2XYHA

Caspase-3:cas60254719
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CASPASE-3 SUBUNIT P17
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xyhA00
4QU0A 4QUAA 3RJMA 4ZVOA 3NS7A 1RWNA 2CNKA 2C2MA 1RWPA 3SIRA 4N5DA 2H54A 4JJEA 1RHUA 5LU9A 4IEFB 2QL9A 1RWMA 5IAEA 2XYGA 4DCPA 1GQFA 2WDPA 4FEAA 2H65A 2FP3A 4IYRA 4QU8A 1KMCA 1IBCA 2J32A 5IBCA 4D3ZA 3E4CA 4EHFA 4JJ8A 1RHMA 2H5JA 5IBPA 3V6LA 5IC4A 4FDLA 4EHDA 5IC6A 4QULA 3ITNA 2J30A 3V4LA 1RWKA 3IBCA 3R7BA 2Y0BA 3R5JA 2K7ZA 3S70A 1RHRA 3H0EA 4N7JA 5H0IA 1F1JA 2H48A 1I4OA 3EDRA 5LU8A 1JXQA 1F9EA 4HQRA 2XYPA 4EHHA 1I3OA 2XZTA 3H1PA 5IABA 1I51A 2P2CA 3D6FA 3GJSA 4QUEA 5LUBA 1SC4A 1SC3A 3PD0A 1RWVA 3GJTA 1GFWA 3PD1A 4DCOA 4EHKA 4ZVPA 1RHQA 2CNNA 4JR1A 1PAUA 3H11A 4M9RA 2CJYA 4N7MA 1RWOA 2C2KA 3NR2A 1QDUA 4QUDA 3KJQA 5IBRA 1CP3A 3H13A 3UOAB 1K86A 4EJFA 1SHLA 4N6GA 4DCJA 1QTNA 4JB8A 4JJ7A 4EHLA 3IBFA 5IANA 3KJNA 4QUGA 3V55A 4ZVSA 1ICEA 3P45A 4AWBA 4NOKA 1I4EB 1NW9B 4FXOA 4QU5A 4JQYA 2CJXA 2QLFA 5K20A 2QLJA 2QL5A 4D3YA 3GJRA 2H5IA 4JR2A 1M72A 4QUIA 3UO8B 4QUHA 3V4OA 4D3XA 2Y1LA 1QX3A 4ZVQA 1CVRA 4AWAA 1BMQA 2H4WA 5I9BA 4EHAA 1NMEA 3NKFA 3KJFA 2FUNB 4EHNA 3OD5A 3S8EA 4I1PA 3SIPA 3DEIA 3R7NA 1NMSA 2C1EA 3D6HA 4ZVUA 3D6MA 4FGUA 4PRYA 3DEHA 4QTXA 3PCXA 2FQQA 2HBRA 2J31A 2H51A 4PRZA 1RHJA 2C2OA 3R5KA 1K88A 1SHJA 4QTYA 1NMQA 2C2ZA 4PS0A 3R7SA 2HBZA 4HVAA 3H11B 4NOMA 2QL7A 1RHKA 2CDRA 1RE1A 5JFTA 4N6NA 3P4UA 1SC1A 4QU9A 5I9TA 3BIJA 1RWWA 3GJQA 4JQZA 2J33A 4AW9A 5IAKA 2DKOA 2XYHA 1PYOA 2NN3C 5IASA 3V3KA 3K7EA 5IAJA 2H4YA 4NBLA 4ZVRA 3R6GA 4QUJA 4ZVTA 2AR9A 2XZDA 4PS1A 4QUBA 3DEKA 4NBKA 2QLBA 3QNWA 4NBNA 3V6MA 3R6LA 4NOJA 5LUAA 2HBQA 4N6OA 4NOLA 5IARA 2CNOA 4JR0A 5IAGA 3DEJA 1RWXA 3EDQA 4I1RA 2CNLA 4HQ0A 4LSZA 2HBYA
chains in the Genus database with same CATH superfamily
4NEGA 1QO9A 2GAFA 1CLEA 2PH3A 2V9CA 4DBZA 4DIFA 1H4TA 1JAXA 1Y1TA 2XGSA 3FCEA 4LXXA 4O29A 3BPSA 3I62A 2W6NA 1YE8A 5JMWA 4MV4A 2O7NA 3CBGA 2RGRA 1LBTA 5J2TA 3OOSA 1AE1A 4AG6A 3FJYA 3T9DA 4Q0MA 1D5WA 4MGZR 3FE2A 1IQPA 2OCXA 2L19A 3L1VA 1XNHA 1C0PA 1FYFA 2WTXA 4DMFA 3KK0A 1KDZA 2O50A 4N7BA 3GEIA 1J22A 5ALGA 5F33A 1VPLA 1OBHA 3T0FA 3V5NA 4BMNA 1BQ3A 4GT1A 4ZEVA 1UKYA 2FFHA 4HWTA 4L4UA 1YJBA 3UUGA 3HCFA 3I9KA 3BCRA 4RVHA 1NN5A 1TB4A 2EJVA 3OLYA 3AZPA 3EGXB 3F98A 3LUBA 2JK0A 4GE0A 4OQDA 4ZC1A 2BTQB 3SJCA 4DXAA 2OLEA 4ETWA 1HV8A 1TJ3A 3EXG2 3FPBA 2LW7A 3PT9A 1SC4A 2QXUA 1IMOA 4BO3A 1T0HB 1T1GA 1YBAA 4I1IA 2QZ9A 1DQYA 1V4NA 2R8YA 3R3ZA 1F5SA 4RKEA 3TVDA 3PDJA 1XZCA 4DIBA 3AETA 3TQQA 3A58B 4MVJG 2I4TA 2QYOA 3EEYA 1BE8A 4CIDA 4DNFA 4F0JA 1ZGHA 2ODWA 5DBEX 4BDTA 1GVNB 3JSAA 2XTJA 1K86A 3JZAA 3T4UA 1HTBA 1OX4A 1EU1A 2PH5A 1AGRA 2DTXA 2PSFA 2Z2KA 2O1XA 1YR2A 3NC1C 1J2EA 2O05A 2GB4A 4HAIA 4C87A 2WJIA 1NLMA 5IANA 4IINA 4NPHA 3LZCA 1HSOA 4Y6LA 3LT2A 1O1YA 2H4JA 5EG5A 3REGA 4ZT2A 2VYFA 3GRYA 1NSTA 4J03A 1KZ9A 2ID9A 4AJLA 4KQIA 1THMA 2ZUUA 4L0DA 5KYYB 1YK0A 4Q3EA 5A71A 2IC5A 2RGYA 3C39A 3QTLA 4IZOA 1VL1A 1V25A 4I55F 5JD6A 2O3JA 4RTRA 3MG9A 1YB5A 4YJDA 3UJ3X 4JP1A 3VA7A 4LPKA 4MQLA 4RPJA 1C8BA 1E4OA 3SIPA 4LF7B 3L6DA 3GG2A 3JQCA 2NUAB 1XZNA 4UHJA 1N0UA 1O6CA 2JGRA 4TKUB 1CUIA 2BGMA 1VLZA 1CK4A 1Y4AE 2WVHA 4AJPA 2BFEA 4ZI2A 2B6HA 1ISMA 2Z1MA 4JBNA 1N0HA 3QJGA 4B74A 2DUUA 4UUOA 3DO5A 1Q1GA 3BXGA 1U2QA 1EDOA 3LBHA 3QLEA 4XSGA 1HLFA 4LDQA 1EMDA 2LE0A 5A3SA 1L4LA 5DE3A 3PLNA 2FEPA 1J8YF 3PUZA 4JXZA 5K3AA 4KO3S 5ALRA 1FP4B 1DCKA 2C3YA 5DHPA 2YXNA 4LNAA 3CLHA 3B52X 3CO5A 2XB8A 4NYIQ 3MFQA 3NC0C 5TC4A 4C4XA 4P83A 1TEVA 1KJIA 3TVTA 4DLZA 3GLIA 5L53A 3WADA 3BEOA 4PX9A 4LRUA 3UH1A 4E31A 1GU1A 1CZNA 4QOEA 3G5MA 3AWDA 3LC1O 1X7GA 1UP6A 4L50A 2VZEA 4NDAA 4L95C 2C58A 4P6VF 2P1DA 2ZTUA 3FKSA 3OY2A 1Z68A 1WVGA 1GA4A 1O6ZA 3OJCA 5JRDS 4M86A 4PC6A 3WZMA 3DQPA 1CEYA 4WINA 5KVQA 4EZEA 1GGMA 2OC9A 1XDWA 5K8VA 4GF5A 4R0VA 3SVTA 2QOEA 3EWAA 1X1TA 2F6RA 2P2ZA 1ULZA 4FZVA 3A6KA 2PLAA 1SUDA 4MMZB 1ISSA 4CGZA 1YBVA 2W22A 3ONNA 5ED4A 1ZUD1 2G63A 5BV7A 1ZESA 5ESDA 8GPBA 2NNWB 4CV2A 4WOCA 1VGQA 5CDHA 1B1CA 4XYLA 5M2QA 5LLTA 3MCTA 4Y1RB 3B9BA 4H7DA 1VJGA 4ZAVA 2O8EA 3IVXA 3LYLA 3RSZA 1T2NA 2W4QA 2NQ8A 2QMUA 3QUCA 3ZDEA 4YRSA 5GVSA 1D6SA 1HG0A 2GZ1A 2H48A 3GGOA 3TZCA 4KRFA 1BE6A 4LDNA 3EZ9A 4DCNA 3M6LA 2P9QA 3JTMA 2OFPA 3IURA 2P6UA 1WTAA 2IPNA 4QBHA 2OECA 3U3MA 4AZ0B 1G9TA 4P3KA 3GLFE 2E87A 2JEOA 4MIEA 1BXGB 3E5MA 5TE9A 1P0PA 3AXTA 3R23A 3TTUA 4PZDA 4E2ZA 1BZYA 3QYJA 1UEIA 4UUQA 4HH0A 4RTLA 3U7GA 2ALJA 3IP1A 3CNLA 3Q5DA 4ZXFA 3PTLA 2DFVA 1DV1A 5SY4A 2RHJA 2VYNA 3F7OA 4UE6A 5D5HA 4ZREA 1J5XA 1U3FA 4C5BA 1GRVA 2D06A 2PS9A 2XGMA 3P45A 3GEGA 3WP1B 4KXNA 4S1WA 2YQZA 1DEHA 3GDHA 1BWSA 1NHWA 1V6CA 3O0TA 4E21A 1RVV1 4ZJUA 2JA2A 1T34A 4WNAA 1JPNA 2PMBA 4BP9A 4PCVA 5SYMA 4CCYB 3TZHA 5ELXA 1XFAA 1LPMA 3CLVA 2CN1A 3GUVA 4I2NA 4DC9A 1W36D 1BXZA 4DLKA 2E9SA 2IXAA 1NT4A 2X4GA 1JHRA 3D5EA 2JEZA 1P0QA 1M33A 2DH6A 4HTFA 4JEIA 4UXJA 2C4UA 3ZE2B 2O2SA 1MAUA 5JCZA 4G1MB 5KJCA 1EGQA 3PCXA 1GZDA 5E9AA 4RWZA 2FQQA 2JRCA 4U39A 4BVGA 1N78A 1YHYA 1FYXA 