1QUL A;  1YTV A;  4U23 A;  3TTL A;  5AA3 A;  4OHN A;  3MPK A;  1Z7M E;  1MDQ A;  2RC7 A;  3OO9 A;  2GHA A;  2ESN A;  1MQH A;  5K2X A;  1Z7N E;  2DP8 A;  4U4S A;  3MVW A;  4QFK A;  4RYA A;  1A55 A;  3MVZ A;  1LB9 A;  2B3B A;  1URD A;  4YU0 A;  2OWS A;  3C32 A;  5H8N B;  3MP6 A;  3RTW B;  5KDT A;  3IB2 A;  4HS7 A;  1QVS A;  3IOW A;  3LR1 A;  5I56 B;  3IOU A;  3JZJ A;  3CG1 A;  4MBP A;  1GGG A;  1FQB A;  3U1O A;  4DCY A;  1D3K A;  1IZ1 A;  4UA8 A;  5CMK A;  3PMX A;  4NF4 B;  1R9L A;  3CI8 A;  4G77 A;  3RPW A;  1AOV A;  3OEL A;  4FE8 A;  5L9M A;  3KN3 A;  4XTC Q;  1PBQ A;  3AXF A;  3C34 A;  1N3X A;  1P1O A;  4N6P A;  2LAO A;  3K1P A;  4OTE A;  1Y3N A;  3UN6 A;  3KOT A;  4F2Q A;  2CZL A;  2Q2A A;  3CVG A;  3DP6 A;  4NED A;  2XXX A;  5F1Q A;  4F18 A;  3TMG A;  4GL0 A;  4GLI A;  3FIR A;  5CI5 A;  3VVD A;  1SYI A;  4YKK A;  1A8F A;  1MH3 A;  1N04 A;  2M8C A;  3DP8 A;  4OEN A;  1QW0 A;  4OVJ A;  4OXV A;  3OEK A;  3KN8 A;  3N26 A;  5L8D A;  1FQA A;  3SEY A;  2V84 A;  2REJ A;  5FHN A;  3Q29 A;  5B7D A;  4FEB A;  3K6X A;  4RPN A;  1Y4C A;  2RCB A;  4KPT A;  1RYX A;  4PFY A;  2P2A A;  4EXL A;  1US4 A;  3RQT A;  3T9X B;  2RF1 A;  1OQH A;  4I62 A;  1SI0 A;  2WKY A;  4HTG A;  3TTR A;  2F36 A;  3T9V A;  2QS1 A;  1QUK A;  2RIN A;  1QUI A;  3TYH A;  3S9E A;  1Y4T A;  5I2N A;  2E0S A;  3M3K A;  3VLU A;  1FQF A;  5EHM A;  3K0V A;  4OET A;  1N7X A;  4BLA A;  3IO4 A;  4R6Y A;  3GXA A;  2B65 A;  1PB7 A;  3JV9 A;  3VDF A;  3C9H A;  4H0W A;  2Q88 A;  5H8F B;  1LFH A;  2THI A;  2HEU A;  2QSX A;  5ELV A;  4EUO A;  1SBP A;  1B32 A;  4C1T A;  4KD5 A;  3IJX B;  4WED A;  1MQJ A;  3SET A;  2O1L A;  3GZG A;  5CBS A;  3PV0 E;  1UTB B;  5AA2 B;  1ATG A;  3OO8 A;  3TUS A;  4RK2 A;  1DTZ A;  1DPP A;  1B3L A;  3CRB A;  5HBC A;  4TOZ A;  5I2K A;  4Q8R A;  3RNN A;  4YB5 A;  3HN0 A;  3KJT A;  4LUB A;  5DEX A;  1D9Y A;  3Q25 A;  3MJN A;  1N3W A;  3MWB A;  1WOD A;  3UGW A;  2HXW A;  5JTY A;  1H43 A;  3IB0 A;  4IO5 A;  3EPE A;  3O2A A;  2UXA A;  5F7V A;  4U22 A;  2VGQ A;  5H8Q B;  3BKI B;  3FXU A;  5TPA B;  3OD7 A;  1LFI A;  1BTJ A;  1ZIU A;  3H03 A;  4GXS B;  1B4Z A;  1XHY A;  3FJG A;  2DWI A;  1B3G A;  4HCY A;  4ESX A;  1LB8 A;  2O68 A;  3FXQ A;  1OVT A;  3PD9 A;  3KJ7 A;  1EZO A;  4NF8 B;  1JW4 A;  3PUY E;  1MY2 A;  4GD5 A;  3FV1 A;  4XKQ A;  4IY6 A;  4I9D A;  1DMB A;  3O29 A;  2E1S A;  4R75 A;  2PT1 A;  2OWT A;  3Q28 A;  4AQ4 A;  1P1N A;  4PFU A;  4ELP A;  3S4U A;  4F3B A;  3SER A;  1NMU A;  5FTI A;  2DQV A;  4H5F A;  4LZ8 A;  3VVE A;  3HHG A;  5CRY A;  4AB5 A;  3MP8 A;  2QJE A;  4THI A;  1DOT A;  1VR5 A;  1Y3Q A;  2ALU A;  4C1U A;  5I58 A;  2I0C A;  3UP9 A;  3E13 X;  4OES A;  2UVJ A;  3FUZ A;  4QHQ A;  4EXK A;  4U21 A;  1VFE A;  3KG2 A;  3QXM A;  4DDD A;  2F78 A;  4YKP A;  2ONR A;  3LBS A;  4P0G A;  1SVX B;  3H6W A;  4PQJ A;  3K01 A;  3G3F A;  5DVI A;  2GRV A;  3OEM A;  3GBB A;  4GF8 A;  3H6V A;  2ONS A;  1ANF A;  4IB2 A;  4PP0 A;  1II5 A;  1LLS A;  1XT8 A;  3MQ9 A;  4O3A A;  4EF1 A;  2CMO A;  1N0T A;  2VD2 A;  5A5X B;  4YZZ A;  5DTB A;  1QKB A;  3U92 A;  3EHS A;  1OLC A;  4I8C A;  2RCA A;  5L9O A;  1MM7 A;  2YPN A;  3K1N A;  3T66 A;  1IIW A;  4G8N A;  1I69 A;  2RC9 A;  2XHD A;  1MQG A;  2QRY A;  4KCD A;  2PT2 A;  2XXV A;  4X1B A;  2F7B A;  2FYI A;  2XXP A;  2ZMB A;  3GLB A;  2OK2 A;  3MUQ A;  2KLF A;  4LVQ A;  4XKP A;  3KZG A;  4RJZ A;  4ZZA A;  2Y7K A;  3LUY A;  1IXI A;  4G68 A;  4JB7 A;  5B70 A;  3MBP A;  1R9Q A;  1VSO A;  4QRZ A;  4U1O A;  1MXX A;  3ZSF A;  1IXH A;  1B7H A;  2HAU A;  2IA4 A;  3IB1 A;  4QF9 A;  5CMC A;  3V5A A;  1NKX A;  2DWA A;  2DOJ A;  1N84 A;  2RC8 A;  2AL4 A;  2HQ0 A;  2UVG A;  1OLA A;  2QS2 A;  3UK4 A;  4BDL A;  5CMM A;  1ZLQ A;  1FTJ A;  1LAF E;  5I84 A;  1EZP A;  4ZZE A;  3MW0 A;  3DEL B;  1UIV A;  4WXJ A;  3TPA A;  3G3I A;  1WVJ A;  4POX A;  1SYH A;  4ZS9 A;  4F1V A;  2GH9 A;  2DWJ A;  4GQO A;  1SW5 A;  1HSJ A;  1I6A A;  2ZYK A;  4IO3 A;  2G29 A;  1LAX A;  1M5F A;  4LQ5 A;  5KZT A;  4F39 A;  2Z23 A;  2A5T A;  3OMB A;  4HCW A;  4PET A;  4OQO A;  1PBP A;  5HM4 B;  5JTY B;  2UYE A;  4I1D A;  4BDO A;  4DXU A;  2ANJ A;  2X7P A;  2V93 A;  3FVO A;  4NMY A;  2I3V A;  3ILU B;  4OEV A;  1MRP A;  1FQE A;  4NF5 B;  3TZA A;  3S2V A;  3IK6 B;  2QMX A;  4FEC A;  5I2K B;  4E0X A;  2QL3 