2XYHA

Caspase-3:cas60254719
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xyhA00
4EHKA 4QUBA 4EJFA 3D6MA 2H54A 2C2OA 4QUIA 3V4OA 5IABA 4N6GA 2C2KA 2H65A 5I9BA 4DCPA 4D3XA 2FP3A 2Y1LA 1QX3A 4N7MA 4QUHA 1K86A 1RHRA 4NOMA 5IASA 3R6LA 3PCXA 1RWKA 2HBQA 2J33A 2HBRA 1RWNA 2K7ZA 3KJQA 4EHHA 4DCJA 5IBPA 1K88A 1RHKA 3KJFA 2CNOA 4QUGA 4QUJA 1F1JA 4FEAA 4N5DA 1M72A 1KMCA 4FDLA 1GFWA 2HBZA 4PS1A 1QTNA 4HVAA 3IBCA 4ZVPA 1SC1A 4FXOA 4EHFA 3NKFA 1CVRA 2C2MA 1SC3A 4ZVOA 3H11B 4JJ8A 1SHLA 1RWVA 1I3OA 3OD5A 5JFTA 1I51A 4I1RA 5LU8A 3H0EA 4IYRA 4AW9A 3V4LA 2H5IA 4D3YA 3S8EA 2J30A 2HBYA 5IC6A 2H4YA 2QLBA 2XYGA 3UOAB 4LSZA 3V6LA 4PS0A 3PD1A 5K20A 3GJRA 3R5JA 2WDPA 5IARA 1SHJA 2QL7A 4NBKA 5IC4A 2FUNB 4NBLA 1F9EA 5IAEA 5LU9A 3E4CA 3DEIA 2CDRA 5IBRA 1RWMA 4ZVUA 3D6FA 1ICEA 1RHUA 4JR0A 4N7JA 2CNNA 3H13A 4JB8A 1RE1A 2QL5A 2XYPA 2NN3C 1NMQA 4QU9A 3V55A 3GJSA 3DEHA 3R7SA 3NR2A 1JXQA 3P4UA 4NOJA 4ZVQA 1BMQA 2QLJA 3SIRA 4DCOA 4HQ0A 1RWXA 2C1EA 5H0IA 3S70A 4JJEA 3P45A 4N6NA 2XYHA 3EDRA 4JQZA 4QU8A 1NMSA 1I4EB 4QUEA 4HQRA 1RWWA 3V6MA 4N6OA 3IBFA 4ZVSA 4ZVRA 4ZVTA 2J31A 1PYOA 3H11A 2FQQA 2CNKA 2QLFA 3RJMA 4QUDA 2H51A 2J32A 4EHLA 2DKOA 3ITNA 4I1PA 3EDQA 4JR1A 3R7BA 4IEFB 1RHQA 1NMEA 1I4OA 2XZTA 5IAGA 4JR2A 4NOKA 3QNWA 4EHAA 3GJTA 3NS7A 2P2CA 3SIPA 4AWAA 3DEJA 3BIJA 2CJYA 3PD0A 1IBCA 5LUAA 5LUBA 2H5JA 1QDUA 2C2ZA 4EHNA 4JJ7A 4NOLA 1RHJA 4QUAA 5IAKA 1NW9B 2CJXA 4QULA 5IBCA 1CP3A 1PAUA 1RWPA 2XZDA 4M9RA 5IAJA 4QTYA 2H48A 3H1PA 2CNLA 1RWOA 4JQYA 2QL9A 4NBNA 2AR9A 3R6GA 4EHDA 3D6HA 4FGUA 4AWBA 3K7EA 3KJNA 1RHMA 3UO8B 1GQFA 2Y0BA 4QU0A 4QU5A 3R7NA 4PRZA 4QTXA 2H4WA 3GJQA 3DEKA 3R5KA 1SC4A 5I9TA 5IANA 4D3ZA 4PRYA 3V3KA
chains in the Genus database with same CATH superfamily
2IUFA 3TDMA 4TROA 5F12A 2VNAA 1Z45A 1G19A 3R7LA 3AI3A 1B1CA 4O1IA 1JEJA 5JU6A 1VFNA 2AHOA 4QDJA 1Q6ZA 1TF7A 3B7PA 3OEED 4DDMA 2VBIA 1U2RA 4DRXB 1NY6A 3O4VA 4PO9A 5B1IA 5CBKA 1WXFA 4DB4A 2EX4A 2H52A 2XA1A 2Q99A 2BR5A 3ER8A 1ZH0A 5KSWB 2RGGA 2PUEA 1X7YB 4FGLA 4D3FA 2Y0CA 1KBQA 2VSNA 3FFXA 5HG0A 4YMGA 3V8NA 5JISA 2H0QA 1CQZA 2VJCA 3GEHA 3NHRA 2VEOA 3ZEIA 1RM0A 1R0RE 3TYXA 2B21A 1QAMA 5G53C 3OJEA 1UPBA 4YONB 3IP8A 1LC3A 4EHFA 4ERNA 3AJ9A 1WA5A 1L5RA 1L5YA 1SCDA 2J9RA 1DXQA 1TLTA 2XMPA 2ZUVA 2KLHA 3OPXA 3QK7A 3QOXA 4B80A 4ZDKA 3GFRA 3TKYA 4B4VA 2FUCA 4OYLA 3S2GA 1AMUA 2PO5A 3HR8A 4V2IA 1IAQA 4B6PA 3KDAA 5BV8A 1DAOA 4X66B 1KBOA 2CVHA 1U6JA 4HEA1 2XWBF 4LQDA 4EI7A 3EZ9A 3GNLA 5JS7A 1G17A 3L0IB 3D5QA 4QNRA 2BTQB 3VDQA 1P9RA 3VPGA 3LY7A 2VTEA 3EH1A 3DAHA 3NYQA 3IXQA 1G8HA 4ZZIA 2OBBA 5KREA 4YRIA 2GAAA 4DRZA 2QL5A 1BHO1 1LPNA 1T4CB 2YZGA 4GO1A 2YS7A 3H1GA 3VR5D 2F9MA 2AEFA 2YQZA 3HCPA 1ESEA 4TMWA 3DQQA 5KAPA 4GLFA 4ZKEA 1QQ6A 3ZE0B 1KPIA 3NHSA 3OSUA 1JXMA 2MYPA 4Q21A 3V32A 4EENA 3UV3A 3S1AA 4ZYVA 4MO9A 2XE7A 3M5CA 5D1NA 3RBAA 3D4OA 5AW3A 5C7YA 4YP1A 2AYZA 2IS4A 2CBGA 3DXZA 3T1HB 4B4DA 3G2OA 4HEJA 4CV0A 1YIDA 1IXYA 5DN9A 2PGDA 2J32A 1YFZA 4LF5B 2VUTA 2ZTMA 4DCVA 2QBYA 3T3NA 2OOSA 3HVKA 1H8EA 3DMHA 3S8YA 3QOFA 1HFKA 2ABWA 2NW6A 2FPIB 3L84A 4YP5A 3F73A 5AVKA 1XEAA 2FFRA 4HLQB 1RLOA 4K46A 1UKVY 1P5RA 4TTSA 3I9KA 1VG1A 3U7GA 2G5TA 2PXCA 1P9LA 4F4IA 2GZAA 4LMPA 2RHJA 4WL0A 2FR8C 3ENVA 3LS2A 3PE6A 1CHNA 1LLUA 1WXQA 4FYYA 3W90A 3KJEA 1WUJS 4RLSA 5ENZA 4XSGA 3CUEF 4W5RA 1RWOA 1M8GA 1V16B 2K87A 2MSWA 2WNHA 1OVMA 3OLWA 1KL7A 1DJLA 1JX6A 2BUCA 1SVIA 4ITVA 5IT0A 1D04A 1IG0A 2R6HA 1Z7BA 1E1MA 3ZCPA 1M2EA 3N3AC 4ZI3A 3K0EA 4KUHA 3NOXA 5HHTA 4R2XA 2ODTX 2OQIA 4OJKA 3STVA 2WU1A 3H3FA 3TW6A 1FNNA 5L7YA 1G6OA 5FOWA 4EVRA 1NJ8A 1N0HA 4YJHA 1AKVA 2X9LA 5LP6F 5KVVA 4HGRA 5EOVA 1P0FA 2C5FA 1G63A 1Z74A 2GXSA 1KETA 3CGGA 4HXEB 3WWDA 4F2GA 2KX7A 1JLRA 2P9FA 3BG5A 3ONEA 1K86A 3PEUA 4FLFA 3QU9A 4FE3A 3BA1A 1FQOA 2OGUA 3UMMA 1GRNA 5J2TB 2P9JA 2CWDA 2JFGA 3QTBA 3DVQX 1TQ2A 2GPBA 3A6JA 2NQTA 3N2EA 4KQIA 2D8MA 2GF9A 4GSLA 4URFA 3EPLA 2H1OA 1CY4A 1G8KA 5J47A 4P8RA 4AT1A 2IF2A 4C0QC 3DLHA 3ZJUA 2I2XB 3C6MA 3CSDA 2EKQA 2XUAA 4I8DA 1F2UB 1G42A 1H23A 1UPTA 2W6QA 3H9UA 4ID9A 1CUFA 1UBCA 2FQXA 2ZIAA 4ZOEA 1R10A 2CEKA 1OYOA 4QPCA 2H59A 3LYUA 1RQNA 1XZNA 3LBYA 4L72A 1Z63A 1GZVA 3PWKA 4Q24A 4ACBA 2XMGA 4PNHA 1X1CA 4G85A 3EDYA 1P72A 2AC7A 2H08A 4Z6KA 1N2CA 1MT3A 2G40A 3NAMA 2TYSB 1CULC 2W6MA 4C88A 5DGIA 4Q3CA 5AW0A 2IBMA 1YTUA 4UULA 1WZNA 4PLCA 5CURA 4D99A 1QP0A 4YIKA 1BCRA 1CDEA 1D2MA 3DE3X 4R9SA 3M6WA 1J4AA 4II2A 3TJZA 5HM8A 3MB8A 1R6UA 4P22A 4Y6SA 4JKYA 5IJAA 3W6UA 1NONA 3IV6A 1ABBA 1VJ5A 3OIGA 1NPDA 4ZKDA 3KXLA 5BN4B 3UK7A 1UBSB 1TK9A 3LLMA 4IXWA 4NCHA 3RVJA 5BWCA 4REMA 1T4GA 5LJLA 1E79A 2VQSA 2IZ5A 3HGMA 4DKXA 2HHCA 3SFTA 5AUNB 5AUPB 4EWLA 1P1BA 1NFFA 1SD1A 3OIYA 2QNIA 3DVLA 4KX5A 3K8ZA 4MPRA 4HUQA 1EUDB 4YRAA 4U7DA 4GNRA 3GP8A 1XNGA 2IHJA 4N48A 4M1YA 4Q7LA 3C5EA 4NTZA 3LCJA 1Z6PA 2ENUA 2ZBRA 1B23P 5HQJA 5EJGA 4O6VA 1IRXA 3I34X 1FLDA 2QP4A 2DKOA 3GFSA 5DT2A 2WJ4A 2XUGA 4A15A 3C7CB 4OHWA 4AP5A 3QKTA 4FBGA 3CTPA 1W9HA 4Q4AB 2AB0A 3ANMA 3LQ4A 2VRWA 4EB8A 1IVSA 1JNYA 1V1RB 4CKCA 4WKGA 2IHTA 