2XXVA

Crystal structure of the gluk2 (glur6) m770k lbd dimer in complex with kainate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
248
structure length
248
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPKGSPYRDKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Conformational Flexibility of the Ligand-Binding Domain Dimer in Kainate Receptor Gating and Desensitization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 85
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxvA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxvA02
3CI8A 3C35A 2O84X 4YKJA 3VLWA 3T9HB 3MPKA 3ZSFA 2UVIA 5ELVA 2RF1A 3OEKA 3G3IA 1TT1A 4ZEDA 1Z7NE 4JSOA 1OLAA 2DP8A 3S2VA 5H8FA 1JW4A 1XT8A 5HBCA 2DVCA 3MP6A 4H5FA 2HZLA 3K1PA 3TTRA 1XC1A 3TTMA 5L8DA 1NNKA 1FTKA 3K4UA 4GIZA 3AXFA 2RC8A 4XKQA 2GHBA 5EHSA 4JSDA 3IOVA 3K6VA 1LGBC 2H4IA 3A09A 1JETA 1AOVA 3E9XA 3EN3A 5KCJB 2XXHA 1RYOA 4WEPA 5CM6A 3KJ7A 1CE2A 1XVYA 3M8UA 4C0RA 1MXYA 4E0WA 4U2RA 1DTGA 4K3FA 3K02A 5I58A 4WXJA 1VE4A 5B70A 3W9VA 4F3SA 1B1HA 2X26A 5B7DA 4ZEKA 3IORA 1B58A 3G3HA 4XKRA 1DTZA 4NF5A 2XX7A 1DPPA 1OVTA 4HTGA 5A5XB 4PETA 2Z8DA 1B0LA 2UXAA 5AA3A 3DP8A 2Y7PA 2O1MA 2DS9A 4ZZAA 4F3PA 4F39A 2M8CA 1M5CA 2HQ0A 1ANFA 2PVUA 1P1QA 4ZZEA 1O7TA 3FUZA 3TCGA 1YAEA 5I2NB 1IQ7A 2ABHA 1XS5A 3K1MA 2VD2A 3K00A 1YPNA 2Y7RA 4PFUA 5DT6A 3EHTA 4N13A 3IJXB 3SEYA 1N7XA 1LAHE 3ILUB 3GXAA 2OZZA 5EHMA 4R72A 5AA2D 1I6BA 2F7BA 4NTLA 2IEEA 5ITOA 1S9TA 3R7XA 2Y7WA 1A8FA 3VVDA 1N3WA 1B4ZA 3MQ9A 1VFEA 4G77A 4GF8A 4XXUA 5CBSA 5K2YA 1P99A 2DWJA 1JW5A 1LB8A 2XX9A 3H6WA 2ESNA 4YKIA 3BBRA 2DE2A 4IO2A 3B6WA 1SW1A 3IAZA 1MM7A 5EYFA 1EZ9A 1POTA 2A5SA 2D3IA 3TKDA 3KN7A 4BDNA 3SEUA 1P1NA 4NF6B 3USDA 4GOTA 4TLLB 1RKMA 4YB6A 3G3GA 2AYSA 3HHGA 4ZEBA 3GLBA 2XD2A 4EXLA 4FE8A 3CVGA 4M4GA 3IOUA 2E1SA 1MQGA 3VE1B 2DSFA 1SW4A 1JEUA 3VLUA 1LSTA 2R71A 3W15C 2KLFA 1IEJA 3T9UA 3RPWA 4PFWA 5FHNA 3MVWA 5AE4A 3PGFA 1P1OA 1EH3A 3D4GA 1WDNA 1B6HA 1I69A 2ZNSA 3C36A 4Q30B 4OETA 2XX8A 3S4UA 3IB0A 4M1VA 4QFPA 1LCTA 4R2FA 3SKPA 3U94A 1SI1A 3O29A 4YKPA 4LQ5A 4IY6A 4U4XA 1PDAA 4DZ1A 1NMUA 2PX1A 2VGQA 3U93A 4MFIA 1BTJA 3OMBA 2FA7A 1BKAA 2CMOA 1JW1A 2UVGA 1BP5A 4F18A 1R6ZA 1QUIA 2A5TA 4P0IA 2XXPA 2Q89A 1M5EA 5I2KB 1MY2A 2Q9TA 1MY0A 4DDDA 4ELRA 4Q0CA 2GFEA 3UGWA 2UYEA 4H5GA 4JBZA 1NH8A 4DLDA 4DIGA 1US5A 1LB9A 3FXUA 4EF2A 2F78A 4H6DA 1QKBA 3TDJA 1Y20A 3BFUA 2DXRA 1AMFA 3BKIB 1B5IA 4YKKA 3DP4A 2F35A 2F7AA 3IO6A 3RUMA 4L17A 4F31B 3PMXA 2PMSA 3KSXA 3PPOA 4OWDA 3SDFA 4QSCA 2BJJX 5CMKA 3MW0A 2XHDA 1TXFA 3TODA 4FORA 4YZZA 1D9VA 3G3JA 3DELB 1MXVA 4HCYA 4X1DA 1SI0A 4LONB 2Y7IA 3T93B 3IJOB 3FZVA 3HHFA 1Y3NA 1OQGA 4KCCA 2NUVA 3FASA 1LFIA 5ISUA 4ISUA 1Z7ME 3VVEA 2NWJA 2OWTA 4R6YA 1ELJA 3B6QA 2V3UA 2OCUA 3S9NC 2OBGA 3S9MC 4RYAA 2FNCA 1MXUA 5JTYB 3T9VA 2RC7A 2AIXA 4OMBA 2PYYA 3CG1A 4U4SA 1USYE 2R6GE 1PBPA 1UTBB 1OMPA 3L6GA 3Q29A 2NOOA 2H5YA 3PUWE 1H43A 3FV1A 3EHSA 4GXAA 1MQIA 3LR1A 1MQHA 4G8MA 4PQJA 1HSJA 1Y3QA 2Z8EA 4TLMB 4DCYA 2O51A 4ESWA 2QS4A 3M3FA 2ZNTA 1SDXA 1QJMA 3VLVA 2Q8JA 1MY1A 4F2QA 4GXSB 4YMAA 1MXXA 1JNFA 3PMWA 1B3HA 3OENA 4XTCQ 3A3UA 1SW2A 3F11A 5A5XA 1OQHA 4EXKA 3LBSA 1A55A 1FTJA 1NKXA 2XXRA 3E13X 2GH9A 2WKYA 3MVXA 2QSXA 1LAFE 2RCAA 4KPTA 3C32A 2ZXTA 2X7PA 3TELA 1GR2A 1FTOA 1R9QA 4I1DA 4NF8B 3SEWA 4I8CA 1T0KA 5I2NA 5DTBA 4KD5A 3HN0A 2O7UA 4ONYA 3FGSA 4Q5TA 3E4RA 3FXRA 1B3GA 2F5XA 3R26A 5CRYA 4F2OA 4LZ8A 2AL5A 4EF1A 1AL3A 3HPIA 3LSFB 3UORA 3V5AA 4Z7EA 2AL4A 1IZ1A 4IGRA 2YLNA 4GL8A 3H7MA 2YJPA 1B9JA 2H9BA 4OXVA 1GV8A 1B7HA 3MZ1A 1UIUA 3DM0A 5CC2A 2R9JA 2RC9A 3QXMA 4FATA 1ZKBA 4PFTA 4X1BA 4YB7A 1B7ZA 5FHMA 4G8NA 1IITA 3SESA 4BDLA 2ZYKA 2I6EA 1XHYA 1PBQA 4FJPA 4OZ9A 4NEDA 4ZECA 3RGYA 5DVFA 1B52A 2F6PA 3C33A 1SBPA 1OVBA 4R74A 3LSLA 3QSLA 2DVZA 3CIJA 4NF6A 2GRVA 4TQUQ 1AIVA 3K6UA 1B2HA 4XIGQ 4G8HA 4FIMA 1FTLA 4RNSA 2Q2CA 4KYDA 3U72A 3ZKKA 3LSXA 1MY4A 3MWBA 2I49A 1B46A 1FCKA 1WVJA 3VV5A 5KDTB 1J1NA 1N0TA 5IKBA 1A40A 2V93A 3OO9A 4POWA 4C1TA 4G2ZA 4RA1A 2F97A 5I57B 2XXTA 1M5DA 3TCHA 1ZLQA 4R9GA 4QFOA 2DOJA 1GVCA 4RXLA 3C9HA 1MY3A 5I84A 3O97A 5AA2A 2B3FA 3H06B 3WAEA 4H1XA 4RY1A 4ZE8A 2ZMBA 4LATA 4FEBA 1DMBA 4FECA 3I5OA 4QHQA 1R1NA 3TMGA 2D21A 4YU0A 3BFTA 1IXGA 4U21A 4ND9A 2XXIA 4BDMA 3G3FA 3QUJA 1IIWA 1ZTYA 4P0GA 4RJZA 2GHAA 2DWIA 3I6VA 3L6HA 1B1XA 1EU8A 3G3KA 4GL0A 5LOMA 1FQFA 5I2KA 2G93A 4QF9A 3IO4A 2O6AA 4LP2B 5CBRA 1O63A 3TQWA 1Y9UA 1II5A 2XD3A 2I3VA 3ZKLA 3S9EA 4JDFA 1B32A 4QFNA 5CMCA 2HCAA 2F7CA 3FATA 4BLAA 4H67A 1P1WA 1I6AA 5I58B 5ITPA 1USYH 3H6TA 4OEVA 2DXYA 4PFYA 4P11A 4OENA 5DVJA 3FIRA 3SEVA 4QFKA 2ONKE 4LVQA 5AA1A 4IB2A 4JWYA 4MLQA 4H8IA 1A54A 1VR5A 3ILTB 4KFQA 5DYHA 3HCQA 3QYTA 3PUZE 3LC8A 1QUKA 3KEIA 4HW8A 1UTHB 2PBWA 2W7YA 4WEDA 3QK6A 2B65A 1PC3A 2XXXA 1A99A 2ONRA 1LBCA 1L5TA 1SYIA 4YMBA 1M5BA 2OJTA 2VD3A 1MH3A 1PB9A 1IUDA 2QS2A 4OQOA 4DXCA 5JTYA 3FD3A 5AA4A 4O3BA 1FTMA 1MDP1 4GD5A 3MPLA 4OTEA 3M3KA 1LAXA 2V84A 4KI0E 4R75A 4IO5A 1PB7A 5H8QB 1ZMGA 1PB8A 3O9PA 3K6WA 3TTLA 3RTFB 3H6UA 3ONMA 1B4HA 1SD3A 1UTBA 4NMYA 4QSEA 4QFLA 3OO6A 3CFLA 2I4BA 1JVXA 4C1UA 2I4CA 2RINA 1N84A 3W9WA 3SERA 4IO3A 3K2DA 4KHZE 3C31A 5JEIA 3CR9A 3OO8A 4O3AA 2O69A 1LCFA 1IXHA 2LAOA 1Y1MA 2ZNUA 2Z23A 3HV1A 3KSJA 4GVOA 4ZEIA 2I0CA 3RY3A 3IR1A 4YAHX 4EQ7A 1A8EA 3OSQA 2XXQA 3MC2A 2O7IA 1MQDA 3QAXA 3DP6A 3K1NA 3Q25A 4KQPA 5BUUA 4OFLA 3GBAA 2HAVA 5TPAB 4GLIA 1HSEA 3CFXA 3H6VA 3FVNA 3FV2A 3R6UA 3TAJA 4F29A 3PUXE 1B3LA 1GGGA 3K0VA 4NF8A 4KYSA 3MP8A 2XXVA 1DSNA 3VXCA 1SVXB 2Z22A 4RPNA 4R73A 3UA8A 4H0WA 3WAFA 5ICQA 2HAUA 3KOTA 3GBBA 1TFAA 1B3FA 1MPCA 4AQ4A 4NF4B 2OK2A 1ATGA 3PPRA 4X48A 5ICTA 4ZE9A 1SQYA 2QL3A 3TEPA 4U23A 3FXQA 1H45A 5H8SA 1QW0A 4H65A 5KCJA 4F3GA 5TP9B 4OESA 3E3KA 4ELOA 4F22A 3TQLA 5IAIA 2G29A 3V83A 2F6GA 2HEUA 3Q26A 2REJA 3T22A 1TWYA 2Y84A 2H25A 3PUVE 4MF3A 2VHAA 5I56B 1URGA 3EHUA 1HSLA 4G68B 1MG1A 1RYXA 3N6TA 1B5HA 1ZIUA 3K6XA 3CSBA 5FTHA 5H8NB 3EPEA 3TFLA 2H98A 1UIVA 1NH7A 1EZOA 1NNPA 5KDTA 1NL5A 3IK6B 3OO7A 5H8HB 2B3BA 4YB5A 4LUBA 3O28A 5F1QA 1MDQA 2QMWA 3U92A 4F1UA 3OSRA 1S50A 4GWOA 3O66A 3OOAA 3C34A 3KOSA 3VFJA 2QS3A 1EZPA 2UVJA 1B0HA 5FTIA 1D3KA 4Z0IA 5I59B 2I58A 4N6PA 4I9DA 3MZBA 1MPDA 3Q28A 1SW5A 3IL1B 3UP9A 2FYIA 3HSTA 3TTKA 3OD7A 1VFDA 2ZYMA 3PV0E 3B7DA 3VDFA 1I6QA 2I3WA 5FHOA 4ECFA 4PP0A 5KZTA 4ELQA 4ZS9A 2VP1A 4DXBA 4O3CA 3VVFA 1N7WA 1AH5A 2Q2AA 1F9BA 3MBPA 3O2AA 4X9TA 1KWHA 4JB7A 5HM4B 3MAMA 3ECRA 4G4PA 1R9LA 4OHNA 4LA9A 2XXYA 4JXIA 4ZDMA 3JYRA 4NE4A 3PPPA 3UN6A 1Y4TA 3EQ1A 4FAJA 1URSA 2V3QA 3D4CA 3TZAA 1MXZA 1LFHA 3RLFE 5DEXB 4ESXA 2ZYNA 4IO6A 4NWDA 4R9FA 3V8XB 1YCJA 3MVYA 3U1OA 3TTNA 2HXWA 3HO7A 3OXNA 2QPQA 4I62A 2ONSA 3RN8A 1H76A 3M3LA 1CB6A 3RTWB 3H03A 2PT2A 1POY1 1P1UA 1MM6A 3RNNA 3KBRA 1UTHA 3TPAA 4IO7A 1IXIA 2F36A 4RK9A 4EDPA 1B40A 1N76A 3JZJA 1Y4CA 3KZGA 1NFTA 4WKMA 4POXA 1B5JA 1MXWA 1N04A 5CI5A 3N26A 3RT8A 3IOTA 2THIA 4XKNA 1OIBA 5H8FB 1FW0A 3FVGA 2F8DA 4LQ2A 1BIYA 3KJTA 3CSGA 5CMBA 2DE3A 5H8QA 1Q35A 3IX1A 2NXOA 1BLFA 3TCFA 1NNTA 2D5WA 4MBPA 1S7YA 3SEXA 3O6GA 3O6IA 4FEDA 4OVJA 3OEMA 4IY5A 2I48A 1MPBA 2DWHA 2ANJA 1XVXA 4NWCA 2RCBA 2OWSA 5F7VA 4U22A 4QSDA 4DXUA 1MS7A 4U1OA 5CMMA 2QS1A 3QIMA 4AB5A 1D9YA 3JV9A 2CZLA 3SETA 3H4ZA 4NF5B 1IXCA 1FQEA 5TPAA 5M2VA 5BWJA 3A3CA 2I0BA 3B6TA 5DVIA 4RPOA 4EQBA 1TFDA 2QJEA 3CG3A 4YICA 1MH4A 1DPEA 3PPNA 3PMVA 1QULA 4MLVA 1B05A 3VXBA 3THIA 4H8JA 2OLBA 5L9OA 3FJMA 4OEUA 2H99A 3FJ7A 3MP1A 5HPQA 5AA2B 3I3VA 2XXWA 4NF4A 4OFJA 3H3GA 2ALUA 4BDOA 4E0XA 3N94A 4LZ5A 1LFGA 4DCXA 3T66A 2V3TA 4R6HA 4IGTA 2QMXA 2F34A 4AB6A 1LLSA 3RQTA 1QKAA 1URDA 4F3BA 4G68C 4UA8A 1OLCA 4IO4A 3N6UA 4XKPA 1LBBA 4GRKA 4OYVA 3FVKA 4RK2A 3Q27A 5TP9A 4R2BA 1Y1ZA 3MZ9A 4KR5A 1ZU0A 2O68A 2DWAA 3FVOA 2P2AA 1UQWA 3LUYA 4U1ZA 4PE5B 1QUJA 3IOWA 4JWXA 1YTVA 3O6HA 1N3XA 5I56A 4G68A 4F1VA 3KFMA 3FJGA 4BDRA 5K2XA 2VOZA 5TU0A 1B7UA 3TYHA 3T9XB 2UYFA 3KN8A 5H8NA 2UVHA 3DLNA 1DOTA 2DE4A 3KGCA 1JVYA 3TUSA 3KG2A 2E0SA 5H8HA 1PEBA 1QVSA 3N5LA 3C4MA 3GZGA 3CFZA 4F19A 2RKMA 3EF7A 3PU5A 4ZEFA 1B3EA 4KCDA 1D4NA 1A7LA 4GQOA 1H3DA 1FQAA 5I59A 3CRBA 3PD9A 4DE8A 1US4A 3T96B 3V89B 1Q1KA 3KN3A 1JEVA 1XOCA 3ZS6A 3MUQA 4HS7A 2V25A 3K01A 3PD8A 4TOZA 4EQ9A 3P7IA 3ODBA 3S9LC 4JWOA 5J1DA 1M5FA 5AA4B 4UACA 4EUOA 1H44A 4R6KA 2REGA 3G7WA 1SYHA 1GTKA 1O64A 2Y7KA 4MH5A 2A5TB 5L9MA 3IB1A 4OFOA 3RT6B 2HFBA 2QRYA 2Z8FA 4HCWA 1ZJLA 3LSWA 3IB2A 2P1SA 1NNFA 1WODA 3UK4A 3UIFA 2DQVA 3PPQA 1FQBA 1FQDA 2ZYOA 3QUFA 1ZBMA 1MQJA 2YPNA 3PUYE 5DEXA 4LZ7A 4KYEA 3OELA 2HZKA 2DYXA 2PT1A 3MVZA 3MJNA 4Q8RA 5L9SA 1VSOA 4BDQA 4ELPA 5JK4A 1JQFA 3U8QA 1B51A 5I57A 1MRPA 1Y3PA 2NVUB 2XXUA 1FQCA 2IA4A 4OERA 4QRZA 4THIA 2P0SA 2Q88A 4N07A 2O1LA 4F1YA 2X7QA 4GFRA 1LAGE