A;  1LCT A;  1MY4 A;  3TEL A;  1XOC A;  2Q89 A;  3EF7 A;  1NH7 A;  3E4R A;  3IR1 A;  2Q9T A;  4F3S A;  3BFT A;  4QFO A;  3FXR A;  4XKR A;  3MZ1 A;  3BFU A;  1JVY A;  4ZE8 A;  3W15 C;  1POT A;  3O97 A;  5IAI A;  1Y20 A;  5DT6 A;  2GFE A;  2REG A;  3MPL A;  3SEX A;  5LOM A;  3C4M A;  3CG3 A;  1NL5 A;  3N6U A;  2I58 A;  4FIM A;  5AA4 B;  4IO4 A;  3HHF A;  4RPO A;  1GVC A;  3EQ1 A;  2XD2 A;  5AA4 A;  5H8F A;  1LBC A;  3KSX A;  2ZYO A;  5HPQ A;  1D9V A;  3FGS A;  4F19 A;  3O66 A;  4KHZ E;  2R71 A;  3MP1 A;  5M2V A;  3R7X A;  4ND9 A;  3QSL A;  1IIT A;  2V3Q A;  2OZZ A;  1RKM A;  1BIY A;  2Y7R A;  4H5G A;  4YIC A;  2PVU A;  4G68 C;  1B46 A;  1M5B A;  4ZEB A;  3DP4 A;  2FNC A;  2O6A A;  1B3F A;  2DVZ A;  4JDF A;  2YLN A;  2I4C A;  2X7Q A;  2ABH A;  4JWY A;  4OFJ A;  5K2Y A;  3VE1 B;  5I59 A;  5FTH A;  4R2F A;  4NTL A;  1PDA A;  1YPN A;  3FJM A;  3PUZ E;  1UTB A;  1FCK A;  4H8J A;  4ZE9 A;  5H8S A;  3RLF E;  1MS7 A;  1LST A;  3EN3 A;  1ZJL A;  3D4G A;  3O6H A;  2F97 A;  4OYV A;  1POY 1;  1O64 A;  1B2H A;  4ELR A;  2PBW A;  5ISU A;  4EQB A;  3PU5 A;  1LCF A;  4DLD A;  3G7W A;  1FW0 A;  1B3E A;  1L5T A;  4OFO A;  5ICT A;  4JWX A;  1B1X A;  1B7U A;  2R6G E;  2DE3 A;  4TLM B;  3WAF A;  1TT1 A;  4YAH X;  1MY0 A;  1IUD A;  3FZV A;  5AA2 D;  5EYF A;  1URS A;  2B3F A;  1USY E;  1UTH B;  3C36 A;  3R6U A;  1Y1Z A;  3CFL A;  4F29 A;  4F3G A;  1P99 A;  3K2D A;  1MDP 1;  2Y7P A;  3VV5 A;  4Z7E A;  3C35 A;  3MC2 A;  4JXI A;  1BLF A;  1ZKB A;  3IOT A;  2V3U A;  3HV1 A;  4U1Z A;  4EQ9 A;  2I4B A;  2VHA A;  2O1M A;  3T22 A;  4MLQ A;  2FA7 A;  1MXY A;  4DZ1 A;  3RY3 A;  3E3K A;  4OEU A;  3CIJ A;  1LAH E;  4YKJ A;  4KYD A;  4P11 A;  1FQC A;  1T0K A;  1MY1 A;  3W9W A;  3CSG A;  3L6H A;  5H8N A;  4NF6 B;  3VFJ A;  3OEN A;  1ZMG A;  2OCU A;  1B52 A;  4RXL A;  1Y1M A;  5AE4 A;  5KCJ A;  4N13 A;  3EHT A;  1RYO A;  4OER A;  2I3W A;  4Z0I A;  5TU0 A;  1PB9 A;  4GL8 A;  1NH8 A;  3MAM A;  3OXN A;  3SES A;  1BKA A;  1P1W A;  1I6Q A;  1P1U A;  3M3L A;  1MXZ A;  3IO6 A;  1MG1 A;  4PFT A;  3TAJ A;  4WEP A;  4X9T A;  5JEI A;  3B7D A;  4MH5 A;  1MPC A;  2XX8 A;  3PUV E;  4ISU A;  2D3I A;  4KYE A;  3R26 A;  4P0I A;  3TCG A;  3N6T A;  4R9G A;  3UIF A;  2XXY A;  4TLL B;  2BJJ X;  3H06 B;  1H44 A;  3K02 A;  1I6B A;  1KWH A;  3DM0 A;  1D4N A;  1IXG A;  1SI1 A;  2R9J A;  3OOA A;  2AL5 A;  4DCX A;  1USY H;  3M3F A;  3G3J A;  3C33 A;  4GOT A;  4DXB A;  2A5S A;  3K1M A;  1XVY A;  4XXU A;  3VLV A;  2F7C A;  5DEX B;  1TXF A;  2O7U A;  2HFB A;  2XX7 A;  3H7M A;  3TCH A;  3TEP A;  3TTK A;  3VXB A;  2F35 A;  1FQD A;  1UTH A;  2XXW A;  3U93 A;  3G3G A;  1MM6 A;  1S9T A;  2DVC A;  3H4Z A;  3MZ9 A;  1Y9U A;  3I3V A;  3O28 A;  4KCC A;  3A3U A;  4KYS A;  1IEJ A;  4LON B;  4POW A;  5EHS A;  2ZYN A;  4BDN A;  4GIZ A;  5BUU A;  4JSO A;  3W9V A;  4YB7 A;  2PYY A;  2XXT A;  1TFD A;  4R6K A;  1B5J A;  1MXW A;  4MLV A;  4Q0C A;  2DWH A;  3T9U A;  4F1Y A;  5I58 B;  5KDT B;  2NOO A;  3PPR A;  3TDJ A;  4AB6 A;  1JET A;  1N7W A;  1ZU0 A;  4EF2 A;  4Q5T A;  1B5H A;  3CFX A;  4L17 A;  4H65 A;  4OFL A;  4YMB A; 
#chains in the Genus database with same CATH topology
 4JSD A;  3RT8 A;  4ELQ A;  1MXU A;  3BIG A;  5ITP A;  2QMW A;  3LV0 A;  3HO7 A;  3A29 A;  3QK6 A;  2I6E A;  3SEU A;  1IQ7 A;  1Y3P A;  1FPF A;  2O7I A;  3QUF A;  4GXA A;  3RGY A;  3TCF A;  1Q1K A;  1R1N A;  4ZEF A;  4G61 A;  1KA1 A;  4K3F A;  1K9Z A;  4KFQ A;  3H6U A;  2DXR A;  4QFL A;  4G8H A;  4JVD A;  3ROJ A;  3MVY A;  2XXU A;  2DXY A;  1OMP A;  3LSF B;  3CR9 A;  3PGF A;  1M5D A;  4O3B A;  2HCA A;  4C0R A;  3K6V A;  2BJI A;  4O3C A;  4PFW A;  2ZZW A;  3N94 A;  4KI0 E;  3KEI A;  4G8M A;  1EYK A;  1XC1 A;  3DLN A;  1NNK A;  4X1D A;  3USD A;  2IEE A;  1PB8 A;  3KN7 A;  3UOR A;  4H1X A;  1FPE A;  1HSE A;  2F6P A;  4MF3 A;  5A5L A;  3ZS6 A;  2AIX A;  4ZED A;  1NV5 A;  4P8B A;  1LBV A;  4N81 A;  2I49 A;  3THI A;  4LA9 A;  3W9V A;  2VD3 A;  1FTM A;  3VVF A;  5IZ3 B;  2ONK E;  1DPE A;  1JP4 A;  4G4P A;  4IGR A;  1A7L A;  4PTK A;  2XXK A;  4HE2 A;  5I57 B;  1NUZ A;  1B1H A;  3CHG A;  1AMF A;  1SDX A;  4HW8 A;  1B3H A;  1EU8 A;  3ECR A;  1JEV A;  4MNI A;  1FTL A;  1B51 A;  5EQ8 A;  1UIU A;  3QIM A;  1NV0 A;  3IJO B;  3SEW A;  4JBZ A;  3RT6 B;  3U72 A;  4EQ7 A;  2P0S A;  3KOS A;  