2XYHB

Caspase-3:cas60254719
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
b'HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 SUBUNIT P17
molecule tags Hydrolase
source organism Homo sapiens
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
total genus 19
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2xyhB00
1GFWB 3R7NB 3D6MB 2CJXB 2C2ZB 3GJRB 2XYGB 1RHKB 4ZVQB 2QLBB 4ZVRB 3EDRB 3NS7B 1SC1B 2Y0BB 1F9EB 3D6HB 2C2KB 1RHUB 2H54B 1PYOB 3R6GB 1IBCB 3R7SB 1RWXB 2C1EB 4ZVSB 3P45B 1RHRB 3IBFB 2H4YB 2HBYB 2XYPB 4ZVTB 1SC4B 1RHQB 2H5IB 1RHJB 2FQQB 2CNLB 2XYHB 3EDQB 1QDUB 4ZVPB 3R7BB 3KJQB 4ZVUB 2QL5B 1RWVB 3IBCB 3R5JB 2CNKB 4DCJB 2Y1LB 1RWKB 2H65B 5K20B 2P2CB 2QLFB 4DCPB 3D6FB 3P4UB 4ZVOB 2HBZB 1PAUB 5IC6B 1I3OB 2QL7B 3R6LB 2CNNB 2HBQB 2H4WB 2HBRB 1SC3B 1RWOB 2CNOB 1RE1B 1RWWB 4JB8B 2H5JB 4DCOB 3SIPB 3QNWB 1RHMB 2CJYB 3RJMB 1RWPB 3GJQB 2DKOB 2CDRB 2XZTB 2C2OB 3GJSB 3GJTB 1RWNB 2XZDB 4LSZB 1QTNB 1NMEB 2QL9B 5IC4B 2C2MB 2QLJB 1BMQB 3KJFB 1RWMB 2H48B 3KJNB 1I51B 2H51B 1ICEB
chains in the Genus database with same CATH superfamily
5F41A 1IUJA 3E3XA 4JV5F 2I5JA 2CQDA 1JLBB 3D54A 3MCMA 5A8WA 5HMZA 2GJIA 1S1UA 4WIIA 1URNA 2L9DA 4C9DA 1HBOB 1LW2B 1JLCA 1S6UA 2GA7A 2V63A 3CDWA 4IQMA 2RDDA 4UUWA 4ZVQB 2BDPA 2BRKA 3NNHA 4Q45A 2CQIA 5CAAA 4JYAJ 1RT7B 4DV1J 4FYXB 1L5UA 4Y34A 1UFWA 4ZK7M 3H2VE 1P6TA 2DGTA 4H4KC 2IHR1 3DLHA 5F0WA 4FXDA 2W8KA 3ITHA 1S48A 2F1FA 2RUSA 3FBEA 3FJ2A 3OXFA 4CP5A 1KDNA 5LT5A 2FLLA 3IFEA 4DR2J 4DPXA 4CO4A 2B6AB 2CFXA 2WSEC 4ZVSB 3M8YA 3MPYA 3IS9B 4A8FA 2ZITA 4A8SA 4UT4A 2F5GA 3LALA 3G82A 5KTQA 2HWTA 1WDTA 1N5TA 3E01A 3GCWP 3I9ZA 2AEFA 4Z37A 1FRXA 2HGMA 2J7UA 4NPOA 2H5IB 4DR3F 3DLLQ 1AZSB 2P6SA 3HFKA 2I0XA 3DRSA 4DX5A 2BX6A 2HQ3A 1AFJA 1TKZA 1S1TA 3BKTA 3NAIA 4LUBA 4NLXA 5J2NA 3CT9A 5GAHI 3QSYB 4DX7A 4N77A 1T7PA 2HRUA 3IGVA 2XQCA 1W7WA 1FESA 1Y0HA 4J9VA 4MFBB 4R25A 