chains in the Genus database with same CATH superfamily
3CI8A 3C35A 2O84X 4KXPA 4YKJA 3VLWA 3T9HB 3MPKA 3ZSFA 2UVIA 5ELVA 2RF1A 3OEKA 3G3IA 1TT1A 4ZEDA 1Z7NE 4JSOA 4MCOA 1OLAA 2DP8A 4N17A 3S2VA 5H8FA 1JW4A 1XT8A 5HBCA 2DVCA 3MP6A 4H5FA 2HZLA 3K1PA 3TTRA 1XC1A 3TTMA 4MJOA 2WX9A 5L8DA 1NNKA 1FTKA 3K4UA 4GIZA 3AXFA 2RC8A 4XKQA 2GHBA 5EHSA 1FBDA 2OX3A 4JSDA 3IOVA 3K6VA 1LGBC 2H4IA 5I5PA 3A09A 1JETA 1AOVA 3E9XA 3EN3A 5KCJB 2XXHA 1RYOA 4WEPA 5IZ3B 5CM6A 3KJ7A 1CE2A 2ZZXA 1XVYA 3M8UA 5ET8A 4C0RA 1MXYA 4E0WA 5IZ1A 3PTYA 4U2RA 4GWSA 1DTGA 1FPKA 4K3FA 3K02A 5I58A 4WXJA 1VE4A 1FJ6A 5B70A 3W9VA 4F3SA 1B1HA 2X26A 4QBAA 5B7DA 4ZEKA 3IORA 1B58A 3G3HA 4XKRA 1DTZA 1NV7A 4NF5A 2XX7A 1AWBA 1DPPA 1OVTA 4N15A 3IFCA 4HTGA 3B8BA 5A5XB 4PETA 2Z8DA 1B0LA 2UXAA 5AA3A 2VPOA 3DP8A 2Y7PA 2O1MA 2DS9A 1FBEA 4GBWA 4ZZAA 4F3PA 4OVRA 4F39A 1RDYA 2M8CA 1M5CA 2HQ0A 1ANFA 2PVUA 1P1QA 4ZZEA 1O7TA 3FUZA 3TCGA 1YAEA 5I2NB 2CEYA 1IQ7A 2Y5KA 2ABHA 1KA0A 1XI6A 1XS5A 3K1MA 2VD2A 3K00A 1YPNA 2Y7RA 2F3BA 4PFUA 5DT6A 3EHTA 4N13A 3IJXB 3SEYA 1N7XA 1LAHE 3ILUB 3GXAA 4N91A 2OZZA 5EHMA 4R72A 5AA2D 1I6BA 2F7BA 4NTLA 2IEEA 5ITOA 1S9TA 3R7XA 2V4CA 2Y7WA 4OVPA 1A8FA 4MX6A 3VVDA 1N3WA 1B4ZA 3MQ9A 1VFEA 4G77A 4GF8A 5ET6A 4XXUA 5CBSA 5K2YA 1P99A 2DWJA 1JW5A 1LB8A 2XX9A 3H6WA 2ESNA 4YKIA 3BBRA 2DE2A 4IO2A 2FBPA 3B6WA 1SW1A 3IAZA 1MM7A 5EYFA 1EZ9A 2KQZA 1POTA 2A5SA 2D3IA 1NV3A 2HPGA 3TKDA 3KN7A 4BDNA 3SEUA 1P1NA 4NF6B 3USDA 4GOTA 4TLLB 1RKMA 4XEQA 4YB6A 3G3GA 4O94A 2AYSA 3HHGA 4ZEBA 3GLBA 2XD2A 4EXLA 4FE8A 3CVGA 4MAGA 1FPLA 4M4GA 3IOUA 2E1SA 1MQGA 4NGUA 3VE1B 2DSFA 1SW4A 4AS4A 1JEUA 1D9QA 3VLUA 1LSTA 2R71A 3W15C 4GWZA 2KLFA 3MSTA 1IEJA 3T9UA 4HE0A 3RPWA 2DDKA 4PFWA 5FHNA 3MVWA 5AE4A 1K9ZA 3PGFA 1P1OA 1EH3A 3D4GA 1WDNA 1B6HA 1I69A 2ZNSA 3C36A 4Q30B 4OETA 2XX8A 3S4UA 3IB0A 4M1VA 4QFPA 1LCTA 4R2FA 3SKPA 3U94A 1SI1A 3O29A 5A5LA 4YKPA 4LQ5A 4IY6A 4U4XA 5EQ9A 1PDAA 4DZ1A 1NMUA 2PX1A 2VGQA 3U93A 4MFIA 1BTJA 3OMBA 2FA7A 1BKAA 2CMOA 1JW1A 2FIXA 2UVGA 2Y5LA 1BP5A 4F18A 1R6ZA 1QUIA 2A5TA 4P0IA 2XXKA 2Q89A 2XXPA 1M5EA 5I2KB 3ISPA 1MY2A 2Q9TA 1MY0A 4DDDA 1LBXA 4ELRA 4Q0CA 2GFEA 3UGWA 2UYEA 4H5GA 4JBZA 1NH8A 3HFUA 4DLDA 4DIGA 1US5A 1LB9A 3FXUA 4EF2A 2F78A 4H6DA 1QKBA 3TDJA 1G0IA 1Y20A 3BFUA 2DXRA 2PCRA 1AMFA 3BKIB 1B5IA 4YKKA 3DP4A 2F35A 2F7AA 1FPEA 3IO6A 3RUMA 4L17A 4F31B 2PFZA 3PMXA 2PMSA 1EYIA 3KSXA 3PPOA 4OWDA 3SDFA 4QSCA 2BJJX 5CMKA 3MW0A 2XHDA 1TXFA 3TODA 4FORA 4YZZA 1D9VA 3G3JA 3DELB 1MXVA 4HCYA 4X1DA 1SI0A 4PDDA 4LONB 2Y7IA 3T93B 3IJOB 3FZVA 3HHFA 1Y3NA 4MNIA 1FTAA 1OQGA 4KCCA 2NUVA 3FASA 4OVTA 1LFIA 5ISUA 4ISUA 1Z7ME 3VVEA 2NWJA 2OWTA 4R6YA 1ELJA 3B6QA 2V3UA 2OCUA 3S9NC 2OBGA 3S9MC 4RYAA 2FNCA 1MXUA 5JTYB 3T9VA 2RC7A 2AIXA 4OMBA 2Q74A 4X04A 2PYYA 3CG1A 1LBWA 4U4SA 1USYE 2R6GE 1PBPA 1UTBB 1OMPA 3L6GA 3Q29A 2NOOA 2H5YA 1YYZA 1H43A 3PUWE 3FV1A 3EHSA 4GXAA 1MQIA 1IMFA 3LR1A 1MQHA 4G8MA 4PQJA 2P3NA 1HSJA 5IZ3A 4PC9A 1Y3QA 2Z8EA 4TLMB 4DCYA 2O51A 4ESWA 2QS4A 3M3FA 2ZNTA 4PCDA 1KA1A 4OVSA 2JJKA 1SDXA 1QJMA 3VLVA 2Q8JA 1MY1A 4F2QA 4GXSB 4YMAA 1MXXA 1JNFA 4DI3D 3PMWA 1B3HA 3OENA 5J16A 4P9KA 2VT5A 4XTCQ 3A3UA 1SW2A 3F11A 5A5XA 1OQHA 4EXKA 3LBSA 1A55A 2QFLA 1FTJA 1NKXA 2XXRA 3E13X 2GH9A 2WKYA 3MVXA 4PAIA 2QSXA 1LAFE 4P56A 2RCAA 4KPTA 3C32A 2ZXTA 1IMDA 2X7PA 3TELA 1GR2A 1FTOA 1R9QA 4I1DA 4JVCA 4NF8B 3SEWA 4I8CA 1T0KA 4P8BA 2FIEA 4DI4B 5I2NA 5DTBA 4KD5A 3HN0A 2O7UA 4ONYA 3FGSA 4Q5TA 3E4RA 3FXRA 1B3GA 2F5XA 3R26A 5CRYA 4F2OA 4LZ8A 2AL5A 4EF1A 1AL3A 3HPIA 3LSFB 3IFAA 3UORA 3V5AA 4Z7EA 2AL4A 1IZ1A 4IGRA 1NV6A 4UABA 4P1LA 2YLNA 3FBPA 4GL8A 3H7MA 2YJPA 1B9JA 5FBPA 2H9BA 4OXVA 1GV8A 1B7HA 3MZ1A 1UIUA 3DM0A 5CC2A 2R9JA 2RC9A 3QXMA 4FATA 4P1EA 4N8YA 1ZKBA 4PFTA 4X1BA 4YB7A 1B7ZA 5FHMA 4G8NA 1IITA 3SESA 4BDLA 2ZYKA 2I6EA 3B50A 1RDXA 1XHYA 1PBQA 4FJPA 4PF6A 2WEFA 4OZ9A 3RPLB 4GWUA 4NEDA 4ZECA 1FBGA 2BJIA 3RGYA 2MKZA 5DVFA 1B52A 2F6PA 3C33A 4PGPA 1SBPA 1OVBA 4R74A 3LSLA 3QSLA 2DVZA 1NUZA 3CIJA 2XWIA 4NF6A 2GRVA 4N6DA 4TQUQ 1AIVA 3K6UA 1FPDA 4JVDA 1B2HA 4XIGQ 5ET7A 4G8HA 4FIMA 1FTLA 4NF0A 4RNSA 2Q2CA 4KYDA 3U72A 3ZKKA 2FHYA 3LSXA 1MY4A 4HXVA 3MWBA 2I49A 3NOHA 1B46A 1FCKA 1WVJA 3VV5A 5KDTB 1J1NA 1N0TA 5IKBA 1A40A 4GX6A 2V93A 3OO9A 4PAFA 4POWA 2XWKA 4G2ZA 4C1TA 5EQ7A 4RA1A 2F97A 5I57B 3A29A 4NG7A 2XXTA 4N8GA 1M5DA 3TCHA 1ZLQA 4R9GA 4QFOA 2DOJA 5EQ8A 1GVCA 4RXLA 3C9HA 1MY3A 5I84A 3O97A 2B3FA 5AA2A 3H06B 3WAEA 4H1XA 4RY1A 4ZE8A 2ZMBA 4LATA 4FEBA 4I3EA 1DMBA 1CNQA 4FECA 3I5OA 4QHQA 1R1NA 3TMGA 2D21A 4NHBA 4YU0A 4N81A 3BFTA 1IXGA 4U21A 4ND9A 2XXIA 3E78A 4BDMA 3G3FA 3QUJA 1IIWA 1ZTYA 4P0GA 4RJZA 5EYHA 2GHAA 2DWIA 3I6VA 4FBPA 3L6HA 1B1XA 1EU8A 3G3KA 4GL0A 5LOMA 1FQFA 5I2KA 2G93A 4QF9A 3IO4A 1KZ8A 2O6AA 4LP2B 4H46A 5CBRA 1O63A 3TQWA 1Y9UA 1NV0A 1II5A 2XD3A 2I3VA 3E79A 3ZKLA 3S9EA 4JDFA 1B32A 2XWVA 4QFNA 5CMCA 2HCAA 2F7CA 2WBBA 3FATA 4BLAA 4H67A 4PFIA 1P1WA 1I6AA 5I58B 5ITPA 1USYH 3H6TA 4I3YA 2CEXA 3ROJA 4OEVA 2DXYA 2QVUA 4PFYA 1FBHA 4PBQA 4P11A 4OENA 1FPJA 5DVJA 3FIRA 3SEVA 4QFKA 2ONKE 4LVQA 3KC0A 5AA1A 4IB2A 1RDZA 4JWYA 4MLQA 4H8IA 1A54A 1VR5A 3ILTB 4KFQA 5DYHA 3HCQA 3QYTA 1K9YA 3PUZE 3LC8A 1QUKA 3KEIA 4HW8A 1UTHB 2CZHA 4O7MA 2PBWA 2W7YA 4WEDA 3QK6A 2B65A 2Q8MA 1PC3A 2XXXA 1A99A 2ONRA 1LBCA 3BIGA 1L5TA 1SYIA 4YMBA 1M5BA 2OJTA 2VD3A 1MH3A 4N4UA 1PB9A 1IUDA 2QS2A 4O8MA 4OQOA 4DXCA 5JTYA 5IZZA 3FD3A 4O7IA 5AA4A 2FVZA 4O3BA 1FTMA 1MDP1 5F24A 4GD5A 3MPLA 4OTEA 3M3KA 1LAXA 2V84A 4KI0E 4R75A 4IO5A 1PB7A 5H8QB 1ZMGA 1PB8A 3O9PA 3K6WA 3TTLA 3RTFB 5LDZA 3H6UA 3ONMA 1B4HA 1SD3A 1UTBA 4NMYA 1EYJA 4QSEA 4QFLA 3OO6A 3CFLA 2I4BA 1JVXA 4C1UA 2I4CA 2RINA 1N84A 2QVVA 3W9WA 3SERA 4IO3A 3K2DA 4KHZE 3C31A 5JEIA 4PAKA 4PF8A 3CR9A 3OO8A 4O3AA 2O69A 1LCFA 1IXHA 2LAOA 1Y1MA 2ZNUA 2WYKA 2Z23A 3HV1A 3KSJA 4GVOA 4ZEIA 2HHMA 2I0CA 3RY3A 3IR1A 4YAHX 4EQ7A 1A8EA 3OSQA 1YXIA 2XXQA 3MC2A 2O7IA 3FXBA 4P47A 5I7IA 1MQDA 3QAXA 3DP6A 3K1NA 3Q25A 4KQPA 5BUUA 4OFLA 3GBAA 2HAVA 5TPAB 4GLIA 1YZ0A 1HSEA 3CFXA 4QXDA 3D1RA 3H6VA 3FVNA 3FV2A 3R6UA 4NX1A 3TAJA 4F29A 3PUXE 1B3LA 1GGGA 3K0VA 4NF8A 5I3SA 4KYSA 3MP8A 2XXVA 1FSAA 1DSNA 3VXCA 1SVXB 2Z22A 4RPNA 4R73A 3UA8A 4H0WA 3WAFA 5ICQA 1JP4A 4GBVA 2HAUA 3KOTA 3GBBA 1TFAA 1B3FA 1MPCA 4AQ4A 4NF4B 2OK2A 1ATGA 3PPRA 4X48A 5ICTA 1DK4A 4XF5A 4ZE9A 1SQYA 2QL3A 3TEPA 4U23A 3FXQA 1H45A 5H8SA 1QW0A 4H65A 4XFEA 5KCJA 4F3GA 5TP9B 4OESA 3E3KA 4ELOA 3RPLA 3TQLA 4F22A 5IAIA 2G29A 3V83A 2F6GA 2HEUA 3Q26A 2REJA 3T22A 1TWYA 2Y84A 2H25A 3PUVE 4MF3A 2VHAA 4MIJA 5I56B 1URGA 1IMBA 3EHUA 1HSLA 4G68B 4MNPA 5ET5A 1MG1A 1RYXA 3N6TA 1B5HA 1ZIUA 3K6XA 3CSBA 5FTHA 5H8NB 3EPEA 3TFLA 1QGXA 2H98A 1LBZA 2GQ1A 1UIVA 1NH7A 1INPA 1NUXA 1EZOA 1NNPA 5KDTA 1NL5A 3IK6B 3OO7A 4OA4A 5H8HB 2B3BA 4YB5A 4LUBA 3O28A 5F1QA 1MDQA 2F3DA 2QMWA 1FBFA 3U92A 4LN5A 4F1UA 4I40A 3OSRA 1S50A 4GWOA 3O66A 1NI9A 3CHGA 3OOAA 3C34A 3KOSA 3VFJA 2QS3A 1EZPA 2UVJA 4OANA 3SZPA 1B0HA 2P3VA 5FTIA 1D3KA 4Z0IA 5I59B 2I58A 3MYUA 4N6PA 4I9DA 3MZBA 1MPDA 3Q28A 1SW5A 3IL1B 4MMPA 3UP9A 2FYIA 3HSTA 1FPFA 3TTKA 3OD7A 1VFDA 5IGAA 2ZYMA 3PV0E 3B7DA 3VDFA 1I6QA 4PFBA 2I3WA 5EYGA 1BK4A 5FHOA 4ECFA 5T3JA 1NV4A 4PP0A 5KZTA 4ELQA 4GX4A 5ESYA 4ZS9A 2VP1A 4DXBA 4O3CA 4AS5A 3VVFA 3RYDA 1N7WA 4X8RA 1AH5A 2Q2AA 1F9BA 3MBPA 3O2AA 4X9TA 1KWHA 4JB7A 5HM4B 3MAMA 3ECRA 4G4PA 1R9LA 3T0JA 4OHNA 4LA9A 2XXYA 4JXIA 4ZDMA 3JYRA 4NE4A 3PPPA 3UN6A 4NQ8A 1Y4TA 3EQ1A 4FAJA 1URSA 2V3QA 1FBCA 3D4CA 3TZAA 1MXZA 1LFHA 4JVIA 3RLFE 5DEXB 4ESXA 2ZYNA 4IO6A 4NWDA 4R9FA 3V8XB 1YCJA 3MVYA 3U1OA 1FBPA 3TTNA 1FRPA 2HXWA 3HO7A 3OXNA 2QPQA 4I62A 2ONSA 3RN8A 1H76A 3M3LA 1NUYA 1CB6A 3RTWB 3H03A 2PT2A 1POY1 1P1UA 1MM6A 3RNNA 3KBRA 1UTHA 3TPAA 4IO7A 1IXIA 2F36A 4RK9A 4EDPA 1B40A 1N76A 3JZJA 1Y4CA 3KZGA 1NFTA 4WKMA 4POXA 2OWZA 1B5JA 1MXWA 1N04A 5CI5A 3N26A 3RT8A 3IOTA 2THIA 4XKNA 2CZKA 2L5VA 1OIBA 5H8FB 1FW0A 3FVGA 2F8DA 4LQ2A 1BIYA 4GX3A 3KJTA 3CSGA 5IM2A 5CMBA 2DE3A 5H8QA 1Q35A 3IX1A 2NXOA 1G0HA 