1XI6 A;  3TQL A;  5IZ3 A;  5TP9 B;  1LBB A;  1QKA A;  3FV2 A;  4MCO A;  5FHO A;  5JK4 A;  2A5T B;  3FAT A;  1FPL A;  1H45 A;  1PEB A;  1LAG E;  5TPA A;  4MFI A;  4DE8 A;  5H8F A;  2WYK A;  3KGC A;  3FAS A;  2VOZ A;  3T1B A;  2D21 A;  5L9S A;  1FJ6 A;  1MPB A;  4NE4 A;  1FBH A;  3O6G A;  4N15 A;  2ZXT A;  1Z7M E;  3LUZ A;  3MVW A;  2B3B A;  4YU0 A;  3MP6 A;  4IR8 A;  4MBP A;  5T3J A;  1D3K A;  4NF4 B;  1R9L A;  1AOV A;  3OEL A;  4XTC Q;  1PBQ A;  3AXF A;  1Y3N A;  1NV6 A;  4F2Q A;  2XXX A;  1IMC A;  2FIX A;  3FIR A;  5CI5 A;  3VVD A;  1MH3 A;  2M8C A;  3N26 A;  3Q29 A;  4MAG A;  3K6X A;  1Y4C A;  2RCB A;  4KPT A;  1US4 A;  4PFI A;  1OQH A;  1QUK A;  2RIN A;  3S9E A;  1Y4T A;  3M3K A;  1K9Y A;  5EHM A;  3K0V A;  1LBZ A;  1PB7 A;  3JV9 A;  1LFH A;  2Q88 A;  2THI A;  5ELV A;  4GWY A;  3IJX B;  1MQJ A;  4O94 A;  3SET A;  1UTB B;  1DTZ A;  3CRB A;  1B3L A;  5HBC A;  1EYI A;  4TOZ A;  3RNN A;  3KJT A;  4LUB A;  4LN5 A;  3IB0 A;  2UXA A;  4U22 A;  5H8Q B;  1LFI A;  3H03 A;  4GXS B;  1B4Z A;  3FJG A;  4HCY A;  2O68 A;  3KJ7 A;  1EZO A;  4NF8 B;  1JW4 A;  5IZZ A;  2XWV A;  1DMB A;  4OA4 A;  3Q28 A;  2CZH A;  2DQV A;  4H5F A;  4P9K A;  3MP8 A;  2QJE A;  4MIJ A;  2F78 A;  4YKP A;  3KBZ A;  3LBS A;  5IM2 A;  3G3F A;  5DVI A;  1XT8 A;  4O3A A;  1N0T A;  2VD2 A;  5A5X B;  5DTB A;  3EHS A;  4G8N A;  5IZ1 A;  4KCD A;  2XXV A;  1R9Q A;  1IXH A;  2HAU A;  2IA4 A;  3IB1 A;  4PGN A;  1NKX A;  1N84 A;  2UVG A;  1OLA A;  1ZLQ A;  3MW0 A;  4I3E A;  4POX A;  4ZS9 A;  2DWJ A;  1HSJ A;  4LQ5 A;  4NN3 A;  4F39 A;  1YYZ A;  4HCW A;  5JTY B;  2V93 A;  3ILU B;  4I40 A;  4OEV A;  1MRP A;  3IK6 B;  5I2K B;  3TEL A;  1LCT A;  2Q89 A;  3EF7 A;  3E4R A;  3IR1 A;  3BFT A;  3FXR A;  1JVY A;  5DT6 A;  2GFE A;  3KC1 A;  3C4M A;  3CG3 A;  1NL5 A;  4FIM A;  4IO4 A;  4MEV A;  2XD2 A;  1LBC A;  5HPQ A;  4F19 A;  5M2V A;  2V3Q A;  2PVU A;  1FBE A;  2DVZ A;  5FTH A;  3PUZ E;  1LST A;  2F97 A;  2PBW A;  4EQB A;  4DLD A;  1B3E A;  1L5T A;  1IUD A;  5AA2 D;  1RDY A;  2PCR A;  3CFL A;  3C35 A;  3MC2 A;  1ZKB A;  3HV1 A;  2I4B A;  3T22 A;  3RY3 A;  3E3K A;  1LAH E;  3W9W A;  1B52 A;  5KCJ A;  4N13 A;  4Z0I A;  1NH8 A;  3OXN A;  4PFT A;  3TAJ A;  4WEP A;  4X9T A;  3B7D A;  4KYE A;  2XXY A;  4TLL B;  2BJJ X;  4GWU A;  3DM0 A;  3HFU A;  5LOM A;  3K1M A;  3VLV A;  3H7M A;  3TEP A;  3VXB A;  1MM6 A;  1S9T A;  2DVC A;  3H4Z A;  4LON B;  1Y9U A;  4POW A;  2KR0 A;  1IEJ A;  2PYY A;  4R6K A;  4MLV A;  4F1Y A;  3PPR A;  4L17 A;  4H65 A;  4OFL A;  4JWO A;  2XWK A;  4KR5 A;  1SQY A;  2F5X A;  1OVB A;  1MH4 A;  1VDW A;  1VE4 A;  1BK4 A;  1JW5 A;  1MQD A;  2X26 A;  4FBP A;  5DYH A;  2I48 A;  3LSL A;  3KC0 A;  4RK9 A;  1F9B A;  3U8Q A;  5LTC A;  4LZ5 A;  2D5W A;  1MPD A;  2F6G A;  3FVN A;  4ZEK A;  4G2Z A;  2CEY A;  4R2B A;  3HCQ A;  3LSW A;  3P7I A;  1B0H A;  2H9B A;  5I7I A;  3H3G A;  1NUY A;  2H5Y A;  2ZNS A;  3PPP A;  3BBR A;  4XFE A;  1B7Z A;  4R74 A;  5DVJ A;  4DXC A;  3CSB A;  3SEV A;  3S9L C;  3B6T A;  3PUW E;  2QS3 A;  4H8I A;  3RTF B;  2GHB A;  3B6Q A;  1FTK A;  2V3T A;  1B9J A;  2HZL A;  3V8X B;  1MQI A;  4OZ9 A;  3SKP A;  1GV8 A;  4F22 A;  2PFY A;  4F31 B;  5EQA A;  1MXV A;  2HPG A;  5AA2 A;  4FJP A;  1B5I A;  3Q26 A;  1OQG A;  3TQW A;  1JEU A;  4GVO A;  2PMS A;  1SW2 A;  4DDD A;  1YZ0 A;  1LGB C;  2QS4 A;  2XA5 A;  1SW1 A;  3FJ7 A;  5I57 A;  1EH3 A;  4QSE A;  4F3P A;  4NF8 A;  3T9H B;  2OWZ A;  1B4H A;  3EHU A;  3RN8 A;  1B6H A;  2XXR A;  1EYJ A;  3PPN A;  3K6W A;  1JVX A;  3GBA A;  2Z8D A;  5I59 B;  1N76 A;  3PPO A;  4R72 A;  3IAZ A;  2ZNT A;  1LBY A;  3IL1 B;  1QJM A;  3HST A;  3G3K A;  4LQ2 A;  2O51 A;  5CBR A;  4PBQ A;  4N8G A;  4QFP A;  1CE2 A;  1BP5 A;  1MY3 A;  2F7A A;  2OJT A;  4GWO A;  5DVF A;  4MX6 A;  2DDK A;  4ECF A;  1FBD A;  4E0W A;  1NNF A;  4IY5 A;  2UVI A;  2L5V A;  1IMB A;  3TTN A;  3F11 A;  2QVR A;  2AYS A;  3K4U A;  1UQW A;  2FHY A;  2Z22 A;  4QSC A;  3TFL A;  1QUL A;  3TTL A;  3MPK A;  2GHA A;  5K2X A;  1Z7N E;  2DP8 A;  4U4S A;  4GWX A;  1A55 A;  2OWS A;  5KDT A;  1LBW A;  1FQB A;  3U1O A;  5CMK A;  1DCU A;  3CI8 A;  4FE8 A;  4N6P A;  1N3X A;  1P1O A;  2LAO A;  3K1P A;  3TMG A;  4GLI A;  4JVI A;  1SYI A;  1A8F A;  2B4M A;  3OEK A;  4HE0 A;  4NHB A;  4FEB A;  3T9X B;  4I62 A;  3TYH A;  2E0S