1EX8A 4CNZA 4LRDA 4QWEA 4OYWA 4HT7A 1KQFB 3VAKA 3CO9A 3TOQA 2V4JA 2YNIA 2AYBA 3MD3A 2PDAA 2EI5A 5HO4A 1JLAA 4H4KA 4AL7A 1G4CA 3ISNC 2KH9A 4NA3A 2L48A 2OP5A 1ULRA 1RK8A 3CCES 3M9NB 4PG6A 2RF2A 2IAJA 4X62F 2AV5A 5KFCA 4WTOB 3OVSA 3CJRA 3E2EA 3VWSA 2GMLA 2VONA 3AXMA 5JUMA 2XY6A 4MKYA 1UTAA 3J81Y 3VAHA 4EZ6A 4LF5F 1D8ZA 2WHOA 4DFJA 2N4CA 4O4RA 5A0YA 3MI7X 2Z57B 2H5JB 3PXGa 2ZE2B 3GSIA 3VGVA 4DOZA 2O67A 5AXLA 2QO3A 2IJFA 5LMUJ 2DRAA 1UWAA 8RUCA 3C15A 3FC9A 4DV6J 2F8MA 4CH0S 4OZNA 1ZTWA 1HD1A 3KDOA 3CD0A 3R1LA 1HYSA 1TK0A 1FKPB 2EFQA 5D4OA 1WKJA 2IC3A 4ATNA 1FEEA 2DGOA 2ZKUA 1WG1A 2IVMA 3ET6B 3GZ7A 3UR3C 1SKUB 4RBUA 4J9LA 1B0TA 4H4MA 3HHEA 1K1SA 2O01C 2XMJA 3M6UA 5KG4A 2XM3A 2B5JB 4TU8A 4XK8C 2BM0A 2B51A 4OZ5A 3KLEB 4ZJLA 1QTNB 2BRLA 3HHDA 4XTTA 3D0HE 1C0UB 5J2PA 1NDKA 1HNZJ 2NUHA 1X60A 1FXLA 2NCKL 3SFGA 1CS4B 2FHOB 3DGVA 2IVFB 4C3KA 4CZCA 3KYLA 2RS2A 2H48B 3RBDA 2Y3YA 3T6JA 4E8UA 4WIQA 2HGNA 5CCMA 3HHNB 2FVRA 1QE1B 1OIAA 1JJHA 2HSEB 2YQ0A 3AOCA 3N79A 4HTJA 3IR5B 3TA0A 2HNDA 4Y2KA 4YR0A 2I6WA 2Q43A 2XNRA 2V94A 3LW5C 1SIZA 1QUVA 2KJVA 3JTPA 2AT1B 3BGUA 4NZ7A 1N5QA 2AWZA 2CG4A 4USIA 1FF2A 4MYUA 3EMTA 4Y2MA 3O2IA 2IJNA 1XN9A 4ETXA 1Y11A 4NYZA 3SQGA 1JLEA 5SZTA 5GAHU 1HMVA 5KT2A 3P49B 2ILZA 5A76A 5IWAF 4F3QA 1VGYA 3IO1A 3A8JA 4KAIA 4OV1A 2ZHOA 2XLJA 2MKCA 2CPYA 3GU0A 2XZWA 3PJXA 1SUQB 5G0RA 3HM9A 1TR0A 1VBZA 3NOGA 3R6GB 1NEEA 2DIUA 4DQIA 1QY7A 2SXLA 5KFDA 2BJDA 4ALZA 4ED8A 2W2OP 2R7OA 3S1TA 3W5ZA 3IP0A 1FRIA 4DV7F 4B3TJ 4L73A 4ILLA 4CM0A 1OSCA 1TV6A 2AZ3A 3ICLA 2YKQA 3QMQA 4USTA 4KIAA 4KV8B 4C8OA 4WYLA 2P8IA 2WSFC 4W92B 3R5BA 5EDWA 2ZZTA 3M2VB 1LFWA 4KHPF 3DGPB 2FQQB 3T19A 1RTJA 3DRRA 3LOUA 4HDHA 3VHQA 4DPUA 5HQ8A 1EHWA 4ID5B 3TZZA 3OSNA 2ADCA 5CYMA 1MMDA 1RI7A 4N47A 2DH7A 2W9CA 2P6TA 3VAFA 2XY7A 3I32A 1LWEB 1W2BR 1FA0A 3M30B 4M94A 1MROB 1R0BG 4LSLA 1HQ2A 1DY3A 4OI2A 2KT2A 4DZDA 4N5SA 2CA9A 