4BQSA 2W2KB 3P9IA 3UN1A 3IEVA 4JI0B 3GFGA 1U0TA 4LXUA 2JGJA 2R7KA 3DL0A 4M8NE 2WLTA 2DOKA 5CLHA 1UWLA 2SCUA 1BMFD 4O2AB 1XZHA 4DG5A 1MW9X 1CY6A 3W2FA 1G8JA 4Z0NA 2F8SA 4AO8A 3CV3A 1YS7A 5D5QA 3B2NA 1V71A 4JQYA 1QMPA 2WE7A 1A3CA 3GEGA 4TUYA 4C7XA 4F3YA 1IK6A 3PZBA 1P2UA 2QVYX 2IFTA 4X94A 1JQEA 3IPXA 5F7ZA 3WL3A 2H4WA 4FQ5A 1KO5A 2DAPA 4MS1B 1ATIA 1KK2A 2GAIA 1T34A 3NAZA 3NG1A 4TMVA 3MPOA 4UFOA 3WBKA 4J76A 4D4JA 5KTNA 3F7NA 1KO8A 3FHCB 3AF2A 3P32A 3P8ZA 3ZHUA 4B81A 3QA3E 1CY8A 3Q3HA 4J43A 4Z2AA 4CLOB 4RSHA 1G5PA 1N5RA 2CMDA 2D6FA 3DDCA 1M75A 5BW6B 2QZPA 3MS4A 2G17A 2D2IA 2REOA 3EIFA 5KX5A 4I4CA 2QUIA 3CRW1 2Y4NA 2V7GA 2IUEA 3RSOA 5EP3A 1T4DA 5G3ZA 4DSNA 4RD0A 2FUEA 3L7OA 2FLWA 1TFUA 1BDJA 1JE0A 4MVJD 4XI9A 1OBOA 1CKEA 1DC3A 1HTTA 1RQ2A 1ULTA 2QNBA 3I6BA 2HBZA 4EOGA 4P3PA 2F3UA 3ECAA 1GSIA 3JWIA 2Q5CA 3HS3A 1BS1A 4MGKR 1KAGA 5EJ9A 4MUKA 4MNTA 3LDFA 4MDFA 4ZO9A 2WSBA 4R41A 3ZH9B 4KAFA 3M6IA 3OJ0A 4KE8A 3LBFA 1PJAA 1CUXA 1LKZA 3PXDA 1IZ0A 1DO8A 1NQOA 1DQYA 3GFVA 4ITUA 4BO8A 3VYTB 2JFYA 3A04A 1YMQA 5JCJA 2QLBA 3IHTA 3OZGA 2H11A 3R7WB 2PCLA 3ROTA 3WOVA 3H83A 2XB9A 1RLMA 3PF8A 2O59A 2J4DA 2O06A 2XQVA 3VH1A 4CG3A 3FZGA 4B2YA 1S01A 1X70A 3U4QA 2GBGA 1O2DA 1WE2A 1XUOA 3ECSA 5GV8A 1HUQA 4M0PA 1HMYA 1ICEA 2J41A 4D5GA 5JHGB 2OZLB 2G0AA 1GGJA 3H13A 1NQVA 4J3JA 5E0OA 3A1DA 1TJ4A 3HZOA 3ND9A 1JEAA 5EIFA 1IJKA 3A05A 3OMLA 3QHPA 4QC2A 3DEHA 4NZ9A 2RAPA 1L1RA 3PJGA 1N0VC 4OO3A 5CDGA 1GVNB 3UWMA 4RY0A 1FYWA 4DLKA 4US1R 4XDZA 3KB2A 1UC4B 3RUAA 5BMOA 4BZZA 3ND7A 4EG3A 2P9CA 4PY2A 5LD2B 5D8DA 2NUBA 3CVOA 5J40A 4LSMA 5FPHA 5JSKA 5KEIA 2PO7A 3VHLB 1JUDA 5G0SA 3GW8A 1MBZA 2ZYAA 3H11A 4H2DA 1FFAA 4RYLA 4W63A 3UV7A 2ZDQA 5IYZB 2BBTA 5ECDA 1U8EA 1GPH1 2OENG 2GHTA 3M34A 3N07A 1J2UA 2VBFA 1ECLA 1RJFA 1U7ZA 2R48A 2X2OA 2J9XB 3E48A 3P9CA 4UQOA 4WI1A 1HX7A 4BFSA 4URHA 3HRIA 2Q6IA 3FYUC 3SU8A 3WBBA 4CM3A 3COZA 4RIFA 2XBMA 4IQFA 4F1KA 4UNIA 4S0ZA 1H8HA 4DR1B 1TO6A 3FMVA 2CXPA 1TYZA 1YZQA 1GFZA 2CE2X 4Y3UA 3S3TA 1ODSA 4UD6A 4EO4A 2JLVA 2PLFA 2HX1A 4JBIA 3AFOA 4NICA 5AJUA 5F2OA 2ZZKA 4BOYA 2ZWMA 2NZJA 2XUFA 4WADA 4M9RA 2Q2NA 4ATNA 3ZE9A 2PQ6A 2WIBA 3ICPA 5LOVA 4IMIB 3BJMA 4IHJB 3SHWA 4O4JF 4DXAA 5HIKA 4YMTA 2XSZD 2PGJA 3NU1A 4D42A 2WTUA 3LUHA 5AWFC 3TH5A 3GJQA 3HFJA 3PDUA 4YUAA 2BW0A 3O3MB 3KYBA 4MI9A 5L4LA 2XKKA 3OT4A 3S2FA 1JQ5A 3PXEA 5I8ZA 4R68A 1FDRA 3BJEA 3T41A 4OHVA 4MOWA 4L3OA 1CZLA 2HLDA 1E9FA 2RH5A 1RYHA 2YHBA 1TPYA 2RCNA 3A9RA 2GESA 4GQAA 4WFQA 4ZN6A 1RI2A 1B43A 2POCA 2OXRA 1USGA 3BZWA 5B3KA 1H93A 4PO8A 4B85A 3L3BA 4X7BA 3QOWA 2R00A 2PPVA 3ESDA 1UQRA 3JQFC 1SVSA 3ZHVA 4Z49A 5AESA 3ZZTA 3J80A 2CNOA 4IXTA 4MI6A 2QD1A 1XIVA 3KRTA 3CNOA 4GEGA 2PX0A 4YAEA 3HA5A 5AJTA 3ZLVA 4KFCA 3GH1A 3ZWWA 4B44A 1KNQA 4QEZA 3KXIA 4D9GA 4C0JA 5IX8A 5JSUA 4XTRA 3RF6A 1N1MA 2CYCA 2RONA 2YMMA 3FE2A 4JZYA 3MPUA 4MW9A 4L73A 3SYLA 4OIFA 1XQ1A 2DSNA 2ZSJA 2NUPB 4RLFA 2AIRA 4ZVOA 3T8YA 4ESVA 3C8MA 4XPIA 1W2HA 1YH3A 4GGPA 2DT8A 3NIGB 5FT9A 1MTZA 4WH0A 4BPBA 3K70D 2AOXA 1OPXA 1VMAA 3UOWA 4M4SA 1MQ9A 2PG3A 5BR4A 2ATIA 2I6QA 4HQ6A 5CVJA 1PD0A 4MGEA 4W5TA 1RXUA 1XB2A 4AY2A 3GLIE 1F8XA 1F8GA 1CRZA 3TTXA 1VJ1A 1B0AA 1TIKA 4XA8A 2YXNA 1BGXT 3VSAA 4MWGA 4A26A 3I6QA 4CDGA 3ICEA 2HQOA 1GKIA 3ODGA 3QY0A 5CB0A 1L4FA 4OXRA 3U49A 1I6MA 2UAGA 2ZREA 1YA8A 3MG9A 1NF8A 1G5RA 1UFOA 4XDHA 2CUKA 3FROA 5DYWA 3SLGA 3RWMB 2V7XA 2WAYA 4FHCA 3T5DA 2Q50A 3GT4A 4DXDA 2Z1NA 1QPZA 4BMXA 4LZLA 4YRRA 3HR4A 3OQ6A 3KFVA 1GA6A 1ULHA 2VHZA 3SEQA 3SWWA 2WK1A 2DWUA 3DTVB 4DM4A 2C1XA 2R87A 1SVMA 1CUUA 1M76A 5EXPA 1NNUA 1SXJA 4DFDA 2QPOA 1E4EA 1T3SA 1XPOA 3I53A 2O2HA 3DZBA 4H16A 1KARA 6LDHA 4IPTA 3RU3A 5TMDA 2NVWA 5B57C 5HXAA 1XA0A 5G41A 1R0ZA 1PWZA 1S8OA 1IN8A 2QN2A 3L1JA 3SIWA 4F86A 2O3UA 1J49A 3DWFA 2CLMB 4RS3A 4YI3A 3T7RA 1OTYA 1ZX1A 1W88B 4D9JA 1H9CA 2WWXA 2QE7A 1TQ6A 1ORWA 4KYTA 5AK3A 3TRHA 2BEVB 2JJ2D 1F0YA 1MABA 4IUBS 1A9SA 4EY6A 2EGGA 2XNHA 4IF4A 2Q6OA 4PYQA 1E1YA 2R65A 3F74A 3VZCA 4C0LA 2PUAA 1ABEA 3IEUA 5E6SB 3QQPA 3OPMA 2EGHA 3L01A 1NOIA 2VJMA 2VQ3A 4US0R 3GUVA 3R7NA 5EE5B 5CDUA 2VXBA 3FMIA 4JC5A 3EGDB 3I5XA 2AN3A 3UV6A 3KJZA 1CY0A 1D4ZA 1KP2A 1DC7A 1MVNA 1YGYA 2R25B 3HJRA 4RVDA 1BRTA 2NOAA 2MYNA 5B4UA 4FGSA 3VX3A 4ZANA 3FFTA 3H87A 4EX7A 1CZUA 3TECE 3C74A 4LRYA 5ENDA 1A88A 4LYHA 5AXCA 1C7QA 1SUEA 3G79A 2I87A 4LHZA 4S1OA 5CPFA 5DGHA 1JEYA 2OQVA 4KI0A 5I9BA 1ZWKA 2P41A 1F38A 2QYSA 5I9SA 1E3QA 3IUBA 3OF2A 4EPRA 3SQLA 3UIEA 2Y1GA 1UXHA 6GPBA 1J2JA 1RLUA 2N0SA 2E4XA 2P79A 4J9UE 3NT5A 2BEUB 1UKZA 4PYJA 2C84A 2WILA 5IW8A 3UJ7A 2GX6A 4QLOA 5TQ0A 1SVOA 3GBVA 4HAVA 2ZBEA 4ZCTA 4HEA6 4LNAA 4NZOA 1TT5A 1XMVA 2G8LA 3KJHA 3LOUA 3IVMA 3M7IA 1BW9B 2VH5R 2MDTA 3AHIA 4KZKA 3HUEA 4N3CA 4H4CA 1LNZA 4C4XA 4TYYA 4X8HA 1ZAKA 4NE7A 3A26A 5ITZA 5DISB 4LTNA 4AS2A 1JEQB 3BGVA 4FR2A 1X19A 4Y2QA 5FQOA 1K7YA 2VHVA 3EIWA 3CSSA 3MJRA 5TEWA 3ZJTA 4HSGA 1Y9DA 2WPNA 4HDRB 1I51A 3E5RA 4PZ9A 4Z3DA 1D4FA 3QKUA 2C5SA 2PNJA 1VDZA 1GUDA 2I80A 5DB4A 2Q9AA 1T1RA 1Z7EA 4GMHA 1QHEA 2OFWA 4BQOA 1ZOPA 2QQGA 2FAXA 