A;  1IMF A;  4X8R A;  2OX3 A;  3VDF A;  4H0W A;  5H8F B;  2QSX A;  4HE1 A;  4EUO A;  1B32 A;  3OO8 A;  4RK2 A;  3HN0 A;  1D9Y A;  3Q25 A;  3MJN A;  1N3W A;  2HXW A;  1H43 A;  3EPE A;  5F7V A;  5TPA B;  2WYP A;  1B3G A;  1OVT A;  2XWI A;  3PUY E;  3FV1 A;  3O29 A;  2PT1 A;  4F3B A;  3S4U A;  4AB5 A;  4PDD A;  1VR5 A;  1Y3Q A;  4C1U A;  5I58 A;  4OES A;  3FUZ A;  3QXM A;  2ONR A;  4P0G A;  3GBB A;  3H6V A;  2ONS A;  1II5 A;  1NI9 A;  4PAF A;  3MST A;  2CMO A;  1YXI A;  1QKB A;  4I8C A;  4NQ8 A;  5L9O A;  3T66 A;  2QRY A;  2PT2 A;  4X1B A;  3QMF A;  2F7B A;  2FYI A;  2XXP A;  3GLB A;  2CZK A;  2OK2 A;  2KLF A;  2VT5 A;  4XKP A;  3KZG A;  4JB7 A;  4G68 A;  5B70 A;  4QRZ A;  3ZSF A;  4QF9 A;  3V5A A;  2HQ0 A;  5CMM A;  5I84 A;  4WXJ A;  1KA0 A;  1RDZ A;  1SW5 A;  1I6A A;  2ZYK A;  1LAX A;  1M5F A;  2Z23 A;  4OVS A;  3OMB A;  4OQO A;  1PBP A;  2UYE A;  4BDO A;  4DXU A;  3TZA A;  4GX3 A;  2QMX A;  4E0X A;  2QL3 A;  1MY4 A;  1XOC A;  2Q9T A;  4O7M A;  4QFO A;  1NV2 A;  3MZ1 A;  3BFU A;  4XKR A;  3W15 C;  5IAI A;  3MPL A;  3E78 A;  3HHF A;  4RPO A;  5AA4 A;  3KSX A;  2ZYO A;  3FGS A;  2WX9 A;  2R71 A;  3MP1 A;  4ND9 A;  1NV3 A;  3QSL A;  1RKM A;  1BIY A;  4YIC A;  4ZEB A;  4G68 C;  1B46 A;  1B3F A;  2I4C A;  5K2Y A;  1YPN A;  5I3S A;  4PAI A;  3EN3 A;  4OVP A;  2P3V A;  3D4G A;  4GWS A;  1RDX A;  1B1X A;  4TLM B;  2DE3 A;  5EQ9 A;  4YAH X;  1MY0 A;  3FZV A;  3D1R A;  4GX6 A;  1USY E;  4F3G A;  3K2D A;  2Y7P A;  4JXI A;  3SZP A;  1MXY A;  4OEU A;  3CIJ A;  1T0K A;  2JJK A;  4PAK A;  3VFJ A;  4NF6 B;  1FPD A;  3EHT A;  1RYO A;  4GX4 A;  1PB9 A;  3SES A;  1KZ8 A;  1I6Q A;  1P1U A;  1MG1 A;  4OVQ A;  1MPC A;  4ISU A;  3TCG A;  3H06 B;  1KWH A;  1D4N A;  1SI1 A;  2AL5 A;  1USY H;  2HFB A;  3TCH A;  5ESY A;  2F35 A;  1UTH A;  2XXW A;  3G3G A;  4DI3 D;  4KCC A;  3A3U A;  1FPG A;  4KYS A;  2GQ1 A;  2ZYN A;  4GIZ A;  4JSO A;  2XXT A;  1MXW A;  4Q0C A;  5KDT B;  5I58 B;  4AB6 A;  1N7W A;  1ZU0 A;  4MJO A;  2WBB A;  4WKM A;  1DSN A;  5FHM A;  4H67 A;  1OIB A;  3UA8 A;  3IFC A;  2NUV A;  4P1L A;  4MMP A;  2QVU A;  2ZYM A;  4PF6 A;  1FTA A;  4NF5 A;  3N5L A;  4ZEI A;  2DYX A;  3U94 A;  3M8U A;  3OO7 A;  4N6K A;  4UAC A;  4RNS A;  1WDN A;  3ZKL A;  1M5C A;  3HPI A;  4OWD A;  2R8T A;  3CFZ A;  2Y84 A;  2H98 A;  2Y7W A;  5ITO A;  1YCJ A;  3RUM A;  1SD3 A;  2DSF A;  2Z8E A;  1FPK A;  4FED A;  5I56 A;  1US5 A;  2O84 X;  2G93 A;  3S9N C;  3K00 A;  1SW4 A;  1XS5 A;  3V89 B;  3B8B A;  4NX1 A;  2V25 A;  4GFR A;  4RY1 A;  3TKD A;  2DE4 A;  3D4C A;  1Q35 A;  2HAV A;  3VXC A;  1B40 A;  4BDQ A;  1NNP A;  3A09 A;  1NV1 A;  2Q8M A;  1ZBM A;  2XXH A;  4ZEC A;  3PMW A;  3H6T A;  1B58 A;  4N07 A;  2FBP A;  5IKB A;  4LP2 B;  1O7T A;  5LDZ A;  3FD3 A;  4X48 A;  5IGA A;  3RPL A;  3L6G A;  2H4I A;  4ELO A;  3A3C A;  2Q8J A;  5CMB A;  4IO2 A;  3B6W A;  4BDM A;  3QYT A;  2XX9 A;  4R6H A;  1XVX A;  1FBC A;  3E79 A;  5KCJ B;  4NF4 A;  4F1U A;  1ZTY A;  2HZK A;  1NFT A;  3PPQ A;  4YKI A;  1NV4 A;  2O69 A;  1AWB A;  4O7I A;  4YMA A;  4FOR A;  2WBD A;  4EDP A;  1GTK A;  3C31 A;  1AIV A;  4FAJ A;  3LC8 A;  2P1S A;  3PD8 A;  1PC3 A;  4QSD A;  3QUJ A;  4I3Y A;  2NVU B;  4YB6 A;  3PMV A;  4PCD A;  3IOR A;  4NWC A;  1DTG A;  4OAN A;  1NV7 A;  4KQP A;  4F2O A;  5ICQ A;  1JW1 A;  2VPN A;  4X04 A;  3E9X A;  2XXI A;  4KXP A;  3FBP A;  1M5E A;  1A40 A;  3S9M C;  3BIH A;  1S7Y A;  1FTO A;  4XF5 A;  5CM6 A;  1TFA A;  1VFD A;  1A99 A;  4RA1 A;  4FAT A;  3ILT B;  1A8E A;  4ONY A;  2H99 A;  3T96 B;  3OO9 A;  4PFB A;  1MQH A;  4RYA A;  1URD A;  3RTW B;  4HS7 A;  3IOW A;  3LR1 A;  3IOU A;  3CG1 A;  1GGG A;  1IZ1 A;  5I5P A;  1QGX A;  4QBA A;  3RPW A;  5L9M A;  3KN3 A;  4N6D A;  3C34 A;  4OTE A;  4UAB A;  1FBG A;  3KOT A;  4F18 A;  3CVG A;  2Q2A A;  3DP6 A;  4NED A;  4GL0 A;  4YKK A;  4XEQ A;  4OVJ A;  4OEN A;  1QW0 A;  4OXV A;  3KN8 A;  5L8D A;  1FQA A;  3SEY A;  2V84 A;  2REJ A;  1RYX A;  4PFY A;  2P2A A;  4EXL A;  2RF1 A;  4P56 A;  5I2N A;  3VLU A;  4OET A;  1N7X A;  3IO4 A;  2XWO A;  4R6Y A;  3C9H A;  4KD5 A;  4WED A;  1LEV A;  3PV0 E;  3TUS A;  1DPP A;  4Q8R A;  5DEX A;  3MWB A;  1WOD A;  3UGW A;  4IO5 A;  2VGQ A;  3FXU A;  1ZIU A;  4PE3 A;  1XHY A;  4ESX A;  1LB8 A;  4GD5 A;  4XKQ A;  4IY6 A;  2E1S A;  4PDH A;  4AQ4 A;  