1BLFA 3TCFA 5LTCA 1NNTA 2D5WA 4PFRA 4MBPA 1FPIA 3BIHA 1S7YA 3SEXA 3T1BA 3O6GA 3O6IA 4FEDA 4OVJA 3OEMA 4IY5A 4MEVA 2I48A 1MPBA 2DWHA 2ANJA 1XVXA 2ZZWA 4GWWA 4NWCA 2RCBA 2OWSA 5F7VA 4U22A 4QSDA 4N6KA 4DXUA 3U65A 1MS7A 4U1OA 3LV0A 5CMMA 2QS1A 3QIMA 4AB5A 1D9YA 3JV9A 2CZLA 3SETA 1EYKA 4NAPA 3H4ZA 4NF5B 1IXCA 1FQEA 5TPAA 5M2VA 5BWJA 3A3CA 3KBZA 2I0BA 3B6TA 2PFYA 5DVIA 4RPOA 1NV2A 4EQBA 1TFDA 2QJEA 3CG3A 4YICA 2VPNA 1MH4A 1DPEA 3PPNA 1FPGA 1SPIA 3PMVA 1QULA 4MLVA 5DW8A 1B05A 3VXBA 3THIA 4H8JA 2OLBA 5L9OA 3FJMA 4OEUA 2H99A 3FJ7A 3MP1A 3GYYA 5HPQA 5AA2B 3I3VA 2XXWA 4NF4A 4OFJA 3H3GA 2ALUA 4BDOA 4E0XA 3N94A 4LZ5A 1VDWA 1LFGA 3EKIA 4DCXA 4GWXA 3T66A 2V3TA 4R6HA 4IGTA 2QMXA 2F34A 4AB6A 1LLSA 3RQTA 1QKAA 1URDA 4F3BA 4G68C 4H45A 4UA8A 1IMEA 1NV5A 1OLCA 1Q9DA 4IO4A 3N6UA 4XKPA 4P3LA 4OYVA 1LBBA 2WBDA 4GRKA 3FVKA 4RK2A 3Q27A 5TP9A 2ZZVA 2QVRA 4R2BA 1Y1ZA 2B4MA 3MZ9A 4KR5A 1ZU0A 2O68A 2DWAA 3FVOA 2P2AA 1UQWA 3LUYA 4U1ZA 4PE5B 1QUJA 3IOWA 4JWXA 1YTVA 3O6HA 1N3XA 5I56A 4G68A 4F1VA 3KFMA 3FJGA 4BDRA 5K2XA 2VOZA 5TU0A 1B7UA 3TYHA 4GWYA 2B4LA 3T9XB 2UYFA 4PGNA 3KN8A 5H8NA 2UVHA 3DLNA 1DOTA 2DE4A 3KGCA 4NN3A 1JVYA 3TUSA 3KG2A 2E0SA 5H8HA 4OVQA 1LAGE 1PEBA 1QVSA 3N5LA 3C4MA 3GZGA 1LBVA 3CFZA 4F19A 2RKMA 3EF7A 4PE3A 3PU5A 4ZEFA 1B3EA 4KCDA 1D4NA 1A7LA 4GQOA 1H3DA 1FQAA 5I59A 3CRBA 1LEVA 3PD9A 4MHFA 4DE8A 1US4A 3T96B 3V89B 1Q1KA 3KN3A 1JEVA 1XOCA 4HE1A 1DBZA 3KC1A 3ZS6A 3MUQA 5EQAA 1DCUA 4HS7A 2V25A 3K01A 3QMFA 3PD8A 4HE2A 4TOZA 4EQ9A 4G61A 4PTKA 3P7IA 3ODBA 3S9LC 3LUZA 4JWOA 5J1DA 1M5FA 5AA4B 4UACA 4PBHA 4EUOA 1H44A 4R6KA 2REGA 3G7WA 1SYHA 1GTKA 1O64A 2Y7KA 4MH5A 2A5TB 5L9MA 3IB1A 2KR0A 4OFOA 2CZIA 1IMCA 3RT6B 2HFBA 2WYPA 2QRYA 2Z8FA 4HCWA 1ZJLA 3LSWA 3IB2A 1LBYA 1NV1A 2P1SA 1NNFA 1WODA 3UK4A 4IR8A 2XA5A 3UIFA 2DQVA 4PDHA 3PPQA 1FQBA 4MNCA 1FQDA 2ZYOA 3QUFA 1ZBMA 1MQJA 2YPNA 3PUYE 5DEXA 4LZ7A 1FJ9A 4KYEA 3OELA 2HZKA 2DYXA 2HXRA 2PT1A 3MVZA 3MJNA 4Q8RA 5L9SA 2XWOA 1VSOA 4BDQA 4ELPA 1FPBA 5JK4A 1JQFA 3U8QA 1B51A 5I57A 1MRPA 1Y3PA 2NVUB 2XXUA 1FQCA 2IA4A 4OERA 2R8TA 4QRZA 4THIA 2P0SA 2Q88A 4N07A 2O1LA 4F1YA 2X7QA 1IMAA 4GFRA 1NUWA
chains in the Genus database with same CATH topology
3CI8A 3C35A 2O84X 4YKJA 3VLWA 3T9HB 3MPKA 3ZSFA 2UVIA 5ELVA 2RF1A 3OEKA 3G3IA 1TT1A 4ZEDA 1Z7NE 4JSOA 1OLAA 2DP8A 3S2VA 5H8FA 1JW4A 1XT8A 5HBCA 2DVCA 3MP6A 4H5FA 2HZLA 3K1PA 3TTRA 1XC1A 3TTMA 5L8DA 1NNKA 1FTKA 3K4UA 4GIZA 3AXFA 2RC8A 4XKQA 2GHBA 5EHSA 4JSDA 3IOVA 3K6VA 1LGBC 2H4IA 3A09A 1JETA 1AOVA 3E9XA 3EN3A 5KCJB 2XXHA 1RYOA 4WEPA 5CM6A 3KJ7A 1CE2A 1XVYA 3M8UA 4C0RA 1MXYA 4E0WA 4U2RA 1DTGA 4K3FA 3K02A 5I58A 4WXJA 1VE4A 5B70A 3W9VA 4F3SA 1B1HA 2X26A 5B7DA 4ZEKA 3IORA 1B58A 3G3HA 4XKRA 1DTZA 4NF5A 2XX7A 1DPPA 1OVTA 4HTGA 5A5XB 4PETA 2Z8DA 1B0LA 2UXAA 5AA3A 3DP8A 2Y7PA 2O1MA 2DS9A 4ZZAA 4F3PA 4F39A 2M8CA 1M5CA 2HQ0A 1ANFA 2PVUA 1P1QA 4ZZEA 1O7TA 3FUZA 3TCGA 1YAEA 5I2NB 1IQ7A 2ABHA 1XS5A 3K1MA 2VD2A 3K00A 1YPNA 2Y7RA 4PFUA 5DT6A 3EHTA 4N13A 3IJXB 3SEYA 1N7XA 1LAHE 3ILUB 3GXAA 2OZZA 5EHMA 4R72A 5AA2D 1I6BA 2F7BA 4NTLA 2IEEA 5ITOA 1S9TA 3R7XA 2Y7WA 1A8FA 3VVDA 1N3WA 1B4ZA 3MQ9A 1VFEA 4G77A 4GF8A 4XXUA 5CBSA 5K2YA 1P99A 2DWJA 1JW5A 1LB8A 2XX9A 3H6WA 2ESNA 4YKIA 3BBRA 2DE2A 4IO2A 3B6WA 1SW1A 3IAZA 1MM7A 5EYFA 1EZ9A 1POTA 2A5SA 2D3IA 3TKDA 3KN7A 4BDNA 3SEUA 1P1NA 4NF6B 3USDA 4GOTA 4TLLB 1RKMA 4YB6A 3G3GA 2AYSA 3HHGA 4ZEBA 3GLBA 2XD2A 4EXLA 4FE8A 3CVGA 4M4GA 3IOUA 2E1SA 1MQGA 3VE1B 2DSFA 1SW4A 1JEUA 3VLUA 1LSTA 2R71A 3W15C 2KLFA 1IEJA 3T9UA 3RPWA 4PFWA 5FHNA 3MVWA 5AE4A 3PGFA 1P1OA 1EH3A 3D4GA 1WDNA 1B6HA 1I69A 2ZNSA 3C36A 4Q30B 4OETA 2XX8A 3S4UA 3IB0A 4M1VA 4QFPA 1LCTA 4R2FA 3SKPA 3U94A 1SI1A 3O29A 4YKPA 4LQ5A 4IY6A 4U4XA 1PDAA 4DZ1A 1NMUA 2PX1A 2VGQA 3U93A 4MFIA 1BTJA 3OMBA 2FA7A 1BKAA 2CMOA 1JW1A 2UVGA 1BP5A 4F18A 1R6ZA 1QUIA 2A5TA 4P0IA 2XXPA 2Q89A 1M5EA 5I2KB 1MY2A 2Q9TA 1MY0A 4DDDA 4ELRA 4Q0CA 2GFEA 3UGWA 2UYEA 4H5GA 4JBZA 1NH8A 4DLDA 4DIGA 1US5A 1LB9A 3FXUA 4EF2A 2F78A 4H6DA 1QKBA 3TDJA 1Y20A 3BFUA 2DXRA 1AMFA 3BKIB 1B5IA 4YKKA 3DP4A 2F35A 2F7AA 3IO6A 3RUMA 4L17A 4F31B 3PMXA 2PMSA 3KSXA 3PPOA 4OWDA 3SDFA 4QSCA 2BJJX 5CMKA 3MW0A 2XHDA 1TXFA 3TODA 4FORA 4YZZA 1D9VA 3G3JA 3DELB 1MXVA 4HCYA 4X1DA 1SI0A 4LONB 2Y7IA 3T93B 3IJOB 3FZVA 3HHFA 1Y3NA 1OQGA 4KCCA 2NUVA 3FASA 1LFIA 5ISUA 4ISUA 1Z7ME 3VVEA 2NWJA 2OWTA 4R6YA 1ELJA 3B6QA 2V3UA 2OCUA 3S9NC 2OBGA 3S9MC 4RYAA 2FNCA 1MXUA 5JTYB 3T9VA 2RC7A 2AIXA 4OMBA 2PYYA 3CG1A 4U4SA 1USYE 2R6GE 1PBPA 1UTBB 1OMPA 3L6GA 3Q29A 2NOOA 2H5YA 3PUWE 1H43A 3FV1A 3EHSA 4GXAA 1MQIA 3LR1A 1MQHA 4G8MA 4PQJA 1HSJA 1Y3QA 2Z8EA 4TLMB 4DCYA 2O51A 4ESWA 2QS4A 3M3FA 2ZNTA 1SDXA 1QJMA 3VLVA 2Q8JA 1MY1A 4F2QA 4GXSB 4YMAA 1MXXA 1JNFA 3PMWA 1B3HA 3OENA 4XTCQ 3A3UA 1SW2A 3F11A 5A5XA 1OQHA 4EXKA 3LBSA 1A55A 1FTJA 1NKXA 2XXRA 3E13X 2GH9A 2WKYA 3MVXA 2QSXA 1LAFE 2RCAA 4KPTA 3C32A 2ZXTA 2X7PA 3TELA 1GR2A 1FTOA 1R9QA 4I1DA 4NF8B 3SEWA 4I8CA 1T0KA 5I2NA 5DTBA 4KD5A 3HN0A 2O7UA 4ONYA 3FGSA 4Q5TA 3E4RA 3FXRA 1B3GA 2F5XA 3R26A 5CRYA 4F2OA 4LZ8A 2AL5A 4EF1A 1AL3A 3HPIA 3LSFB 3UORA 3V5AA 4Z7EA 2AL4A 1IZ1A 4IGRA 2YLNA 4GL8A 3H7MA 2YJPA 1B9JA 2H9BA 4OXVA 1GV8A 1B7HA 3MZ1A 1UIUA 3DM0A 5CC2A 2R9JA 2RC9A 3QXMA 4FATA 1ZKBA 4PFTA 4X1BA 4YB7A 1B7ZA 5FHMA 4G8NA 1IITA 3SESA 4BDLA 2ZYKA 2I6EA 1XHYA 1PBQA 4FJPA 4OZ9A 4NEDA 4ZECA 3RGYA 5DVFA 1B52A 2F6PA 3C33A 1SBPA 1OVBA 4R74A 3LSLA 3QSLA 2DVZA 3CIJA 4NF6A 2GRVA 4TQUQ 1AIVA 3K6UA 1B2HA 4XIGQ 4G8HA 4FIMA 1FTLA 4RNSA 2Q2CA 4KYDA 3U72A 3ZKKA 3LSXA 1MY4A 3MWBA 2I49A 1B46A 1FCKA 1WVJA 3VV5A 5KDTB 1J1NA 1N0TA 5IKBA 1A40A 2V93A 3OO9A 4POWA 4C1TA 4G2ZA 4RA1A 2F97A 5I57B 2XXTA 1M5DA 3TCHA 1ZLQA 4R9GA 4QFOA 2DOJA 1GVCA 4RXLA 3C9HA 1MY3A 5I84A 3O97A 5AA2A 2B3FA 3H06B 3WAEA 4H1XA 4RY1A 4ZE8A 2ZMBA 4LATA 4FEBA 1DMBA 4FECA 3I5OA 4QHQA 1R1NA 3TMGA 2D21A 4YU0A 3BFTA 1IXGA 4U21A 4ND9A 2XXIA 4BDMA 3G3FA 3QUJA 1IIWA 1ZTYA 4P0GA 4RJZA 2GHAA 2DWIA 3I6VA 3L6HA 1B1XA 1EU8A 3G3KA 4GL0A 5LOMA 1FQFA 5I2KA 2G93A 4QF9A 3IO4A 2O6AA 4LP2B 5CBRA 1O63A 3TQWA 1Y9UA 1II5A 2XD3A 2I3VA 3ZKLA 3S9EA 4JDFA 1B32A 4QFNA 5CMCA 2HCAA 2F7CA 3FATA 4BLAA 4H67A 1P1WA 1I6AA 5I58B 5ITPA 1USYH 3H6TA 4OEVA 2DXYA 4PFYA 4P11A 4OENA 5DVJA 3FIRA 3SEVA 4QFKA 2ONKE 4LVQA 5AA1A 4IB2A 4JWYA 4MLQA 4H8IA 1A54A 1VR5A 3ILTB 4KFQA 5DYHA 3HCQA 3QYTA 3PUZE 3LC8A 1QUKA 3KEIA 4HW8A 1UTHB 2PBWA 2W7YA 4WEDA 3QK6A 2B65A 1PC3A 2XXXA 1A99A 2ONRA 1LBCA 1L5TA 1SYIA 4YMBA 1M5BA 2OJTA 2VD3A 1MH3A 1PB9A 1IUDA 2QS2A 4OQOA 4DXCA 5JTYA 3FD3A 5AA4A 4O3BA 1FTMA 1MDP1 4GD5A 3MPLA 4OTEA 3M3KA 1LAXA 2V84A 4KI0E 4R75A 4IO5A 1PB7A 5H8QB 1ZMGA 1PB8A 3O9PA 3K6WA 3TTLA 3RTFB 3H6UA 3ONMA 1B4HA 1SD3A 1UTBA 4NMYA 4QSEA 4QFLA 3OO6A 3CFLA 2I4BA 1JVXA 4C1UA 2I4CA 2RINA 1N84A 3W9WA 3SERA 4IO3A 3K2DA 4KHZE 3C31A 5JEIA 3CR9A 3OO8A 4O3AA 2O69A 1LCFA 1IXHA 2LAOA 1Y1MA 2ZNUA 2Z23A 3HV1A 3KSJA 4GVOA 4ZEIA 2I0CA 3RY3A 3IR1A 4YAHX 4EQ7A 1A8EA 3OSQA 2XXQA 3MC2A 2O7IA 1MQDA 3QAXA 3DP6A 3K1NA 3Q25A 4KQPA 5BUUA 4OFLA 3GBAA 2HAVA 5TPAB 4GLIA 1HSEA 3CFXA 3H6VA 3FVNA 3FV2A 3R6UA 3TAJA 4F29A 3PUXE 1B3LA 1GGGA 3K0VA 4NF8A 4KYSA 3MP8A 2XXVA 1DSNA 3VXCA 1SVXB 2Z22A 4RPNA 4R73A 3UA8A 4H0WA 3WAFA 5ICQA 2HAUA 3KOTA 3GBBA 1TFAA 1B3FA 1MPCA 4AQ4A 4NF4B 2OK2A 1ATGA 3PPRA 4X48A 5ICTA 4ZE9A 1SQYA 2QL3A 3TEPA 4U23A 3FXQA 1H45A 5H8SA 1QW0A 4H65A 5KCJA 4F3GA 5TP9B 4OESA 3E3KA 4ELOA 4F22A 3TQLA 5IAIA 2G29A 3V83A 2F6GA 2HEUA 3Q26A 2REJA 3T22A 1TWYA 2Y84A 2H25A 3PUVE 4MF3A 2VHAA 5I56B 1URGA 3EHUA 1HSLA 4G68B 1MG1A 1RYXA 3N6TA 1B5HA 1ZIUA 3K6XA 3CSBA 5FTHA 5H8NB 3EPEA 3TFLA 2H98A 1UIVA 1NH7A 1EZOA 1NNPA 5KDTA 1NL5A 3IK6B 3OO7A 5H8HB 2B3BA 4YB5A 4LUBA 3O28A 5F1QA 1MDQA 2QMWA 3U92A 4F1UA 3OSRA 1S50A 4GWOA 3O66A 3OOAA 3C34A 3KOSA 3VFJA 2QS3A 1EZPA 2UVJA 1B0HA 5FTIA 1D3KA 4Z0IA 5I59B 2I58A 4N6PA 4I9DA 3MZBA 1MPDA 3Q28A 1SW5A 3IL1B 3UP9A 2FYIA 3HSTA 3TTKA 3OD7A 1VFDA 2ZYMA 3PV0E 3B7DA 3VDFA 1I6QA 2I3WA 5FHOA 4ECFA 4PP0A 5KZTA 4ELQA 4ZS9A 2VP1A 4DXBA 4O3CA 3VVFA 1N7WA 1AH5A 2Q2AA 1F9BA 3MBPA 3O2AA 4X9TA 1KWHA 4JB7A 5HM4B 3MAMA 3ECRA 4G4PA 1R9LA 4OHNA 4LA9A 2XXYA 4JXIA 4ZDMA 3JYRA 4NE4A 3PPPA 3UN6A 1Y4TA 3EQ1A 4FAJA 1URSA 2V3QA 3D4CA 3TZAA 1MXZA 1LFHA 3RLFE 5DEXB 4ESXA 2ZYNA 4IO6A 4NWDA 4R9FA 3V8XB 1YCJA 3MVYA 3U1OA 3TTNA 2HXWA 3HO7A 3OXNA 2QPQA 4I62A 2ONSA 3RN8A 1H76A 3M3LA 1CB6A 3RTWB 