4U4AA 2FUKA 2PT5A 3PNYA 4PLTA 3UK2A 4AKTA 1V1MB 3FFWA 3VJLA 4ZCTA 2QN9A 1UFKA 1GPLA 2NW6A 3FNHA 4Q3DA 4LJSA 4IHKA 5AQ1A 1WNTA 2CZGA 1XJ0A 3DFIA 2V45A 3E05A 2W6JA 4RHCA 3TZEA 4UTNA 3A4IA 1VPVA 1OB5A 2NTJA 1M2FA 2HK7A 4KQMA 4B7CA 2ZZNA 1DUSA 3PUXA 5K0EA 4J75A 1S6YA 2PPVA 2QR3A 3C8HA 2DHQA 1EWVA 1GNSA 2RGCA 2RGWA 2GF0A 1ZK3A 1LTQA 1M34E 1NXOA 3C3CA 5CLGA 1IMJA 3GYBA 1M10A 5DDIP 3TAHA 3U4GA 1NUUA 4NBNA 1CUGA 1VSVA 1WKVA 4KYIB 1T24A 1LU9A 2FETA 5CT4A 2H57A 4RK4A 1FLAA 1E32A 5TY0A 2XZOA 1T1JA 2J46A 5B1SA 2C96A 2CDNA 4FGSA 1ANKA 1MH9A 1V48A 2BEJA 3DFKA 2BJVA 4LXUA 4XLTA 1A4RA 3IAUA 4MVYA 5AM1A 5HJ7A 1IDOA 2F9MA 5J2UF 2ZSIA 3L93A 4R0NA 1SUCA 1KJJA 1SN7A 1NXQA 2VDJA 3AIKA 4IFTA 4O5AA 1VMKA 3JQ6A 3H8VA 3KTAB 1Q7GA 4PGFA 4TROA 4CFZA 5A7FA 1ADYA 1ZM4A 2FSVC 5EJMA 4Y30A 3O4RA 3IT1A 1TC2A 1KVUA 3LC7O 2Z4RA 4R8RA 4S3MA 3GY0A 1LB1B 4KQWA 2ZB2A 3THXB 5FPSA 1GL9B 1L5KA 3LIIA 4RA6A 2AL7A 1JZTA 4RFSA 4IOLA 2O2CA 1B14A 2CVPA 2IV3A 5JWRA 2XMCA 3G8CA 5F9FA 4L0MA 1UBMS 3OURA 3IAS1 4CM9A 4JI6B 1BFKA 3LUHA 1BX0A 3QUAA 1XDUA 4N47A 1PFKA 1XRJA 2XUDA 3TCKA 5B6PA 5AVTA 2XXAB 3UXEA 2QZSA 1NY5A 1P33A 2P3OA 1D07A 2PA0A 5AI0A 1F8UA 5BV2P 2XNSA 1H4QA 3QFHA 3LK6A 3WYDA 2GUWA 1ISIA 4ZVPA 1JJFA 1MABB 2E0IA 2IGTA 3H04A 4O4HF 3HC7A 2OYSA 3FWPA 1EJ2A 3C7KA 4B7XA 4PV7A 1EUDB 1B8PA 4HWGA 4OQMA 3RYHA 2AG5A 3TVYA 1O97D 2ZAMA 3ZY6A 1TTHA 3O3OB 4RDHA 3R0QA 1M1NA 2ZUSA 1T25A 2WZCA 1BHO1 2I6FA 3D7RA 3DF9A 4XWYA 4TYYA 2F8TA 2LTAA 2FQYA 5DGCA 4AWBA 1W85B 2PRKA 3DO6A 4JLAA 4ESOA 1I5RA 1T5LA 1WR8A 1DKMA 3FD8A 4MR8A 5K20A 3C5CA 3ROKA 1NT2A 1UQTA 5JJIA 2P2YA 4HDRB 1SU7A 4MVJI 4KR6A 1UQUA 1R0XA 4AJ2A 3EC1A 4PXAA 2YWHA 4XLZA 4OKSA 3LP8A 2AE1A 1OTXA 1FLNA 2ZEJA 1WXFA 3HY6A 3IQFA 1KC3A 4EZIA 3OLXA 2D1YA 4PN7A 4EHNA 4PQFA 1C9YA 2DUJA 5DHSA 5KDLA 2NVUB 3HJCA 2L69A 1KO8A 1U5AA 2BELA 1B8NA 3C1OA 3L9XA 1E7QA 5H1YA 5LWHA 1CNFA 1COZA 3HA5A 1UZMA 4BNWA 1AHHA 1QS0B 2FG5A 4ZT5A 1L5LA 3KSRA 5HKOA 1F0KA 1H65A 1B0PA 1Z45A 3QA9A 3H9EO 2J9XB 4AF8A 2GEVA 3DD1A 4WAUA 3CPSA 1T4GA 3A36A 4JL5A 5FI5A 3PQ6A 1WL8A 2QJWA 4X1YA 1GWNA 2WF9A 1R5OA 2J5QA 3CEHA 3QTTA 4Y0NA 3OLQA 4LZPA 3QRWA 4HTFB 2V4UA 2OFXA 1YHZA 1UZUA 2YHIB 1KEZA 4B3BA 3VSEA 1D3AA 4BTLA 1QRRA 2ACKA 1RRMA 3ID6C 4PGHA 4WECA 1TO2E 1WZUA 2A9RA 1FDVA 3LFUA 4XASA 5I5GA 1S2LA 2OO5A 2Q1SA 3CURA 1FZTA 3MCUA 5MGNA 1KH1A 2IHBA 2ZRPA 1GPH1 5BWCA 3T9CA 1KY5A 1HZZA 5TT1A 1TUGA 2XCQA 3AR5A 3LUFA 5FWXB 2PUCA 4MTLA 3GJ0A 4EITA 1LSJA 2PE5A 1L6RA 4QLBA 2E82A 3FHOA 2EERA 1E5XA 1YMQA 3G6WA 2VDKB 1BROA 2Y4NA 3JQ8B 5D51S 4G5RA 3FVRA 4Y2JA 3AMVA 3ASVA 3WRWA 2RK4A 2HXYA 4NNPA 4QUKA 2OBXA 3AM5A 4RMJA 4YRAA 4ZDWA 1SUFA 5G02A 5DBFA 1EFVB 1V96A 2IEIA 2FB9A 1ABBA 1R16A 4IIFA 5JVDF 4MW7A 2CXTA 5AM5A 4CLHA 2O8DB 2QN2A 4BN4A 5JJBA 3G49A 1XZ8A 1GNRA 2QQFA 2X14A 3H9UA 1FNDA 1Z4KA 5C5DA 2HMVA 3E15A 1PZNA 3MPUA 4PYLA 2HOQA 5CNIA 2QRMA 2RKOA 1S9DA 2X4DA 2ZYTX 4DTCA 1R8JA 2CE7A 3A10A 5LQAA 3T3IA 3ME5A 5AM3A 4LF9B 3KSUA 3SPXA 5AVKA 2FDXA 4CQJA 5J47A 1KSFX 1V9SA 4IIBA 3IYLW 4V0SA 3RD5A 2FE4A 4CETA 3ESAA 4HWPA 1ZX1A 4F92B 3ED5A 1EE1A 2QRQA 1F8FA 2HY7A 4GD3Q 4IF4A 4LGCA 3D64A 2WR8A 3CFYA 2AK3A 4Y6PA 2CVZA 3P4YA 1ZK0A 1QDUA 3ET4A 1WXXA 3SHTA 3TDMA 1FLVA 4OAOA 5ARDA 3EDOA 1XZHA 2ZUWA 1L5HB 2I6XA 1GV1A 3IBTA 2VRCD 4HEJA 4K81B 3DHVA 4XGKA 4QRHA 3GN1A 2GN4A 3BKWA 4PLWA 3KOZA 4V0NA 3BE6A 4F5ZA 4KZPA 2P4UA 2VJMA 1W35A 3DXFA 3HXPA 2RC5A 4G0NA 1LCIA 2WUWE 4J7CA 4L9RA 4U5QA 4XZ3A 5HS6A 2XKBA 4CIXA 5H81A 3EOAI 4IMPA 1IG0A 3SXJA 4LHXA 1C7JA 2AYXA 4Y6OA 1YTLA 3AFNA 5IJ0B 3OOJA 3V2UA 1KU6A 3OTHA 2RHDA 4ALNA 3QWIA 1JDSA 3LXMA 1YB1A 1WSDA 2Z30A 1NVTA 1PFYA 4US0R 1OAAA 1SKYE 4TV9B 3DL4A 3D6MA 4DILA 1ZC4A 2IPLA 2OEPA 2C8LA 3BD7A 4PX3A 3T3EA 1OIVA 1FY2A 3EDMA 4PTLA 4B4UA 2ZRGA 2X8WA 3E9CA 4NMMA 2I34A 2WWRA 1ZM9A 2PAFA 2Q0HA 1FC0A 4QQRA 1U31A 2UYYA 1E96A 3OZCA 3QYPA 3T7IA 1H42A 1P1BA 4M0LA 3UAVA 5CLJA 3MMPA 2VSYA 3NHAA 4Z7OB 1RYFA 2EFHB 5IKPA 1VHQA 3MBOA 4HH3C 1QPZA 2BISA 1T6XA 3DZIA 3H11B 4MRMA 2BGGA 3WV4A 4URZR 4EB0A 4EDFA 4WH0A 4MITA 2O57A 3C6KA 2HF8A 4PR3A 5DHQA 2J33A 4QYXA 4Y9UA 2OHFA 1FMTA 5EUQB 3TQFA 2AN5A 4K1XA 3VHXA 4DT1B 2O1EA 3LGSA 4JB2A 4Q9JA 5KTMA 3JVDA 4DRYA 2DX7A 2RGNC 4OP3A 4R16A 4WK2B 3T1NA 1TEZA 2IYUA 4IIHA 3OFSA 1JSZA 4XB6B 3H5WA 3RRJA 2AX3A 4L8YA 4UASA 4F4IA 4R01A 1TKBA 1L7VC 5ALOA 2RHHA 3OCWA 5KX5F 1DSSG 1HGXA 1WU8A 2VPYA 1K5HA 1HLGA 3OU2A 4P82A 4N9QA 1OUMA 2DM6A 3FX2A 2C94A 2ILVA 2FFBA 2R6DA 1OKKA 2QUJA 4WNIA 3FH0A 3MRTA 4MR7A 4LJRA 3E1GA 2WG0A 3E48A 4JH0A 4EW1A 2IEAA 2PKQP 3RLIA 4E32A 1QFJA 5ERGB 3HVRA 5CA1B 3ZXUB 2FW7A 4IV8A 3WA6A 3OTWA 4EYGA 3L02A 3X2SA 1NQAO 4JJ8A 2BH2A 2QUIA 1MX9A 2GLTA 3F5QA 3N6RA 2PJUA 4RGYA 2I03A 1BCRB 4IRXA 1GG2A 2PYZA 2ZJ3A 5ANRB 4EELA 1A4UA 3F49S 4P4SB 4RVUA 3GL9A 1Z6ZA 4R8MA 4Q3AA 3R7BA 2D2FA 3CNQS 2OO7A 4H7IA 4HGNA 5J1TB 1G64A 1V7PC 3BWMA 4P2BA 4F21A 1AKRA 2PG3A 5DM2A 3UWKA 1CJUC 3DBLA 1RBYA 1GPAA 1KS2A 4AZWA 1GZ4A 2EZ4A 4H7JA 2BFDA 5F9HA 2CJYA 2ZITA 1PEKE 2CFRA 5AVOA 2W00A 3KPWA 2ENUA 4JNKA 4IJVA 3EMVA 4O2RA 3U3RA 