4ELP A;  4PFU A;  4O8M A;  3SER A;  5FTI A;  4LZ8 A;  3VVE A;  3HHG A;  5CRY A;  2ALU A;  2I0C A;  3UP9 A;  4EXK A;  4U21 A;  3KG2 A;  1FBP A;  2CZI A;  3OEM A;  4PP0 A;  1LLS A;  1FPB A;  2FVZ A;  3U92 A;  1OLC A;  2RCA A;  1MM7 A;  2YPN A;  3K1N A;  1IIW A;  1I69 A;  2RC9 A;  1MQG A;  4OVR A;  2ZMB A;  4MNC A;  4ZZA A;  1IMD A;  2Y7K A;  3LUY A;  3MBP A;  4U1O A;  1MXX A;  1B7H A;  5CMC A;  2DWA A;  1Q9D A;  2AL4 A;  4BDL A;  2QS2 A;  3UK4 A;  3U65 A;  1FTJ A;  1LAF E;  4PBH A;  3DEL B;  3TPA A;  3G3I A;  1WVJ A;  1SYH A;  2G29 A;  2Y5K A;  2A5T A;  4PET A;  2ANJ A;  2X7P A;  3FVO A;  4NMY A;  2I3V A;  4N17 A;  1NH7 A;  4F3S A;  3O97 A;  1Y20 A;  5AA4 B;  2I58 A;  3EQ1 A;  1D9V A;  5ET6 A;  1FSA A;  3R7X A;  1M5B A;  3DP4 A;  4JDF A;  2X7Q A;  1PDA A;  4H8J A;  5H8S A;  4QXD A;  4NAP A;  3O6H A;  1ZJL A;  4ELR A;  4H45 A;  3PU5 A;  3G7W A;  1FW0 A;  5J16 A;  4OFO A;  2R6G E;  5ET8 A;  1TT1 A;  5EYF A;  1URS A;  1UTH B;  2F3D A;  3IOT A;  4U1Z A;  2VHA A;  2O1M A;  4MLQ A;  2FA7 A;  4P11 A;  1MY1 A;  3CSG A;  3L6H A;  5H8N A;  2OCU A;  1Y1M A;  5AE4 A;  4OER A;  2I3W A;  4GL8 A;  3MAM A;  3IO6 A;  4MH5 A;  3PUV E;  4P0I A;  4NF0 A;  3N6T A;  4R9G A;  3UIF A;  3K02 A;  1H44 A;  1I6B A;  1IXG A;  2R9J A;  4DCX A;  3G3J A;  4GOT A;  1XVY A;  4XXU A;  2F7C A;  5DEX B;  2XX7 A;  2KQZ A;  3O28 A;  4ESW A;  4BDN A;  4YB7 A;  1TFD A;  2DWH A;  3TDJ A;  4EF2 A;  1JET A;  4Q5T A;  3CFX A;  1FBF A;  2Q2C A;  3OSR A;  1ELJ A;  4IGT A;  3G3H A;  3LSX A;  1NNT A;  1GR2 A;  4U4X A;  2XD3 A;  3OSQ A;  2XXQ A;  1A54 A;  4PE5 B;  5BWJ A;  5H8Q A;  3FVG A;  1P1Q A;  2VPO A;  2NXO A;  4QFN A;  2DE2 A;  5AA1 A;  2DS9 A;  4IO6 A;  1S50 A;  3TTM A;  4DIG A;  1O63 A;  2CEX A;  1G0H A;  5H8H A;  1B0L A;  2UVH A;  1J1N A;  1R6Z A;  2Y5L A;  4PC9 A;  3I6V A;  5I2N B;  4Q30 B;  2OBG A;  4M1V A;  4N91 A;  2Y7I A;  2W7Y A;  4BDR A;  4M4G A;  2I0B A;  3IX1 A;  3MZB A;  5ET7 A;  3Q27 A;  4N4U A;  1LFG A;  2OLB A;  3FXB A;  1H76 A;  4R73 A;  4U2R A;  1CB6 A;  4G68 B;  3KBR A;  4IO7 A;  4DI4 B;  3T93 B;  3QAX A;  2NWJ A;  1SPI A;  1AL3 A;  4JVC A;  3ONM A;  3KFM A;  4NG7 A;  2QFL A;  4OMB A;  2F8D A;  2VP1 A;  4H46 A;  5ISU A;  4GWZ A;  3FVK A;  3GYY A;  5F24 A;  5FBP A;  3IOV A;  3MYU A;  4NF6 A;  2B4L A;  1IXC A;  5TP9 A;  1JQF A;  3PTY A;  2QPQ A;  3PUX E;  1YAE A;  2YJP A;  4XKN A;  3ODB A;  3WAE A;  2F34 A;  2HXR A;  2H25 A;  3O9P A;  1DK4 A;  3OO6 A;  4GRK A;  5A5X A;  1TWY A;  3I5O A;  3K6U A;  1FPI A;  3ZKK A;  3JYR A;  5H8H B;  3VLW A;  2V4C A;  3KSJ A;  1URG A;  4H6D A;  1H3D A;  4AS4 A;  4N8Y A;  5CC2 A;  1HSL A;  4TQU Q;  2ZNU A;  3SDF A;  4ZDM A;  3O6I A;  5EYH A;  3MVX A;  4R9F A;  4HXV A;  1QUJ A;  1AH5 A;  2Z8F A;  4LAT A;  1B05 A;  2UYF A;  4XIG Q;  2RKM A;  1D9Q A;  5J1D A;  4LZ7 A;  1G0I A;  1LBX A;  2PX1 A;  1JNF A;  3V83 A;  1EZ9 A;  4PFR A;  4NWD A;  1YTV A;  4U23 A;  5AA3 A;  4OHN A;  4GWW A;  1MDQ A;  2RC7 A;  2ESN A;  4QFK A;  3MVZ A;  1LB9 A;  3C32 A;  5H8N B;  5DW8 A;  3IB2 A;  1QVS A;  5I56 B;  3JZJ A;  4DCY A;  4UA8 A;  3ISP A;  3PMX A;  5EQ7 A;  4G77 A;  4P1E A;  3UN6 A;  3RYD A;  2CZL A;  5F1Q A;  2PFZ A;  1N04 A;  3DP8 A;  5FHN A;  4RPN A;  3RQT A;  1INP A;  1SI0 A;  2WKY A;  4HTG A;  4MHF A;  3TTR A;  2F36 A;  3T9V A;  2QS1 A;  1QUI A;  1FQF A;  4BLA A;  3GXA A;  2B65 A;  2HEU A;  2FIE A;  1SBP A;  4C1T A;  4PGP A;  2O1L A;  3GZG A;  5CBS A;  5AA2 B;  1ATG A;  5I2K A;  4YB5 A;  5JTY A;  3O2A A;  3T0J A;  3BKI B;  3OD7 A;  4OVT A;  1BTJ A;  2P3N A;  1NUW A;  2DWI A;  3FXQ A;  3PD9 A;  1MY2 A;  1IMA A;  4I9D A;  4R75 A;  2OWT A;  4MNP A;  1P1N A;  1NMU A;  2Q74 A;  4THI A;  1DOT A;  3E13 X;  2UVJ A;  4QHQ A;  1VFE A;  1SVX B;  3H6W A;  4PQJ A;  3K01 A;  2GRV A;  4GF8 A;  1IME A;  5B7D A;  1ANF A;  4IB2 A;  1FJ9 A;  1NUX A;  4EF1 A;  3MQ9 A;  2WEF A;  4AS5 A;  4YZZ A;  3IFA A;  2XHD A;  4LVQ A;  3MUQ A;  4RJZ A;  1IXI A;  1VSO A;  2DOJ A;  2RC8 A;  1EZP A;  4ZZE A;  4P47 A;  1UIV A;  4PF8 A;  4F1V A;  2GH9 A;  4GQO A;  4IO3 A;  2MKZ A;  5HM4 B;  1FPJ A;  4I1D A;  1FRP A;  4NF5 B;  1FQE A;  3S2V A;  4FEC A;  2ZZX A;  3NOH A;  4ZE8 A;  1POT A;  4NGU A;  5ET5 A;  2REG A;  3SEX A;  3N6U A;  3B50 A;  2QVV A;  1GVC A;  3O66 A;  3RPL B;  4KHZ E;  1IIT A;  2OZZ A;  2Y7R A;  