3H03A 2PT2A 1POY1 1P1UA 1MM6A 3RNNA 3KBRA 1UTHA 3TPAA 4IO7A 1IXIA 2F36A 4RK9A 4EDPA 1B40A 1N76A 3JZJA 1Y4CA 3KZGA 1NFTA 4WKMA 4POXA 1B5JA 1MXWA 1N04A 5CI5A 3N26A 3RT8A 3IOTA 2THIA 4XKNA 1OIBA 5H8FB 1FW0A 3FVGA 2F8DA 4LQ2A 1BIYA 3KJTA 3CSGA 5CMBA 2DE3A 5H8QA 1Q35A 3IX1A 2NXOA 1BLFA 3TCFA 1NNTA 2D5WA 4MBPA 1S7YA 3SEXA 3O6GA 3O6IA 4FEDA 4OVJA 3OEMA 4IY5A 2I48A 1MPBA 2DWHA 2ANJA 1XVXA 4NWCA 2RCBA 2OWSA 5F7VA 4U22A 4QSDA 4DXUA 1MS7A 4U1OA 5CMMA 2QS1A 3QIMA 4AB5A 1D9YA 3JV9A 2CZLA 3SETA 3H4ZA 4NF5B 1IXCA 1FQEA 5TPAA 5M2VA 5BWJA 3A3CA 2I0BA 3B6TA 5DVIA 4RPOA 4EQBA 1TFDA 2QJEA 3CG3A 4YICA 1MH4A 1DPEA 3PPNA 3PMVA 1QULA 4MLVA 1B05A 3VXBA 3THIA 4H8JA 2OLBA 5L9OA 3FJMA 4OEUA 2H99A 3FJ7A 3MP1A 5HPQA 5AA2B 3I3VA 2XXWA 4NF4A 4OFJA 3H3GA 2ALUA 4BDOA 4E0XA 3N94A 4LZ5A 1LFGA 4DCXA 3T66A 2V3TA 4R6HA 4IGTA 2QMXA 2F34A 4AB6A 1LLSA 3RQTA 1QKAA 1URDA 4F3BA 4G68C 4UA8A 1OLCA 4IO4A 3N6UA 4XKPA 1LBBA 4GRKA 4OYVA 3FVKA 4RK2A 3Q27A 5TP9A 4R2BA 1Y1ZA 3MZ9A 4KR5A 1ZU0A 2O68A 2DWAA 3FVOA 2P2AA 1UQWA 3LUYA 4U1ZA 4PE5B 1QUJA 3IOWA 4JWXA 1YTVA 3O6HA 1N3XA 5I56A 4G68A 4F1VA 3KFMA 3FJGA 4BDRA 5K2XA 2VOZA 5TU0A 1B7UA 3TYHA 3T9XB 2UYFA 3KN8A 5H8NA 2UVHA 3DLNA 1DOTA 2DE4A 3KGCA 1JVYA 3TUSA 3KG2A 2E0SA 5H8HA 1PEBA 1QVSA 3N5LA 3C4MA 3GZGA 3CFZA 4F19A 2RKMA 3EF7A 3PU5A 4ZEFA 1B3EA 4KCDA 1D4NA 1A7LA 4GQOA 1H3DA 1FQAA 5I59A 3CRBA 3PD9A 4DE8A 1US4A 3T96B 3V89B 1Q1KA 3KN3A 1JEVA 1XOCA 3ZS6A 3MUQA 4HS7A 2V25A 3K01A 3PD8A 4TOZA 4EQ9A 3P7IA 3ODBA 3S9LC 4JWOA 5J1DA 1M5FA 5AA4B 4UACA 4EUOA 1H44A 4R6KA 2REGA 3G7WA 1SYHA 1GTKA 1O64A 2Y7KA 4MH5A 2A5TB 5L9MA 3IB1A 4OFOA 3RT6B 2HFBA 2QRYA 2Z8FA 4HCWA 1ZJLA 3LSWA 3IB2A 2P1SA 1NNFA 1WODA 3UK4A 3UIFA 2DQVA 3PPQA 1FQBA 1FQDA 2ZYOA 3QUFA 1ZBMA 1MQJA 2YPNA 3PUYE 5DEXA 4LZ7A 4KYEA 3OELA 2HZKA 2DYXA 2PT1A 3MVZA 3MJNA 4Q8RA 5L9SA 1VSOA 4BDQA 4ELPA 5JK4A 1JQFA 3U8QA 1B51A 5I57A 1MRPA 1Y3PA 2NVUB 2XXUA 1FQCA 2IA4A 4OERA 4QRZA 4THIA 2P0SA 2Q88A 4N07A 2O1LA 4F1YA 2X7QA 4GFRA 1LAGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CI8 A;  3C35 A;  2O84 X;  4YKJ A;  3VLW A;  3T9H B;  3MPK A;  3ZSF A;  2UVI A;  5ELV A;  2RF1 A;  3OEK A;  3G3I A;  1TT1 A;  4ZED A;  1Z7N E;  4JSO A;  1OLA A;  2DP8 A;  3S2V A;  5H8F A;  1JW4 A;  1XT8 A;  5HBC A;  2DVC A;  3MP6 A;  4H5F A;  2HZL A;  3K1P A;  3TTR A;  1XC1 A;  3TTM A;  5L8D A;  1NNK A;  1FTK A;  3K4U A;  4GIZ A;  3AXF A;  2RC8 A;  4XKQ A;  2GHB A;  5EHS A;  4JSD A;  3IOV A;  3K6V A;  1LGB C;  2H4I A;  3A09 A;  1JET A;  1AOV A;  3E9X A;  3EN3 A;  5KCJ B;  2XXH A;  1RYO A;  4WEP A;  5CM6 A;  3KJ7 A;  1CE2 A;  1XVY A;  3M8U A;  4C0R A;  1MXY A;  4E0W A;  4U2R A;  1DTG A;  4K3F A;  3K02 A;  5I58 A;  4WXJ A;  1VE4 A;  5B70 A;  3W9V A;  4F3S A;  1B1H A;  2X26 A;  5B7D A;  4ZEK A;  3IOR A;  1B58 A;  3G3H A;  4XKR A;  1DTZ A;  4NF5 A;  2XX7 A;  1DPP A;  1OVT A;  4HTG A;  5A5X B;  4PET A;  2Z8D A;  1B0L A;  2UXA A;  5AA3 A;  3DP8 A;  2Y7P A;  2O1M A;  2DS9 A;  4ZZA A;  4F3P A;  4F39 A;  2M8C A;  1M5C A;  2HQ0 A;  1ANF A;  2PVU A;  1P1Q A;  4ZZE A;  1O7T A;  3FUZ A;  3TCG A;  1YAE A;  5I2N B;  1IQ7 A;  2ABH A;  1XS5 A;  3K1M A;  2VD2 A;  3K00 A;  1YPN A;  2Y7R A;  4PFU A;  5DT6 A;  3EHT A;  4N13 A;  3IJX B;  3SEY A;  1N7X A;  1LAH E;  3ILU B;  3GXA A;  2OZZ A;  5EHM A;  4R72 A;  5AA2 D;  1I6B A;  2F7B A;  4NTL A;  2IEE A;  5ITO A;  1S9T A;  3R7X A;  2Y7W A;  1A8F A;  3VVD A;  1N3W A;  1B4Z A;  3MQ9 A;  1VFE A;  4G77 A;  4GF8 A;  4XXU A;  5CBS A;  5K2Y A;  1P99 A;  2DWJ A;  1JW5 A;  1LB8 A;  2XX9 A;  3H6W A;  2ESN A;  4YKI A;  3BBR A;  2DE2 A;  4IO2 A;  3B6W A;  1SW1 A;  3IAZ A;  1MM7 A;  5EYF A;  1EZ9 A;  1POT A;  2A5S A;  2D3I A;  3TKD A;  3KN7 A;  4BDN A;  3SEU A;  1P1N A;  4NF6 B;  3USD A;  4GOT A;  4TLL B;  1RKM A;  4YB6 A;  3G3G A;  2AYS A;  3HHG A;  4ZEB A;  3GLB A;  2XD2 A;  4EXL A;  4FE8 A;  3CVG A;  4M4G A;  3IOU A;  2E1S A;  1MQG A;  3VE1 B;  2DSF A;  1SW4 A;  1JEU A;  3VLU A;  1LST A;  2R71 A;  3W15 C;  2KLF A;  1IEJ A;  3T9U A;  3RPW A;  4PFW A;  5FHN A;  3MVW A;  5AE4 A;  3PGF A;  1P1O A;  1EH3 A;  3D4G A;  1WDN A;  1B6H A;  1I69 A;  2ZNS A;  3C36 A;  4Q30 B;  4OET A;  2XX8 A;  3S4U A;  3IB0 A;  4M1V A;  4QFP A;  1LCT A;  4R2F A;  3SKP A;  3U94 A;  1SI1 A;  3O29 A;  4YKP A;  4LQ5 A;  4IY6 A;  4U4X A;  1PDA A;  4DZ1 A;  1NMU A;  2PX1 A;  2VGQ A;  3U93 A;  4MFI A;  1BTJ A;  3OMB A;  2FA7 A;  1BKA A;  2CMO A;  1JW1 A;  2UVG A;  1BP5 A;  4F18 A;  1R6Z A;  1QUI A;  2A5T A;  4P0I A;  2XXP A;  2Q89 A;  1M5E A;  5I2K B;  1MY2 A;  2Q9T A;  1MY0 A;  4DDD A;  4ELR A;  4Q0C A;  2GFE A;  3UGW A;  2UYE A;  4H5G A;  4JBZ A;  1NH8 A;  4DLD A;  4DIG A;  1US5 A;  1LB9 A;  3FXU A;  4EF2 A;  2F78 A;  4H6D A;  1QKB A;  3TDJ A;  1Y20 A;  3BFU A;  2DXR A;  1AMF A;  3BKI B;  1B5I A;  4YKK A;  3DP4 A;  2F35 A;  2F7A A;  3IO6 A;  3RUM A;  4L17 A;  4F31 B;  3PMX A;  2PMS A;  3KSX A;  3PPO A;  4OWD A;  3SDF A;  4QSC A;  2BJJ X;  5CMK A;  3MW0 A;  2XHD A;  1TXF A;  3TOD A;  4FOR A;  4YZZ A;  1D9V A;  3G3J A;  3DEL B;  1MXV A;  4HCY A;  4X1D A;  1SI0 A;  4LON B;  2Y7I A;  3T93 B;  3IJO B;  3FZV A;  3HHF A;  1Y3N A;  1OQG A;  4KCC A;  2NUV A;  3FAS A;  1LFI A;  5ISU A;  4ISU A;  1Z7M E;  3VVE A;  2NWJ A;  2OWT A;  4R6Y A;  1ELJ A;  3B6Q A;  2V3U A;  2OCU A;  3S9N C;  2OBG A;  3S9M C;  4RYA A;  2FNC A;  1MXU A;  5JTY B;  3T9V A;  2RC7 A;  2AIX A;  4OMB A;  2PYY A;  3CG1 A;  4U4S A;  1USY E;  2R6G E;  1PBP A;  1UTB B;  1OMP A;  3L6G A;  3Q29 A;  2NOO A;  2H5Y A;  3PUW E;  1H43 A;  3FV1 A;  3EHS A;  4GXA A;  1MQI A;  3LR1 A;  1MQH A;  4G8M A;  4PQJ A;  1HSJ A;  1Y3Q A;  2Z8E A;  4TLM B;  4DCY A;  2O51 A;  4ESW A;  2QS4 A;  3M3F A;  2ZNT A;  1SDX A;  1QJM A;  3VLV A;  2Q8J A;  1MY1 A;  4F2Q A;  4GXS B;  4YMA A;  1MXX A;  1JNF A;  3PMW A;  1B3H A;  3OEN A;  4XTC Q;  3A3U A;  1SW2 A;  3F11 A;  5A5X A;  1OQH A;  4EXK A;  3LBS A;  1A55 A;  1FTJ A;  1NKX A;  2XXR A;  3E13 X;  2GH9 A;  2WKY A;  3MVX A;  2QSX A;  1LAF E;  2RCA A;  4KPT A;  3C32 A;  2ZXT A;  2X7P A;  3TEL A;  1GR2 A;  1FTO A;  1R9Q A;  4I1D A;  4NF8 B;  3SEW A;  4I8C A;  1T0K A;  5I2N A;  5DTB A;  4KD5 A;  3HN0 A;  2O7U A;  4ONY A;  3FGS A;  4Q5T A;  3E4R A;  3FXR A;  1B3G A;  2F5X A;  3R26 A;  5CRY A;  4F2O A;  4LZ8 A;  2AL5 A;  4EF1 A;  1AL3 A;  3HPI A;  3LSF B;  3UOR A;  3V5A A;  4Z7E A;  2AL4 A;  1IZ1 A;  4IGR A;  2YLN A;  4GL8 A;  3H7M A;  2YJP A;  1B9J A;  2H9B A;  4OXV A;  1GV8 A;  1B7H A;  3MZ1 A;  1UIU A;  3DM0 A;  5CC2 A;  2R9J A;  2RC9 A;  3QXM A;  4FAT A;  1ZKB A;  4PFT A;  4X1B A;  4YB7 A;  1B7Z A;  5FHM A;  4G8N A;  1IIT A;  3SES A;  4BDL A;  2ZYK A;  2I6E A;  1XHY A;  1PBQ A;  4FJP A;  4OZ9 A;  4NED A;  4ZEC A;  3RGY A;  5DVF A;  1B52 A;  2F6P A;  3C33 A;  1SBP A;  1OVB A;  4R74 A;  3LSL A;  3QSL A;  2DVZ A;  3CIJ A;  4NF6 A;  2GRV A;  4TQU Q;  1AIV A;  3K6U A;  1B2H A;  4XIG Q;  4G8H A;  4FIM A;  1FTL A;  4RNS A;  2Q2C A;  4KYD A;  3U72 A;  3ZKK A;  3LSX A;  1MY4 A;  3MWB A;  2I49 A;  1B46 A;  1FCK A;  1WVJ A;  3VV5 A;  5KDT B;  1J1N A;  1N0T A;  5IKB A;  1A40 A;  2V93 A;  3OO9 A;  4POW A;  4C1T A;  4G2Z A;  4RA1 A;  2F97 A;  5I57 B;  2XXT A;  1M5D A;  3TCH A;  1ZLQ A;  4R9G A;  4QFO A;  2DOJ A;  1GVC A;  4RXL A;  3C9H A;  1MY3 A;  5I84 A;  3O97 A;  5AA2 A;  2B3F A;  3H06 B;  3WAE A;  4H1X A;  4RY1 A;  4ZE8 A;  2ZMB A;  4LAT A;  4FEB A;  1DMB A;  4FEC A;  3I5O A;  4QHQ A;  1R1N A;  3TMG A;  2D21 A;  4YU0 A;  3BFT A;  1IXG A;  4U21 A;  4ND9 A;  2XXI A;  4BDM A;  3G3F A;  3QUJ A;  1IIW A;  1ZTY A;  4P0G A;  4RJZ A;  2GHA A;  2DWI A;  3I6V A;  3L6H A;  1B1X A;  1EU8 A;  3G3K A;  4GL0 A;  5LOM A;  1FQF A;  5I2K A;  2G93 A;  4QF9 A;  3IO4 A;  2O6A A;  4LP2 B;  5CBR A;  1O63 A;  3TQW A;  1Y9U A;  1II5 A;  2XD3 A;  2I3V A;  3ZKL A;  3S9E A;  4JDF A;  1B32 A;  4QFN A;  5CMC A;  2HCA A;  2F7C A;  3FAT A;  4BLA A;  4H67 A;  1P1W A;  1I6A A;  5I58 B;  5ITP A;  1USY H;  3H6T A;  4OEV A;  2DXY A;  4PFY A;  4P11 A;  4OEN A;  5DVJ A;  3FIR A;  3SEV A;  4QFK A;  2ONK E;  4LVQ A;  5AA1 A;  4IB2 A;  4JWY A;  4MLQ A;  4H8I A;  1A54 A;  1VR5 A;  3ILT B;  4KFQ A;  5DYH A;  3HCQ A;  3QYT A;  3PUZ E;  3LC8 A;  1QUK A;  3KEI A;  4HW8 A;  1UTH B;  2PBW A;  2W7Y A;  4WED A;  3QK6 A;  2B65 A;  1PC3 