1PX2A 5E6UA 1HQCA 3L0SA 3DL2A 1KFJB 3IR7A 3T5PA 1QK3A 3G0OA 1ESZA 1NUPA 1W6RA 1P39A 1R5BA 3PGKA 3FCCA 4KACA 4MMXB 1LDBA 4BRUA 5C9ZA 4Z4HA 2C57A 3DE7X 2TMGA 2VP2A 3PB3A 4OA5A 4IM7A 2Y1DA 5ILOA 3FIJA 2HJWA 2PA3A 3TZQA 1XDUA 4JENA 1D4OA 1T0UA 4WECA 2W8BA 5BSWA 1T29A 3UJ6A 4NYJR 5ALUA 1T2VA 1QHYA 1PWYE 4FOTA 4XWKA 1EFUA 2DKFA 1DKOA 4E2ZA 1B42A 2HQSA 5J2UF 4YUYA 3GAAA 2NVUA 1UBLS 3CY6A 3WHKA 1EFAA 1QK5A 4FW9A 2QVXX 5J63A 3SHQA 4YQYA 1QPBA 1U7UA 3TE7A 3VSEA 3HJFA 3OZDA 1CZHA 3QV1A 1G2IA 4B48A 3EYWA 3D5TA 2GN8A 2QX6A 5EVJA 4L8FA 2YIMA 4UCQA 5EI5A 3V1UA 3FYUB 4GUDA 4OXIA 1C7JA 3ZIUA 3UJPA 4U2CA 4CEIA 4F85A 1I3MA 2XZPA 1A9QA 2W2MA 4GE3A 4IEFB 4PXAA 2CXSA 2NQ8A 4QUKA 3RASA 4LVNA 3Q8XB 1P62B 4KGXA 4WCDA 2VZ8A 4RANA 4TTJA 5IF3A 5KNDA 4B3XA 2AFRA 2GARA 2VYFA 1T8UA 2AWOA 1C0IA 2FPPB 3OKAA 1WQ3A 5TRTA 4ENTA 3DWGA 5A3JA 2EJTA 2VPTA 2ZPAA 2VIIA 5GJWC 1V7ZA 3M1YA 4RD1A 3Q4GA 4I1YA 1PBNA 3B8HA 3U4GA 4K9SA 1NG9A 1DBRA 4IKOA 1Z39A 5CLFA 1U2EA 1DSSG 1YS2X 1YUMA 1U8XX 3L40A 5EAIA 3U7QA 4BIIA 4YQFA 4X6YA 2OSVA 3K6SA 1QGZA 1IL0A 2HEGA 5BP7A 2LDXA 2CXUA 2DM6A 4MKFA 3FYDA 4RADA 2CVPA 2H3HA 3BWCA 2BBSA 4PFQA 3O3CA 3CIFA 2HA4A 2V7VA 5IM4A 3N59A 5DPMA 2C97A 4DS3A 3EXG1 1VIVA 2I6TA 3E35A 4LDJA 4OG2A 5JD4A 2TRSB 5DTJA 1SA0A 3WBFA 1G16A 1E5VA 1YAJA 1F4VA 4M7PA 4LFBB 1GCIA 1YT5A 4WERA 1OWOA 1UKYA 3MJVA 3CJTA 4Z4QA 3MJDA 1OA0A 4LF4B 2K2QB 1NBIA 3DHVA 3GVCA 3QI7A 3VZQA 4DC1A 4AY6A 5THQA 1NTOA 3FCEA 4DG9A 1EDZA 1O58A 2Y9MB 5JXHA 1QV9A 1IU9A 4QG7A 5FTJA 3LBIA 1YASA 4GKAA 3ASVA 1YVDA 2IDMA 1CUZA 5HIIA 4PTYA 4EF5A 5A7FA 1K9SA 3ZK8A 2HZBA 2O5VA 1X87A 3U13A 2LDBA 4AB1A 5DM2A 2XHZA 4DBLC 3LSTA 1XD8A 1QVVA 2EFJA 4Q9DA 3F0TA 5JSQA 3UKDA 5EGNA 1TU3A 4CTJA 1C1XB 1VRCA 2RFLA 3N76A 4EJMA 4K81B 4OA8A 4EW3A 4FDTA 3OKCA 4P83A 1GZ7A 2FZWA 4D3DA 2COUA 2ZJAA 3KHSA 1KAOA 2X5XA 1K4KA 5HNKA 5BPHA 1RZUA 2B2XA 3AUXA 3STWA 4EIWA 3I1IA 3FKSD 1U3TA 3LXRA 4AZ3B 3FSGA 3TO5A 1K9VF 2WDPA 2R2AA 5DNVA 1G60A 3EXFB 1FTYA 1UOOA 1CS0A 3IDAA 2EJCA 3HFGA 2OORA 1JKJB 1PR5A 2VT7A 3GLSA 2RGYA 2MCFA 3DO8A 2BFFA 3EMVA 1PEKE 1TU0A 2BJVA 1XJWA 3F67A 3FPHA 3RPEA 2D5CA 1IOLA 2ZJOA 1YJQA 4ROSA 4BL5A 2BGGA 3STTA 4RPHA 4YRSA 2ZB3A 2JGIA 1XDBA 4ZPJA 4M1MA 1UBRS 3D6TB 4BV2A 5F7OA 1ETUA 4Z3OA 4YY3B 2XMSA 3P9QA 1EAMA 4X9XA 3V6MA 5D85A 4DMLA 1Z4MA 1VIMA 5FBVB 1UKCA 2A86A 2VAMA 3AINA 3NCHA 4TTTS 4G1VA 1M6EX 2ORWA 1O6ZA 3LYLA 1MN6A 2O48X 3ROMA 4TKLA 4E5MA 5KU1A 3BSFA 4L2IA 2GILA 2WIAA 2XXAA 2VP6A 5GZ1A 3H05A 4MHTA 2VT3A 3OFVA 1HNZB 3U2QA 2JLWA 3Q10A 5LCXA 3AONB 2G04A 2C3OA 1I8TA 2RGUA 2UYYA 1M67A 1OASA 4PXSA 1RWQA 1HSZA 5L3ZA 2PL3A 2G08A 5DNDA 4ZCPA 2GOYA 2AG1A 3WNQA 1ACLA 5BR1A 4OCZA 5AI6A 3MLBA 4AJHA 2G7MC 3RK0A 5KYXA 4L50A 2CJXA 4H6PA 4EJ0A 2DF8A 4GQBA 4QO8A 2GXAA 2CD7A 2V7TA 3EDMA 3U1VA 1W34A 2R1VB 1H0HA 3WKDA 3A32A 4G1UC 1F8YA 3DCYA 2QL9A 4X45A 3UA4A 1QO9A 2J0VA 4LY9A 1MRNA 4JL8A 1NN1A 3NGXA 4YH1A 4XE5A 2EBHX 4J0GA 4NU5A 1A9XA 3D7SA 1Y48E 2BT4A 3BPSA 3C16C 4JLKA 4TXMA 1J1IA 3HY4A 4KYUA 1AUOA 1U5BA 1SHUX 1IEWA 3IVCA 4EJFA 3ZEAA 5FB3A 4BNFA 1L4HA 4B2IA 3TK1A 2HF9A 3HJNA 4UCFA 4XLTA 4DLBA 1GUFA 1PKXA 3F71A 5HJEA 2QZ9A 5CDHA 4FMCF 1Z2CA 4H6VA 3KWJA 4NOMA 3CURA 3MWKA 5EHNA 2XB8A 3T1TA 3MK31 4XR4A 2JJYA 3VR5H 2W4MA 2JHGA 2R6DA 3TAHA 1XWWA 2PX5A 2MSCB 2VPXA 3M2TA 4X1KB 1LQTA 3AGPA 3GWZA 3PHGA 4IYJA 4HYTA 4QXPA 1Q0UA 5BSRA 3V8BA 3ABIA 4HNRA 1CE8B 1L5HB 1YMVA 4OU4A 1BWRA 1I1QB 2P2ZA 3EHDA 4NEHB 4OSEA 3PR2B 4GI3A 1QZZA 5KYWB 5CA1B 2P5YA 1Q50A 3T7IA 1E2PA 1VHJA 5IVIA 2Y8EA 1XMQB 1M2KA 4EJSA 3P2JA 1HFEL 1CLUA 1E0JA 1U04A 2AT1A 2O8FA 4K8RB 5GZ3A 4XQ9A 4UQPA 2VI5A 1ZMOA 1R27A 3AJDA 1IY8A 4EB0A 3ZVNA 2FPLA 5FPKA 3W7AA 1XRPA 1G1AA 3PPVA 4BAUA 2H16A 2YXDA 2LBPA 1ZRSA 2FEKA 1IATA 4KPUB 5KC9A 4E6PA 4WW0A 2NSDA 1PFUA 3OVMA 3A0UA 4GPBA 4GBJA 2BFEA 3K09C 2XAAA 4CCYB 2BGJA 3RSSA 2PMCA 2GNPA 2E5WA 1U1CA 2XE4A 9LDBA 1EGHA 3O3OB 3NJ4A 7REQA 4FGKA 5CJ2A 2ZQYA 4CIDA 3PR3A 3VYVA 3INRA 3S1SA 4N7JA 2JFPA 1QGYA 2X0RA 3MIZA 3O94A 2FF5A 3Q2IA 4EA8A 3RUEA 1CUBA 3QOYA 3ERCA 4C7KA 3UB2A 3LTEA 5DGXA 3EUEA 2PD4A 2FFQA 3GHYA 4R2WA 2EF0A 3SM3A 5H0IA 2VWGA 3CRVA 3N2KB 4JVOA 3AUJB 3HJUA 4EMUA 3BQNB 5HR5A 3P7MA 4IH1A 4Z5XA 5LA6B 121PA 4DSAA 2PUJA 3REOA 3K9WA 1PQUA 3NDRA 3QE9Y 3BFVA 2DEUA 3JQ7B 1XU7A 3H5RA 3EBLA 1XGKA 1G6KA 4IIVA 4U63A 3SYTA 3UUWA 1ZI8A 3ICQB 4IIJA 4MK4A 1SOWA 2BFMA 5LQCA 4ZYTA 5IUNC 1MD9A 1W9MA 3DLCA 4M0FA 5BY2A 2GYYA 4HDSA 3IUEA 3WLRA 4BFYA 3FWYA 1JTEA 4LBWA 5CK5A 5KCZA 2FA9A 1VE3A 4OAOA 5AVJA 2GAOA 3MWEA 3I61A 4E7PA 1QZ3A 4W9RA 1GG8A 2E4YA 1B8UA 3LCUA 4BWYA 4E21A 4QDXA 2Y05A 4RWZA 1EHCA 5AOBA 1UIRA 1FNBA 1KJZA 1RI4A 1X3LA 3OCUA 4PC1A 4DGSA 1SKBA 1F2DA 2Y66A 2O8EB 5AI0A 3CLSD 5EJEA 2OO5C 4J0FA 2G09A 3FJ1A 2NO9A 3P96A 1XK7A 3L9WA 3RYCB 1VCOA 2H7VA 3K4PA 3NNSA 2ZR0A 3OFKA 4PQEA 3OLYA 1T6XA 4W5QA 1K7CA 4LF6B 4UU1A 1GQFA 2WUVA 4R40A 2DWCA 1Y7TA 2QZSA 2VDLB 3LVRE 2D5IA 3QVMA 5JRDS 1JVNA 5E6RA 2HKIA 5I9TA 1ETHA 3RGGA 3QUQA 2OG1A 2DG2A 4ZZ1A 1YA4A 5MGBA 3B2QA 2H1CA 3J7TA 1TVMA 5A2GA 2FW0A 1LGYA 