4H5G A;  2FNC A;  2O6A A;  2YLN A;  5I59 A;  4JWY A;  2ABH A;  3VE1 B;  4OFJ A;  3EKI A;  4R2F A;  4NTL A;  3FJM A;  1UTB A;  1FCK A;  4ZE9 A;  3RLF E;  1MS7 A;  4OYV A;  1POY 1;  1O64 A;  1B2H A;  1LCF A;  5ICT A;  4P3L A;  4JWX A;  4GBV A;  1B7U A;  3WAF A;  3R6U A;  2B3F A;  3C36 A;  1Y1Z A;  4F29 A;  1P99 A;  1MDP 1;  3VV5 A;  2F3B A;  4Z7E A;  4EQ9 A;  1BLF A;  2V3U A;  4DZ1 A;  4YKJ A;  2ZZV A;  1CNQ A;  4KYD A;  1FQC A;  3OEN A;  1ZMG A;  4RXL A;  5TU0 A;  1BKA A;  5EYG A;  1P1W A;  3M3L A;  1MXZ A;  4GBW A;  2HHM A;  5JEI A;  2XX8 A;  2D3I A;  3R26 A;  3OOA A;  1DBZ A;  4DXB A;  3M3F A;  3C33 A;  2A5S A;  1TXF A;  2O7U A;  3TTK A;  1FQD A;  3U93 A;  3TOD A;  3MZ9 A;  3I3V A;  5KZT A;  5BUU A;  5EHS A;  1B5J A;  3T9U A;  2NOO A;  1B5H A;  4YMB A; 
#chains in the Genus database with same CATH homology
 4WKM A;  4JSD A;  1DSN A;  4JWO A;  5FHM A;  2Q2C A;  3OSR A;  4H67 A;  4KR5 A;  1ELJ A;  3RT8 A;  1SQY A;  1OIB A;  1MXU A;  2F5X A;  1OVB A;  4IGT A;  3UA8 A;  4ELQ A;  1MH4 A;  3G3H A;  3LSX A;  1NNT A;  1GR2 A;  4U4X A;  2NUV A;  2XD3 A;  3OSQ A;  2XXQ A;  1A54 A;  2ZYM A;  4PE5 B;  5BWJ A;  1VE4 A;  1JW5 A;  5ITP A;  5H8Q A;  4NF5 A;  3N5L A;  4ZEI A;  3FVG A;  2QMW A;  1P1Q A;  1MQD A;  2DYX A;  2X26 A;  3U94 A;  2NXO A;  4QFN A;  2DE2 A;  3M8U A;  3OO7 A;  3HO7 A;  5DYH A;  2I48 A;  3LSL A;  5AA1 A;  4UAC A;  4RNS A;  1WDN A;  2DS9 A;  4IO6 A;  1S50 A;  3TTM A;  3ZKL A;  3QK6 A;  1M5C A;  3HPI A;  2I6E A;  4DIG A;  4RK9 A;  1F9B A;  3U8Q A;  1O63 A;  4OWD A;  3SEU A;  3CFZ A;  3TOD A;  2Y84 A;  1IQ7 A;  1Y3P A;  4LZ5 A;  5H8H A;  2D5W A;  2O7I A;  1MPD A;  1B0L A;  3QUF A;  2UVH A;  2H98 A;  2F6G A;  1J1N A;  1R6Z A;  3FVN A;  2Y7W A;  3I6V A;  5I2N B;  5ITO A;  1YCJ A;  4ZEK A;  3RGY A;  1SD3 A;  4Q30 B;  3RUM A;  3TCF A;  2DSF A;  2Z8E A;  4G2Z A;  2OBG A;  4FED A;  4R2B A;  5I56 A;  1US5 A;  4M1V A;  2O84 X;  1Q1K A;  2Y7I A;  1R1N A;  2G93 A;  2W7Y A;  3HCQ A;  3LSW A;  4ZEF A;  3S9N C;  3P7I A;  4BDR A;  4M4G A;  2I0B A;  3K00 A;  1SW4 A;  4K3F A;  4KFQ A;  1B0H A;  1XS5 A;  2H9B A;  3H6U A;  4GXA A;  3V89 B;  2DXR A;  3H3G A;  4G8H A;  4QFL A;  2H5Y A;  3TKD A;  2V25 A;  3IX1 A;  3MZB A;  4GFR A;  4RY1 A;  2ZNS A;  2DE4 A;  3D4C A;  3MVY A;  3Q27 A;  1Q35 A;  2HAV A;  1LFG A;  3PPP A;  3VXC A;  1B40 A;  3BBR A;  4BDQ A;  2XXU A;  2DXY A;  1NNP A;  1B7Z A;  4R74 A;  3A09 A;  1OMP A;  2OLB A;  1H76 A;  3LSF B;  1ZBM A;  3CR9 A;  3PGF A;  1M5D A;  4O3B A;  4R73 A;  2XXH A;  5DVJ A;  4DXC A;  4U2R A;  1CB6 A;  3PMW A;  4ZEC A;  3H6T A;  3CSB A;  2HCA A;  4G68 B;  4C0R A;  1B58 A;  3K6V A;  3KBR A;  4IO7 A;  3T93 B;  4N07 A;  4YMA A;  3QAX A;  2NWJ A;  3SEV A;  4O3C A;  1AL3 A;  5IKB A;  3S9L C;  4LP2 B;  3ONM A;  3KFM A;  4PFW A;  4OMB A;  3B6T A;  3N94 A;  1O7T A;  2F8D A;  2VP1 A;  3PUW E;  4KI0 E;  3KEI A;  2QS3 A;  4G8M A;  3FD3 A;  4H8I A;  1XC1 A;  3DLN A;  1NNK A;  4X48 A;  4X1D A;  2IEE A;  3RTF B;  3USD A;  2GHB A;  3B6Q A;  1FTK A;  2V3T A;  1PB8 A;  3FVK A;  3KN7 A;  3UOR A;  4H1X A;  3IOV A;  3L6G A;  2H4I A;  4ELO A;  1HSE A;  2F6P A;  4MF3 A;  3A3C A;  2AIX A;  5CMB A;  2Q8J A;  1B9J A;  3ZS6 A;  4ZED A;  4NF6 A;  2HZL A;  4IO2 A;  3V8X B;  1IXC A;  1MQI A;  3B6W A;  4OZ9 A;  5TP9 A;  4BDM A;  3QYT A;  1JQF A;  2XX9 A;  4R6H A;  2QPQ A;  1GV8 A;  3SKP A;  4F22 A;  1XVX A;  4F31 B;  3PUX E;  1MXV A;  5KCJ B;  4NF4 A;  4F1U A;  5AA2 A;  2I49 A;  1YAE A;  1ZTY A;  3THI A;  2YJP A;  4FJP A;  1B5I A;  3ODB A;  2VD3 A;  3Q26 A;  1FTM A;  4LA9 A;  4XKN A;  3VVF A;  1OQG A;  2F34 A;  3WAE A;  2HZK A;  1NFT A;  2H25 A;  3O9P A;  3PPQ A;  2ONK E;  3OO6 A;  4GRK A;  4YKI A;  1DPE A;  4G4P A;  2O69 A;  3TQW A;  1JEU A;  5A5X A;  4IGR A;  1A7L A;  4GVO A;  1TWY A;  3I5O A;  5I57 B;  2PMS A;  1SW2 A;  1B1H A;  3K6U A;  3ZKK A;  3JYR A;  1LGB C;  4FOR A;  2QS4 A;  5H8H B;  3VLW A;  1AMF A;  1SDX A;  4EDP A;  1GTK A;  4HW8 A;  1B3H A;  1EU8 A;  1SW1 A;  3ECR A;  3FJ7 A;  5I57 A;  1JEV A;  3KSJ A;  3C31 A;  1AIV A;  1FTL A;  1EH3 A;  1B51 A;  1URG A;  1UIU A;  4H6D A;  4FAJ A;  3LC8 A;  3QIM A;  2P1S A;  4QSE A;  4F3P A;  3IJO B;  4NF8 A;  3PD8 A;  1PC3 A;  3T9H B;  1B4H A;  3EHU A;  4QSD A;  3SEW A;  1H3D A;  3QUJ A;  1B6H A;  4YB6 A;  2XXR A;  3PMV