A;  2XXX A;  1A99 A;  2ONR A;  1LBC A;  1L5T A;  1SYI A;  4YMB A;  1M5B A;  2OJT A;  2VD3 A;  1MH3 A;  1PB9 A;  1IUD A;  2QS2 A;  4OQO A;  4DXC A;  5JTY A;  3FD3 A;  5AA4 A;  4O3B A;  1FTM A;  1MDP 1;  4GD5 A;  3MPL A;  4OTE A;  3M3K A;  1LAX A;  2V84 A;  4KI0 E;  4R75 A;  4IO5 A;  1PB7 A;  5H8Q B;  1ZMG A;  1PB8 A;  3O9P A;  3K6W A;  3TTL A;  3RTF B;  3H6U A;  3ONM A;  1B4H A;  1SD3 A;  1UTB A;  4NMY A;  4QSE A;  4QFL A;  3OO6 A;  3CFL A;  2I4B A;  1JVX A;  4C1U A;  2I4C A;  2RIN A;  1N84 A;  3W9W A;  3SER A;  4IO3 A;  3K2D A;  4KHZ E;  3C31 A;  5JEI A;  3CR9 A;  3OO8 A;  4O3A A;  2O69 A;  1LCF A;  1IXH A;  2LAO A;  1Y1M A;  2ZNU A;  2Z23 A;  3HV1 A;  3KSJ A;  4GVO A;  4ZEI A;  2I0C A;  3RY3 A;  3IR1 A;  4YAH X;  4EQ7 A;  1A8E A;  3OSQ A;  2XXQ A;  3MC2 A;  2O7I A;  1MQD A;  3QAX A;  3DP6 A;  3K1N A;  3Q25 A;  4KQP A;  5BUU A;  4OFL A;  3GBA A;  2HAV A;  5TPA B;  4GLI A;  1HSE A;  3CFX A;  3H6V A;  3FVN A;  3FV2 A;  3R6U A;  3TAJ A;  4F29 A;  3PUX E;  1B3L A;  1GGG A;  3K0V A;  4NF8 A;  4KYS A;  3MP8 A;  2XXV A;  1DSN A;  3VXC A;  1SVX B;  2Z22 A;  4RPN A;  4R73 A;  3UA8 A;  4H0W A;  3WAF A;  5ICQ A;  2HAU A;  3KOT A;  3GBB A;  1TFA A;  1B3F A;  1MPC A;  4AQ4 A;  4NF4 B;  2OK2 A;  1ATG A;  3PPR A;  4X48 A;  5ICT A;  4ZE9 A;  1SQY A;  2QL3 A;  3TEP A;  4U23 A;  3FXQ A;  1H45 A;  5H8S A;  1QW0 A;  4H65 A;  5KCJ A;  4F3G A;  5TP9 B;  4OES A;  3E3K A;  4ELO A;  4F22 A;  3TQL A;  5IAI A;  2G29 A;  3V83 A;  2F6G A;  2HEU A;  3Q26 A;  2REJ A;  3T22 A;  1TWY A;  2Y84 A;  2H25 A;  3PUV E;  4MF3 A;  2VHA A;  5I56 B;  1URG A;  3EHU A;  1HSL A;  4G68 B;  1MG1 A;  1RYX A;  3N6T A;  1B5H A;  1ZIU A;  3K6X A;  3CSB A;  5FTH A;  5H8N B;  3EPE A;  3TFL A;  2H98 A;  1UIV A;  1NH7 A;  1EZO A;  1NNP A;  5KDT A;  1NL5 A;  3IK6 B;  3OO7 A;  5H8H B;  2B3B A;  4YB5 A;  4LUB A;  3O28 A;  5F1Q A;  1MDQ A;  2QMW A;  3U92 A;  4F1U A;  3OSR A;  1S50 A;  4GWO A;  3O66 A;  3OOA A;  3C34 A;  3KOS A;  3VFJ A;  2QS3 A;  1EZP A;  2UVJ A;  1B0H A;  5FTI A;  1D3K A;  4Z0I A;  5I59 B;  2I58 A;  4N6P A;  4I9D A;  3MZB A;  1MPD A;  3Q28 A;  1SW5 A;  3IL1 B;  3UP9 A;  2FYI A;  3HST A;  3TTK A;  3OD7 A;  1VFD A;  2ZYM A;  3PV0 E;  3B7D A;  3VDF A;  1I6Q A;  2I3W A;  5FHO A;  4ECF A;  4PP0 A;  5KZT A;  4ELQ A;  4ZS9 A;  2VP1 A;  4DXB A;  4O3C A;  3VVF A;  1N7W A;  1AH5 A;  2Q2A A;  1F9B A;  3MBP A;  3O2A A;  4X9T A;  1KWH A;  4JB7 A;  5HM4 B;  3MAM A;  3ECR A;  4G4P A;  1R9L A;  4OHN A;  4LA9 A;  2XXY A;  4JXI A;  4ZDM A;  3JYR A;  4NE4 A;  3PPP A;  3UN6 A;  1Y4T A;  3EQ1 A;  4FAJ A;  1URS A;  2V3Q A;  3D4C A;  3TZA A;  1MXZ A;  1LFH A;  3RLF E;  5DEX B;  4ESX A;  2ZYN A;  4IO6 A;  4NWD A;  4R9F A;  3V8X B;  1YCJ A;  3MVY A;  3U1O A;  3TTN A;  2HXW A;  3HO7 A;  3OXN A;  2QPQ A;  4I62 A;  2ONS A;  3RN8 A;  1H76 A;  3M3L A;  1CB6 A;  3RTW B;  3H03 A;  2PT2 A;  1POY 1;  1P1U A;  1MM6 A;  3RNN A;  3KBR A;  1UTH A;  3TPA A;  4IO7 A;  1IXI A;  2F36 A;  4RK9 A;  4EDP A;  1B40 A;  1N76 A;  3JZJ A;  1Y4C A;  3KZG A;  1NFT A;  4WKM A;  4POX A;  1B5J A;  1MXW A;  1N04 A;  5CI5 A;  3N26 A;  3RT8 A;  3IOT A;  2THI A;  4XKN A;  1OIB A;  5H8F B;  1FW0 A;  3FVG A;  2F8D A;  4LQ2 A;  1BIY A;  3KJT A;  3CSG A;  5CMB A;  2DE3 A;  5H8Q A;  1Q35 A;  3IX1 A;  2NXO A;  1BLF A;  3TCF A;  1NNT A;  2D5W A;  4MBP A;  1S7Y A;  3SEX A;  3O6G A;  3O6I A;  4FED A;  4OVJ A;  3OEM A;  4IY5 A;  2I48 A;  1MPB A;  2DWH A;  2ANJ A;  1XVX A;  4NWC A;  2RCB A;  2OWS A;  5F7V A;  4U22 A;  4QSD A;  4DXU A;  1MS7 A;  4U1O A;  5CMM A;  2QS1 A;  3QIM A;  4AB5 A;  1D9Y A;  3JV9 A;  2CZL A;  3SET A;  3H4Z A;  4NF5 B;  1IXC A;  1FQE A;  5TPA A;  5M2V A;  5BWJ A;  3A3C A;  2I0B A;  3B6T A;  5DVI A;  4RPO A;  4EQB A;  1TFD A;  2QJE A;  3CG3 A;  4YIC A;  1MH4 A;  1DPE A;  3PPN A;  3PMV A;  1QUL A;  4MLV A;  1B05 A;  3VXB A;  3THI A;  4H8J A;  2OLB A;  5L9O A;  3FJM A;  4OEU A;  2H99 A;  3FJ7 A;  3MP1 A;  5HPQ A;  5AA2 B;  3I3V A;  2XXW A;  4NF4 A;  4OFJ A;  3H3G A;  2ALU A;  4BDO A;  4E0X A;  3N94 A;  4LZ5 A;  1LFG A;  4DCX A;  3T66 A;  2V3T A;  4R6H A;  4IGT A;  2QMX A;  2F34 A;  4AB6 A;  1LLS A;  3RQT A;  1QKA A;  1URD A;  4F3B A;  4G68 C;  4UA8 A;  1OLC A;  4IO4 A;  3N6U A;  4XKP A;  1LBB A;  4GRK A;  4OYV A;  3FVK A;  4RK2 A;  3Q27 A;  5TP9 A;  4R2B A;  1Y1Z A;  3MZ9 A;  4KR5 A;  1ZU0 A;  2O68 A;  2DWA A;  3FVO A;  2P2A A;  1UQW A;  3LUY A;  4U1Z A;  4PE5 B;  1QUJ A;  3IOW A;  4JWX A;  1YTV A;  3O6H A;  1N3X A;  5I56 A;  4G68 A;  4F1V A;  3KFM A;  3FJG A;  4BDR A;  5K2X A;  2VOZ A;  5TU0 A;  1B7U A;  3TYH A;  3T9X B;  2UYF A;  3KN8 A;  5H8N A;  2UVH A;  3DLN A;  1DOT A;  2DE4 A;  3KGC A;  1JVY A;  3TUS A;  3KG2 A;  2E0S A;  5H8H A;  1PEB A;  1QVS A;  3N5L A;  3C4M A;  3GZG A;  3CFZ A;  4F19 A;  2RKM A;  3EF7 A;  3PU5 A;  4ZEF A;  1B3E A;  4KCD A;  1D4N A;  1A7L A;  4GQO A;  1H3D A;  1FQA A;  5I59 A;  3CRB A;  3PD9 A;  4DE8 A;  1US4 A;  3T96 B;  3V89 B;  1Q1K A;  3KN3 A;  1JEV A;  1XOC A;  3ZS6 A;  3MUQ A;  4HS7 A;  2V25 A;  3K01 A;  3PD8 A;  4TOZ A;  4EQ9 A;  3P7I A;  3ODB A;  3S9L C;  4JWO A;  5J1D A;  1M5F A;  5AA4 B;  4UAC A;  4EUO A;  1H44 A;  4R6K A;  2REG A;  3G7W A;  1SYH A;  1GTK A;  1O64 A;  2Y7K A;  4MH5 A;  2A5T B;  5L9M A;  3IB1 A;  4OFO A;  3RT6 B;  2HFB A;  2QRY A;  2Z8F A;  4HCW A;  1ZJL A;  3LSW A;  3IB2 A;  2P1S A;  1NNF A;  1WOD A;  3UK4 A;  3UIF A;  2DQV A;  3PPQ A;  1FQB A;  1FQD A;  2ZYO A;  3QUF A;  1ZBM A;  1MQJ A;  2YPN A;  3PUY E;  5DEX A;  4LZ7 A;  4KYE A;  3OEL A;  2HZK A;  2DYX A;  2PT1 A;  3MVZ A;  3MJN A;  4Q8R A;  5L9S A;  1VSO A;  4BDQ A;  4ELP A;  5JK4 A;  1JQF A;  3U8Q A;  1B51 A;  5I57 A;  1MRP A;  1Y3P A;  2NVU B;  2XXU A;  1FQC A;  2IA4 A;  4OER A;  4QRZ A;  4THI A;  2P0S A;  2Q88 A;  4N07 A;  2O1L A;  4F1Y A;  2X7Q A;  4GFR A;  1LAG E; 
#chains in the Genus database with same CATH topology
 3CI8 A;  3C35 A;  2O84 X;  4KXP A;  4YKJ A;  3VLW A;  3T9H B;  3MPK A;  3ZSF A;  2UVI A;  5ELV A;  2RF1 A;  3OEK A;  3G3I A;  1TT1 A;  4ZED A;  1Z7N E;  4JSO A;  4MCO A;  1OLA A;  2DP8 A;  4N17 A;  3S2V A;  5H8F A;  1JW4 A;  1XT8 A;  5HBC A;  2DVC A;  3MP6 A;  4H5F A;  2HZL A;  3K1P A;  3TTR A;  1XC1 A;  3TTM A;  4MJO A;  2WX9 A;  5L8D A;  1NNK A;  1FTK A;  3K4U A;  4GIZ A;  3AXF A;  2RC8 A;  4XKQ A;  2GHB A;  5EHS A;  1FBD A;  2OX3 A;  4JSD A;  3IOV A;  3K6V A;  1LGB C;  2H4I A;  5I5P A;  3A09 A;  1JET A;  1AOV A;  3E9X A;  3EN3 A;  5KCJ B;  2XXH A;  1RYO A;  4WEP A;  5IZ3 B;  5CM6 A;  3KJ7 A;  1CE2 A;  2ZZX A;  1XVY A;  3M8U A;  5ET8 A;  4C0R A;  1MXY A;  4E0W A;  5IZ1 A;  3PTY A;  4U2R A;  4GWS A;  1DTG A;  1FPK A;  4K3F A;  3K02 A;  5I58 A;  4WXJ A;  1VE4 A;  1FJ6 A;  5B70 A;  3W9V A;  4F3S A;  1B1H A;  2X26 A;  4QBA A;  5B7D A;  4ZEK A;  3IOR A;  1B58 A;  3G3H A;  4XKR A;  1DTZ A;  1NV7 A;  4NF5 A;  2XX7 A;  1AWB A;  1DPP A;  1OVT A;  4N15 A;  3IFC A;  4HTG A;  3B8B A;  5A5X B;  4PET A;  2Z8D A;  1B0L A;  2UXA A;  5AA3 A;  2VPO A;  3DP8 A;  2Y7P A;  2O1M A;  2DS9 A;  1FBE A;  4GBW A;  4ZZA A;  4F3P A;  4OVR A;  4F39 A;  1RDY A;  2M8C A;  1M5C A;  2HQ0 A;  1ANF A;  2PVU A;  1P1Q A;  4ZZE A;  1O7T A;  3FUZ A;  3TCG A;  1YAE A;  5I2N B;  2CEY A;  1IQ7 A;  2Y5K A;  2ABH A;  1KA0 A;  1XI6 A;  1XS5 A;  3K1M A;  2VD2 A;  3K00 A;  1YPN A;  2Y7R A;  2F3B A;  4PFU A;  5DT6 A;  3EHT A;  4N13 A;  3IJX B;  3SEY A;  1N7X A;  1LAH E;  3ILU B;  3GXA A;  4N91 A;  2OZZ A;  5EHM A;  4R72 A;  5AA2 D;  1I6B A;  2F7B A;  4NTL A;  2IEE A;  5ITO A;  1S9T A;  3R7X A;  2V4C A;  2Y7W A;  4OVP A;  1A8F A;  4MX6 A;  3VVD A;  1N3W A;  1B4Z A;  3MQ9 A;  1VFE A;  4G77 A;  4GF8 A;  5ET6 A;  4XXU A;  5CBS A;  5K2Y A;  1P99 A;  2DWJ A;  1JW5 A;  1LB8 A;  2XX9 A;  3H6W A;  2ESN A;  4YKI A;  3BBR A;  2DE2 A;  4IO2 A;  2FBP A;  3B6W A;  1SW1 A;  3IAZ A;  1MM7 A;  5EYF A;  1EZ9 A;  2KQZ A;  1POT A;  2A5S A;  2D3I A;  1NV3 A;  2HPG A;  3TKD A;  3KN7 A;  4BDN A;  3SEU A;  1P1N A;  4NF6 B;  3USD A;  4GOT A;  4TLL B;  1RKM A;  4XEQ A;  4YB6 A;  3G3G A;  4O94 A;  2AYS A;  3HHG A;  4ZEB A;  3GLB A;  2XD2 A;  4EXL A;  4FE8 A;  3CVG A;  4MAG A;  1FPL A;  4M4G A;  3IOU A;  2E1S A;  1MQG A;  4NGU A;  3VE1 B;  2DSF A;  1SW4 A;  4AS4 A;  1JEU A;  