1VJDA 3WKBA 2JGNA 2IYFA 2NVBA 3L4BA 2WIFA 4ZEMA 1CZKA 3RUHA 4IFEA 4V39A 2HMAA 1Y7HA 3QELB 5HVNA 4DR6B 4NIMA 3FDFA 1O0SA 1NKSA 2BI4A 3I4CA 1SG0A 3QIVA 1D4AA 4WCVA 2PL9A 3LG2A 4O4LB 4YJ2F 3KSZO 2HADA 4UHKA 3VAAA 1VGQA 4BVBA 3U3DA 5AM3A 1PSWA 4BNWA 1TC1A 1RE0A 1F1JA 2UYGA 2PYZA 2YNMC 1S8FA 3QVKA 3AV0B 4G2NA 1O94A 3EZGA 2MSDB 4OEHA 4PAGA 3MBIA 4HNAB 4ABYA 1X7GA 3BK2A 1XA4A 2OECA 3EF1A 5JH7B 4MVJE 2WG2A 1LF0A 3NATA 2B30A 5SY6A 4EPTA 1FQJA 4QT4A 2FPGB 3EG9B 5KYUA 4EKGA 3ZW7A 3DFUA 2XZLA 2JDIA 3ESQA 1MEEA 1TPZA 2XT6A 3AJAA 3MS7A 5L6LB 5IS2A 3CT4A 3QMWA 1YB2A 3IOYA 4XIJA 1RT9A 1WW3A 1D7OA 4QG3A 1F2VA 2I4RA 3F6EX 4I1OA 1V8PA 1W2WB 1EIZA 3N5KA 2O8DB 1CEXA 3E3OA 2EBFX 5EFZA 3DM9B 5F1YA 1IJEA 2HF2A 3OC0A 5FWXB 1RFGE 2ZS7A 2WUGA 2R86A 1Z8DA 4OJYA 3GOQA 5LZ2A 4OKSA 1KNXA 3OZXA 2IIVA 1NNLA 2EX0A 3HY6A 3RC2A 2KS6A 5CD9A 1Y80A 3ELUA 4NY1A 3G7NA 1R8XA 4QM7A 3SYMA 1JYEA 1NWHA 2W6JD 1IBKB 2HSWA 3PKJA 4ZGBA 4IVQA 4DV1B 3M5DA 2CVOA 5IT4A 1FXWF 3KKOA 2ID7A 2E18A 1N92A 4C7BA 1DIHA 5T8KC 1T1GA 2HCBA 3TQIA 3RVSA 4GPAA 3KG2A 3HKCA 1T2DA 5BSFA 3F5MA 2X5JO 1LPBB 1OV4A 4OQLA 4PBTA 4RHYA 4U39A 3LZ6A 3PFWO 5I7HA 1XMPA 2W2VA 5L3QA 3BE5A 1KIMA 2C4HA 3RT1A 2C3PA 3HU3A 3KBBA 3Q15C 3EVTA 4FNOA 1ZD8A 1HYBA 4W5NA 1NP3A 1SUSA 2J3JA 2V1XA 3EXEB 4GF5A 4P3YA 4DLRA 4K6GA 5ICFA 3MWJA 4MVJH 4H0NA 5C1OA 3DMTA 1CR6A 4G67A 5KJCA 1QHFA 2H2WA 2PR7A 1V11B 4UU0A 3KO8A 4W8OA 4G6ZA 5DEOA 1HE8B 3EEIA 5K8JB 3ZU5A 4H3VA 3PC2A 3C1AA 2IYWA 2ZVQX 4EKEA 1BX3A 2RHGB 3K1AA 3QFSA 1RYEA 1Z0KA 1GPDG 3FB1A 3K92A 4ERXA 5CVDA 2Z2JA 4UHDA 5DBGA 3RROA 4PQYA 1AC5A 1I4TD 3JAKA 2CE7A 1YF3A 3ANLA 3LHDA 4QU5A 3BH6A 3W8EA 1Z6YA 2PANA 3MCVA 3NWPA 4AO6A 2E37A 1WW8A 3NOVA 3DUFA 4LXXA 4GMGA 5AK5A 3R9IA 4CF3A 4CF6A 2WWRA 3IQIX 3T9FA 4GM1A 2LPMA 2O8BA 5AJZA 4CG2A 1PKEA 1FYXA 1E1QA 3K3PA 3LIPA 5JAUA 2OAGA 3B6KA 3I8OA 4B33A 2FN4A 3BDIA 5COQA 5JDIC 1XTIA 2DY1A 4D81A 1QLJA 2H1RA 2PS9A 3ZWMA 2ET6A 1UCFA 1OFIA 1L4EA 2VJBA 4G07A 5A1JA 2XADA 2CJWA 4CG0A 5TVGA 3WKCA 2WV7A 4M0LA 2NO7A 1E2DA 2WUWE 4OHYA 4OHOA 3TLZA 3ZLTA 2CLCX 1HC7A 1GPUA 3FOZA 2P9BA 1L7AA 1SG6A 1PNRA 5JS2A 2Z6UA 5CITA 3WVNA 3L6RA 3GV0A 1J9EA 2FJ0A 4LYDA 3OCCA 4KODA 3ZU2A 3FA2A 4PO3X 3NEAA 5FPPA 3LT0A 2PFGA 2JLUA 4MR8B 1JN0A 2VT2A 3O73A 4OMFG 3W3ZB 2XDYA 2NUTA 3G1UA 1HQDA 3D81A 3HZHA 1NG1A 1HFJA 1JAHA 3GQVA 4NV0A 1ZJ5A 2Q5OA 4QOSA 4YASA 1IZ7A 4O4IB 5IYZF 4UHBA 5CXQA 1G8YA 2C0QA 2XI4A 3AYZB 4CIAA 4MJXA 4F84A 2XF8A 3BMQA 1DKRA 1L7PA 2ZI7A 3EGVA 1DEKA 1Q84A 4RM2A 1A82A 3VA7A 2CL6X 1GZSA 3WISA 4WLEA 2WHRA 2ERXA 4X1OA 1T3HA 3NI2A 1YZFA 3IQGX 4HDNB 1VG8A 2A5JA 5KTOA 1I33A 2XUQA 3LWBA 2JLXA 1AX9A 3C7KA 2HA6A 3ZLUA 5A4AA 2HK8A 2HTEA 2W6ID 1BGVA 5KQLA 5I9NA 4JT9A 3IBSA 2QJWA 3JQPA 3PC3A 2OESA 2ZPUA 2WC1A 4NCXA 2HWXA 1ENOA 2WD9A 2PMKA 2CHQA 1VCNA 3DBRA 1G2PA 1UM9A 4GP9A 3LUDA 4HB0A 3QW4B 3TXYA 1KVRA 4HAIA 3E3MA 2HF8A 2OXCA 4QHSA 3CUKA 2VYVA 3KXPA 2CNWD 4S1TA 3A1CA 4URVR 1N2IA 2D4AA 3KLBA 1V3UA 4MR7B 3UJCA 4JROA 3NHUA 4GS5A 3SDSA 4PX3A 1GJRA 2XCLA 1N5MA 3QPBA 5JMWA 3SF0A 1P5HA 1U28C 2I7CA 2P40A 4ZT3A 4CDNA 4LXIA 3I9JA 4H7HA 1KMIY 5LMCA 1GM5A 5EJ4A 4QTZA 2XTAA 4RKWA 4W8HA 1K89A 4KE6A 5FAKA 1FXSA 2ICAA 4HLUA 3VAZA 2QHXA 4UZSA 4V0QA 4DLVA 4IQ8A 3SSAA 4BQIA 2O1XA 2AV6A 1SKAA 2RARA 5J58A 2P2NA 2VP0A 4RKYA 4ZHQB 1AGYA 3HDHA 3KD2A 2MMGA 5I47A 2YDYA 1D8AA 1Y8QB 1NW8A 2QY6A 1WV1A 4OL9A 5ABPA 5FTNA 5KMGB 4ALMA 3GFFA 1ODJA 2UDPA 4MVJG 1L4LA 2VTKA 5CGZA 3C5WP 5EIBC 2FKAA 2UVPB 1R5OA 1V8OA 4PG5A 2F1IA 2W22A 3Q3EA 2D0OB 4WXEA 1CFJA 5DM0A 3MWDA 1O77A 3QVOA 2FWJA 2PJZA 3Q72A 1QGED 3N86A 1U3GA 1WUYA 1F48A 2F3TA 3MTQA 4KR0A 1WDTA 4WLOA 4K86A 4XQCA 2AFIB 1CB7A 1R4NB 1RW4A 2WU4A 3EVZA 3TZCA 5CEEA 5BVGA 1KYZA 3MWYW 3W5SA 3BEDA 1I7LA 1SZPA 2AUTA 1ZK3A 3HDTA 2Q1SA 4BX2A 1XF1A 3OJLA 4OM7A 5LVAA 4KV9A 4OXNA 4JI7B 4RHEA 5HILA 2GBFA 1EP2B 1UF9A 2C8KA 2KSQA 3PDCA 4WKNA 4XVHA 2CYBA 3SX2A 1JG2A 3QVGA 1ODCA 1JG3A 2JLBA 3ZV6A 2V98A 2MYTA 1UP6A 1JRLA 5BSEA 1A2BA 5JNLA 4RQTA 1Y0BA 5JR3A 1XVUA 3EX7C 3WSWA 4D0NA 1GILA 4G0PA 4KFSA 2B1IA 1VJRA 3BTVA 5A0VA 1L5SA 1U2TA 1WXXA 1M1YA 3AEZA 3GEPA 3I4LA 1XMSA 3EIOA 3KR0A 4CV2A 5FDFA 2C2MA 4DV7B 3THXB 3UJHA 2VUSA 2BMEA 3E22A 3VC3A 1QIDA 1QYIA 5LU8A 5BRJA 2ZJ1A 2P6RA 5CGQB 2P9HA 2JKYA 3ZDQA 2ZUFA 4MDHA 4N0PA 2BL4A 1ACJA 1TDJA 2FOLA 2ZANA 3GJRA 5G4KA 1EUYA 4IDHA 4Q9JA 3PNSA 3T7AA 2QGFA 2XCSB 1XNQB 3GYGA 3QVTA 1F9EA 2FGKA 3CZAA 2IODA 5IJ9A 1W47A 5INTA 4R69A 1F20A 2YRFA 1FUIA 3U4HA 1RHUA 5HKKD 1RXCA 1NJ6A 2LCIA 3O8BA 3AIMA 4I5GA 4ZDWA 3OY2A 5ADVA 1RLTA 3TBFA 3H4MA 2ZJ5A 3IHKA 5TQ2B 3L9XA 3QX7A 1Z07A 3EA4A 2YQ5A 3AZOA 3KPWA 3OHMA 4HQ0A 4P4UA 3RDPA 4TZKA 1KOFA 4DBZA 2J85A 1I4EB 1RTKA 1ULSA 2H7CA 1B8OA 3ESAA 4DEYA 4WLVA 2VJDA 3QJ5A 5HK9A 4V38A 2Z4RA 4WUVA 3OQHA 1K3UB 1FA9A 1VTKA 3VSCA 2B8EA 4MV6A 2PKYX 4URWR 2JJQA 3V8QA 2GPYA 3BVPA 3IMCA 1OWPA 4XEUA 4E0BA 3SC3A 2CUTA 1SZCA 3CUTA 5H9VA 1YCFA 5FEUA 3JRXA 1TE2A 2P4UA 3B6JA 4NAHA 1B00A 1Q3KA 5C32A 3EHEA 3ICVA 3WK5A 2IZ1A 3OCXA 4AO7A 2FZKA 4OGKA 2AG0A 1K7XB 3ADPA 1NW9B 