1BLUA 3LAMA 3T1HF 3ZNJ1 3HVTA 3PYDA 3GLJA 3QQCD 1M5KC 3IM8A 1NB2A 3K17A 2ALZA 3PYGA 4NASA 5ETQA 1UVJA 2XS5A 2VG7B 2MXYA 4OI4A 3MR5A 4GVBA 1GMVA 3IG1B 3D2WA 5T14A 4LIRA 4X64F 5CD4A 4RW8B 4X66J 5DDQC 2MMYA 1TL1A 4CTAA 4ZVOB 1NXIA 2DHXA 3DKDA 4YUDA 3ELHA 5KFAA 1JB0C 2ZBCA 2DHAA 2M7SA 5H9FJ 3CXCR 4LF9F 1CVJA 3GSDA 1FX4A 3HVTB 4Y65A 5IQQA 2MKKA 4Q8EA 2ZOGA 3EGZA 1ROFA 2CNNB 1JK9B 3Q2SC 4OX6A 2X3DA 4GC7A 3SXLA 2HBRB 2EXUA 2A6OA 3CD6S 2I38A 2CNOB 4RNNA 3BJYA 2IBKA 3HX9A 5HQMA 1M5OC 2HNYB 4IRKA 2PE8A 5H9FK 3CJKA 5AE2A 4X4NA 3DOMB 3HCXA 4HT5A 2GMHA 1VS3A 5L8RC 3LPYA 3BO3A 3THTA 1RT1B 3IRXB 4J7CA 1TMMA 3KJVA 5EWEA 2E5HA 4BHQA 4ES3A 2DITA 3O8WA 4GKJF 3D4JA 3BKUA 3TAPA 1WF2A 5ETKA 5CYJA 3QIPB 2J0WA 4CO0A 1FWKA 4B9NA 1FE4A 2UUTA 3FZ2A 4F36A 4URGA 2UVRA 3TEHB 3M2UA 3HHLD 3VGSA 2UU9F 2R2TA 2VQEF 4WYWA 2JX2A 3PVXA 5KFYA 3NY0A 4JI4J 1HQEA 2FHJA 4ZIVA 4ZPCA 4ILRA 4YB5A 4JI5F 1FK9B 2QT7A 2V6AA 3C6TA 3MM5B 3N4WA 3US5A 2VG5B 1J5OA 1RWMB 1SKSA 2ZFHA 3CJSA 2HHVA 2BR0A 2R8GA 4ITSA 1D0EA 1FJGF 1F5CA 4ECVA 4G65A 3BSNA 4MMOA 5ETPA 1QD1A 2HLUA 3KNGA 3KNAA 2EPIA 3M2UB 4F0HA 3QLHB 2CQGA 1N5YA 2HHTA 4LQ9A 3UDVA 1NLKL 1YJTA 1T03B 2E9RX 2C2ZB 2HVEA 4PWDA 3LP0B 5CZVA 5K14A 2ALYB 3HF5A 4DU7A 1Q16B 2MJUA 2PT0A 2W01A 3ZZ0A 4YB1P 2M3DA 3T1AA 3FEXB 3O1LA 4B9SA 3G6ES 4DFMA 2GHWA 2OPPB 2OPQA 2ILYA 3I0SB 3MCOA 5HATA 4DL7A 2N7CA 1QLNA 5CABA 1SJ3P 5F8JA 3D6HB 3SSRA 1H74A 2W8LA 3GE9A 4H4MB 2HQFA 2YWKA 1U2RA 2FD2A 2JVOA 2KVQE 2VBYA 2WBRA 4NLWA 4TVAB 1RSCA 2DK2A 5K14B 2UXDJ 2E5LJ 2HZCA 2FLPA 3KLEA 4AYBD 1IBMF 3QATA 1KD1T 3H4BA 4LF6F 5HK4A 3D1OA 4BS2A 2W9BA 3JSMA 4JI2J 1UZDA 3IBFB 3HZEA 1RT6B 4U95A 4Y0FA 4F8RA 3LGMA 4IFVB 2IA6A 1KQSR 1NUEA 3VV2B 2XY5A 5C24A 1U48A 3UN5A 1U02A 4A8YA 4NLVA 4U96A 4QR2A 3S01A 4CYUB 4X4PA 3CCQS 4F4XA 5HVHA 1H7WA 2K2PA 2O5DA 2WB4A 4LF5J 2GHVC 1BGXT 2J8AA 1TL7A 3N5BA 3EYZA 1DQ8A 1Q8LA 2ZM6F 2DNKA 2ZBRA 3ZO7A 