3WLTA 4UFPA 3RREA 5CA1F 5D7NA 3N8NA 1OGYA 2A9JA 5AKHA 1SU4A 4TYPA 3RS9A 3TBFA 2EJUA 2ZETA 4B5KA 4DL9A 3H6HA 2O20A 5I4IA 4WBSA 1ENZA 1P7YA 2VJLA 2W5UA 3FVTA 3CKYA 1MU0A 1P8AA 1U0SY 2ZCVA 3I37X 1U5CA 3JAWA 1X7WB 3MT8A 4OHPA 4HPWA 4EEKA 5IH7A 5AVJA 1E7SA 1XZLA 1WMEA 2AR0A 1E3TA 2H9YA 3COJA 2Z4SA 1PDVA 1BA2A 2ONZA 3QLVA 3OX2A 2Z5VA 5IM5A 4B6RA 1VG9B 3FBGA 4YRJA 3G2KA 1O7JA 4DEVA 2HA3A 2O8EB 3HM2A 1ZLXA 2HK9A 2QR2A 3CJTA 4DBLE 5LXTF 1KE1A 2JLZA 2GYVA 2Y1GA 1SBCA 1VA4A 1OW3B 1FRFS 2G83A 3SU8A 4BFSA 1TAUA 2NZ8A 4KQHA 3GJ3A 3KV1A 4OB6A 4ZCRA 3O2SB 2OQ2A 3QU4A 1C2YA 1L7EA 5TMEA 1CUXA 2HSEA 5JS8A 4C6TB 4P4UA 3QG1A 3F7MA 4ZDIA 2JVJA 3KAJA 2CLCX 4JIMA 1EK2A 1SZJG 1YQGA 2ZJ8A 4EEZA 1NONA 2Y0PA 4KFSA 5DTQA 4NJEB 1H9CA 4BCBA 4QGFA 2ZTSA 3C87A 2IGBA 2WU0A 3MWKA 1GT6A 2B83A 1YVUA 2RKWA 2FDCA 3ZLVA 3RHZA 9MHTA 1K2WA 1U8YA 3BRQA 1E3WA 3BJEA 2EJTA 3M4NA 5K8LA 2P6MA 3IRVA 1QH1B 4G26A 2QTTA 4A10A 1X13A 2XUFA 3MERA 3QLUA 5TPZA 4LVOA 4ZZIA 1SVMA 4X1KB 3CMMA 4LHYA 4UDYX 5KO2A 2XBLA 5KNDH 3FCAA 3UUEA 4RDIA 3PGXA 2ACVA 1OLUB 3OF2A 3ZVLA 1XO1A 1UDAA 1V95A 1U2SA 3FNGA 5HMLA 2UYGA 2YV5A 4G1FA 2OBFA 1KAEA 4J0IA 2W2KA 4RZHA 5CUQA 1N7JA 1GKKA 3KYJB 4D42A 2JLXA 3MTGA 1CX9B 3N39C 3ZZ0A 2G4LA 4HX5A 3DOIA 2XVAA 3OUTA 2FEXA 3I42A 2R1ZA 3LBFA 4LOIA 721PA 2OR3A 1UOEA 2A94A 4G5GA 2DR0A 3MN1A 3DHNA 4L4XA 2Q5IA 1WCV1 3GN2A 4QLOA 5COQA 4C0LA 4P7FA 3GEPA 2N3ZA 1Y9DA 1KEPA 1KVTA 2A88A 1EGMB 2GZSA 2NT3A 2P4SA 2OHGA 2Q99A 5DYWA 1YZKA 2ABWA 3GGPA 5K0NA 3HCBA 3T1QA 4DT1A 1E3LA 4HXEB 4G01B 4RZSA 5KTSA 3M8KA 4MWCA 5KI6A 1CJMA 1YKSA 4B4VA 5JH7A 5GJBA 1B23P 3IQHX 4FGKA 3W7VA 4JX9A 3X2EA 3FOAA 1YE5A 4KXMA 2NYAA 2K6GA 3U44B 2C7PA 1JEQB 1U81A 3DUWA 4TT3D 3LNTA 4PG7A 3AR7A 3E23A 3GUZA 4JV5B 5TPWA 3V34A 4B6EA 4XQEA 3ER8A 1T8RA 3R0ZA 1XZEA 4JXXA 1UOQA 3Q3VA 1XVAA 3AKEA 3UT6A 3R24A 5M7EA 1KSGA 3CPHA 5HOQA 2UUCB 2VATA 4K87A 4EG3A 1DAOA 4J1TA 1CF9A 1DLJA 3G9QA 2K87A 1IQ0A 3LZ6A 3VI4B 5K0GA 5IULC 1P9LA 1I0ZA 4F7WA 1ADJA 1MUUA 4KGDA 1PJSA 5EQTA 2FKNA 3L7DA 4YUXA 3KIPA 3KUDA 1B8VA 5LM3A 4JLMA 4N0QA 2NUTB 1BAPA 1XVLA 1GL3A 4HLDA 4DCJA 1M34A 1ONBA 2PKCA 4YMGA 2WM3A 4PSAA 2I29A 4ZVVA 4N41A 1T15A 4FFVA 4WESB 3T99A 2FZEA 1XXHE 1Y8QA 2PQ2A 3QNUA 4W1QA 2RKBA 2W2TA 1ZXBA 3EVZA 1E62A 2K5UA 5B1HA 3ZY4A 4D4GA 4DIMA 5H16A 4X1KA 4Q7EA 5ECGC 5EL0A 5HM6A 5FTMA 1AMUA 1ODLA 4CJXA 2WSMA 1KS9A 3K73O 3GT3A 1ZXXA 4RELA 3EA4A 1LC0A 3CHYA 1TAGA 1RYYA 2JFYA 2Y3IA 3ND6A 2R8OA 3BMQB 2AG8A 3OZXA 1U8FO 2WU1A 1Z6YA 2BHSA 1VYHA 2RC6A 4PPNA 4X1IA 3RSGA 3EVEA 3GR6A 1BEZA 3PUIA 4XDZA 3T7RA 3LECA 3PXGA 3KG2A 2ZB8A 3JD2A 2XA1A 2VP9A 4GC5A 3IA7A 3DDHA 5KVVA 1R50A 2JCBA 3OEEA 1O0BA 1E7WA 1NUPA 4KWTA 3HYTA 5IKXA 1L4NA 3M2TA 3RS3A 1RJDA 2D0OB 3AR6A 1Q0TA 2C5SA 4KIGA 4HNVA 3FNRA 4OLHA 1QFSA 3GGJA 3HCWA 3GJQA 1UXJA 1YJAA 1AMNA 2N9UA 5FOTA 1C9DB 1JX6A 2MR6A 2NTVA 2HH9A 3FA2A 3NHKA 4LBWA 5CM9C 2J9ZB 5DWDA 4Q4LA 2AUNA 4BV2A 4UZSA 4FYPA 2PXAA 3HLKA 4UJ3A 4X91A 3NWOA 3G82C 2CNOA 4HVLA 3WQQA 4BGIA 3V97A 2JZOA 1MCZA 5FOUA 4EFNA 3O94A 4GHWA 2WQ7A 1LI4A 5C51B 1CS0B 1T0PA 1TYAE 4NZYA 4PZ0A 5DPMA 5JAQA 5JCJA 4X66B 3RBZA 5LFAA 3OFKA 1Q74A 5CX1B 3EGDA 3F5SA 2MMGA 1N2CE 1R4ZA 2YWXA 1X77A 2YWBA 3FM9A 2NSJA 3FZQA 4I50F 3W3ZB 1KEEB 5JYEA 1SFRA 4WQMA 5JE8A 1VP9A 3K1AB 1MEOA 1BE0A 5C7LO 3QJYA 1KDTA 2RGEA 2Y1DA 4RV4A 5B55A 3R5XA 4GOXA 2O2GA 5HK9A 4HDNA 4AWXA 3V2HA 4BQEA 4XRGA 1WY7A 3QX3A 1TCVA 1I1NA 2IXBA 5E9JA 3VR5H 1W4CA 1X19A 3VKWA 1ZUIA 3AEKB 3UUFA 3G5TA 4JI7B 1DT3A 2B8TA 2BHNA 3FYSA 3PNKA 4NECA 3T4XA 1YQ9A 2AFHB 2AOTB 4FYIA 3PJEA 4BVHA 2FN3A 5BSEA 2PX5A 2A3RA 1R27A 3ZV6A 4N12A 1WP9A 2FPIB 1ZPDA 2V7XA 3GRAA 4IL5A 4XIIA 3IHTA 1JKXA 1OSNA 4AMGA 1TI7A 1MRZA 1Z25A 4NR0A 1RWVA 3OTQA 2P65A 3PC6A 3LLMA 1TKCA 1N3BA 1U7WA 2WLSA 2ZZKA 1F8GA 2H7VA 5CIWA 3ZN2A 2XNHA 1GA6A 2C2KA 1Q22A 3H1EA 3Q3IA 3L1KA 5IZ4A 3H3FA 2AFVA 1FU8A 1XAIA 1JHXA 4IICA 2BVNA 3M1LA 2DFTA 2ZRKA 2C83A 4AM8A 2Y1FA 3OEHA 1AT1A 3AVVA 4DYVA 4S05A 3LHKA 1XTUA 1DOAA 1KYIA 5DXFA 3L8FA 3UXMA 5LWQA 2VHXA 4OCZA 2EW8A 1FDTA 2EWVA 1W6RA 3MRVA 1T8UA 2FVXA 4GXQA 5FORA 3H2KA 1JB1A 2Q4RA 3L7OA 3Q41A 2M1ZA 3CNOA 4GYYA 4OBBA 4J8PA 4D3FA 4L02A 4NJOA 5FOQA 3I64A 2P35A 1W2HA 4MDYA 2ZTLA 4GE3A 1N2XA 1CVRA 4GVPA 2VJAA 3EWSA 5KNBA 3WAGA 3TSAA 4XCXA 2C4TA 4MUNA 1M0TA 1K5PA 3BMCA 3OD1A 1OXTA 3PWTA 1SJ9A 1A98A 4IIJF 4LVCA 1U9JA 3ES9A 4RVFA 2J7KA 3K9HA 1OH7A 3VPGA 4PAOA 4MVJP 1P7ZA 2BBWA 2D8AA 1BNCA 4CMAA 2ZJ5A 3AJ9A 4LAFA 3NHBA 2AI1A 2OVFA 4UCWA 5FNVF 1ZL0A 4B3JA 5C2JB 2WPDA 3AHGA 1P4RA 4AZTA 1JE0A 3GDGA 1XWIA 3D2BA 4NDZA 3RCBA 1UPUA 3V8QA 3UAYA 1H66A 2H07A 3QWAA 3MWGA 4DJAA 2I3BA 4N3GA 1DIOB 2NPFA 2BI4A 4DB4A 2ZXEA 3M3DA 1PR3A 4YI5A 4DA9A 1X1DA 1NLUA 1QE0A 4RZUA 2FW0A 5FUBA 4B3IA 5EZSA 2FSIA 4TS1A 2ODNA 3CM0A 2GESA 1GTRA 2XAAA 3I5MA 3S0JA 1C8LA 1IWOA 5IASA 5MDHA 1JJIA 7AT1A 3WJAA 2LRHA 2AUTA 3JD3A 4RX1A 1P5HA 2WD7A 3M6XA 1DJPA 1JXOA 2XUPA 4ZK6A 4URWR 4Y2RA 5CLFA 4ZYUA 5CXSA 3TWOA 4EAQA 1IBSA 1MB4A 3GT4A 4UCXA 4KDCA 4BB0A 3GA0A 3TAUA 4A5SA 2VYCA 3OKCA 5CPBA 3B3JA 3GLHA 4BVKA 