2GUGA 2GLTA 2MSKA 2SICE 2XA9A 2XQKA 3K71B 4WN9B 1W1WA 1AQIA 4KXXA 1I9GA 2HV9A 4D6YA 4X1YA 4DUPA 4US2R 5LWHA 1KWGA 2PY6A 4I6EA 5D7BA 1VXOA 3BXEA 3KETA 3TBHA 3T94A 1JYSA 2A9OA 5DH9A 5L95A 3E2PA 3GELA 3CXUA 1ULAA 2AG5A 1Z2EA 4JC4A 1DO0A 1VJGA 3KLOA 3O2NA 4PW0A 4YJKA 4IIEA 4BNTA 1NZJA 3VVCA 3DOFA 1A50B 1D07A 2IKQA 3TOSA 2IUSA 3HSYA 2HDHA 2ODNA 1KI6A 3BRWA 3FOCA 3HCRA 4WUTA 4N41A 1JDBC 1SU6A 3RBXA 3H0CA 2OZPA 1HLFA 2ZIXA 3QYFA 1DXOA 1NVVQ 3GLHB 4ZI7F 2TECE 4MTCA 4RTNA 5JECA 1HO3A 1UBGA 3RTDA 4IP0A 1WZ2A 2KBEA 3UHAA 1NXTA 2IOFK 1ZG3A 3FTEA 1ULBA 3SC4A 5DM60 3FNEA 2YZ2A 1MGPA 1UOPA 3NQ41 4ZOBA 5NULA 5EJIA 1PGQA 4EA7A 4F8JA 1DQRA 1VQ1A 3I45A 2VTDA 3JVVA 4BEBA 4YPVA 3WNZA 4JS0A 4ZJUA 1TF2A 4W5OA 2FEXA 3DXYA 1GTL1 1X1TA 3NM6B 3ORSA 4L95C 4BTLA 5CYGA 3ANSA 2B1GA 1CVRA 4CM4A 4E33A 3UICA 5HMMA 4D4KA 3FETA 2QDKA 1RRVA 3LLSA 3OTIA 4DYDA 2FZLA 1RYBA 4NH0A 1T2CA 1TU4A 5H16A 1NXXA 3JYLA 1CZRA 5BOSA 2BHSA 2JGFA 2AN9A 3IJPA 1WBBA 2C29D 3AEYA 1BWPA 1U0OC 3P2IA 3PQCA 4TXHA 2LGJA 3AO0B 1PP4A 1YDMA 1KDVA 2ZS9A 3AWDA 5KOIA 1F0NA 4R01A 4MR9A 4O0LA 4LVOA 5FLEX 4FS3A 5F77A 2GLUA 4W5JA 1PR4A 2YOGA 2DUNA 1P31A 4HN2A 2EHJA 2PN1A 4C01A 4B76A 1JJBA 1XI2A 2BLNA 2ZVDA 3P4UA 4KXNA 1A98A 2A9KA 3AUYA 4NOJA 4NPHA 4FDMA 2HT6A 2GVDC 2LKDA 3EFOB 4WZAA 1TYDE 1YJBA 2D1YA 3AQIA 2N75A 3AU8A 4FNGA 1JA1A 3C3PA 4LNUB 4BJ5A 2BDEA 4A8PA 1XEWY 2I6XA 1EFDN 3OSZA 3RWBA 2FE4A 2PMFA 4L6IA 5JCPA 3KZNA 4B8WA 3THWA 1Y6GA 1VSTA 4ZT2A 1BJTA 1I5EA 1AXRA 5JWHA 2C92A 5EYPA 4BVKA 1P77A 4C14A 2OAP1 1C3VA 1DI0A 4RTLA 3COYA 3KHTA 2P30A 5EPEA 2ON6A 4MPTA 5EE3A 1BDMA 3N28A 3OMXA 1G7SA 1QIFA 2FXVA 3OUUA 5FPQA 1UMDA 4I6GA 5EY5B 3REFA 3SJAA 2WG1A 3ZK7A 1X3SA 4TLCA 4FFPA 2SKEA 1Q11A 4YCDA 4B8YA 3GX1A 1ZZGA 3GZJA 4CMAA 4QOJA 3VKFA 6REQB 2BGRA 3P97A 1UKBA 2OR3A 1C9EA 2FEMA 3MEQA 3ZY4A 4YACA 5EMHA 2O20A 1T3LA 3ZQ6A 2JBAA 3KQUA 2JAUA 1VJTA 1P6QA 1XTRA 4PGAA 3KLNA 1TEHA 2PL1A 1IDOA 5LB2A 4X3OA 2J7PA 5HJ2A 2NUAB 1ELOA 1WMFA 3DKKA 3DJFA 4FFRA 3SZOA 3MWFA 4FT2A 5F2EA 5I8WA 3MCTA 3T06B 2AN5A 2QMZA 2Y0BA 4EFKA 3UNXA 3AB7A 2Z8XA 2RD2A 4MCAA 1I0LA 4TXJA 2AQHA 4DUYB 1QF9A 1R0KA 1G20B 1EK0A 3JQ9C 1QPGA 4Q6BA 5ALKA 3MXTA 1LSOA 3BXGA 2XW6A 4Q9NA 1T9KA 2JD1A 4HZGA 4OPMA 1O57A 4Y2XA 3URMA 2V1UA 3NDBB 2G06A 3W5CA 4Y30A 1OWNA 3MTDA 2B8NA 3UJAA 3PEEA 4W6QA 2C4KA 3C4QA 3DHNA 2QQ0A 3DYIA 2EEPA 5EJFA 4GI2A 1PCXA 3KAJA 1LRKA 1QP8A 1SFRA 1XXHA 4Y6LA 4CW7A 1KZ4A 3N8NA 4WMLA 1NNSA 2Q6TA 3JQCA 4AIIA 1LLFA 1V8DA 4Q0MA 5GINE 4HGOA 2Q2VA 4BC0A 3M33A 4FGZA 5DI3A 4O0MA 3AVUA 2WY2D 4N5DA 1ISJA 5CLLA 1SUFA 1BD3A 3HE3A 1C8KA 1FSGA 3CKYA 4WA7A 4CM8A 4JLWA 3KPYA 3F6YA 3ME5A 2XOKD 3LVFO 3GEMA 4HGZA 4YO7A 1GGVA 3FMGA 4N5MA 3ZI0A 1F0PA 4DF3A 3MW8A 1LS6A 4MIYA 4XD7A 3TUZC 4OK6A 1ZISA 1OXMA 4D6PA 3FY4A 5JSZB 2PU7A 3NAGA 1V5IA 2BEKA 3X1YA 1MH9A 4I5IA 4M86A 4DUGA 3EA0A 3R8FA 1DJMA 3RAPR 1KAEA 1X1AA 3K8YA 2I33A 2AOTB 4U4AA 4X7MA 2PRZA 3VNBA 4BN4A 4UU7A 3S7ZA 2PH3A 4MVXA 3AKZA 4KQ9A 3CZ9A 4HG2A 2BOVA 4D5EA 3BGWA 5ALEA 1XZ8A 1KGSA 2PSJA 3DL7A 4L5BA 4S35A 4BLUA 2ODAA 5KWJA 1GV1A 2VRBA 4MRSA 4ZJYA 1PZHA 3KWLA 1ZMBA 3BXHA 4KXLA 4REQA 3G89A 4CKZA 1GZ4A 2OK7A 2YIJA 2NZYA 3DGFC 4J9VA 5GMOA 4GXRA 2I7TA 1OZHA 3VBEA 1DBIA 1UZNA 1WKBA 5KYVA 3EDRA 4R1PA 2QW0X 1PJCA 3I3SR 3ZCRA 1WXDA 2J3IA 4KQMA 1FU4A 3HCNA 4NH4A 1N4AA 2PUFA 4NCAA 4GZ5A 4ZI5A 3CLRC 1UJBA 1M2FA 2ORED 2YBDA 4RO0A 1JAXA 4ZZ0A 1Z12A 3OEEA 2J0EA 3DXFA 3EOZA 3HU2A 1PDVA 3M4JA 4G65A 1RR6A 1YZLA 3LT2A 2PJDA 3FPFA 4YPFA 1ZW6A 3ZHZA 4X0EA 3ZGZA 3M89A 5DWQA 1EZZA 2DH5A 4K05A 3ZG6A 2YRWA 3TXXA 3FOAA 2GTPA 4RELA 3PQ4A 2F1KA 3QEJA 3RRFA 3BB4A 3I58A 3ADOA 3QU4A 2AI3A 4M1QA 2DTEA 5HQTA 1L8QA 4DWWA 2PRSA 5JNTA 1Y3BE 1KQOA 2HW8A 4BLQA 2W8ZA 1MX1A 3SP1A 2FY8A 4N5LA 1T5SA 3R23A 5DLPA 2H7XA 4X54A 3RK1A 3T5CA 4TZ6A 3MUFA 3P9XA 5CIWA 3CZMA 4BLSA 5JPDA 3EW9A 2C94A 2FEAA 2XEXA 2JCSA 2WJAA 3LHIA 1HF3A 4OATA 3RS0A 3WLSA 4BLWA 4D44A 4ZEVA 2WNSA 2ZXUA 3Q1LA 5CA1F 4PNEA 1G41A 1I4LD 1NY5A 2CNLA 3KEGA 1AXGA 1K92A 3ONNA 3QBJA 4OI1A 3V2IA 2JFZA 1K68A 3VO1A 1JDBB 1WTCA 3CR7A 1MXFA 2ZRLA 2FOXA 4TYWA 1LA2A 2EEZA 4RA6A 2QPLA 1TXGA 5D5PA 4RD4A 4FINA 3CO0S 4NKRA 1RBYA 1NQXA 1KR2A 2R3SA 1TEVA 2A7XA 2FR0A 1WHTA 1PX0A 3EN0A 3DKIA 2B92A 3KYDA 1HPLA 1KORA 2ZVJA 1SZDA 3EQ9A 2CDBA 3MAGA 2AXQA 5FTWA 5BYAA 4J16A 5ALIA 1BDIA 3S27A 1U65A 4LYJA 3VR5A 1ZEMA 1RVDA 5E0KB 1Y6ZA 1FZTA 2HBQA 4PGFA 5TNXA 1VM6A 4LRWA 4RETA 4ZC1A 1YJXA 1YFKA 3PTZA 3B1FA 2BSQA 4N8SA 3KCNA 1W49A 1CG6A 1WCXA 3HPQA 4S12A 3B6ZA 5BUQA 1G7CA 1Y5MA 4CNQA 4Q1EA 3RS3A 3QVLA 5KPDA 1SXQA 2BUBA 1I80A 3IO3A 2BD0A 4W8GA 3S1AB 4BNNA 1JQBA 3ZWDA 4GKKB 4URZR 3PRKE 3GCWA 4LI3X 4LFAB 1ZKMA 2F64A 3I6ZA 1SC3A 1W36D 4NNOA 1XPJA 3M70A 5JFTA 1FC0A 2QBYB 2AC4A 3AXTA 1S3GA 4BP9A 3E3AA 3N87A 1BTOA 5BN1A 3FZNA 2DVMA 1UBMS 2OZKA 5M29A 2PQ2A 1Q0ZA 2XECA 4D4MA 3NBAA 3LNCA 4F4JA 4OKNA 1UXOA 4WNYA 3SM9A 4ENVA 4YJDA 1EWRA 1SCJA 2VPIA 3A31A 4LJ7A 1N9ZA 3HN6A 3HJCA 2BV3A 4H7DA 1FL9A 5JS1A 2R8RA 3DNFA 4Q9KA 4KN8A 1KFKB 2C07A 1JQKA 3DW1X 3EXHC 5P8WA 4HX2A 5BSGA 