1D9Q A;  3VLU A;  1LST A;  2R71 A;  3W15 C;  4GWZ A;  2KLF A;  3MST A;  1IEJ A;  3T9U A;  4HE0 A;  3RPW A;  2DDK A;  4PFW A;  5FHN A;  3MVW A;  5AE4 A;  1K9Z A;  3PGF A;  1P1O A;  1EH3 A;  3D4G A;  1WDN A;  1B6H A;  1I69 A;  2ZNS A;  3C36 A;  4Q30 B;  4OET A;  2XX8 A;  3S4U A;  3IB0 A;  4M1V A;  4QFP A;  1LCT A;  4R2F A;  3SKP A;  3U94 A;  1SI1 A;  3O29 A;  5A5L A;  4YKP A;  4LQ5 A;  4IY6 A;  4U4X A;  5EQ9 A;  1PDA A;  4DZ1 A;  1NMU A;  2PX1 A;  2VGQ A;  3U93 A;  4MFI A;  1BTJ A;  3OMB A;  2FA7 A;  1BKA A;  2CMO A;  1JW1 A;  2FIX A;  2UVG A;  2Y5L A;  1BP5 A;  4F18 A;  1R6Z A;  1QUI A;  2A5T A;  4P0I A;  2XXK A;  2Q89 A;  2XXP A;  1M5E A;  5I2K B;  3ISP A;  1MY2 A;  2Q9T A;  1MY0 A;  4DDD A;  1LBX A;  4ELR A;  4Q0C A;  2GFE A;  3UGW A;  2UYE A;  4H5G A;  4JBZ A;  1NH8 A;  3HFU A;  4DLD A;  4DIG A;  1US5 A;  1LB9 A;  3FXU A;  4EF2 A;  2F78 A;  4H6D A;  1QKB A;  3TDJ A;  1G0I A;  1Y20 A;  3BFU A;  2DXR A;  2PCR A;  1AMF A;  3BKI B;  1B5I A;  4YKK A;  3DP4 A;  2F35 A;  2F7A A;  1FPE A;  3IO6 A;  3RUM A;  4L17 A;  4F31 B;  2PFZ A;  3PMX A;  2PMS A;  1EYI A;  3KSX A;  3PPO A;  4OWD A;  3SDF A;  4QSC A;  2BJJ X;  5CMK A;  3MW0 A;  2XHD A;  1TXF A;  3TOD A;  4FOR A;  4YZZ A;  1D9V A;  3G3J A;  3DEL B;  1MXV A;  4HCY A;  4X1D A;  1SI0 A;  4PDD A;  4LON B;  2Y7I A;  3T93 B;  3IJO B;  3FZV A;  3HHF A;  1Y3N A;  4MNI A;  1FTA A;  1OQG A;  4KCC A;  2NUV A;  3FAS A;  4OVT A;  1LFI A;  5ISU A;  4ISU A;  1Z7M E;  3VVE A;  2NWJ A;  2OWT A;  4R6Y A;  1ELJ A;  3B6Q A;  2V3U A;  2OCU A;  3S9N C;  2OBG A;  3S9M C;  4RYA A;  2FNC A;  1MXU A;  5JTY B;  3T9V A;  2RC7 A;  2AIX A;  4OMB A;  2Q74 A;  4X04 A;  2PYY A;  3CG1 A;  1LBW A;  4U4S A;  1USY E;  2R6G E;  1PBP A;  1UTB B;  1OMP A;  3L6G A;  3Q29 A;  2NOO A;  2H5Y A;  1YYZ A;  1H43 A;  3PUW E;  3FV1 A;  3EHS A;  4GXA A;  1MQI A;  1IMF A;  3LR1 A;  1MQH A;  4G8M A;  4PQJ A;  2P3N A;  1HSJ A;  5IZ3 A;  4PC9 A;  1Y3Q A;  2Z8E A;  4TLM B;  4DCY A;  2O51 A;  4ESW A;  2QS4 A;  3M3F A;  2ZNT A;  4PCD A;  1KA1 A;  4OVS A;  2JJK A;  1SDX A;  1QJM A;  3VLV A;  2Q8J A;  1MY1 A;  4F2Q A;  4GXS B;  4YMA A;  1MXX A;  1JNF A;  4DI3 D;  3PMW A;  1B3H A;  3OEN A;  5J16 A;  4P9K A;  2VT5 A;  4XTC Q;  3A3U A;  1SW2 A;  3F11 A;  5A5X A;  1OQH A;  4EXK A;  3LBS A;  1A55 A;  2QFL A;  1FTJ A;  1NKX A;  2XXR A;  3E13 X;  2GH9 A;  2WKY A;  3MVX A;  4PAI A;  2QSX A;  1LAF E;  4P56 A;  2RCA A;  4KPT A;  3C32 A;  2ZXT A;  1IMD A;  2X7P A;  3TEL A;  1GR2 A;  1FTO A;  1R9Q A;  4I1D A;  4JVC A;  4NF8 B;  3SEW A;  4I8C A;  1T0K A;  4P8B A;  2FIE A;  4DI4 B;  5I2N A;  5DTB A;  4KD5 A;  3HN0 A;  2O7U A;  4ONY A;  3FGS A;  4Q5T A;  3E4R A;  3FXR A;  1B3G A;  2F5X A;  3R26 A;  5CRY A;  4F2O A;  4LZ8 A;  2AL5 A;  4EF1 A;  1AL3 A;  3HPI A;  3LSF B;  3IFA A;  3UOR A;  3V5A A;  4Z7E A;  2AL4 A;  1IZ1 A;  4IGR A;  1NV6 A;  4UAB A;  4P1L A;  2YLN A;  3FBP A;  4GL8 A;  3H7M A;  2YJP A;  1B9J A;  5FBP A;  2H9B A;  4OXV A;  1GV8 A;  1B7H A;  3MZ1 A;  1UIU A;  3DM0 A;  5CC2 A;  2R9J A;  2RC9 A;  3QXM A;  4FAT A;  4P1E A;  4N8Y A;  1ZKB A;  4PFT A;  4X1B A;  4YB7 A;  1B7Z A;  5FHM A;  4G8N A;  1IIT A;  3SES A;  4BDL A;  2ZYK A;  2I6E A;  3B50 A;  1RDX A;  1XHY A;  1PBQ A;  4FJP A;  4PF6 A;  2WEF A;  4OZ9 A;  3RPL B;  4GWU A;  4NED A;  4ZEC A;  1FBG A;  2BJI A;  3RGY A;  2MKZ A;  5DVF A;  1B52 A;  2F6P A;  3C33 A;  4PGP A;  1SBP A;  1OVB A;  4R74 A;  3LSL A;  3QSL A;  2DVZ A;  1NUZ A;  3CIJ A;  2XWI A;  4NF6 A;  2GRV A;  4N6D A;  4TQU Q;  1AIV A;  3K6U A;  1FPD A;  4JVD A;  1B2H A;  4XIG Q;  5ET7 A;  4G8H A;  4FIM A;  1FTL A;  4NF0 A;  4RNS A;  2Q2C A;  4KYD A;  3U72 A;  3ZKK A;  2FHY A;  3LSX A;  1MY4 A;  4HXV A;  3MWB A;  2I49 A;  3NOH A;  1B46 A;  1FCK A;  1WVJ A;  3VV5 A;  5KDT B;  1J1N A;  1N0T A;  5IKB A;  1A40 A;  4GX6 A;  2V93 A;  3OO9 A;  4PAF A;  4POW A;  2XWK A;  4G2Z A;  4C1T A;  5EQ7 A;  4RA1 A;  2F97 A;  5I57 B;  3A29 A;  4NG7 A;  2XXT A;  4N8G A;  1M5D A;  3TCH A;  1ZLQ A;  4R9G A;  4QFO A;  2DOJ A;  5EQ8 A;  1GVC A;  4RXL A;  3C9H A;  1MY3 A;  5I84 A;  3O97 A;  2B3F A;  5AA2 A;  3H06 B;  3WAE A;  4H1X A;  4RY1 A;  4ZE8 A;  2ZMB A;  4LAT A;  4FEB A;  4I3E A;  1DMB A;  1CNQ A;  4FEC A;  3I5O A;  4QHQ A;  1R1N A;  3TMG A;  2D21 A;  4NHB A;  4YU0 A;  4N81 A;  3BFT A;  1IXG A;  4U21 A;  4ND9 A;  2XXI A;  3E78 A;  4BDM A;  3G3F A;  3QUJ A;  1IIW A;  1ZTY A;  4P0G A;  4RJZ A;  5EYH A;  2GHA A;  2DWI A;  3I6V A;  4FBP A;  3L6H A;  1B1X A;  1EU8 A;  3G3K A;  4GL0 A;  5LOM A;  1FQF A;  5I2K A;  2G93 A;  4QF9 A;  3IO4 A;  1KZ8 A;  2O6A A;  4LP2 B;  4H46 A;  5CBR A;  1O63 A;  3TQW A;  1Y9U A;  1NV0 A;  1II5 A;  2XD3 A;  2I3V A;  3E79 A;  3ZKL A;  3S9E A;  4JDF A;  1B32 A;  2XWV A;  4QFN A;  5CMC A;  2HCA A;  2F7C A;  2WBB A;  3FAT A;  4BLA A;  4H67 A;  4PFI A;  1P1W A;  1I6A A;  5I58 B;  5ITP A;  1USY H;  3H6T A;  4I3Y A;  2CEX A;  3ROJ A;  4OEV A;  2DXY A;  2QVU A;  4PFY A;  1FBH A;  4PBQ A;  4P11 A;  4OEN A;  1FPJ A;  5DVJ A;  3FIR A;  3SEV A;  4QFK A;  2ONK E;  4LVQ A;  3KC0 A;  5AA1 A;  4IB2 A;  1RDZ A;  4JWY A;  4MLQ A;  4H8I A;  1A54 A;  1VR5 A;  3ILT B;  4KFQ A;  5DYH A;  3HCQ A;  3QYT A;  1K9Y A;  3PUZ E;  3LC8 A;  1QUK A;  3KEI A;  4HW8 A;  1UTH B;  2CZH A;  4O7M A;  2PBW A;  2W7Y A;  4WED A;  3QK6 A;  2B65 A;  2Q8M A;  1PC3 A;  2XXX A;  1A99 A;  2ONR A;  1LBC A;  3BIG A;  1L5T A;  1SYI A;  4YMB A;  1M5B A;  2OJT A;  2VD3 A;  1MH3 A;  4N4U A;  1PB9 A;  1IUD A;  2QS2 A;  4O8M A;  4OQO A;  4DXC A;  5JTY A;  5IZZ A;  3FD3 A;  4O7I A;  5AA4 A;  2FVZ A;  4O3B A;  1FTM A;  1MDP 1;  5F24 A;  4GD5 A;  3MPL A;  4OTE A;  3M3K A;  1LAX A;  2V84 A;  4KI0 E;  4R75 A;  4IO5 A;  1PB7 A;  5H8Q B;  1ZMG A;  1PB8 A;  3O9P A;  3K6W A;  3TTL A;  3RTF B;  5LDZ A;  3H6U A;  3ONM A;  1B4H A;  1SD3 A;  1UTB A;  4NMY A;  1EYJ A;  4QSE A;  4QFL A;  3OO6 A;  3CFL A;  2I4B A;  1JVX A;  4C1U A;  2I4C A;  2RIN A;  1N84 A;  2QVV A;  3W9W A;  3SER A;  4IO3 A;  3K2D A;  4KHZ E;  3C31 A;  5JEI A;  4PAK A;  4PF8 A;  3CR9 A;  3OO8 A;  4O3A A;  2O69 A;  1LCF A;  1IXH A;  2LAO A;  1Y1M A;  2ZNU A;  2WYK A;  2Z23 A;  3HV1 A;  3KSJ A;  4GVO A;  4ZEI A;  2HHM A;  2I0C A;  3RY3 A;  3IR1 A;  4YAH X;  4EQ7 A;  1A8E A;  3OSQ A;  1YXI A;  2XXQ A;  3MC2 A;  2O7I A;  3FXB A;  4P47 A;  5I7I A;  1MQD A;  3QAX A;  3DP6 A;  3K1N A;  3Q25 A;  4KQP A;  5BUU A;  4OFL A;  3GBA A;  2HAV A;  5TPA B;  4GLI A;  1YZ0 A;  1HSE A;  3CFX A;  4QXD A;  3D1R A;  3H6V A;  3FVN A;  3FV2 A;  3R6U A;  4NX1 A;  3TAJ A;  4F29 A;  3PUX E;  1B3L A;  1GGG A;  3K0V A;  4NF8 A;  5I3S A;  4KYS A;  3MP8 A;  2XXV A;  1FSA A;  1DSN A;  3VXC A;  1SVX B;  2Z22 A;  4RPN A;  4R73 A;  3UA8 A;  4H0W A;  3WAF A;  5ICQ A;  1JP4 A;  4GBV A;  2HAU A;  3KOT A;  3GBB A;  1TFA A;  1B3F A;  1MPC A;  4AQ4 A;  4NF4 B;  2OK2 A;  1ATG A;  3PPR A;  4X48 A;  5ICT A;  1DK4 A;  4XF5 A;  4ZE9 A;  1SQY A;  2QL3 A;  3TEP A;  4U23 A;  3FXQ A;  1H45 A;  5H8S A;  1QW0 A;  4H65 A;  4XFE A;  5KCJ A;  4F3G A;  5TP9 B;  4OES A;  3E3K A;  4ELO A;  3RPL A;  3TQL A;  4F22 A;  5IAI A;  2G29 A;  3V83 A;  2F6G A;  2HEU A;  3Q26 A;  2REJ A;  3T22 A;  1TWY A;  2Y84 A;  2H25 A;  3PUV E;  4MF3 A;  2VHA A;  4MIJ A;  5I56 B;  1URG A;  1IMB A;  3EHU A;  1HSL A;  4G68 B;  4MNP A;  5ET5 A;  1MG1 A;  1RYX A;  3N6T A;  1B5H A;  1ZIU A;  3K6X A;  3CSB A;  5FTH A;  5H8N B;  3EPE A;  3TFL A;  1QGX A;  2H98 A;  1LBZ A;  2GQ1 A;  1UIV A;  1NH7 A;  1INP A;  1NUX A;  1EZO A;  1NNP A;  5KDT A;  1NL5 A;  3IK6 B;  3OO7 A;  4OA4 A;  5H8H B;  2B3B A;  4YB5 A;  4LUB A;  3O28 A;  5F1Q A;  1MDQ A;  2F3D A;  2QMW A;  1FBF A;  3U92 A;  4LN5 A;  4F1U A;  4I40 A;  3OSR A;  1S50 A;  4GWO A;  3O66 A;  1NI9 A;  3CHG A;  3OOA A;  3C34 A;  3KOS A;  3VFJ A;  2QS3 A;  1EZP A;  2UVJ A;  4OAN A;  3SZP A;  1B0H A;  2P3V A;  5FTI A;  1D3K A;  4Z0I A;  5I59 B;  2I58 A;  3MYU A;  4N6P A;  4I9D A;  3MZB A;  1MPD A;  3Q28 A;  1SW5 A;  3IL1 B;  4MMP A;  3UP9 A;  2FYI A;  3HST A;  1FPF A;  3TTK A;  3OD7 A;  1VFD A;  5IGA A;  2ZYM A;  3PV0 E;  3B7D A;  3VDF A;  1I6Q A;  4PFB A;  2I3W A;  5EYG A;  1BK4 A;  5FHO A;  4ECF A;  5T3J A;  1NV4 A;  4PP0 A;  5KZT A;  4ELQ A;  4GX4 A;  5ESY A;  4ZS9 A;  2VP1 A;  4DXB