2ZIXB 3ISVA 3EQ2A 2OA0A 1E2IA 1D6NA 3O3CA 4H4EA 1H6AA 5B5SA 3WXBA 3IP9A 4U0JA 5DVZA 2F43B 5H3HA 2D2VA 4LQLA 4KWIA 2FWNA 3JAKA 4K88A 1WA5A 1DKPA 2JJYA 4LE1A 3UC5A 2BM9A 4B34A 5BQOA 2I8AA 4AD8A 4F9FA 1U1DA 1VOTA 1SVLA 2VSXA 3LQYA 4D79A 2SKEA 3UAGA 6CHYA 3V4SA 4FHZA 2SNIE 5C35A 4LBYA 4GVLA 3TLGA 3ZXYA 5FCDA 1DRUA 2W93A 4JASB 4EK9A 1TNDA 1FK8A 1G6KA 3AK4A 3RHFA 4JSRA 3VISA 4KXWA 1NUAA 5A04A 3CLKA 2NU7A 2JK1A 3VC3A 2BV3A 1FA9A 1RE0A 4P8RA 3T3DA 2QS9A 4YT8A 4X8OA 4H1VA 2J3HA 2MYPA 2PKQO 3V4OA 1SD2A 2PSHA 2REOA 2SICE 1U3TA 4NEQA 2BSXA 2WF8A 1WJGA 1ESEA 1YXMA 2ONKA 2O2EA 3W8DA 4C76A 4CTJA 4EY8A 2VEDA 1Z0AA 4FOOA 3K0HA 4B2YA 2CJPA 3H1GA 2ILTA 4EFKA 2CNWA 1FFCA 2GCEA 1Q20A 1U0TA 1QWOA 1ZNZA 2NTNA 2JC3A 1ISFA 2QPOA 2VSQA 4Z8XA 4JROA 4ZTZB 3P9SA 4XSVA 1MC8A 1E1DA 3LI2A 4GQAA 4NRDA 4NYIR 1F9AA 3SVZA 5C8DA 1XTTA 3FAKA 1AB5A 3ZWPA 5DTRA 1RJWA 4LHZA 3CO0S 3PTAA 2E5LB 1ZVJA 2VAMA 4MUBA 1UXKA 2ADMA 4EUKA 4Z3DA 5CCEA 3KQHA 1QK5A 3FMVA 1OCEA 3PGVA 4HAOA 1DQZA 1GOTA 2W2MA 4Q7KA 3U3JA 5KB3A 4YMLA 2FE1A 3B6ZA 1NVWQ 1BOFA 2NV0A 5IUNC 3RG2A 2UZ3A 2FSFA 3RT7A 4K7JA 1YJCA 4PNEA 4U9IS 4CUZA 2HMUA 4O2BB 3WSTA 2JRLA 2C2XA 2DVMA 3OZVA 5DM4A 1D4ZA 4DXHA 4F4UA 4JJKA 1ULHA 4O4JF 3KVOA 5FPTA 2G8LA 3VPSA 4IXWA 4X3CA 1I6MA 1BMQA 1IULA 5HX7A 2GZ2A 1XGKA 4G36A 5FL7A 2BR5A 4ZCIA 1CSEE 4FONA 2NZJA 4MPJA 1K8YB 4JXJA 3RAJA 4JX8A 4AF6A 4ZICA 2AV6A 2FN9A 2WZDA 1V8DA 1HFWA 1RJGA 2ISCA 3CZCA 2WMOB 1N5OX 3QZUA 3JZDA 3ZIAA 4DVJA 4F93B 1SOWA 1YUBA 5LNK6 3FIJA 4DLLA 5JI2E 5JNWA 5LZ7A 4DCSA 2WABA 1IUOA 2V74B 3FRHA 2W2XA 4X00A 4C22A 5BMVA 4L72A 3AL2A 5E9WA 4MW6A 3ABIA 5K8IA 1GILA 5BUQA 1GNVA 1RM0A 2O2XA 3AR3A 4TPKA 2CLMB 3H87A 5BYJA 4E08A 1Y3DE 4G5FA 4DV2B 2JDIA 4KN5A 5ERYA 4KQGA 3RI3A 1Q21A 1LA2A 1NTOA 4DV5B 4TYWA 1A9SA 3O75A 3ZU3A 3L06A 1VGRA 4K26A 3GXOA 3R7WA 1R4MB 4Z86A 4CWAA 2XCSB 2VDWA 1P72A 4Q15A 4MVWA 1AZSC 1WF6A 3ZG6A 1GYRA 3OEWA 4D46A 4RTMA 4NHOA 3MRXA 3LLCA 3EAQA 5CVEA 3RW9A 3ZS8A 4RPGA 2C7VA 2VSOA 3Q2OA 2PRJA 3L46A 2QYTA 1QG6A 1L7BA 5ICGA 2YMLA 3I6QA 2A4MA 4PF1A 3BD8A 4FDTA 3U3KA 3GARA 1Y4DE 2R48A 3RR2A 1J6UA 1O54A 1MT0A 2WUDA 4BZQA 1QQBA 3QPWA 3RSQA 2Q6TA 1S3GA 1PR4A 1K6XA 1NXTA 2VA9A 5CBPB 4X5OA 3PCTA 3V4FA 4XM0A 1AB6A 3HYRA 3BTUA 4W6QA 3ZI4A 5AUOB 1Q7EA 1WUJS 4C0AC 1L8XA 4EL5A 1VXOA 3JY6A 1A77A 5IEJA 4PYRA 5CFNA 1ZCFA 5L3SB 5DNCA 2O4UX 3WMEA 2YZKA 3DMYA 4ND3A 1CDOA 3MBKA 2H59A 1WCXA 2XH8A 3SI7A 1N6OA 3VDQA 4AY2A 1BSVA 3FZEA 4UNQA 4ZQHA 3EGOA 4IYJA 1PEAA 4DC1A 2H63A 3OCZA 2YICA 3GJTA 1S3SA 3ZWMA 4CKWA 4US2R 4R8KA 1EFHA 5J4VA 4LWQA 1Z0IA 3QIVA 2QHXA 1Y3BE 4JP2A 4BNIA 2PYDA 4M9XA 2QLNA 3AVPA 3ED1A 3MMSA 4YEDA 5ALPA 2YJNA 1X74A 2C4KA 3Q12A 1ZN2A 2Z5FA 4ZI5A 2QPLA 1ZGBA 2ZYAA 2AFHE 4D81A 5AVXA 3PT5A 4GIBA 3QITA 3QPBA 5ALLA 3EC7A 1XTVA 5K2OA 4B1FA 2RIPA 3EDCA 3U0VA 1ZO8A 1ZISA 5AQEA 4EKIA 1S2IA 2R25B 4L76A 1PX2A 4BE9A 1I2ZA 2B1RA 1ZN8A 1VLVA 3QFSA 4PHFA 3ZH9B 4B3DA 1H3EA 2O7SA 1KQ3A 1JZSA 4I9UA 1OYYA 4NBSA 5E1OA 2JAQA 3VZSA 4B0PA 2ZJ4A 3DTVD 2KPOA 3IKJA 4PRLA 2JEYA 1NKSA 3V1UA 5DIZA 3WICA 3OOYA 3PHBE 4GMKA 1PJ4A 1KO4A 1SWWA 3UICA 4EG7A 1PSWA 2HJWA 2VJDA 3UJHA 1O6GA 1QE5A 1UT8A 3S27A 2QNIA 2G1JA 3NAQA 1JIQA 3MQ4A 3GP3A 3C24A 3ZWXA 1QR2A 4N5LA 2RCNA 3MAGA 4H7PA 3WXMA 5KMGB 3DR5A 1XMPA 4BNNA 5JEEA 1GDTA 4A15A 3ZLUA 4F2WA 2I6QA 2NO6A 5BXYA 3FB4A 3WJ7A 4GSKA 4L3VA 4YDSA 5L40A 3HWRA 4FUTA 5TXGA 3W5VA 4B5LA 5FEUA 3ITEA 5AW0A 2DF8A 5KDOA 4B8ZA 4F3KA 3KQOA 1C4KA 1QHHB 2YW2A 1ZVQA 3JZFA 1LWNA 2C9ZA 1JDBC 3DONA 2OGWA 3VMFA 3A70A 4KUHA 3WRYC 1QKJA 4K3UA 4OLFA 1UXOA 3IAS6 1MAAA 3CUUA 3HCEA 1AUPA 2HKIA 2KQUA 3DLCA 2Q50A 2QRGA 2FPUA 3HDGA 2FEKA 3QVUA 1AQJA 2ZBDA 2C20A 2I87A 4X20A 4QSHA 2JLBA 3RYFA 4B4KA 1JEYB 2OCLA 1L4MA 5I47A 1RJEA 1Y7TA 2JAWA 2VO1A 3FR7A 3O73A 2YS6A 5IZCC 3E84A 1K1EA 1NVEA 3TZBA 4NPAA 2F9FA 2XTNA 2ZWPA 1ZN7A 4TWRA 4IDHA 3KKKA 4IJMA 5TQ0B 1PR1A 3SIRA 4KQ6A 4CR7A 2XKAA 1Z6TA 1Y4UA 3JQFC 4MX8A 2WYWA 1Z3IX 1PZEA 1VA5A 2IK8A 2Y9MB 3RFUA 4N48A 4KN9S 3BXHA 4QQFA 4RKRA 3O1JC 3Q6MA 4GVXA 5CYPA 1X7XA 2ZI9A 3T0IA 3M3PA 5AVQA 3L0IB 4QU8A 1S01A 4LYDA 1F20A 2HA5A 2H9AA 1PQPA 1KORA 1BCSA 3HYCA 4JLPA 4L5BA 2IX9A 4RY0A 5DTEA 1RT9A 3LPCA 1SKAA 1YS1X 2J3MA 1PGJA 2HX1A 1HZJA 2A67A 1HYHA 1ODFA 1N92A 1Y1LA 1Z0JA 4TTAA 1P2BA 2QB5A 2JIQA 1QIDA 1RLIA 4Q34A 1RP7A 3GP8A 4JJGA 4U7FA 5P21A 4NYMQ 3Q9UA 2OV4A 2ZYWX 3IT2A 3TBKA 1OFUA 4CM5A 4IS3A 4D9IA 5C4IA 2XZLA 1Y9AA 4WJKB 5TQ2B 3W6UA 1E69A 4QFDA 4UHKA 4YCDA 3KDAA 2CLLB 1R6VA 2GAIA 2IOYA 4F3RA 1MVOA 5LQNA 3CS3A 1RQPA 1XZQA 3WHLA 1HQYE 2ORWA 3K0BA 3RJ9A 1JFFA 3PUHA 4N7MA 1COWD 1UMCA 1NR7A 3TQSA 3PEWA 2VJQA 1L1QA 5EZYA 5I01A 5G0SA 1KHHA 3GBPA 1W49A 3H13A 4MV1A 5HDBB 2ZUTA 1C0LA 2PWZA 4EJFA 5K03A 1B0UA 3F71A 2ZJBA 1Z15A 4XWGA 1PK8A 2Q2OA 2FWIA 3FSEA 1T3GA 4H6XA 1H94A 5KHLB 3FZGA 3NDIA 3P26A 1SNYA 2DPGA 1IJKA 1PHPA 3WWOA 1RQ2A 2BKEA 5ILGA 4TQUS 2D1FA 3UJBA 3D6AA 5HMMA 1K75A 5F52A 5JBNA 4J9VA 4NZ9A 1EVJA 4J3JA 2YDXA 1P4AA 3MINB 3KLPX 2V7QD 3JASA 2NUPA 3QBDA 2P5TB 3QLUC 5I4KA 2X8BA 3QPVA 1PG2A 1KMHA 1OZHA 3B1WA 