1HOTA 1G18A 3PFKA 3T9BA 4L08A 1MQSA 5JCOA 4EHIA 5B1YA 4GYYA 3G0DA 1QNLA 1KE2A 3ZDYB 4GKJB 4FYPA 3WGIA 1U0EA 1NJ2A 3UT5A 1WBDA 1JIQA 5T4EA 1SQ6A 3QEBZ 1T2AA 3S7TA 1N33B 1SQFA 5K09A 2E4ZA 4KLCA 2NLOA 1V4BA 2IYNA 1H0KA 2GA8A 4LWZA 1NBHA 1NE7A 8ADHA 5C53B 4KFUA 1O6CA 3IAM6 3SJBA 1JPUA 3IAXA 3GRYA 1C0LA 2D74A 3K9CA 4YJHB 1DBWA 1ECCA 1OY1A 3PQ7A 3UMRA 4AP9A 5JD6A 1ZH2A 4UFPA 1N1EA 4U9UA 5EZ6B 3HM9A 4I1PA 1A5AB 4M99A 1N7HA 2QUJA 3H6GA 4WDRA 1TTTA 1MG5A 4R83A 4BO2A 2O2ZA 2IGBA 2E82A 4QBHA 1VKJA 2F17A 1PR6A 2EW2A 2X1LA 3GEDA 4RVSA 2QMEA 4BO1A 1WXGA 3HADA 1KZHA 2CJYA 2NV2B 2ZB4A 3O90A 4ES6A 1JILA 2O2CA 2VTBA 4WLNA 3U56A 1UFKA 2O14A 4WKOA 3S2IA 4ALNA 5FUVA 3WMGA 3CNEA 3CZ4A 2R00C 3LT1A 3ASUA 4MWDA 1YVPA 1ZM7A 4CKEA 5T6MA 1ZU4A 4Q00A 2D59A 3LA6A 1V5EA 2RBGA 1Y4AE 3MRVA 3C6QA 4JQCA 5FV4A 1GPLA 1Q14A 4M1OA 5AHKA 2UV8A 5CT8A 4EMSA 6PFKA 4PZ0A 4Q9LA 1I7QB 1N6NA 2QYOA 3KEOA 5M5BA 1FY2A 2QUZA 1VIDA 3ZY3A 4AM8A 2G1AA 1CDOA 1Z7WA 1UANA 4I99A 1N2CB 2OHJA 4KRGA 4LDQA 1PT9A 3I6IA 5EMLA 5REQA 3TRIA 4QXQA 4PG4A 5U4QA 4BMCA 2IOHA 2QJRA 4P53A 4Q66C 1ZQ1A 2ASVA 4G2TA 4A1OA 3U16A 2HXGA 4MVJI 3K15A 1BCRB 1ZK2A 1VB5A 3A11A 1K97A 2XY4A 2X9QA 3A3NA 4EYKA 4WBNF 4ZAWA 2JHPA 3DKPA 3S2SA 1L3IA 1VCIA 3EULA 3E03A 1CVLA 3I04A 4NQRA 1XALA 4M89A 1AG9A 1IEVA 2JATA 3T4XA 1LDNA 4FC6A 3KS9A 3QF4A 3UXYA 1E1DA 1TAUA 4N01A 2IEAA 4UM5A 5K9ZA 4M1TA 3K0SA 3UMFA 2PGXA 4ZQFA 5ALFA 1Z26A 4L6CA 3D2CA 4RL6A 5BW5A 3ET4A 4MUJA 4RNCA 2ODQA 5T3UA 1HURA 1XN4A 2PNFA 2WSSD 3X2EA 3GIDA 1FX1A 4HUQB 3WYDA 5D6OA 1WG8A 1F60A 1SXIA 2FMKA 2ZULA 4OQNA 2QR3A 3OKFA 2UYCA 4PLZA 1GWNA 4N03A 1QO0D 2PZEA 4L5JA 5IN5A 2QM7A 2ZPTX 2ZWPA 1G66A 2EQAA 3A2MA 3IVAA 4NENA 5FORA 1KKLA 3ILXA 1DBQA 1N5IA 3A1NA 4AROA 1YFLA 1IFXA 1L9KA 3OJWA 3TRDA 4LKOA 3HSSA 5AOCA 3EXG2 3SGLA 3GXBA 3M4NA 3TL3A 4C3VA 1H9AA 1ZPDA 3E7DA 5L3VA 1TEZA 1I2ZA 4LHWA 1BMFA 2PWYA 2VNJA 4CKCB 1KEEA 1O9GA 1D1PA 2GD1O 1IQ0A 3INTA 2JGRA 3L4JA 3O92A 9LDTA 4MRMA 3KD3A 4Y1EA 3BIWA 2SCUB 3LD9A 1XMOB 2R5WA 2AH5A 3L7NA 2IPOA 1Q1ZA 3MMSA 2A94A 3X44A 1YDHA 3M4YA 3UWDA 2CJPA 5CHYA 2DHQA 2X0FA 2CBZA 4PANA 1XV5A 1KTIA 1I5OA 5EJ6A 4TUYB 2CHUA 2WWIA 1XTQA 4XWGA 1VCMA 2IUTA 2ZS8A 4IOLA 4P32A 5JADA 1GGEA 4DIUA 1AF7A 4W82A 2O1SA 4YB8A 1PHRA 2HA2A 2H31A 2FN3A 1PL0A 1RMTA 3QWBA 3VKVA 2QRHA 5C1PA 1JALA 1FRVA 2QSJA 3AF0A 2G4LA 5EEHA 3FPCA 4KJXA 5BV7A 4HYEA 3ITNA 4GR9A 3IUQA 1L5GB 2RGRA 5IFKA 3MTBA 1CYEA 3EDQA 3MOIA 4JQSA 4FKBA 4B3GA 2BKXA 3BXFA 3P9KA 4GRDA 2IH5A 4FWIB 1QQ7A 2EG5A 4KFRA 3GD5A 4JOBA 3WDMA 2W6PA 3R3HA 1JZTA 2R68A 2VRNA 3HCAA 4WJKB 5NLLA 2ZLBA 4HQKA 3TR0A 3ETGA 4UTPA 2OVBA 5BSVA 3DPSA 4X61A 2FWPA 5JJBA 4LOKA 3N58A 3D3WA 5J5AA 1J0DA 5JZ9A 1G3QA 3U6KA 2FZGA 2Q1WA 4D79A 2FWIA 2BFBA 2FE1A 1VKNA 2ZB2A 3G2JA 2SKDA 4Z99A 4NULA 3T0FA 1OB5A 5IUJC 1E64A 1JSCA 1O5TA 3EB9A 4OP2A 4ED9A 2ZU6A 4J0CA 6Q21A 3PT9A 4O4IF 1XZKA 4WNAA 4D41A 3WQQA 3P1JA 3HYTA 4JZKA 4Q1FA 1V6SA 3GLVA 5J59A 2GRJA 2ZETA 2Q07A 1B14A 3C3BA 2XD9A 2GT1A 2QPAA 3DAOA 3F3YA 1GTVA 3QX9A 4R9UC 4ZOCA 7MHTA 2WW8A 3C6BA 1E3WA 5CCDA 1Q1BA 2VDQB 4LJAA 3ZUPA 4KDFA 4A92A 3SX0A 1Q77A 4WZ6A 2GH1A 3I83A 2XWPA 3QXGA 4A91A 3U4QB 1TC2A 5ELXA 5FNVA 1LW6E 2DFVA 4Y7CA 2R8BA 4ABTA 3RVMA 3O1JC 3O6VA 4JHLA 4RORA 2IU3A 1HYQA 3CUSA 3GUZA 3AH8A 3T4EA 2QVGA 1YZUA 4JXXA 1TFRA 1XMXA 1FTQA 1R8YA 1DWOA 3N1UA 5JARA 3KKZA 5JVDA 1E2NA 2CHVA 1ILEA 4L4ZA 3NXSA 5H4HA 1P3JA 3C3AA 4EB3A 1Z5GA 4DMFA 5JY1A 1VPTA 2AJBA 1O5OA 2QI9C 4TN1A 1U1FA 3D7KA 3GZ4A 4AD8A 4B9EA 4M87A 3TZ6A 3KUCA 1CNMA 3LCCA 4WCFC 1DDOA 2DFDA 4UVDA 4QBTA 1WLYA 2RGDA 3H11B 5FBHA 3E9YA 4CETA 3TPFA 2OGZA 3OE7D 4NEQA 4ZVNA 1YI8A 4YBZA 5PGMA 4S1NA 3LUPA 1J0EA 4WJZA 4XFDA 1JMYA 5LLDA 1Y1LA 3TNLA 4D1YA 5HK8A 5CEFA 3MUNA 4OLBA 2VP9A 2Z9CA 5HGXA 3H7AA 2DUMA 3V7FA 3DOUA 3O1LA 1IWPB 4QYXA 1Z17A 3RC9A 1VPWA 1ML3A 1DL5A 5AYVA 3IHLA 2FMHA 1E77A 3PVZA 4NECA 1KDRA 2FDRA 3LV8A 1JJAA 1NUHA 2X7JA 3G59A 2AOVA 2CY0A 4LUCA 2GRAA 3IAUA 5DXAA 2GI4A 3ZWAA 4EVIA 4YIHA 3LPMA 2NX2A 3EF0A 1DAKA 1STOA 2BHRA 2WINI 5EKSA 2ERYA 5JO9A 1L4BA 5KOJA 5AW2A 4NG5A 1GQYA 3ZYCA 3HWRA 3BHJA 4URUR 4BP3A 3K0CA 2XSZA 2V0NA 3ENZA 3L7JA 1VCHA 1MO2A 5K6AA 5LOVB 2G77B 4HD8A 2BFWA 1T15A 1U2QA 2C82A 2V3CC 2J67A 2P5TB 4ER3A 3R40A 1PG2A 1GZUA 4HXYA 3GA7A 1CSEE 1XEXA 2IJGX 2B98A 4DC9A 4TYMA 4MV8A 4U7PB 3USZA 4ZCRA 4MZXA 5ER9A 1YIAA 3AILA 2FOIA 2HPVA 2PDAA 2ZRCA 3FKQA 2BEWA 4DW8A 3ZBUA 2J3HA 3SR4A 2P27A 1HE3A 4BB0A 4L74A 4D6XA 2AVDA 4ENUA 4LSWA 3CEHA 4GRIA 2FRVA 3DSRA 1N6LA 5FTMA 2HQ1A 2IEIA 2ZJYA 5EC8A 5TF4A 4M53A 1PFQA 1SKYB 1XLVA 2V6FA 4DIMA 2V3VA 5CB4F 4FUTA 5CX1A 1W35A 2ATXA 2FG7C 2UU9B 2FMUA 3EQ6A 3A9UA 3U7EB 3WLJA 3E84A 5L3SA 3NVKI 4RXMA 2BFAA 2O7VA 1Q83A 2I65A 2NO5A 3DF7A 2ONKA 1RQGA 1TTQB 4A82A 4E03A 1BXKA 2VR1A 2F62A 3COWA 4K6HA 3OE4A 3FCXA 4HWGA 1ZH8A 3CA8A 1HRKA 1P61B 3ISJA 4JH0A 4QKQA 1S2OA 2F1HA 221PA 2P2SA 3K32A 4HWRA 1CWUA 4B84A 3EZ7A 2NPIA 4UHHA 3R9WA 1CEYA 3QW2A 5CFZA 1R5NA 4YLYA 2PV7A 1YKSA 2XRYA 4H18A 5FIUA 4URYR 1OQAA 2FSHA 2F00A 2ISQA 4XQGA 5HTOA 2JAWA 