A;  4O3C A;  4AS5 A;  3VVF A;  3RYD A;  1N7W A;  4X8R A;  1AH5 A;  2Q2A A;  1F9B A;  3MBP A;  3O2A A;  4X9T A;  1KWH A;  4JB7 A;  5HM4 B;  3MAM A;  3ECR A;  4G4P A;  1R9L A;  3T0J A;  4OHN A;  4LA9 A;  2XXY A;  4JXI A;  4ZDM A;  3JYR A;  4NE4 A;  3PPP A;  3UN6 A;  4NQ8 A;  1Y4T A;  3EQ1 A;  4FAJ A;  1URS A;  2V3Q A;  1FBC A;  3D4C A;  3TZA A;  1MXZ A;  1LFH A;  4JVI A;  3RLF E;  5DEX B;  4ESX A;  2ZYN A;  4IO6 A;  4NWD A;  4R9F A;  3V8X B;  1YCJ A;  3MVY A;  3U1O A;  1FBP A;  3TTN A;  1FRP A;  2HXW A;  3HO7 A;  3OXN A;  2QPQ A;  4I62 A;  2ONS A;  3RN8 A;  1H76 A;  3M3L A;  1NUY A;  1CB6 A;  3RTW B;  3H03 A;  2PT2 A;  1POY 1;  1P1U A;  1MM6 A;  3RNN A;  3KBR A;  1UTH A;  3TPA A;  4IO7 A;  1IXI A;  2F36 A;  4RK9 A;  4EDP A;  1B40 A;  1N76 A;  3JZJ A;  1Y4C A;  3KZG A;  1NFT A;  4WKM A;  4POX A;  2OWZ A;  1B5J A;  1MXW A;  1N04 A;  5CI5 A;  3N26 A;  3RT8 A;  3IOT A;  2THI A;  4XKN A;  2CZK A;  2L5V A;  1OIB A;  5H8F B;  1FW0 A;  3FVG A;  2F8D A;  4LQ2 A;  1BIY A;  4GX3 A;  3KJT A;  3CSG A;  5IM2 A;  5CMB A;  2DE3 A;  5H8Q A;  1Q35 A;  3IX1 A;  2NXO A;  1G0H A;  1BLF A;  3TCF A;  5LTC A;  1NNT A;  2D5W A;  4PFR A;  4MBP A;  1FPI A;  3BIH A;  1S7Y A;  3SEX A;  3T1B A;  3O6G A;  3O6I A;  4FED A;  4OVJ A;  3OEM A;  4IY5 A;  4MEV A;  2I48 A;  1MPB A;  2DWH A;  2ANJ A;  1XVX A;  2ZZW A;  4GWW A;  4NWC A;  2RCB A;  2OWS A;  5F7V A;  4U22 A;  4QSD A;  4N6K A;  4DXU A;  3U65 A;  1MS7 A;  4U1O A;  3LV0 A;  5CMM A;  2QS1 A;  3QIM A;  4AB5 A;  1D9Y A;  3JV9 A;  2CZL A;  3SET A;  1EYK A;  4NAP A;  3H4Z A;  4NF5 B;  1IXC A;  1FQE A;  5TPA A;  5M2V A;  5BWJ A;  3A3C A;  3KBZ A;  2I0B A;  3B6T A;  2PFY A;  5DVI A;  4RPO A;  1NV2 A;  4EQB A;  1TFD A;  2QJE A;  3CG3 A;  4YIC A;  2VPN A;  1MH4 A;  1DPE A;  3PPN A;  1FPG A;  1SPI A;  3PMV A;  1QUL A;  4MLV A;  5DW8 A;  1B05 A;  3VXB A;  3THI A;  4H8J A;  2OLB A;  5L9O A;  3FJM A;  4OEU A;  2H99 A;  3FJ7 A;  3MP1 A;  3GYY A;  5HPQ A;  5AA2 B;  3I3V A;  2XXW A;  4NF4 A;  4OFJ A;  3H3G A;  2ALU A;  4BDO A;  4E0X A;  3N94 A;  4LZ5 A;  1VDW A;  1LFG A;  3EKI A;  4DCX A;  4GWX A;  3T66 A;  2V3T A;  4R6H A;  4IGT A;  2QMX A;  2F34 A;  4AB6 A;  1LLS A;  3RQT A;  1QKA A;  1URD A;  4F3B A;  4G68 C;  4H45 A;  4UA8 A;  1IME A;  1NV5 A;  1OLC A;  1Q9D A;  4IO4 A;  3N6U A;  4XKP A;  4P3L A;  4OYV A;  1LBB A;  2WBD A;  4GRK A;  3FVK A;  4RK2 A;  3Q27 A;  5TP9 A;  2ZZV A;  2QVR A;  4R2B A;  1Y1Z A;  2B4M A;  3MZ9 A;  4KR5 A;  1ZU0 A;  2O68 A;  2DWA A;  3FVO A;  2P2A A;  1UQW A;  3LUY A;  4U1Z A;  4PE5 B;  1QUJ A;  3IOW A;  4JWX A;  1YTV A;  3O6H A;  1N3X A;  5I56 A;  4G68 A;  4F1V A;  3KFM A;  3FJG A;  4BDR A;  5K2X A;  2VOZ A;  5TU0 A;  1B7U A;  3TYH A;  4GWY A;  2B4L A;  3T9X B;  2UYF A;  4PGN A;  3KN8 A;  5H8N A;  2UVH A;  3DLN A;  1DOT A;  2DE4 A;  3KGC A;  4NN3 A;  1JVY A;  3TUS A;  3KG2 A;  2E0S A;  5H8H A;  4OVQ A;  1LAG E;  1PEB A;  1QVS A;  3N5L A;  3C4M A;  3GZG A;  1LBV A;  3CFZ A;  4F19 A;  2RKM A;  3EF7 A;  4PE3 A;  3PU5 A;  4ZEF A;  1B3E A;  4KCD A;  1D4N A;  1A7L A;  4GQO A;  1H3D A;  1FQA A;  5I59 A;  3CRB A;  1LEV A;  3PD9 A;  4MHF A;  4DE8 A;  1US4 A;  3T96 B;  3V89 B;  1Q1K A;  3KN3 A;  1JEV A;  1XOC A;  4HE1 A;  1DBZ A;  3KC1 A;  3ZS6 A;  3MUQ A;  5EQA A;  1DCU A;  4HS7 A;  2V25 A;  3K01 A;  3QMF A;  3PD8 A;  4HE2 A;  4TOZ A;  4EQ9 A;  4G61 A;  4PTK A;  3P7I A;  3ODB A;  3S9L C;  3LUZ A;  4JWO A;  5J1D A;  1M5F A;  5AA4 B;  4UAC A;  4PBH A;  4EUO A;  1H44 A;  4R6K A;  2REG A;  3G7W A;  1SYH A;  1GTK A;  1O64 A;  2Y7K A;  4MH5 A;  2A5T B;  5L9M A;  3IB1 A;  2KR0 A;  4OFO A;  2CZI A;  1IMC A;  3RT6 B;  2HFB A;  2WYP A;  2QRY A;  2Z8F A;  4HCW A;  1ZJL A;  3LSW A;  3IB2 A;  1LBY A;  1NV1 A;  2P1S A;  1NNF A;  1WOD A;  3UK4 A;  4IR8 A;  2XA5 A;  3UIF A;  2DQV A;  4PDH A;  3PPQ A;  1FQB A;  4MNC A;  1FQD A;  2ZYO A;  3QUF A;  1ZBM A;  1MQJ A;  2YPN A;  3PUY E;  5DEX A;  4LZ7 A;  1FJ9 A;  4KYE A;  3OEL A;  2HZK A;  2DYX A;  2HXR A;  2PT1 A;  3MVZ A;  3MJN A;  4Q8R A;  5L9S A;  2XWO A;  1VSO A;  4BDQ A;  4ELP A;  1FPB A;  5JK4 A;  1JQF A;  3U8Q A;  1B51 A;  5I57 A;  1MRP A;  1Y3P A;  2NVU B;  2XXU A;  1FQC A;  2IA4 A;  4OER A;  2R8T A;  4QRZ A;  4THI A;  2P0S A;  2Q88 A;  4N07 A;  2O1L A;  4F1Y A;  2X7Q A;  1IMA A;  4GFR A;  1NUW A; 
#chains in the Genus database with same CATH homology
 3CI8 A;  3C35 A;  2O84 X;  4YKJ A;  3VLW A;  3T9H B;  3MPK A;  3ZSF A;  2UVI A;  5ELV A;  2RF1 A;  3OEK A;  3G3I A;  1TT1 A;  4ZED A;  1Z7N E;  4JSO A;  1OLA A;  2DP8 A;  3S2V A;  5H8F A;  1JW4 A;  1XT8 A;  5HBC A;  2DVC A;  3MP6 A;  4H5F A;  2HZL A;  3K1P A;  3TTR A;  1XC1 A;  3TTM A;  5L8D A;  1NNK A;  1FTK A;  3K4U A;  4GIZ A;  3AXF A;  2RC8 A;  4XKQ A;  2GHB A;  5EHS A;  4JSD A;  3IOV A;  3K6V A;  1LGB C;  2H4I A;  3A09 A;  1JET A;  1AOV A;  3E9X A;  3EN3 A;  5KCJ B;  2XXH A;  1RYO A;  4WEP A;  5CM6 A;  3KJ7 A;  1CE2 A;  1XVY A;  3M8U A;  4C0R A;  1MXY A;  4E0W A;  4U2R A;  1DTG A;  4K3F A;  3K02 A;  5I58 A;  4WXJ A;  1VE4 A;  5B70 A;  3W9V A;  4F3S A;  1B1H A;  2X26 A;  5B7D A;  4ZEK A;  3IOR A;  1B58 A;  3G3H A;  4XKR A;  1DTZ A;  4NF5 A;  2XX7 A;  1DPP A;  1OVT A;  4HTG A;  5A5X B;  4PET A;  2Z8D A;  1B0L A;  2UXA A;  5AA3 A;  3DP8 A;  2Y7P A;  2O1M A;  2DS9 A;  4ZZA A;  4F3P A;  4F39 A;  2M8C A;  1M5C A;  2HQ0 A;  1ANF A;  2PVU A;  1P1Q A;  4ZZE A;  1O7T A;  3FUZ A;  3TCG A;  1YAE A;  5I2N B;  1IQ7 A;  2ABH A;  1XS5 A;  3K1M A;  2VD2 A;  3K00 A;  1YPN A;  2Y7R A;  4PFU A;  5DT6 A;  3EHT A;  4N13 A;  3IJX B;  3SEY A;  1N7X A;  1LAH E;  3ILU B;  3GXA A;  2OZZ A;  5EHM A;  4R72 A;  5AA2 D;  1I6B A;  2F7B A;  4NTL A;  2IEE A;  5ITO A;  1S9T A;  3R7X A;  2Y7W A;  1A8F A;  3VVD A;  1N3W A;  1B4Z A;  3MQ9 A;  1VFE A;  4G77 A;  4GF8 A;  4XXU A;  5CBS A;  5K2Y A;  1P99 A;  2DWJ A;  1JW5 A;  1LB8 A;  2XX9 A;  3H6W A;  2ESN A;  4YKI A;  3BBR A;  2DE2 A;  4IO2 A;  3B6W A;  1SW1 A;  3IAZ A;  1MM7 A;  5EYF A;  1EZ9 A;  1POT A;  2A5S A;  2D3I A;  3TKD A;  3KN7 A;  4BDN A;  3SEU A;  1P1N A;  4NF6 B;  3USD A;  4GOT A;  4TLL B;  1RKM A;  4YB6 A;  3G3G A;  2AYS A;  3HHG A;  4ZEB A;  3GLB A;  2XD2 A;  4EXL A;  4FE8 A;  3CVG A;  4M4G A;  3IOU A;  2E1S A;  1MQG A;  3VE1 B;  2DSF A;  1SW4 A;  1JEU A;  3VLU A;  1LST A;  2R71 A;  3W15 C;  2KLF A;  1IEJ A;  3T9U A;  3RPW A;  4PFW A;  5FHN A;  3MVW A;  5AE4 A;  3PGF A;  1P1O A;  1EH3 A;  3D4G A;  1WDN A;  1B6H A;  1I69 A;  2ZNS A;  3C36 A;  4Q30 B;  4OET A;  2XX8 A;  3S4U A;  3IB0 A;  4M1V A;  4QFP A;  1LCT A;  4R2F A;  3SKP A;  3U94 A;  1SI1 A;  3O29 A;  4YKP A;  4LQ5 A;  4IY6 A;  4U4X A;  1PDA A;  4DZ1 A;  1NMU A;  2PX1 A;  2VGQ A;  3U93 A;  4MFI A;  1BTJ A;  3OMB A;  2FA7 A;  1BKA A;  2CMO A;  1JW1 A;  2UVG A;  1BP5 A;  4F18 A;  1R6Z A;  1QUI A;  2A5T A;  4P0I A;  2XXP A;  2Q89 A;  1M5E A;  5I2K B;  1MY2 A;  2Q9T A;  1MY0 A;  4DDD A;  4ELR A;  4Q0C A;  2GFE A;  3UGW A;  2UYE A;  4H5G A;  4JBZ A;  1NH8 A;  4DLD A;  4DIG A;  1US5 A;  1LB9 A;  3FXU A;  4EF2 A;  2F78 A;  4H6D A;  1QKB A;  3TDJ A;  1Y20 A;  3BFU A;  2DXR A;  1AMF A;  3BKI B;  1B5I A;  4YKK A;  3DP4 A;  2F35 A;  2F7A A;  3IO6 A;  3RUM A;  4L17 A;  4F31 B;  3PMX A;  2PMS A;  3KSX A;  3PPO A;  4OWD A;  3SDF A;  4QSC A;  2BJJ X;  5CMK A;  3MW0 A;  2XHD A;  1TXF A;  3TOD A;  4FOR A;  4YZZ A;  1D9V A;  3G3J A;  3DEL B;  1MXV A;  4HCY A;  4X1D A;  1SI0 A;  4LON B;  2Y7I A;  3T93 B;  3IJO B;  3FZV A;  3HHF A;  1Y3N A;  1OQG A;  4KCC A;  2NUV A;  3FAS A;  1LFI A;  5ISU A;  4ISU A;  1Z7M E;  3VVE A;  2NWJ A;  2OWT A;  4R6Y A;  1ELJ A;  3B6Q A;  2V3U A;  2OCU A;  3S9N C;  2OBG A;  3S9M C;  4RYA A;  2FNC A;  1MXU A;  5JTY B;  3T9V A;  2RC7 A;  2AIX A;  4OMB A;  2PYY A;  3CG1 A;  4U4S A;  1USY E;  2R6G E;  1PBP A;  1UTB B;  1OMP A;  3L6G A;  3Q29 A;  2NOO A;  2H5Y A;  3PUW E;  1H43 A;  3FV1 A;  3EHS A;  4GXA A;  1MQI A;  3LR1 A;  1MQH A;  4G8M A;  4PQJ A;  1HSJ A;  1Y3Q A;  2Z8E A;  4TLM B;  4DCY A;  2O51 A;  4ESW A;  2QS4 A;  3M3F A;  2ZNT A;  1SDX A;  1QJM A;  3VLV A;  2Q8J A;  1MY1 A;  4F2Q A;  4GXS B;  4YMA A;  1MXX A;  1JNF A;  3PMW A;  1B3H A;  3OEN A;  4XTC Q;  3A3U A;  1SW2 A;  3F11 A;  5A5X A;  1OQH A;  4EXK A;  3LBS A;  1A55 A;  1FTJ A;  