1X2EA 4MQFA 1U3VA 1M1ZA 4AIIA 4BO6A 4YV1A 3ZJVA 2CDAA 4DG5A 1H4SA 3VJRA 1G291 2E4YA 2PT7A 1PV1A 4R9VA 1CUFA 4E12A 3RAFC 1OASA 4CM1A 4D5EA 1WLYA 4YRQA 4PG5A 5A05A 3WE7A 1UXIA 2AJBA 2X58A 3ND8A 3OO1A 1DG9A 4KH1A 2G9NA 1DEKA 1U0RA 1Y81A 2AMYA 2GK6A 1QIKA 2YJ4A 3MRSA 3RS2A 3U44A 1OQAA 3CKLA 4INZA 4AUEA 2HA6A 5TGDA 3OZEA 3ZIAD 5IT9A 1EKXA 3CX8A 4XE5A 2JGEA 2KW5A 1I1HA 1I32A 2ISSD 3AEKA 3BCSA 5E7IA 2HMYB 4KUEA 5B37A 2V55B 2Z4TA 5FOSA 4JBYA 2NN3C 4B46A 5EE1A 6Q21A 5FQOA 4KP7A 4QDXA 4CF5A 3KYBA 5BNIA 2NNLD 1HK7A 3PCRB 5CFRA 8LDHA 1GGFA 2PEYA 5AJWA 2C7GA 2RAUA 3VUEA 2AN1A 1EJBA 4TM7A 3C6QA 4IRUB 3RUPA 2G08A 5LUAA 1U7PA 1ZAKA 2GAJA 2JL1A 3HUTA 1MG5A 2W2VA 4YAUA 4G2TA 4QGSA 2EFEB 2ST1A 3NGLA 1QGZA 2FCRA 2FYTA 4LJLA 3C16C 5LD2B 3OE1A 3U19A 2GZMA 3BWBA 3L0SA 1SBIA 2EFGA 2N1BA 3DUFA 4R7ZA 4QU0A 1J0XO 4Q9DA 3DMNA 1X1BA 1EWYA 1YVDA 2VI5A 4D92A 5KNCH 5H3LA 3V9AA 2QZ4A 3M6MD 1PJ8A 4NC9A 3ZOZA 3OLZA 1JBQA 5BW4A 1FJHA 2JGIA 3IPXA 1HE2A 3RJZA 4JI3B 2J5KA 3U5ZB 1GRCA 2N0SA 1SVUA 1PP4A 1VMIA 1VXRA 1ZFNA 3M70A 3DLAA 2R4QA 5IBPA 4B7UA 4CKWB 5CYOA 4DV4B 1Z2DA 1S1CA 5DCYA 3H5LA 5TQ0A 2JFPA 3AEXA 2EJCA 1Y5NA 3H7IA 2G5PA 3FYUB 2WW8A 2WY2D 4ZU1X 4RYDA 1VLHA 5FT9A 1Y37A 1HUQA 1VJ5A 3ROEA 4BLPA 2RG1A 3G1TA 5ICMA 2HXSA 2EFYA 2O14A 2XNDD 3ELBA 3HS3A 4XCVA 4EJSC 2CLHB 1ACLA 2AC7A 2GJ8A 3M0EA 3PE4A 4LPSA 4K9DA 3RKUA 2IP4A 3RYIA 1G60A 3HG7A 5TV2A 2HADA 2VDPB 3KX2A 3VAZA 4Z7JA 4RY9A 5B4TA 3OJFA 3OQIA 3KJHA 1VL0A 3WIDA 4B9EA 3RYCA 3IEXA 4X62B 4KSBA 4W9NC 5AKYA 1C7ZA 5JS2A 3RV3A 2V58A 1PVOA 4FKBA 1YGPA 1NA5A 4G1UC 5A5FA 3P1JA 1MW9X 3KRTA 5BVHB 4Q18A 1GTZA 4EHBA 1QGUB 4P1ZA 5ALTA 5F7ZA 4YYEA 4EM6A 5B6IA 4V0QA 2A9PA 3IP5A 4QUIA 3P4XA 5JC1A 3O6VA 1FOEB 1O87A 2GD0A 1TKRA 2Y1LA 1L9XA 3CINA 2R47A 4CLDA 4DSZA 3UBTA 4AQYB 3EFOA 2DFNA 2P4EA 2AUMA 1MQAA 4UBOA 4XIGS 2XCRB 4A2CA 4UM9B 4IW3B 4R8LA 3BIFA 2QAJA 3WLHA 4CG2A 4Y1EA 1D2AA 3OBBA 1JA1A 2QPAA 1UT5A 3B82A 1GRNA 2GK4A 1I4TD 3I8XA 1W0JA 4G89A 4IDDA 1IXSB 2WMDA 1YJXA 1MZPA 2AG0A 5FRDA 3D59A 4E2XA 4RVGA 4CI9A 2XMPA 3OAAD 1HETA 2XCLA 1DBIA 4AP9A 2BRUC 4YFVA 3W5UA 3WTCA 1JDNA 5KVCA 4I50A 2P27A 5ER6A 4U6QA 1U7XA 2QVBA 3MPOA 3PPVA 4YWHA 1H23A 1G19A 4X85A 1PKEA 3M6UA 1GJRA 1ZHFA 2F1OA 2I6TA 3LJKA 1BQEA 2BAGA 2QUHA 2QAGA 3STYA 3VC2A 5KYXA 2HJRA 2IY7A 2FZCA 3BKXA 3LT1A 2FXVA 1BD3A 2DKOA 4HQKA 5JXWA 4P7GA 4A27A 1RXIA 2RI1A 5DI9A 1CS4C 3GEDA 5CB4A 2AR9A 2K2WA 1Y1SA 4DJTA 3P0HA 3VMMA 2Q5LA 3R3XA 1SHUX 3LQFA 3WGYA 3G2PA 4EKDA 3UT5B 4U3JB 2MWMA 2ZBVA 1RR6A 3G2LA 4BJ1A 1QS0A 1ZSYA 1DC8A 4GMFA 5L3QA 4C6RA 4EB8A 2X2FA 1J09A 2JGAA 4RULA 2W4IA 4BWGA 5KKCA 4RHTA 2XRZA 3UCXA 3Q4GA 3N8DA 2YXDA 1EHYA 5CPFA 4W6ZA 1XN4A 1E2KA 4JVMA 4Q1AA 1JVSA 1SCIA 5E4JA 4BNDB 3QKSB 2UXCB 3LKDA 2HCBA 2HQ1A 3DE0X 2G9UA 3P2KA 1H1TA 1XTBA 3PFKA 1C1DA 5JHHB 5EIOA 3EVAA 4YRKA 1U2DC 1ZUNB 2Q3FA 2FZ4A 2M6SA 5E9QA 1IZ9A 5ESWA 2CCKA 3ZNNA 2OFFA 2NZWA 2J67A 2C5BA 2OWDA 1W48A 3L7AA 4UBJA 4OD0A 5CB4F 3QMMA 2P7HA 1YS9A 2DRIA 1CNEA 1YBMA 5EYPB 1E58A 3JQBC 1JDBB 1U4OA 2O0JA 2IYRA 3CH5A 3D3EA 2I33A 3ON5A 3CZ9A 4E2YA 1X8JA 1ZU4A 2QSJA 3BL6A 2YIJA 3GVHA 3OY7A 4KB5A 4P92A 4RD6A 3RRZA 4CN9A 1XG5A 2Q4EA 1C7QA 4G07A 1Z5WA 5HDQA 2Z5GA 4Q9KA 1KBQA 4YIHA 1Q7TA 5BQ5A 2VTBB 5DWVA 3B9PA 3W5HA 1RHQA 4LMAA 4ZHQA 1EAMA 1Y0BA 4S12A 2G1KA 4R3WA 1VFNA 3SR0A 3UH0A 4IGFA 2JG3A 3AL3A 4HO1X 3KQTA 5F21A 1NUTA 4HFMA 2C3UA 2ZAOA 3HPRA 2F55A 2FMKA 1OY1A 3TIXB 3FOCA 4BNVA 1EFVA 5KSZA 4JYBA 3WWCA 3BHJA 4O4HA 5K0ZA 1SG0A 3FLBA 3JQ7A 2OWEA 4TTTS 3WDMA 4YX9A 1BS1A 1Z2CA 1I1QB 3QXSA 4GI7A 5A0TA 5K0LA 2QX6A 4JFAA 1AVTA 2I2BA 3UK7A 1PTKA 3BIWA 3E5RA 1Y5MA 4YREA 4E1BA 3PHJA 2X3FA 4OGKA 1ZR2A 3AY0A 3HU1A 4G5OA 2BBOA 2PR7A 2YQ4A 2G77B 3EVGA 4KGVA 2XI4A 5AJZA 1G8HA 1RI3A 1CR4A 2GEBA 3CCCA 1MOQA 3PHLA 4XUCA 1QCYA 4ITRC 5ALZA 4BRUA 1X7HA 2FA9A 4UUBA 1XD8A 4EUFA 2ZIVB 1YAHA 3GCWA 3OUZA 3RC7A 4JLOA 1T36B 3D54D 3UMVA 4PHCA 4BY9E 2O8DA 4ZZ1A 5JC8A 4S04A 4HPJB 1LWOA 1I2AA 4M53A 2GPTA 1V8ZA 1VSQA 4HJXA 6YASA 5HZGA 2CV2A 2GO7A 1BRTA 5KKAA 5G4KB 3WGQA 4OHVA 2Y2UA 3LW7A 2LD4A 3R0IA 4PM4A 1JKIA 1CYDA 4TTJA 2V6JA 4MI1A 4ENVA 4FLFA 1GQSA 1IATA 5JARA 4J76A 5G53C 2JJ1A 3PGLA 3GELA 1YQEA 3JV7A 5E8JA 5AWFC 5K6AA 5LA6B 4IGIA 5HP4A 3I6YA 3HJTA 1FEZA 5IHPA 3E9RA 1JHUA 5CIQA 5EE3A 3V6MA 4NX2A 4K9LA 2ZR9A 3T34A 1JIIA 1JPUA 2A14A 1EG7A 4OB8A 1G7RA 3HYNA 3MJ4A 4JUIA 3K9LA 5G0WA 1R3DA 1MAHA 2IDJA 4POOA 3ESYA 4IIDA 5AI4A 3SY8A 4L9SA 1QYCA 3NOQA 2P1ZA 3C6BA 4FFWA 3RWBA 4P5PA 4ADSG 4CDNA 4GPBA 3V4RA 1X3SA 2VK4A 3MJCA 4C30A 3REOA 4ZMSA 2NU8B 3D6VA 4NONA 3D8RA 1D8TA 1UMDB 1PZMA 1GSOA 4HBZA 4P3YA 4NSNA 5T64A 1WULS 5EJ9A 1VHJA 2QGZA 5FYDA 1C3EA 3K70C 4BVJA 3ESQA 3OZIA 2Y0EA 3AUAA 1G0NA 3BF7A 4UM5A 4L22A 4WACA 3AFOA 3ZYCA 4UDXX 3KAKA 1Q50A 3P97A 1E1RA 4EPXA 2R1UA 1IBMB 2CUNA 4U02A 1R74A 4BXOB 3VKVA 1ZI8A 4CBVA 4RABA 1GP2A 3FNIA 3R3UA 3NIWA 4DABA 1W76A 3EGDB 1D2CA 3I83A 2JCSA 1IZYA 2QAIA 1FW6A 1C30A 2HJGA 4CLOA 3U1TA 1BXRB 2QJFA 6ABPA 4TTRA 4WY2A 4TL8A 2AW5A 5H0IA 1IUKA 3B6EA 1SXJD 1D03A 3K9CA 4BFZA 4RGQA 4BWYA 