2DBZA 1NI5A 1SU8A 1YC5A 3PNVA 1N3YA 4KAXA 4RPGA 5IKPA 4IIXA 4CUZA 4YAKA 5KBYA 2HYIC 4NP6A 1RWKA 3DEAA 1GPAA 1HT3A 1QVZA 1QFZA 2D54A 2WZQA 3EC7A 3IBTA 3MM4A 4H1VA 4KR9A 3ZWCA 1ZWLA 3PRJA 2I3ZA 4B4OA 4EFNA 4I50F 1I7SB 2LR0A 1LVHA 4WKBA 2VPQA 4CKYA 4DWJA 1RLJA 1RQRA 3ONFA 2OORC 1HDRA 1FVXA 4PS1A 2V6IA 4ZT7A 1I6LA 2EKPA 1PJ3A 3MUEA 1BWQA 1SXJB 1ZC3A 1WEKA 1JZSA 3MT0A 3ND5A 4M8IA 1A9ZA 1E4EB 2BP7A 1QX4A 4ER6A 5EXTA 1QGDA 2ZAOA 1QORA 3R0VA 1X7XB 3IB3A 1QCZA 5FBQB 1P2SA 2QAGC 4LK3A 4MYHA 3AUAA 4LHVA 4PZLA 3ZBQA 5IKMA 4UBIA 3I73A 4PZEA 3LKDA 3SEAA 4DLLA 3VNQA 3IPAA 3WGOA 4P0TA 5TT1A 4PSAA 2P0AA 5HCIA 3IT1A 2DZDA 1SIOA 1UZAA 3R0ZA 2FG6C 2JJ2A 1I3CA 3DBIA 4A0HA 3PWSA 2RHBA 4AY4A 2OV2A 5JZBA 3DMFA 1SHZA 4P98A 4RZIA 4X90A 4U1RA 5BW8A 1EMDA 2NSJA 4TQGA 4C2BA 3JZIA 3WY9A 5JFOA 1RXYA 2Q0XA 3VUFA 3PUZA 3JD4A 4J0JA 3CLUD 1EVQA 2EFHB 3I8SA 4HC4A 1L8AA 1W0JD 3HO1A 3OICA 1BMDA 4UBJA 4R2HA 1PQWA 5E1BA 5A0FA 1IK4A 4TLMB 2VJMB 2ZBGA 4U00A 4UATA 2C7GA 4XVCA 3IC5A 3KB8A 1Y4ZA 3ON5A 4BNLA 4ZQBA 2OUIA 4QQFA 1HORA 1G6HA 2YWCA 3GCXA 4CKWA 3L6OO 1GCOA 4JB0A 3ZGXA 2QZ4A 2ZSHA 1CJBA 5C3UA 1C41A 2QF7A 3HBLA 5K51A 1E58A 4CIBA 4QYTA 3ZCVA 2OYSA 3LY5A 1GNPA 2NZWA 2VF4X 1JEYB 3F6BX 4CL2A 1U1DA 1JVSA 2QD4A 3N2YA 4JR1A 3LO8A 4C4OA 3FWNA 4F5YA 5AVQA 1P1FA 4X62B 4BUZA 1C0KA 3ELWA 1UZLA 4OHKA 3LUBA 1TIBA 2Q2QA 3E9EA 2KQUA 5ALPA 3AF3A 3F4KA 3TM5A 1IQRA 2QP9X 4N39A 1KYYA 1LI4A 3T1QA 3H4IA 5H3HA 4DBLE 1VECA 5TQ0B 3EWAA 3PD0A 3WSTA 1IBCA 2ATCA 2DCUA 4OGLA 4IFIA 1D0VA 1K8RA 1TT5B 2VFAA 3U40A 5DOZA 1O03A 4AJEA 3PEFA 3FN4A 1H22A 2HH9A 4JOCA 5SYMA 1RYFA 3TSYA 2VA8A 2VSYA 1H8ED 4IL5A 4NHOA 3V4VB 3G5AA 4FJ1A 2G7ZA 3ONDA 1VLZA 2EZTA 3PUYA 4DGQA 5AH0A 1NDQA 3O4JA 3K53A 3O8NA 4KBFA 1E7SA 4MUYA 4CTNA 2OHXA 1W4ZA 4MUXA 4UM8B 2GVZC 5FPTA 3UJDA 4BJ3A 4RH0A 3F6CA 3OHSX 2DMRA 3EFBA 3SFZA 1S2DA 2QXYA 5HA5A 2FDXA 4KR3A 1U0JA 1GVHA 4PRYA 1JGTA 4G9EA 3A27A 3Q12A 4Z0HO 1CRLA 5E6UB 1H2EA 2V5AA 3ADKA 3AT1A 4L4SA 3WP1B 4EJSC 2GNAA 2BFOA 2P6UA 1XRSB 3ETDA 4GRAA 3ZE8A 1BHSA 3SC2B 2X3UA 2QD5A 2XYQA 3D2AA 3FF4A 3JS5A 1E9BA 4NCNA 4U3JA 1ZGAA 5FL7D 4BV8A 5B7QA 2HT1A 1KDTA 3WYFA 1Y4SA 1XJ0A 1IXSB 2YS6A 2K7ZA 4YP0A 3G0GA 2V9ZA 2W8BB 1W2GA 2HNAA 2FW7A 2O5RA 3EFEA 3HA2A 3HHEA 3KJQA 4LCEA 4RIGA 5EUMA 5EZYF 1GAQA 5C8VA 2ZZNA 2ZITA 2Z2IA 3A4MA 4FLEA 1LBQA 2VP5A 3PCTA 2NVUB 1F6WA 1DQPA 2P11A 2PKWA 3QX8A 2Y1EA 1EZ1A 1LU9A 4GR4A 1Y3DE 3OCZA 3ZY6A 1ESDA 1A4RA 2ACEA 1LPOA 4FBLA 3DAYA 5E4TA 2PAAA 2WWWA 3WYBA 2C42A 2IZZA 5IHPA 5FL3A 1I4WA 2ACWA 4LV8B 4J3NA 2IWHA 4B31A 3ED1A 3C87A 3RWOA 4CEIB 1GQSA 3NHKA 3EAFA 2J0UA 3AZPA 3EVCA 3ORHA 4XGQA 1R9MA 3P4YA 4RV9A 1GL3A 4OH1A 4RFSA 4MTLA 4Q1BA 3QFFA 3UKJA 3D64A 3DFZA 5EKXA 3SZUA 4BLTA 3ZZNA 2VJYA 1XD2A 4GEKA 3ZE7A 1PFKA 2PKEA 2OKCA 3OEHD 2IIPA 1Q1QA 3MGCA 2R6ZA 3TIFA 2C4MA 1ZIPA 3GDFA 1R9JA 5FJJA 5H7XA 5EJ5A 2C03A 4GLOA 4BNKA 3CW2A 3GWGA 3U7QB 3WLTA 3OA0A 1AK2A 3TW0A 3K6SB 2GPSA 4RCYA 5FWAA 3V55A 3W77A 4YRPA 1XVTA 4UOEA 2PUCA 1E0DA 2BMAA 3GCGA 4RABA 4TWIA 3UG6A 4CCSA 3IP7A 2QX4A 3LUFA 2VWHA 1U7XA 3CBQA 1AUXA 2BGIA 3FYSA 5EJ7A 4OAQA 1KFBB 3C5HA 4FCCA 3L79A 1J42A 1SA0B 4DLUA 1OYWA 3B82A 4RF3A 3ORYA 4BGDA 2WV9A 2CKMA 5E1MA 2O9JA 4IIDA 5LYJA 5LB4A 3FFBA 5HRUA 3B1ZA 4M8KA 2WWYA 4K9QA 2WZDA 1D5CA 5DLEA 5G4LA 2JH3A 3SPXA 4A9AA 4DZZA 2JHFA 3UB3A 3NEYA 2FEWB 2JIBA 3B89A 3QLUC 3I9V1 4MS3A 2HLPA 5K2MA 4KQ6A 1JQ3A 4PGGA 2LTAA 2RGAA 2D0PB 3L4BC 4GMXA 1AGXA 1GT91 3HVHA 4J4HA 5FA8A 5I45A 2WRZA 1BCSA 3R09A 1V35A 3AHFA 5I48A 2VO1A 1DX6A 1RYMA 3VMFA 1O97D 1OF1A 5F21A 4QBFA 3H1BA 3LM8A 5BUSA 4E2FA 2J48A 1UK8A 4PYKA 4MKGA 3E70C 3HXOA 4LRUA 4C2UA 1QZTA 3N39C 1L5OA 1QE0A 1SEVA 4MAAA 1XJQA 2YWXA 1GLVA 3EPRA 5F1KA 1O94C 1T9AA 1J8MF 2VF2A 4G5OA 5C51B 3FKSA 3OM9A 1EP3B 4HYQA 4C5CA 2PIDA 3QKIA 1AB6A 5E9WA 4NMXB 2OPHA 5B30A 2K7FA 1UBKS 3RYIA 1NE2A 1AVTA 3AP2A 4KTTE 4BEJA 4KP7A 2XUPA 2WLSA 1RI3A 4EW2A 2OTCA 3OLXA 2V6GA 4Y2PA 3AVXA 2O0JA 5K45A 4B3BA 4KR6A 3QLJA 1CS0B 1Z8NA 2IYXA 3BBLA 1CEEA 5DWDA 2ZYUX 1YBMA 1LSUA 5IAOA 2ONJA 3BSYA 3QP9A 1S3SA 4BNYA 2E21A 3WK6A 5DHSA 2Q5FA 1N3BA 3E9ZA 3JVIA 1KDZA 2XNDA 1N32B 5FHQA 1TGYA 1HDXA 4DT1A 4BYMA 5L9AA 1KWKA 3X0DA 1FS4A 3G8AA 3V2HA 3IBCA 3LIIA 1AN0A 2EV9A 5A5VA 5FADA 4WE3A 1JL3A 1GUYA 1NOKA 1P1HA 5LR6A 1TI7A 3LOQA 1EFTA 3NORA 1DB3A 1FSPA 4X85A 1WOYA 1ZGBA 2HHLA 1UXJA 2PZJA 4TZ0A 4DVJA 4G4GA 2XXAB 2AFHB 5B2ZA 1UODA 1KVTA 4KSYA 4IMPA 1FFBA 1PK8A 1U7TA 2B83A 2FPXA 2GK6A 4HDMA 4A0GA 3G2NA 2Z8ZA 4JBNA 2O7QA 2H4XA 3O1HB 3TZEA 3E3LA 1MOQA 1CZOA 3DLIA 4EL0A 5IDQA 1SHJA 1O95A 5K8TA 1IB0A 4JA2A 4NBLA 1K63A 1V95A 1PEDA 1ECGA 4ARZA 5KYXB 1H2AS 3HB7A 3C3CA 2ZI6A 4CI0B 5FBRB 2Y3IA 4JR0A 1YS9A 3D3KA 3VO2A 4QJBA 5C35A 2UXCB 2WTBA 4Q1AA 1P7PA 1E9VA 2QTMA 2Z08A 2Y76A 5AHOA 1W8IA 3U44A 3AEKB 4CIXA 2RHRA 4D80A 2A92A 4ZGWA 3DF9A 1A9XB 3PD7A 4OL0A 3Q6MA 4TV9F 1NURA 3EFHA 3OLQA 5EPUA 4KVFA 2FSFA 1U5BB 4KPGA 5IRCD 5ALGA 1U0SY 4P4NA 1ULZA 2HB6A 4GP6A 4WQMA 1BNCA 5ALJA 5HIAA 2A9JA 2AR7A 2YJZA 3WGYA 1XC7A 3FNRA 3MUOA 5JYCA 4J7XA 4MZDA 