A;  2NVU B;  3IOR A;  3RN8 A;  3PPN A;  4JBZ A;  4NWC A;  1DTG A;  3RT6 B;  3U72 A;  1HSL A;  3K6W A;  1JVX A;  3GBA A;  4EQ7 A;  5CC2 A;  2Z8D A;  4KQP A;  5I59 B;  4TQU Q;  4F2O A;  1N76 A;  3PPO A;  1JW1 A;  2ZNU A;  4R72 A;  3SDF A;  3E9X A;  5ICQ A;  3IAZ A;  2ZNT A;  4ZDM A;  3IL1 B;  2XXI A;  3O6I A;  4ESW A;  3MVX A;  1QJM A;  2P0S A;  3KOS A;  4R9F A;  1M5E A;  3HST A;  3G3K A;  4LQ2 A;  1A40 A;  2O51 A;  3TQL A;  5CBR A;  1QUJ A;  5TP9 B;  1LBB A;  3S9M C;  1AH5 A;  1QKA A;  3FV2 A;  4QFP A;  1S7Y A;  1CE2 A;  5FHO A;  1BP5 A;  5JK4 A;  1MY3 A;  2F7A A;  2A5T B;  2OJT A;  1FTO A;  4GWO A;  5DVF A;  2Z8F A;  3FAT A;  1H45 A;  1PEB A;  1LAG E;  5TPA A;  4LAT A;  4MFI A;  4DE8 A;  3KGC A;  4ECF A;  3FAS A;  5CM6 A;  1B05 A;  2VOZ A;  2UYF A;  1TFA A;  4E0W A;  1VFD A;  1NNF A;  1A99 A;  2UVI A;  4IY5 A;  4XIG Q;  2RKM A;  2D21 A;  4RA1 A;  5J1D A;  4LZ7 A;  3TTN A;  2PX1 A;  4FAT A;  3F11 A;  1JNF A;  2AYS A;  3ILT B;  5L9S A;  1A8E A;  4ONY A;  1EZ9 A;  3K4U A;  3V83 A;  1MPB A;  1UQW A;  4NE4 A;  2Z22 A;  3O6G A;  4QSC A;  3TFL A;  2H99 A;  2ZXT A;  3T96 B;  4NWD A;  1QUL A;  1YTV A;  4U23 A;  3TTL A;  5AA3 A;  4OHN A;  3MPK A;  1Z7M E;  1MDQ A;  2RC7 A;  3OO9 A;  2GHA A;  2ESN A;  1MQH A;  5K2X A;  1Z7N E;  2DP8 A;  4U4S A;  3MVW A;  4QFK A;  4RYA A;  1A55 A;  3MVZ A;  1LB9 A;  2B3B A;  1URD A;  4YU0 A;  2OWS A;  3C32 A;  5H8N B;  3MP6 A;  3RTW B;  5KDT A;  3IB2 A;  4HS7 A;  1QVS A;  3IOW A;  3LR1 A;  5I56 B;  3IOU A;  3JZJ A;  3CG1 A;  4MBP A;  1GGG A;  1FQB A;  3U1O A;  4DCY A;  1D3K A;  1IZ1 A;  4UA8 A;  5CMK A;  3PMX A;  4NF4 B;  1R9L A;  3CI8 A;  4G77 A;  3RPW A;  1AOV A;  3OEL A;  4FE8 A;  5L9M A;  3KN3 A;  4XTC Q;  1PBQ A;  3AXF A;  3C34 A;  1N3X A;  1P1O A;  4N6P A;  2LAO A;  3K1P A;  4OTE A;  1Y3N A;  3UN6 A;  3KOT A;  4F2Q A;  2CZL A;  2Q2A A;  3CVG A;  3DP6 A;  4NED A;  2XXX A;  5F1Q A;  4F18 A;  3TMG A;  4GL0 A;  4GLI A;  3FIR A;  5CI5 A;  3VVD A;  1SYI A;  4YKK A;  1A8F A;  1MH3 A;  1N04 A;  2M8C A;  3DP8 A;  4OEN A;  1QW0 A;  4OVJ A;  4OXV A;  3OEK A;  3KN8 A;  3N26 A;  5L8D A;  1FQA A;  3SEY A;  2V84 A;  2REJ A;  5FHN A;  3Q29 A;  5B7D A;  4FEB A;  3K6X A;  4RPN A;  1Y4C A;  2RCB A;  4KPT A;  1RYX A;  4PFY A;  2P2A A;  4EXL A;  1US4 A;  3RQT A;  3T9X B;  2RF1 A;  1OQH A;  4I62 A;  1SI0 A;  2WKY A;  4HTG A;  3TTR A;  2F36 A;  3T9V A;  2QS1 A;  1QUK A;  2RIN A;  1QUI A;  3TYH A;  3S9E A;  1Y4T A;  5I2N A;  2E0S A;  3M3K A;  3VLU A;  1FQF A;  5EHM A;  3K0V A;  4OET A;  1N7X A;  4BLA A;  3IO4 A;  4R6Y A;  3GXA A;  2B65 A;  1PB7 A;  3JV9 A;  3VDF A;  3C9H A;  4H0W A;  2Q88 A;  5H8F B;  1LFH A;  2THI A;  2HEU A;  2QSX A;  5ELV A;  4EUO A;  1SBP A;  1B32 A;  4C1T A;  4KD5 A;  3IJX B;  4WED A;  1MQJ A;  3SET A;  2O1L A;  3GZG A;  5CBS A;  3PV0 E;  1UTB B;  5AA2 B;  1ATG A;  3OO8 A;  3TUS A;  4RK2 A;  1DTZ A;  1DPP A;  1B3L A;  3CRB A;  5HBC A;  4TOZ A;  5I2K A;  4Q8R A;  3RNN A;  4YB5 A;  3HN0 A;  3KJT A;  4LUB A;  5DEX A;  1D9Y A;  3Q25 A;  3MJN A;  1N3W A;  3MWB A;  1WOD A;  3UGW A;  2HXW A;  5JTY A;  1H43 A;  3IB0 A;  4IO5 A;  3EPE A;  3O2A A;  2UXA A;  5F7V A;  4U22 A;  2VGQ A;  5H8Q B;  3BKI B;  3FXU A;  5TPA B;  3OD7 A;  1LFI A;  1BTJ A;  1ZIU A;  3H03 A;  4GXS B;  1B4Z A;  1XHY A;  3FJG A;  2DWI A;  1B3G A;  4HCY A;  4ESX A;  1LB8 A;  2O68 A;  3FXQ A;  1OVT A;  3PD9 A;  3KJ7 A;  1EZO A;  4NF8 B;  1JW4 A;  3PUY E;  1MY2 A;  4GD5 A;  3FV1 A;  4XKQ A;  4IY6 A;  4I9D A;  1DMB A;  3O29 A;  2E1S A;  4R75 A;  2PT1 A;  2OWT A;  3Q28 A;  4AQ4 A;  1P1N A;  4PFU A;  4ELP A;  3S4U A;  4F3B A;  3SER A;  1NMU A;  5FTI A;  2DQV A;  4H5F A;  4LZ8 A;  3VVE A;  3HHG A;  5CRY A;  4AB5 A;  3MP8 A;  2QJE A;  4THI A;  1DOT A;  1VR5 A;  1Y3Q A;  2ALU A;  4C1U A;  5I58 A;  2I0C A;  3UP9 A;  3E13 X;  4OES A;  2UVJ A;  3FUZ A;  4QHQ A;  4EXK A;  4U21 A;  1VFE A;  3KG2 A;  3QXM A;  4DDD A;  2F78 A;  4YKP A;  2ONR A;  3LBS A;  4P0G A;  1SVX B;  3H6W A;  4PQJ A;  3K01 A;  3G3F A;  5DVI A;  2GRV A;  3OEM A;  3GBB A;  4GF8 A;  3H6V A;  2ONS A;  1ANF A;  4IB2 A;  4PP0 A;  1II5 A;  1LLS A;  1XT8 A;  3MQ9 A;  4O3A A;  4EF1 A;  2CMO A;  1N0T A;  2VD2 A;  5A5X B;  4YZZ A;  5DTB A;  1QKB A;  3U92 A;  3EHS A;  1OLC A;  4I8C A;  2RCA A;  5L9O A;  1MM7 A;  2YPN A;  3K1N A;  