1A5BB 3MTJA 2PZKA 2G80A 3RUAA 3D6FA 2SCUA 1T0IA 2WJZB 4LJ5A 3SF8A 3WGIA 1KJZA 4RS4A 4CHTA 2AWNA 3B1VA 4GQBA 4Y2TA 3RS4A 3GGSA 1RMQA 9ABPA 1T36A 2QNBA 5U9CA 2POCA 1ZSVA 3EYAA 1NF8A 1Y42X 3AZQA 1Z34A 3CUEF 3UBMA 2O5VA 1CY2A 3A6ZA 2HNBA 2WVAA 5AKEA 1Q92A 4DA6A 4B47A 1XD2A 4GYWA 2VQFB 1AKTA 3ZR4B 1IBKB 2NM0A 4ER0A 2WINI 3EIUA 3P9IA 4YLGA 2YZNA 2O23A 1E2UA 5AHOA 1Y3HA 2VL7A 5FJIA 2AZTA 4BFLA 1QM5A 2KB0A 3P0RA 3TIGA 2QMQA 2WOOA 1KA9H 1MABA 3D7SA 5E3IA 1YR9A 2HA7A 1YL5A 3C70A 3YASA 4MWEA 3DJFA 2FPOA 1PX0A 2Q0QA 3LC0A 2GILA 1NP3A 1MRSA 4RO0A 4ZO9A 4ZVNA 1N5JA 2H06A 4CMGA 2W8BA 2J0UA 4G0UA 3EW7A 2IXGA 4IJWA 1L5RA 1K8XB 3N8HA 2W6PA 4IMIB 1FDWA 4FILA 1HNXB 3D0KA 1RKUA 1TMGE 1JA0A 2HWYA 2ZU6A 5IFKA 4M3NA 3IMGA 2AWOA 1ORTA 4PAWA 1O58A 3RS5A 1FVFA 1XTIA 4LXGA 1A2KC 2SBTA 1L5SA 3EDYA 4BE4A 3O4IA 3AEUB 2QU8A 1Y6GA 3WLPA 1UC8A 2BFCB 3F6YA 4AJKA 3NVDA 3IHWA 4LN1A 3UK1A 1YQWA 4GH5A 3B6IA 5CFOA 5FEMA 4LYEA 9GPBA 1NMQA 2D3TA 4QNNA 4MUAA 3ZDRA 1JDZA 4FEGA 2GOYA 1Q0SA 2F48A 1U65A 1V8FA 2ZKLA 3HLYA 4HVAA 4IZ6A 4PCUA 2B37A 3UWOA 1OWOA 5EIBC 4Y6SA 1ZOOA 1OH6A 1MAWA 3IHKA 4D0RA 1JMKC 2WAYA 1RKVA 8OHMA 1SHKA 5U4XA 4G67A 5CEFA 1GAQA 1Z75A 1LI7A 1MO5A 4WXRA 3WVNA 1BS9A 2P75A 2E1RA 4NMLA 1SEPA 4ZRNA 1KI4A 4ARSA 1W2WB 4ZOQI 1G9SA 4I9NA 3U7IA 1QC5A 2QBYA 1OF1A 1E4EA 3VR5D 4D26A 2B34A 4FCVA 1KPIA 2H85A 3ZW9A 2YWRA 3SXUB 2R97A 1U9IC 4C7MA 4ALJA 2HR1A 1XNRB 4WJLA 3EXAA 5LDGA 5ADUS 4M0EA 3C1TA 4PGAA 3V8MA 4N0PA 5CJJA 1CR1A 1G66A 3U4CA 4EY5A 4GBMA 2EBHX 5BV8A 1FVHA 1A8QA 2R1TB 1DOZA 2EU8A 2WM9B 3S2UA 3ELDA 4QD3A 3TGLA 1B93A 1ADGA 2AW3A 2C82A 5DCUA 3X1XA 4ZVMA 1NDHA 1TXGA 5BWBA 1MG0A 8MHTA 3HUDA 4R54A 5LJLA 2HDNB 4UUMA 1M8JA 1ZOLA 3FPAA 3IUMA 4GKAA 3I01M 4AS3A 3C4QA 4RANA 4A1FA 5FBKA 3D4BA 3IELA 1Y80A 4ZCPA 5G1OA 4LF6B 3AV3A 3H19A 3JYLA 5K2MA 3CLUC 5BOSB 1HE8B 1T8SA 4HH4A 4PRKA 5EC8A 3RGGA 5KYWB 1GD1O 8ADHA 5FBWB 1CRZA 1WD7A 2VR1A 3AERB 5AHXA 2XJ4A 5IAOA 1PR0A 1K08A 1X7YA 1XHFA 2H7XA 4L08A 1ULUA 2R6HA 1VECA 4EFMA 3HSYA 1JFLA 4XFJA 2W0SA 1D1PA 3VZBA 1GFWA 3EIEA 1LDNA 1YV9A 3VZDA 3WDSA 4EJMA 2BMWA 2WTAA 1W0KD 2HIGA 4H3SA 2GK3A 5CITA 1IAQA 1XDZA 4CMJA 2NPIA 2VT7A 4C7OB 2OV1A 5CDGA 3EIWA 2VBGA 2YJGA 1YONA 3K0CA 1G8GA 2PT6A 4K05A 1VYVA 1X8LA 2L2QA 3KU1A 3KYIB 3ORHA 1HDYA 3R5HA 3SDSA 1XPUA 1G41A 1AUQA 2XSZD 3KZCA 1M1UA 3ZGLA 2WE8A 1NVKA 4H16A 1NFFA 1ZCBA 2P41A 4MSUA 3H2GA 4HFJA 5B6JA 2IU4A 5HHTA 3IEVA 3DGEC 2C5GA 2C00A 4YAGA 2PCJA 2WAAA 3CZAA 1P4HA 1ZM2A 1LVUA 4ZQCB 3W8NA 5JD4A 1C3LA 4CGYA 3N5KA 4WZBA 4FZ3A 1VCOA 5G40A 1KDRA 3BIXA 3DAHA 4HKTA 2BYTA 3LSTA 2R8ZA 4OY3A 3N6XA 5E8RA 3KOXA 3MM4A 4MV7A 5K4AA 3ZZNA 4Q47A 3RAGA 4P3PA 1X86B 1EBBA 1IE3A 2XMBA 1VE5A 3TM5A 3QA3E 3VYSB 1A9XA 1M5TA 1UWVA 4PU0A 5DYTA 3M5PA 1H2AS 4QDUA 3WO1A 4N5IX 10MHA 4C5CA 1DIGA 3DS8A 1Z7EA 4H3VA 2Z9BA 3G2OA 4BNZA 4E0BA 1POXA 2BP7B 3UCEA 4HVCA 3GLFB 4RL6A 2A9VA 3DUFB 3DE1X 4GI2A 5HKKA 4MULA 1QIGA 3BICA 3QVVA 1CU1A 2AZMA 2F2TA 2H2DA 3RTGA 3GPBA 3WYEA 3CVWA 1U94A 1OYOA 2VK8A 2ZAYA 3DBRA 4Y2PA 3UW3A 1AX9A 2C7RA 4J7UA 3F9IA 1T8YA 3ZDXB 3FF1A 3OQIB 4L85A 4ZAZA 5HZMA 4RTQA 3GRRA 4Z49A 2ECOA 1OT3A 3FJ1A 2YIDA 3NV9A 1JBKA 1URPA 3JALA 4LXQA 4MUKA 3NJRA 1UMBA 3QF4A 3DQQA 4IZIA 4WK6A 4YUVA 3TKAA 1ML3A 1IPHA 1W94A 1RM5A 3UWMA 3OPYB 3ST7A 4PZPA 2HEGA 2YWFA 1VKOA 3NWEA 2PH1A 2JIDA 3ADBA 4UEQA 5DASA 4IDGA 3L04A 2LCQA 4LNUB 5F5LA 5IVIA 4Y9DA 5ER9A 3W9BA 3WQHA 5KJ6A 1GHTA 4UDOA 3RQSA 3WIUA 2GCOB 1P7VA 1RACA 3T3PB 3GLGA 1B26A 3TPZA 3ZLBA 3QVWA 4TV8F 4X6LA 1L5YA 3Q1LA 4L07A 1VDMA 1XRNA 4O2AA 3DE7X 3HZZA 3ZE0B 1P45A 1FMFA 4OL0A 1T9HA 1BGVA 4TMTA 2XUJA 1ZMRA 3ZTTA 1GZ5A 4ZGGA 5JW6A 3DTVA 2PQ6A 2X22A 1LF0A 3TW8A 1YS6A 3H0KA 1Y8QB 4GZ3A 4YNBA 2E2WA 5GONB 2EZTA 4PCAA 2PCLA 3HFRA 4TL7A 4CKCB 2GBLA 2PVCA 4GWLA 3IO3A 4KGXA 3AYZB 5BN3A 3N7AA 1FTYA 2FVYA 3W8FA 2I8CA 3H5TA 3AY7A 2G28A 3FPJA 4JGIA 3D5TA 1N2CB 3NYQA 1YNOA 1SM4A 1T5TA 2BFCA 4CQMA 1N9GB 2PZFA 5AKKA 1XDGA 4ZQGA 4WSOA 3ZY5A 3UF0A 3QY0A 1DC5A 4IH1A 4NCXA 1G5IA 1DIRA 4OFWA 1EFPA 4RMIA 5DHFA 4C7JA 1KIAA 3ZVKA 2BBSA 2OCAA 1QH0A 2WSIA 4Q9LA 4MKXA 3ONWA 1DX9A 2Z98A 3HNOA 4XLLA 3U61B 3NR2A 3IPAA 2EKDA 3IHLA 4TLCA 5FOVA 1AGXA 3ZX4A 1E5LA 2Q41A 5EIAA 4ND1A 1RMTA 1FTGA 3DLPX 3N0RA 1ESDA 2NYUA 5GM1A 2QDXA 5JY6A 2JFGA 3ZVMA 2WHYA 4TMFA 3IBFA 3CSUA 1PGQA 3KPUA 4N39A 4RM3A 3L6OO 4NXMB 1MJHA 4LCBA 5FJJA 4DR2B 1H8HD 3LLSA 4I50B 1WD5A 3V1KA 1VBMA 3PUJA 3C3DA 1BX1A 3S81A 2GD1O 1QUEA 1I7LA 2DKFA 2D7JA 1NC3A 4BNUA 3QE4A 3QUBA 3ACBA 2BOVA 2Z2XA 1W88A 1I80A 2LCIA 3NKLA 1KL7A 2HQRA 3ENWA 4W7HA 4NFLA 3H84A 1L5GB 1NMEA 2I2CA 2QVLA 2VHQA 4MWGA 2OZLA 2B2XA 1ONOA 2CBGA 1FRVA 3ANMA 4L4YA 4NBUA 3VXKA 1NVBA 3UGJA 2XRYA 1T3SA 4YLYA 2AJCA 3IC5A 2OT3B 4KO4S 3NOXA 2IXEA 1C3OA 5FPHA 2VHZA 4TV9F 4FYMA 3KYCA 3TM4A 3DLBA 2XGJA 1L4HA 3GI1A 3MW8A 3NPMA 2EHDA 4HYQA 1YO6A 1DX6A 3USES 4DLTA 1A76A 3MJFA 1KWKA 1WKCA 1CERA 1LQ2A 2E85A 2CT8A 2XDAA 2Q3HA 4MARA 5AVRA 1YKGA 1XMOB 2L0XA 1UM8A 2B8NA 4MK4A 2HJSA 5C7YA 5EQDA 4GX5A 3JSXA 2OQIA 4CN8A 5CCBA 3NVAA 1XCOA 3C3XA 3I8SA 3O8NA 