1NKX A;  2XXR A;  3E13 X;  2GH9 A;  2WKY A;  3MVX A;  2QSX A;  1LAF E;  2RCA A;  4KPT A;  3C32 A;  2ZXT A;  2X7P A;  3TEL A;  1GR2 A;  1FTO A;  1R9Q A;  4I1D A;  4NF8 B;  3SEW A;  4I8C A;  1T0K A;  5I2N A;  5DTB A;  4KD5 A;  3HN0 A;  2O7U A;  4ONY A;  3FGS A;  4Q5T A;  3E4R A;  3FXR A;  1B3G A;  2F5X A;  3R26 A;  5CRY A;  4F2O A;  4LZ8 A;  2AL5 A;  4EF1 A;  1AL3 A;  3HPI A;  3LSF B;  3UOR A;  3V5A A;  4Z7E A;  2AL4 A;  1IZ1 A;  4IGR A;  2YLN A;  4GL8 A;  3H7M A;  2YJP A;  1B9J A;  2H9B A;  4OXV A;  1GV8 A;  1B7H A;  3MZ1 A;  1UIU A;  3DM0 A;  5CC2 A;  2R9J A;  2RC9 A;  3QXM A;  4FAT A;  1ZKB A;  4PFT A;  4X1B A;  4YB7 A;  1B7Z A;  5FHM A;  4G8N A;  1IIT A;  3SES A;  4BDL A;  2ZYK A;  2I6E A;  1XHY A;  1PBQ A;  4FJP A;  4OZ9 A;  4NED A;  4ZEC A;  3RGY A;  5DVF A;  1B52 A;  2F6P A;  3C33 A;  1SBP A;  1OVB A;  4R74 A;  3LSL A;  3QSL A;  2DVZ A;  3CIJ A;  4NF6 A;  2GRV A;  4TQU Q;  1AIV A;  3K6U A;  1B2H A;  4XIG Q;  4G8H A;  4FIM A;  1FTL A;  4RNS A;  2Q2C A;  4KYD A;  3U72 A;  3ZKK A;  3LSX A;  1MY4 A;  3MWB A;  2I49 A;  1B46 A;  1FCK A;  1WVJ A;  3VV5 A;  5KDT B;  1J1N A;  1N0T A;  5IKB A;  1A40 A;  2V93 A;  3OO9 A;  4POW A;  4C1T A;  4G2Z A;  4RA1 A;  2F97 A;  5I57 B;  2XXT A;  1M5D A;  3TCH A;  1ZLQ A;  4R9G A;  4QFO A;  2DOJ A;  1GVC A;  4RXL A;  3C9H A;  1MY3 A;  5I84 A;  3O97 A;  5AA2 A;  2B3F A;  3H06 B;  3WAE A;  4H1X A;  4RY1 A;  4ZE8 A;  2ZMB A;  4LAT A;  4FEB A;  1DMB A;  4FEC A;  3I5O A;  4QHQ A;  1R1N A;  3TMG A;  2D21 A;  4YU0 A;  3BFT A;  1IXG A;  4U21 A;  4ND9 A;  2XXI A;  4BDM A;  3G3F A;  3QUJ A;  1IIW A;  1ZTY A;  4P0G A;  4RJZ A;  2GHA A;  2DWI A;  3I6V A;  3L6H A;  1B1X A;  1EU8 A;  3G3K A;  4GL0 A;  5LOM A;  1FQF A;  5I2K A;  2G93 A;  4QF9 A;  3IO4 A;  2O6A A;  4LP2 B;  5CBR A;  1O63 A;  3TQW A;  1Y9U A;  1II5 A;  2XD3 A;  2I3V A;  3ZKL A;  3S9E A;  4JDF A;  1B32 A;  4QFN A;  5CMC A;  2HCA A;  2F7C A;  3FAT A;  4BLA A;  4H67 A;  1P1W A;  1I6A A;  5I58 B;  5ITP A;  1USY H;  3H6T A;  4OEV A;  2DXY A;  4PFY A;  4P11 A;  4OEN A;  5DVJ A;  3FIR A;  3SEV A;  4QFK A;  2ONK E;  4LVQ A;  5AA1 A;  4IB2 A;  4JWY A;  4MLQ A;  4H8I A;  1A54 A;  1VR5 A;  3ILT B;  4KFQ A;  5DYH A;  3HCQ A;  3QYT A;  3PUZ E;  3LC8 A;  1QUK A;  3KEI A;  4HW8 A;  1UTH B;  2PBW A;  2W7Y A;  4WED A;  3QK6 A;  2B65 A;  1PC3 A;  2XXX A;  1A99 A;  2ONR A;  1LBC A;  1L5T A;  1SYI A;  4YMB A;  1M5B A;  2OJT A;  2VD3 A;  1MH3 A;  1PB9 A;  1IUD A;  2QS2 A;  4OQO A;  4DXC A;  5JTY A;  3FD3 A;  5AA4 A;  4O3B A;  1FTM A;  1MDP 1;  4GD5 A;  3MPL A;  4OTE A;  3M3K A;  1LAX A;  2V84 A;  4KI0 E;  4R75 A;  4IO5 A;  1PB7 A;  5H8Q B;  1ZMG A;  1PB8 A;  3O9P A;  3K6W A;  3TTL A;  3RTF B;  3H6U A;  3ONM A;  1B4H A;  1SD3 A;  1UTB A;  4NMY A;  4QSE A;  4QFL A;  3OO6 A;  3CFL A;  2I4B A;  1JVX A;  4C1U A;  2I4C A;  2RIN A;  1N84 A;  3W9W A;  3SER A;  4IO3 A;  3K2D A;  4KHZ E;  3C31 A;  5JEI A;  3CR9 A;  3OO8 A;  4O3A A;  2O69 A;  1LCF A;  1IXH A;  2LAO A;  1Y1M A;  2ZNU A;  2Z23 A;  3HV1 A;  3KSJ A;  4GVO A;  4ZEI A;  2I0C A;  3RY3 A;  3IR1 A;  4YAH X;  4EQ7 A;  1A8E A;  3OSQ A;  2XXQ A;  3MC2 A;  2O7I A;  1MQD A;  3QAX A;  3DP6 A;  3K1N A;  3Q25 A;  4KQP A;  5BUU A;  4OFL A;  3GBA A;  2HAV A;  5TPA B;  4GLI A;  1HSE A;  3CFX A;  3H6V A;  3FVN A;  3FV2 A;  3R6U A;  3TAJ A;  4F29 A;  3PUX E;  1B3L A;  1GGG A;  3K0V A;  4NF8 A;  4KYS A;  3MP8 A;  2XXV A;  1DSN A;  3VXC A;  1SVX B;  2Z22 A;  4RPN A;  4R73 A;  3UA8 A;  4H0W A;  3WAF A;  5ICQ A;  2HAU A;  3KOT A;  3GBB A;  1TFA A;  1B3F A;  1MPC A;  4AQ4 A;  4NF4 B;  2OK2 A;  1ATG A;  3PPR A;  4X48 A;  5ICT A;  4ZE9 A;  1SQY A;  2QL3 A;  3TEP A;  4U23 A;  3FXQ A;  1H45 A;  5H8S A;  1QW0 A;  4H65 A;  5KCJ A;  4F3G A;  5TP9 B;  4OES A;  3E3K A;  4ELO A;  4F22 A;  3TQL A;  5IAI A;  2G29 A;  3V83 A;  2F6G A;  2HEU A;  3Q26 A;  2REJ A;  3T22 A;  1TWY A;  2Y84 A;  2H25 A;  3PUV E;  4MF3 A;  2VHA A;  5I56 B;  1URG A;  3EHU A;  1HSL A;  4G68 B;  1MG1 A;  1RYX A;  3N6T A;  1B5H A;  1ZIU A;  3K6X A;  3CSB A;  5FTH A;  5H8N B;  3EPE A;  3TFL A;  2H98 A;  1UIV A;  1NH7 A;  1EZO A;  1NNP A;  5KDT A;  1NL5 A;  3IK6 B;  3OO7 A;  5H8H B;  2B3B A;  4YB5 A;  4LUB A;  3O28 A;  5F1Q A;  1MDQ A;  2QMW A;  3U92 A;  4F1U A;  3OSR A;  1S50 A;  4GWO A;  3O66 A;  3OOA A;  3C34 A;  3KOS A;  3VFJ A;  2QS3 A;  1EZP A;  2UVJ A;  1B0H A;  5FTI A;  1D3K A;  4Z0I A;  5I59 B;  2I58 A;  4N6P A;  4I9D A;  3MZB A;  1MPD A;  3Q28 A;  1SW5 A;  3IL1 B;  3UP9 A;  2FYI A;  3HST A;  3TTK A;  3OD7 A;  1VFD A;  2ZYM A;  3PV0 E;  3B7D A;  3VDF A;  1I6Q A;  2I3W A;  5FHO A;  4ECF A;  4PP0 A;  5KZT A;  4ELQ A;  4ZS9 A;  2VP1 A;  4DXB A;  4O3C A;  3VVF A;  1N7W A;  1AH5 A;  2Q2A A;  1F9B A;  3MBP A;  3O2A A;  4X9T A;  1KWH A;  4JB7 A;  5HM4 B;  3MAM A;  3ECR A;  4G4P A;  1R9L A;  4OHN A;  4LA9 A;  2XXY A;  4JXI A;  4ZDM A;  3JYR A;  4NE4 A;  3PPP A;  3UN6 A;  1Y4T A;  3EQ1 A;  4FAJ A;  1URS A;  2V3Q A;  3D4C A;  3TZA A;  1MXZ A;  1LFH A;  3RLF E;  5DEX B;  4ESX A;  2ZYN A;  4IO6 A;  4NWD A;  4R9F A;  3V8X B;  1YCJ A;  3MVY A;  3U1O A;  3TTN A;  2HXW A;  3HO7 A;  3OXN A;  2QPQ A;  4I62 A;  2ONS A;  3RN8 A;  1H76 A;  3M3L A;  1CB6 A;  3RTW B;  3H03 A;  2PT2 A;  1POY 1;  1P1U A;  1MM6 A;  3RNN A;  3KBR A;  1UTH A;  3TPA A;  4IO7 A;  1IXI A;  2F36 A;  4RK9 A;  4EDP A;  1B40 A;  1N76 A;  3JZJ A;  1Y4C A;  3KZG A;  1NFT A;  4WKM A;  4POX A;  1B5J A;  1MXW A;  1N04 A;  5CI5 A;  3N26 A;  3RT8 A;  3IOT A;  2THI A;  4XKN A;  1OIB A;  5H8F B;  1FW0 A;  3FVG A;  2F8D A;  4LQ2 A;  1BIY A;  3KJT A;  3CSG A;  5CMB A;  2DE3 A;  5H8Q A;  1Q35 A;  3IX1 A;  2NXO A;  1BLF A;  3TCF A;  1NNT A;  2D5W A;  4MBP A;  1S7Y A;  3SEX A;  3O6G A;  3O6I A;  4FED A;  4OVJ A;  3OEM A;  4IY5 A;  2I48 A;  1MPB A;  2DWH A;  2ANJ A;  1XVX A;  4NWC A;  2RCB A;  2OWS A;  5F7V A;  4U22 A;  4QSD A;  4DXU A;  1MS7 A;  4U1O A;  5CMM A;  2QS1 A;  3QIM A;  4AB5 A;  1D9Y A;  3JV9 A;  2CZL A;  3SET A;  3H4Z A;  4NF5 B;  1IXC A;  1FQE A;  5TPA A;  5M2V A;  5BWJ A;  3A3C A;  2I0B A;  3B6T A;  5DVI A;  4RPO A;  4EQB A;  1TFD A;  2QJE A;  3CG3 A;  4YIC A;  1MH4 A;  1DPE A;  3PPN A;  3PMV A;  1QUL A;  4MLV A;  1B05 A;  3VXB A;  3THI A;  4H8J A;  2OLB A;  5L9O A;  3FJM A;  4OEU A;  2H99 A;  3FJ7 A;  3MP1 A;  5HPQ A;  5AA2 B;  3I3V A;  2XXW A;  4NF4 A;  4OFJ A;  3H3G A;  2ALU A;  4BDO A;  4E0X A;  3N94 A;  4LZ5 A;  1LFG A;  4DCX A;  3T66 A;  2V3T A;  4R6H A;  4IGT A;  2QMX A;  2F34 A;  4AB6 A;  1LLS A;  3RQT A;  1QKA A;  1URD A;  4F3B A;  4G68 C;  4UA8 A;  1OLC A;  4IO4 A;  3N6U A;  4XKP A;  1LBB A;  4GRK A;  4OYV A;  3FVK A;  4RK2 A;  3Q27 A;  5TP9 A;  4R2B A;  1Y1Z A;  3MZ9 A;  4KR5 A;  1ZU0 A;  2O68 A;  2DWA A;  3FVO A;  2P2A A;  1UQW A;  3LUY A;  4U1Z A;  4PE5 B;  1QUJ A;  3IOW A;  4JWX A;  1YTV A;  3O6H A;  1N3X A;  5I56 A;  4G68 A;  4F1V A;  3KFM A;  3FJG A;  4BDR A;  5K2X A;  2VOZ A;  5TU0 A;  1B7U A;  3TYH A;  3T9X B;  2UYF A;  3KN8 A;  5H8N A;  2UVH A;  3DLN A;  1DOT A;  2DE4 A;  3KGC A;  1JVY A;  3TUS A;  3KG2 A;  2E0S A;  5H8H A;  1PEB A;  1QVS A;  3N5L A;  3C4M A;  3GZG A;  3CFZ A;  4F19 A;  2RKM A;  3EF7 A;  3PU5 A;  4ZEF A;  1B3E A;  4KCD A;  1D4N A;  1A7L A;  4GQO A;  1H3D A;  1FQA A;  5I59 A;  3CRB A;  3PD9 A;  4DE8 A;  1US4 A;  3T96 B;  3V89 B;  1Q1K A;  3KN3 A;  1JEV A;  1XOC A;  3ZS6 A;  3MUQ A;  4HS7 A;  2V25 A;  3K01 A;  3PD8 A;  4TOZ A;  4EQ9 A;  3P7I A;  3ODB A;  3S9L C;  4JWO A;  5J1D A;  1M5F A;  5AA4 B;  4UAC A;  4EUO A;  1H44 A;  4R6K A;  2REG A;  3G7W A;  1SYH A;  1GTK A;  1O64 A;  2Y7K A;  4MH5 A;  2A5T B;  5L9M A;  3IB1 A;  4OFO A;  3RT6 B;  2HFB A;  2QRY A;  2Z8F A;  4HCW A;  1ZJL A;  3LSW A;  3IB2 A;  2P1S A;  1NNF A;  1WOD A;  3UK4 A;  3UIF A;  2DQV A;  3PPQ A;  1FQB A;  1FQD A;  2ZYO A;  3QUF A;  1ZBM A;  1MQJ A;  2YPN A;  3PUY E;  5DEX A;  4LZ7 A;  4KYE A;  3OEL A;  2HZK A;  2DYX A;  2PT1 A;  3MVZ A;  3MJN A;  4Q8R A;  5L9S A;  1VSO A;  4BDQ A;  4ELP A;  5JK4 A;  1JQF A;  3U8Q A;  1B51 A;  5I57 A;  1MRP A;  1Y3P A;  2NVU B;  2XXU A;  1FQC A;  2IA4 A;  4OER A;  4QRZ A;  4THI A;  2P0S A;  2Q88 A;  4N07 A;  2O1L A;  4F1Y A;  2X7Q A;  4GFR A;  1LAG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...