3T66 A;  1IIW A;  4G8N A;  1I69 A;  2RC9 A;  2XHD A;  1MQG A;  2QRY A;  4KCD A;  2PT2 A;  2XXV A;  4X1B A;  2F7B A;  2FYI A;  2XXP A;  2ZMB A;  3GLB A;  2OK2 A;  3MUQ A;  2KLF A;  4LVQ A;  4XKP A;  3KZG A;  4RJZ A;  4ZZA A;  2Y7K A;  3LUY A;  1IXI A;  4G68 A;  4JB7 A;  5B70 A;  3MBP A;  1R9Q A;  1VSO A;  4QRZ A;  4U1O A;  1MXX A;  3ZSF A;  1IXH A;  1B7H A;  2HAU A;  2IA4 A;  3IB1 A;  4QF9 A;  5CMC A;  3V5A A;  1NKX A;  2DWA A;  2DOJ A;  1N84 A;  2RC8 A;  2AL4 A;  2HQ0 A;  2UVG A;  1OLA A;  2QS2 A;  3UK4 A;  4BDL A;  5CMM A;  1ZLQ A;  1FTJ A;  1LAF E;  5I84 A;  1EZP A;  4ZZE A;  3MW0 A;  3DEL B;  1UIV A;  4WXJ A;  3TPA A;  3G3I A;  1WVJ A;  4POX A;  1SYH A;  4ZS9 A;  4F1V A;  2GH9 A;  2DWJ A;  4GQO A;  1SW5 A;  1HSJ A;  1I6A A;  2ZYK A;  4IO3 A;  2G29 A;  1LAX A;  1M5F A;  4LQ5 A;  5KZT A;  4F39 A;  2Z23 A;  2A5T A;  3OMB A;  4HCW A;  4PET A;  4OQO A;  1PBP A;  5HM4 B;  5JTY B;  2UYE A;  4I1D A;  4BDO A;  4DXU A;  2ANJ A;  2X7P A;  2V93 A;  3FVO A;  4NMY A;  2I3V A;  3ILU B;  4OEV A;  1MRP A;  1FQE A;  4NF5 B;  3TZA A;  3S2V A;  3IK6 B;  2QMX A;  4FEC A;  5I2K B;  4E0X A;  2QL3 A;  1LCT A;  1MY4 A;  3TEL A;  1XOC A;  2Q89 A;  3EF7 A;  1NH7 A;  3E4R A;  3IR1 A;  2Q9T A;  4F3S A;  3BFT A;  4QFO A;  3FXR A;  4XKR A;  3MZ1 A;  3BFU A;  1JVY A;  4ZE8 A;  3W15 C;  1POT A;  3O97 A;  5IAI A;  1Y20 A;  5DT6 A;  2GFE A;  2REG A;  3MPL A;  3SEX A;  5LOM A;  3C4M A;  3CG3 A;  1NL5 A;  3N6U A;  2I58 A;  4FIM A;  5AA4 B;  4IO4 A;  3HHF A;  4RPO A;  1GVC A;  3EQ1 A;  2XD2 A;  5AA4 A;  5H8F A;  1LBC A;  3KSX A;  2ZYO A;  5HPQ A;  1D9V A;  3FGS A;  4F19 A;  3O66 A;  4KHZ E;  2R71 A;  3MP1 A;  5M2V A;  3R7X A;  4ND9 A;  3QSL A;  1IIT A;  2V3Q A;  2OZZ A;  1RKM A;  1BIY A;  2Y7R A;  4H5G A;  4YIC A;  2PVU A;  4G68 C;  1B46 A;  1M5B A;  4ZEB A;  3DP4 A;  2FNC A;  2O6A A;  1B3F A;  2DVZ A;  4JDF A;  2YLN A;  2I4C A;  2X7Q A;  2ABH A;  4JWY A;  4OFJ A;  5K2Y A;  3VE1 B;  5I59 A;  5FTH A;  4R2F A;  4NTL A;  1PDA A;  1YPN A;  3FJM A;  3PUZ E;  1UTB A;  1FCK A;  4H8J A;  4ZE9 A;  5H8S A;  3RLF E;  1MS7 A;  1LST A;  3EN3 A;  1ZJL A;  3D4G A;  3O6H A;  2F97 A;  4OYV A;  1POY 1;  1O64 A;  1B2H A;  4ELR A;  2PBW A;  5ISU A;  4EQB A;  3PU5 A;  1LCF A;  4DLD A;  3G7W A;  1FW0 A;  1B3E A;  1L5T A;  4OFO A;  5ICT A;  4JWX A;  1B1X A;  1B7U A;  2R6G E;  2DE3 A;  4TLM B;  3WAF A;  1TT1 A;  4YAH X;  1MY0 A;  1IUD A;  3FZV A;  5AA2 D;  5EYF A;  1URS A;  2B3F A;  1USY E;  1UTH B;  3C36 A;  3R6U A;  1Y1Z A;  3CFL A;  4F29 A;  4F3G A;  1P99 A;  3K2D A;  1MDP 1;  2Y7P A;  3VV5 A;  4Z7E A;  3C35 A;  3MC2 A;  4JXI A;  1BLF A;  1ZKB A;  3IOT A;  2V3U A;  3HV1 A;  4U1Z A;  4EQ9 A;  2I4B A;  2VHA A;  2O1M A;  3T22 A;  4MLQ A;  2FA7 A;  1MXY A;  4DZ1 A;  3RY3 A;  3E3K A;  4OEU A;  3CIJ A;  1LAH E;  4YKJ A;  4KYD A;  4P11 A;  1FQC A;  1T0K A;  1MY1 A;  3W9W A;  3CSG A;  3L6H A;  5H8N A;  4NF6 B;  3VFJ A;  3OEN A;  1ZMG A;  2OCU A;  1B52 A;  4RXL A;  1Y1M A;  5AE4 A;  5KCJ A;  4N13 A;  3EHT A;  1RYO A;  4OER A;  2I3W A;  4Z0I A;  5TU0 A;  1PB9 A;  4GL8 A;  1NH8 A;  3MAM A;  3OXN A;  3SES A;  1BKA A;  1P1W A;  1I6Q A;  1P1U A;  3M3L A;  1MXZ A;  3IO6 A;  1MG1 A;  4PFT A;  3TAJ A;  4WEP A;  4X9T A;  5JEI A;  3B7D A;  4MH5 A;  1MPC A;  2XX8 A;  3PUV E;  4ISU A;  2D3I A;  4KYE A;  3R26 A;  4P0I A;  3TCG A;  3N6T A;  4R9G A;  3UIF A;  2XXY A;  4TLL B;  2BJJ X;  3H06 B;  1H44 A;  3K02 A;  1I6B A;  1KWH A;  3DM0 A;  1D4N A;  1IXG A;  1SI1 A;  2R9J A;  3OOA A;  2AL5 A;  4DCX A;  1USY H;  3M3F A;  3G3J A;  3C33 A;  4GOT A;  4DXB A;  2A5S A;  3K1M A;  1XVY A;  4XXU A;  3VLV A;  2F7C A;  5DEX B;  1TXF A;  2O7U A;  2HFB A;  2XX7 A;  3H7M A;  3TCH A;  3TEP A;  3TTK A;  3VXB A;  2F35 A;  1FQD A;  1UTH A;  2XXW A;  3U93 A;  3G3G A;  1MM6 A;  1S9T A;  2DVC A;  3H4Z A;  3MZ9 A;  1Y9U A;  3I3V A;  3O28 A;  4KCC A;  3A3U A;  4KYS A;  1IEJ A;  4LON B;  4POW A;  5EHS A;  2ZYN A;  4BDN A;  4GIZ A;  5BUU A;  4JSO A;  3W9V A;  4YB7 A;  2PYY A;  2XXT A;  1TFD A;  4R6K A;  1B5J A;  1MXW A;  4MLV A;  4Q0C A;  2DWH A;  3T9U A;  4F1Y A;  5I58 B;  5KDT B;  2NOO A;  3PPR A;  3TDJ A;  4AB6 A;  1JET A;  1N7W A;  1ZU0 A;  4EF2 A;  4Q5T A;  1B5H A;  3CFX A;  4L17 A;  4H65 A;  4OFL A;  4YMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...