5JFTA 4EBBA 2QROA 2XBUA 4KVZA 4EMBA 2BT4A 3UWPA 3JWJA 4Z54A 2VH2A 4LW8A 5C53B 4J29A 4PZCA 4MJ3A 3ZJ5A 3MXOA 1UBRS 2Q5CA 3UKJA 1XCLA 2XMZA 5EHIA 3WS7A 4OSPA 4IJ5A 1V2GA 4LXHA 4TS9A 5IJXA 4JLJA 1XAGA 2ZR8A 2DEUA 5DTIA 3ZWWA 4LXIA 1FX0A 4RENA 3QSYA 3ZHYA 2V1XA 1SCBA 5EEHA 3X1WA 2ZBRA 1XQYA 2NXJA 3K2QA 3UQYS 3HCRA 3CU5A 1DZ3A 2ATXA 3AVTA 1DKQA 3QE3A 1GFSA 1GV0A 1JT9A 3F8TA 2JLSA 4RK7A 1H8EA 1AK1A 2YYZA 4EPTA 2BE7A 2FN4A 2P5UA 4YDRA 1HYEA 1R00A 2EX4A 4X20B 1R66A 3L6EA 3ZV7A 4EH1A 4IYRA 1CR0A 4CF6A 4KN6A 1L7NA 3Q87B 4KSCA 3IEKA 1JQJC 1SIBE 1XELA 3CR7A 4E2WA 3ABSB 2B4YA 2HU7A 2OHVA 3SF0A 1DJLA 4QOFA 5B3JA 3X0DA 2Q1YA 4UQOA 4EUHA 3EGVA 4KIWA 1T5IA 1K63A 3G7NA 3QX9A 3ZJTA 2GYYA 2AH5A 3RTDA 1R10A 3LX4A 2OP1A 2VBCA 4P4NA 3PXEA 3SJUA 3QK7A 4B80A 2D54A 4YRPA 3ETNA 1F9EA 3GRKA 1HFKA 1Z6PA 4IH9A 3EPKA 2EKPA 1K8RA 1U2PA 2WV9A 2X0KA 1QG0A 3NP7A 2ACEA 4IXDA 2C9CA 2WKRA 3S8YA 3ADCA 4UC0A 4LSGA 4FE7A 2NVOA 3CY6A 2HQSA 2CHQA 4OH7A 4PONA 1Q1BA 1XFDA 3HB1A 1RYDA 3ENVA 2OXCA 4FC7A 4KCGA 1N2JA 4W8HA 3STWA 3EG9B 2Y2VA 3LVFO 1Q0RA 4LZAA 1H5QA 3IRUA 2QF7A 1NWCA 2FF5A 3BJZA 3SJ7A 1N5DA 1HT2E 1PI3A 5J5VA 4C06A 2OZKA 3R3SA 2JFFA 4DLRA 3JWPA 1H1DA 3TMAA 1K7EB 3Q98A 4PC2A 1MIOA 3EUAA 4WOJA 3NG1A 1OWPA 1Y5IA 3PPXA 4BVEA 1FNSA 2R87A 2XIJA 4C1NA 4Q3KA 3ABOB 4B3XA 2QD4A 4WMLA 1N2HA 1NIJA 2GD6A 1W9MA 3NOOA 4BKQA 3IJRA 4DNOA 2PSSA 3RUIA 4B8WA 3TIFA 3SSNA 5EJEA 3IVAA 1Z18A 4JBGA 4X60A 1RRPA 3W5AA 4I4TB 4QG7A 3W4IA 1Q7CA 1VE6A 1G4AE 3DE4X 3OKAA 2D2XA 3P2MA 2BMJA 4TYQA 3GP5A 5HFNA 3IEIA 2ZIUB 2J85A 2VRNA 1NM5C 3AFHA 4OJTA 3FTDA 2C2OA 4Z6KA 2RHWA 5K09A 3L8GA 1NUQA 2ID4A 3CR8A 2AMJA 3CVUA 2UZ1A 1XJCA 2NO9A 4QGAA 3AVYA 4R7TA 1EGVB 1EIZA 3FIUA 1ISPA 3T7KA 1ULAA 3S2ZA 4MAAA 4K6HA 5T5QA 4J94A 2ZIZA 3JWEA 4JYZA 2HA4A 5EJ4A 3C85A 1H69A 3VVLA 4LOJA 2PZAA 3Q85A 2PX4A 4TZ6A 4L8FA 1NJ8A 3KFVA 1NVVQ 5CTAA 3ZY3A 1J24A 1OV6A 1Y6QA 1OXXK 1XP5A 1Z39A 4H1UA 5DGDA 5IP5A 5A3RA 3DAYA 4PINA 1H9BA 4D8XA 3SDBA 4CMIA 2WIFA 4MW2A 4DSAA 2N75A 2HFKA 1BH2A 1QOZA 4D4JA 2ZRQA 3IDQA 121PA 2HRCA 3K0EA 2BZ0A 1P5ZB 2FRDC 3DE6X 5DSXA 1LSSA 4YLEA 3PIRA 5C1IA 3RC3A 1E6MA 3ROPA 1RAFA 3SJBA 3G2MA 3CZMA 4OGLA 3TLCA 2ES4A 5CFZA 1R0LA 4OX9B 4BQOA 3BILA 3T95A 5IG2A 2R6FA 1TO6A 2FZWA 1TX4B 3C5EA 5BQFA 3HBAA 4BX2A 2A8YA 1V39A 1ITZA 1W5AA 2RGNA 1LS6A 4WCFB 2XTZA 4EABA 2WFZA 1OXSC 3T1TA 3L2OB 3FXAA 1XCMA 4I4NA 4B2LA 1N6LA 2I2WA 4UHHA 3FUTA 1EVEA 3H17A 5HUHA 4AF7A 1TW2A 1MN6A 2GF9A 1Q1QA 1X7ZA 3JQPA 4ND5A 1QYRA 4R51A 4YXWA 2DLCX 3BWXA 1Y5LA 4EGJA 3KOOA 4CLEA 1E3EA 1MR3F 4O1IA 4NMWA 4WFKA 4L0CA 3THYB 1IOLA 2V5UA 2R00C 3P2IA 5DGXA 3SX0A 5C1PA 1EUQA 5DRYA 1C4OA 4JVOA 4W82A 1VI2A 3RSCA 3TLMA 4EW6A 3NHUA 3FPHA 2VWPA 4C78A 1UQRA 1V26A 4HQFA 1L7XA 2AJ8A 3BB3A 3D4NA 2ORVA 5CURA 1J2YA 2GMWA 2XX3A 3SNKA 2C9MA 2IDMA 3KEMA 1VRVA 2H4ZA 2WLTA 3DVAA 4D0GA 4QJ3A 4YC7A 4DSUA 1SCUA 3DFUA 3MCAA 3OP4A 1F17A 3PFNA 1ZWLA 3LQ2A 1AGNA 2C61A 3SYKA 3KJNA 3SS8A 1F3LA 2GEUA 3WK6A 4C4OA 3OBIA 4L9AA 4NICA 4XGQA 1EZ4A 2GTHA 1JGTA 2O2YA 1GCUA 2X8JA 1TQ8A 3OE7D 4ZOBA 1FRZA 1PIWA 2V6IA 3FF4A 2QT0A 2JBAA 1AF7A 3B9RA 2A0XA 3IOCA 3N2KA 4MYTA 1HDCA 2AD5A 4K8OA 2PGLA 3LDFA 4MWOA 4Q9IA 4MVJA 2J0EA 1FRQA 1CUYA 5EI5A 3GLSA 3AG5A 4OQQA 3RANA 2IS1A 2YL2A 1OLXB 3EASA 2WWGA 5IF9A 4UJ5A 3ZCQA 3WNDA 5KWJA 1XCPA 4OHOA 5LQJA 4DR1B 5ETJA 4ZU6X 3IQGX 4Y6QA 3W6PA 3HU3A 1PW7A 4L4ZA 4QJ5A 5CH3A 3SXUA 2GPYA 4AX8A 4RF2A 2F9LA 2VK1A 4JITA 1PGPA 1QVRA 3PE3A 4JEMA 2QE7A 4LOAA 3PA6A 3S6JA 2LBPA 5D7BA 1O5IA 2RAPA 3WIVA 3WP0A 3WK5A 1EBFA 4MS3B 2V65A 1RAHA 2I65A 2GXUA 1FZQA 2XYRA 4U2KA 2ZGVA 1TJNA 3KZ1E 1W46A 4U7HA 5DU2A 3R74A 4KJZA 2VN8A 4D9MA 2RSLA 1E5TA 1RXVA 2MSDB 4TYMA 5DX8A 4BMYA 5IJ0A 5KNDA 3GFQA 2V7VA 4LBVA 4MV8A 4E5YA 1JR3E 2ZW9A 3PRKE 1K06A 1UK6A 2H4YA 2ATEA 3PPWA 4JUBA 4EPYA 3BM5A 5EVJA 3LOPA 2HWXA 3LU1A 4B83A 4RQTA 5CK5A 5A5VA 1B3RA 1XLVA 3RFCA 4ZYWA 4CCAA 2WJJA 2Z08A 1LPOA 2OP0A 2OZPA 4HP8A 4QSMA 3LKVA 5D1NA 4D9CA 4YRZA 2G09A 5EXPA 3TFWA 1W30A 2RK3A 2ZSUA 3VOBA 1QB8A 2HYIC 4OK5A 3I6MA 3LYUA 5HE9A 1YC2A 4NBTA 1F14A 2O8CA 1SOAA 1VE1A 1LX6A 2HIHA 1UKEA 2QK4A 3GDWA 3EF1A 3LKZA 5ALEA 3HACA 2RARA 2HCFA 3VHLB 3ZCXA 4AZ3A 3NIFB 4RJTA 2HLDA 2NAPA 5CTJA 3S2EA 3W5SA 3BS4A 2D6FA 1MX5A 3OPMA 4FFMA 1IUNA 2FZ5A 3NTLA 4R2WA 4HOYA 3GLGB 4GSLA 3LF2A 1QP0A 3K30A 1KDYA 4QM7A 4V2UA 5HQ3B 4FDLA 5HRAA 2GRJA 4NJMA 4OOEA 2IEBA 1TA9A 1D2MA 5A4MS 1R3UA 4NV3A 5KQMA 1RWKA 3AO0B 3MUEA 4UU1A 2EEZA 1IK6A 2VNSA 1JDUA 3INRA 4I4TF 4PPQA 5GIOE 2MINB 3AZOA 3PEVA 4JKYA 4C0WA 4F7DA 4KITB 1NDUA 1LFAA 2IP1A 2R68A 1U3WA 4BCCA 1J0CA 5IH3A 4ZI7A 5CT5A 1LZLA 3PNLA 4P31A 4YJ2A 4ZV7A 3IJPA 2AD1A 3Q40A 2BIFA 2P8SA 3LHFA 1GTJ1 1AZLA 3WO0A 4C08A 2HWUA 2BM8A 1GY8A 1K0UA 4XB1A 2GJSA 3ANTA 5AR1A 1C81A 5DNYB 2DT5A 4IY1A 4Q7MB 4ZI7F 1XSEA 4FHGA 4XOUA 1KGDA 2J87A 3JQFA 1DX4A 1NQTA 1N2SA 221PA 4M55A 1BMFD 4YB8A 1J4AA 3E9ZA 2JH9A 1E2DA 1ATIA 3EFEA 3ESRA 3TKLA 1W73A 3V48A 2WIKA 4HLUC 4KMOA 2R60A 3TOXA 1EX7A 4MA0A 3DDUA 3PFHA 3TOSA 2QTFA 5DEIA 1KJYA 2NQTA 3E1SA 2FH5B 2J1LA 4AKIA 2SKDA 