1HFWA 3QYJA 4AXXA 3CKMA 2QSZA 5LBIA 1K06A 1U7OA 2HXYA 5DM4A 3TX2A 1JSZA 3IS3A 3GT7A 3NOOA 3G0CA 3EF3A 5AVUA 3TE6A 1AURA 2Q45A 4XDGA 3RFXA 4ZQEA 4LI0A 4OX9Y 1KYWA 1UEIA 1ZD5A 3DDZX 3V97A 5JXIA 2D5LA 3FPEA 4U7FA 4DBVO 3V4SA 4JMPA 2MSLA 1U8YA 4KLRA 5DBFA 4ZT6A 3RODA 3RS4A 1EHIA 1SCNE 1QTRA 1U9CA 2C2HA 1ZSNA 3HN7A 2F3QA 4DR3B 4D02A 2QXTA 1XQWA 2I66A 1HE4A 3CHYA 2ZCVA 3G8BA 4K3UA 4RIEA 3DYBA 5H70A 4EJSB 4ZQCB 2BTEA 2O8FB 1LY1A 1TMOA 1OLUA 3TZHA 1SGWA 4CMIA 4LMRA 4JP8A 4Q18A 4H60A 3LQKA 5IWCA 1K5GA 4C0AC 1H8HD 1GZ3A 2ZYGA 4JUCA 2FYTA 1SQGA 5FUBA 3AVQA 1TJPB 1YRQA 2BFEB 2FWAA 4YFYA 5A5GA 1KEZA 1DGQA 4YCMA 4IBOA 4UAVA 3SXUB 1W4LA 4LPSA 1E3LA 1G1MA 1YRHA 1SPXA 4FNAA 4LK2A 3U3KA 4CKXA 4S04A 2W2QA 1XZGA 5EMJA 4RD2A 5CFNA 3WMEA 7REQB 1BXZA 5UKDA 3IILA 2JW5A 3MC1A 4DIOA 5AVSA 4BUJA 4KHPB 2AX4A 1G0NA 4QBKA 4G1BA 3QLEA 2AKYA 1JR6A 4Y1RA 1W0KA 2GJ4A 1E6CA 2ZE7A 2QRVA 2AR0A 4FP9A 4LDAA 2CT8A 1XLWA 3WAGA 4UBOA 3QQ5A 4W9NA 1DTSA 1CJVC 2FQWA 2NT3A 2OUKA 2XTZA 3RKRA 1Z8FA 3B9PA 1EI9A 4Q7EA 3VNAA 2G0NA 1FE8A 1UWCA 1BZYA 3AEUA 3AHCA 2VNHA 4ALLA 1QOPB 2AOWA 1L7RA 2XQIA 5LQKA 4WXHA 1FJHA 6YASA 1ZD9A 3BL5A 3A3PA 2IYQA 5K0FA 1YBFA 2O0HA 4HDSB 4LSZA 4M83A 2AMYA 2FF7A 2C4VA 3OZSA 1JH8A 1PR1A 3QNUA 4OGGA 2MR5A 3MWLA 1LCIA 3MWEB 3PGMA 2JZOA 2JF0A 4GT1A 3RS8A 1T0PA 3B12A 1KR5A 2HWYA 4WESA 3MRSA 3ENWA 3ITEA 3IQZA 4MRPA 5C1IA 1Q74A 4HLUC 1S0UA 4R9VA 4BO5A 5J4VA 5JV5A 5GOZA 3EOBI 3OIUA 1GNQA 4BXOA 1TKCA 4KOAA 4D8UA 1KY3A 4BTVA 2AMLA 4GP7A 4REOA 4UTVA 4WNCA 1EKXA 1UBEA 3QG1A 4P34A 2YXBA 4R51A 5EERA 3VDMA 2V65A 1A97A 3ZIAA 4O2RA 1R16A 5E6RB 2C2YA 3WB1A 3H2YA 4H4DA 4WOJA 4F5DA 1JJ7A 1W5FA 3C3YA 3K5IA 3MJTA 4O2BF 4ZVTA 4B32A 3UJBA 2B8JA 1EX6A 2IT1A 2XOXA 2WEKA 5F2KA 2WM2A 4YDSA 2XGOA 1OCEA 4HMQA 3G2QA 2BGKA 3GLHE 1GHTA 1HL7A 5IXSA 4DA7A 3FUWA 4UBNA 5IAGA 2WUDA 2OQRA 2X5KO 3IAEA 1U8CB 4RXUA 4QODA 1DFIA 1OFTA 1SXJD 5EUQB 4IIFA 1F12A 2Q49A 4HGYA 1QSGA 2FKNA 1RRFA 4YNBA 1LRLA 3E0XA 4MA0A 2IXDA 2OCIA 4W1QA 1ND5A 1YGPA 1CC1S 2Q5QA 4DMKA 1ID8A 1VOTA 1ZJZA 3NC0C 2JAXA 3L4SO 5EQJB 4E94A 3LP5A 3WYEA 1V9SA 1Z5ZA 4BFUA 5EFOA 5JWOA 5KYUB 2WKWA 4X65B 3PK0A 4BJ6A 3LK6A 5KUTA 2A9FA 2CCKA 1XVVA 2YUIA 3QMMA 4U7JA 1RSZA 4F04A 2GHRA 3R5KA 1HEYA 2V74B 5LQSA 3ZKWA 4UMEA 1J06A 1GPMA 3THSA 1I1NA 2CLFB 1LVUA 3AKYA 4P5DA 3LKZA 5JTTA 3I2JA 3RI3A 2GEDA 4MUGA 4ND8A 5DTRA 1CYDA 1J8FA 1D1QA 4GOKA 4LXGA 4X44A 3D6NB 5JE8A 5B64A 2EX1A 3AUSA 1QG4A 3ZI7A 2PS1A 2I3GA 3HBFA 1H5UA 3AF5A 3VR6D 2H9YA 4WKPA 3DLTA 4K1LA 2HM7A 2QRNA 1R9NA 1ZVQA 3I9MA 4KMOA 5K8VA 3AY0A 2Y0EA 3DLPX 3DD5A 4O1MA 5IM4F 1RHKA 4I4TF 3OJOA 1VZ2A 1M6VA 2O2GA 3DBHB 2GJ8A 3GARA 3JQAA 4GKVA 4TUYF 4B09A 2PQMA 2FHPA 4FCTA 2CVFA 4NZPA 3B85A 1UKAA 1NBME 4FOLA 1QTNA 2JIOA 4ZFNA 4TYQA 4B47A 2IXGA 2B8WA 2J87A 3BMOA 2H92A 3HDVA 2HRCA 3HKCB 2CFCA 3FSRA 3M81A 4YJ3F 3S8MA 1GG2A 5JNUA 4X63A 2BCGY 3PIRA 3LL7A 4YP9A 5L3QB 2PWBA 1FFGA 1ODKA 2BFPA 3FUVA 4TN5A 4TLAA 2N47A 1W1UA 3WKAA 4CIWA 1H4VB 3L5KA 4IYRA 4AZ0A 2GBPA 3PXUA 4IJUA 3M3PA 4RXTA 1LEHA 1IQPA 1XE3A 5A62A 5BNWA 1UBJS 5I5GA 4LJ6A 5KHOC 1ISHA 4QEDA 2JB9A 2EJWA 1IBSA 1PLKA 3ZTTA 1T8YA 1SUPA 2KBFA 2RGBA 1THGA 3ZQJA 1XEFA 1EQAA 1E3DA 2QTCA 3DZHA 3ILYA 4CF4A 4W5HA 5M04A 2G63A 3O0TA 3TUIC 4O5AA 4D9EA 1ZJJA 1Q1AA 4Q03A 1AKTA 2PKXA 2AYYA 1MHPA 2A30A 1AHHA 2QENA 3ILHA 4HTFA 4LA4A 4QXOA 5K0BA 1THZA 3G49A 4EARA 1JT2A 4JVNA 4OHFA 4PIVA 4RPCA 5JANA 2IOYA 3RUDA 4HTAA 3JAKB 2QQFA 3RIHA 3AYXB 2N42A 1ISIA 1SBQA 1ZICA 3QY9A 3KELA 2B9EA 2OCPA 3TMKA 3TAUA 1NYQA 1H2RS 3DUFB 1IN5A 1W46A 2BE7A 4GX2A 4OYRA 1N5LA 2IHVA 1R6TA 3HCFA 5EHIA 4ZARA 4AN1A 2L82A 4B5LA 2O8BB 3VPSA 1R3UA 4YUVA 4IDGA 2HSEA 5ICCA 1K8ZB 2V58A 1HM5A 2GCEA 4S3MA 2VF5X 1N57A 2W71A 4MA4A 3P0JA 4YFVA 5DP2A 1LJ8A 2Z09A 1JJVA 2CJWB 4N54A 4UVIA 4LGYA 3CUYA 4TXLA 4UNNA 3ROKA 5IH7A 3SQWA 3IALA 4M0EA 1AS0A 4AI6A 2BCJQ 2X23A 4QJ5A 1NIJA 1L8XA 3AUKA 4TMKA 4DDTA 1POWA 2B4QA 2C98A 1E96A 3CR8A 4OHRA 4GVLA 5BN3A 4E2XA 1HV8A 1ADFA 3K9BA 1PTJA 3EVBA 2Y1KA 3CU5A 3VMMA 4BU0A 4DMUB 4F6LA 4DLSA 3JYPA 1EK5A 2W2NA 4YC7A 1P2VA 2OAEA 4GMDA 5EIEA 1L7VC 3LFHA 2P9QA 4ISBA 1DCKA 2NUTB 4X60A 1P4JA 4ZDJA 3R9XA 4IFBA 2RHCA 4PFKA 3UMGA 1GQQA 3QV2A 1NJGA 4JXJA 2XGMA 4YRDA 1OD6A 4X00A 3TZBA 3BMQB 1AZWA 4M55A 2X19A 1XLTA 4GGOA 5LIRA 5KNCA 1OH8A 1ORVA 4HEHA 1BKDR 1KIFA 4MEJA 1QP7A 3GG9A 5AKYA 1H1LA 4XVQA 1WY5A 4E5VA 1WBJB 1TM1E 3QF7A 1X92A 4OLFA 3SHVA 2W6IA 1L7XA 2PVSA 4G63A 2NT4A 4L85A 1WCV1 2EG9A 3QHQA 3ELYA 3GJZA 4QLAA 5K7SA 3BS4A 4OHZA 1WSAA 3L0ZA 4A8JA 1NFQA 4TGLA 4YR7A 1KEPA 3NHLA 3UUGA 2B4YA 1WQ1R 3F9RA 1Q7GA 2GSWA 4BX3A 2E7ZA 5AVXA 2BDUA 1KA9H 2XCIA 3DBRB 1UM9B 5HFJA 3BK1A 3KR9A 1YZVA 1G4AE 1URPA 2G5GX 1BEUB 3CFYA 3QZUA 4HX5A 1NRXA 1PWEA 5F23A 1NX9A 1ZCZA 2ZOSA 4BEVA 1IM8A 4JJ8A 4KO1S 1HNXB 2VAXA 3SZMA 3DO5A 3E9QA 1LBTA 3G88A 3F6SA 4JFRA 4WNIA 2R8PA 1SEPA 5B3JC 1M34A 4EG6A 5GTDA 2WVJA 5DBHX 4MJLA 2XDQA 3FBTA 2WWTA 4GPIB 1LSJA 2FFBA 4WZZA 3GHHA 4EG0A 3STYA 1L0BA 4JYZA 2ZYHA 1R4AA 5SICE 3T9EA 4EK9A 1QNFA 5J2TA 1WPRA 1YZTA 2QTVA 3ONWA