3TEJA 1I3LA 1ZITA 3KR2A 3LY5A 3KS9A 1YR7A 2DLNA 5TQJA 3EXHA 4I1UA 2O5CA 2IV7A 2R6JA 1PLKA 1VPEA 1E89A 4W9RA 3ZHOA 5ADHA 1WMDA 1NU8A 1S8NA 4ZI7B 4PTYA 3BB4A 1MJ5A 4UEOA 2W58A 3IE2A 1ZY2A 2NXCA 2ZRLA 3B5IA 3NM5A 2X0EA 4CL3A 2GPJA 2R6ZA 1T9ZA 2FPXA 2FMFA 1A3CA 2CCJA 4CL2A 3PX3A 4G8DA 3H2JA 2PXXA 1I13A 1XXHB 3MC1A 2WSSA 4MGYR 3K16A 2QSYA 4N03A 3Q10A 5DNVA 2O8FA 4K0RA 1U0GA 2JJ2D 4ZAFA 1U7TA 4MPRA 5T6MA 3SKVA 1J8FA 3OQHA 3QFCA 3TUZC 1UCFA 2PLNA 4C1BA 5GOTA 1EXNA 4NOMA 3NWJA 5TEVA 3BTSA 4Q4AA 1QCZA 5BR7A 5FWYA 2XQIA 4JYCA 4X95A 2EKLA 2WB2A 1YAJA 4M0DA 1E79D 1G7TA 1NV9A 2I3GA 1EHIA 3GGGA 4TKMA 4PXYA 4RTKA 1FX1A 4D1YA 2DUNA 1QANA 2HWKA 2PGIA 3LP5A 1PGOA 2FFRA 5DFAA 1QMPA 2KLBA 5IXYA 3ICWA 1P7PA 1U2ZA 3AKYA 1OJLA 3NHJA 3H9BA 3I76A 3SLRA 3JAMA 1X1RA 3BE5A 5HG0A 5DNWA 1YI1A 1NXWA 2PUEA 1AV6A 5AJTA 1ZEMA 1TUBA 5IUKC 1QH1A 1GPJA 4L5CA 3CRMA 3MWYW 1CUSA 5HSGA 1PNQA 1XLUA 3QUQA 2YJ3A 2PKXA 2OOSA 3CWCA 4GP7A 3FNFA 3SJAA 2OTCA 2BW0A 1N4DA 2DUMA 1SK8A 2GSWA 4HS9A 3ABQB 1ORRA 1DXYA 1KDOA 2A4KA 1M2HA 2P6NA 2F3SA 3JARA 2EIXA 2A9OA 4ACAA 3HTXA 3EPHA 3RBVA 2HHHB 4MI9A 5JLAA 1UAAA 1QFMA 2IPMA 2M32A 4KAJA 3OPYA 2INGX 3GROA 4KJXA 2A5YB 2MHCA 3IULA 4O4HB 2J30A 4Q9NA 2YX1A 3SYNA 2BI7A 2DWCA 4UPEA 1QGED 4DDMA 3N59A 1KI1A 3UWDA 3C97A 5CAEB 3GA5A 4MS1B 4N7JA 1CY6A 3EUEA 2WILA 4YAKA 3MYYA 4OHMA 1M2JA 1N33B 4U7WA 1PS9A 1XRRA 2HRDA 1ZMXA 1NE2A 1P1HA 2V4ZA 2OXIA 3TR5A 4LEIA 4UOZA 4QYWA 3ZC3A 1AS2A 3KL2A 3TAXA 1XZMA 3SS9X 2FFQA 1JJ7A 1ZW1A 3G2NA 1DOHA 4I6JA 4HNGA 2GCNA 4EO7A 4DIEA 4DUZB 5CLIA 4JT8A 4QDKA 3G89A 2PWYA 2ECKA 1Y82A 3U4MA 2GJKA 1LPAB 1SKUA 2R751 4MAMA 1JEJA 4V02A 2B0CA 5TLSA 3F6RA 3LOUA 3KQSA 4FLEA 1DI0A 2Z58A 1MFZA 3ACCA 1XU4A 1ZD9A 2EX0A 5FL7D 2FV8A 5JG7A 1MQ8B 4DSNA 1V45E 1G5TA 1YZGA 2FQWA 1GQQA 1V41E 2HPHA 3C3YA 5L8VA 4WN3A 4QGBA 4ZOLF 4DA7A 3SX2A 1JIKA 3HDTA 4Z4CA 3TRHA 1GUYA 5EKUA 2NT4A 2WWFA 2YFYA 1EP3B 3WWZA 4YTEA 5TMDA 3CX3A 3NONA 4G3XA 1DO0A 3RRBA 2VYVD 3L07A 1L4BA 3MXTA 4KBGA 2HLPA 3OIFA 1JFRA 3AHCA 4PHHA 4ZQEA 4X65B 3KLNA 3IAHA 2YQ5A 3OD5A 4E13A 3O5AA 2Q28A 3LM8A 1JE1A 3W7AA 1ZIYA 2CYAA 2QMYA 2Z1NA 4G56A 4P38A 5GONF 1FUIA 3U3ZA 1DIHA 3LX8A 1RHJA 1DCMA 5KYYA 3BORA 1CIJA 1ECGA 3WQSB 5AVSA 1WPRA 1XZAA 5AYVA 4UBKA 4FQ7A 5F76A 2BMFA 2J3LA 3COVA 4UMDA 2I9KA 5AKJA 4PVCA 2OYRA 4LI3X 5JSUA 2I1VB 4J4HA 1G8KA 1K0FA 2JZCA 4JLDA 1JKMA 4TUYA 3TTXA 5CT8A 3E9MA 3JRNA 4CXMA 2F1JA 1VCNA 1D7OA 4Q3OA 1WUIS 4HI0E 5LCXA 3PRJA 2CJWB 3A32A 3TXXA 3OECA 4W5JA 1ZNWA 3BTOA 4PC3A 3MTDA 3VVBA 3QNMA 4OHWA 4OLBA 1IWBB 3AL0C 4F4JA 5LVAA 2XB4A 5E95A 4O08A 4DLNA 1Q77A 1WMBA 2Q3JA 3FZYA 3ZWVA 1ZW6A 2EG9A 1K4YA 1LTHR 3PI6A 2BUAA 3L1IA 1YMUA 3B8HA 3RYIB 4DCMA 4C4YA 5B58T 2UVDA 5LYYA 3VYTB 3B1XA 4X8LA 2CKDA 1P2DA 2X0IA 1TLTA 1DJOA 1I9CA 4F3NA 4ZOCA 2ETXA 3ECAA 4KKXB 4IEFB 3JQAA 1QVZA 1E2HA 1YS4A 1SXJB 1WQ4A 1HDOA 4LK2A 5FUYA 3KEGA 4AK9A 1MIHA 1HOTA 2CL0X 4R2KA 4A6XA 3S7ZA 1XEXA 4JD5A 2K4MA 3IUEA 3NH6A 2XHEA 4Q37A 5CB4B 4KXUA 4AXBA 2H52A 2ZJ1A 4OGFA 2PXHA 3BB1A 2NV2B 1KI6B 2P9EA 3H75A 5AOCA 1U6IA 1WSWA 5HEKA 1CEQA 3OP1A 5IJAA 4Z4IA 3GPDG 4XVHA 4CIBA 2FW8A 2X9QA 1ID8A 6LDHA 1CPYA 1VI5A 5ALJA 2C1ZA 1POWA 2GI4A 4ID9A 2IE8A 4DRZA 3U31A 3VTAA 1DRVA 4MYRA 3VPDA 1UWCA 1VBKA 2I4RA 5EQFA 2O8BB 4L73A 1TF5A 3AP1A 4Y0VA 2P9FA 2ZIFA 1A27A 4MVJD 3FTCA 1O08A 1UPFA 3PD0A 2I7TA 4RUKA 2J6IA 3B12A 3QUSA 1FSPA 3FUXA 5FNZA 1ZK1A 4XH9B 1RC1A 2GA8A 3A9TA 4FCCA 4XUDA 3GFSA 5CJPA 2VQ3A 4MUHA 4PQEA 5LMCA 1PT8A 5HUJA 5T41A 4PSKA 5DNEA 4ZDJA 3OZBA 3VO2A 3HV2A 4UE3S 3TJZA 3FYUA 3F96A 3D8BA 1PL8A 3ZE8A 3BCUA 1YRYE 4RD2A 5B30A 2PQ0A 3U37A 3CUSA 3N5CA 2W2PA 4J4TA 1N4AA 3HGMA 5KVSA 4OU5A 3ETDA 4LFAB 1LEHA 2P6OA 4QWMA 2QLFA 3F9CA 5DT2A 4Y2XA 1ZH2A 2BEKA 1YB6A 1OXUA 4BLTA 4PQYA 1JIUA 5CYFA 1KGSA 1UMKA 2VLBA 4FD3A 1PK9A 3GCDA 3GH3A 5BN5B 3TPCA 3W5CA 3GVCA 1JB9A 2E55A 2R3SA 2AOUA 1YR6A 2AQKA 2VXYA 3FGZA 1Q95A 3IH5A 3QENA 5TF0A 3T7TA 1E3MA 4BFVA 2X23A 3QY9A 4MYHA 3DNMA 3EISA 4BQQA 2IUTA 3SBEA 3S8EA 1MQSA 4ALIA 1YVEI 5J58A 1W36C 1H2BA 4HZIA 2R8XA 2YOFA 3QE0A 1XKQA 2ZG6A 4P80A 3VO1A 2H51A 2MYUA 3DT9A 3NDRA 2D0DA 4H1WA 2XWPA 3S2IA 4D02A 3JQDA 1KY4A 3KD3A 4WWHA 1BE1A 1LPBB 1QH8B 4JWTA 4ZODA 4WNAB 1Z8HA 2ZULA 4PNPA 5DW3A 4JYPA 1U5BA 3U7HB 4BPBA 4B9AA 5IDQA 3RIXA 3TRFA 3VR3A 4HXYA 1Y8AA 1FFWA 1XRLA 5ADVA 3RFTA 5DULA 3N05A 1W5TA 2D2EA 2CDRA 3D8TA 1NJ2A 3H2ZA 1UBOS 4MV0A 1K89A 4QVGA 4F9TA 4KPFC 4ZHSA 3U56A 2DFLA 3U7JA 2MU1A 1P31A 3AR8A 3TN7A 1XTZA 3G5LA 2A86A 4K1LA 4RVSA 5BSRA 4KR0A 5IAJA 4NS1A 4XJTA 4MWSA 3ESDA 1FPQA 2O0LA 1ZHHA 3TW0A 4NBKA 1IN5A 2LDXA 3IPLA 3KTOA 1VLLA 4CL8A 1A96A 1Z28A 3KT6A 3SVLA 2VF2A 4KW7A 3KNZA 3UAZA 3ECSA 5H70A 2ZXFA 2VPTA 5CDYA 4LV8B 3IDSA 5A9SA 1T2CA 2C1XA 2CVQA 2G9ZA 3LMKA 1QIEA 1GTSA 4M7RA 1X7YB 2BMVA 3OZWA 1Z82A 5B7PA 1D4OA 1JSCA 1QRAA 2C2MA 4FE4A 4AULA 2DCUA 5F78A 4QFBA 2Z8ZA 3B85A 2PTGA 4TUYB 2AOXA 2ATIA 3W4JA 4CDGA 2HTEA 2PMDA 5FA5A 2C84A 5D3QA 4WY5A 3WL7A 2AFRA 8ABPA 1P4GA 1GZSA 1AJEA 4PYMA 4CCSA 1GQRA 3DVSX 5AXAA 4HMQA 5B53A 1E1NA 3KAQA 1K66A 5JYCA