3KLVA 1QSYA 4F02A 2DR7A 2ZD1B 3JSMB 1D1UA 2CPHA 1YJNS 4WXOA 1RWVB 1Y9OA 2EFNA 2QA1A 1RT6A 3EVOA 3WX8A 3R5AA 3HJVA 4X65J 1SJ4P 1S4EA 2V9KA 3O6QA 4IFVA 4TLQA 3DLGA 4DWIA 4LF7J 3DYAB 3M32B 5J1EA 5HL7Q 3PW2A 4Q5VA 1RAJA 2W2PP 3FFIA 1WOSA 1G2EA 2M52A 2MQLA 5DDOC 4ETZA 5E3CA 4CM2A 1FKOB 1PG5B 3FBFA 4P10A 2FPHX 2WVDA 2J76E 3O5TB 4ZP6A 4ZP7A 3TX8A 3QJLA 2W7AA 4Z7CA 2W24A 3IBWA 1UA1A 1IQZA 4KTQA 4ED0A 5DQHA 2K3IA 4DR7J 1EAYC 2I5JB 1RU2A 3K89A 1C1CB 1M0SA 4RW9B 2W25A 3TWZA 3AA9A 2Y9HA 1LWCB 5KFUA 4EU0A 4NCGB 4UY85 4FF1A 2WVEA 3N6MA 4PQAA 1MMLA 5ETNA 1UKUA 3M9MB 2V8PA 2YPYA 3LWLA 4V19J 1AT1B 4OYIA 4O3NA 3TQ1A 4IYQA 1JJ4A 1RWPB 1Q0NA 1NZ8A 4FKYA 3W2VB 2ZJPQ 1DURA 4FS2A 3KXDA 4EO8A 3PR4A 2ZHBA 4P7VA 4DR5J 1HL6A 1R8BA 2HQCA 4PWWA 3H42A 4CLWA 4DV2F 4LF1A 1S9EA 4ED6A 1CEZA 4DLGA 3QGIA 2XWXA 2VJVA 2ATCB 3AODA 3NNAA 2XZDB 4WFXA 1Q78A 5D8HB 2J9EA 2LQ8A 3PY8A 1HNWF 5I3UA 4NEYA 2HHXA 2YWEA 4NLSA 1HW8A 4QQBA 3BYPA 5A8KA 3RB4A 5F3TA 1SV5A 3W65A 3KLHA 4RLEA 2C2MB 3FUYA 3BSOA 2HKEA 3E01B 3K59A 3HSJA 1OO0B 2ROGA 4F50A 3B4MA 2J9DE 3BQ0A 4NCAA 1AZSA 1SQEA 2ZWOA 4NLUA 1T11A 3MECA 1OY8A 5KFZA 3HSDA 4ZJOA 3KK1B 4N8OA 2GS8A 3KHHA 3LGNA 4ENOA 3HO1A 2CZ4A 2OKQA 1P9YA 1XWLA 3DI6A 2VKZG 4QWDA 3CJ2A 2IMWP 1R43A 3R3TA 2HS3A 2CJKA 1PJ6A 3M7VA 3MHYA 3M6XA 4TYBA 3L4BC 3W2WB 4F4AA 3Q23A 4J91A 2G1DA 2XS7A 4C97A 3OW2R 2MLXA 2OFGX 3VGUA 4ZLNA 4PAAA 3J7AN 2OPSA 5C2CA 3W63A 4DR3J 1TMJA 1VIXA 2APOA 4XAKA 2V8GA 3MECB 4TQRA 2ZBIA 1OYEA 3OTCA 2IM1A 2CQ3A 3JQMA 4KE5A 3T1HJ 5B09A 1GH8A 2YKNB 3Q8QB 3OTOJ 1QAJA 3MM8B 2CJQA 3MTKA 4TY8A 9ATCB 2JHEA 4J9SA 3MR7A 4DV3J 1R8AA 3G2XA 5GAEU 1FFWB 3I5AA 4MT1A 2E1CA 3QIPA 3PO5A 3RG6A 2VODA 3MPUB 1A6LA 2GVZA 3QAUA 5J1NA 4P71A 4GRSA 2UUWA 3A12A 3L09A 4OIXA 5CHCB 1VC0A 1HBMB 3GIKA 2ZJRQ 4I6YA 2C1EB 2IRXA 3LA0A 3T6BA 2MZRA 5L39A 4QW9A 2AGQA 2PI5A 4N41A 2L9NA 2KM8C 4DFKA 2Y8YA 1YRTA 1T02A 3J7ZT 1KOOA 1FFSB 1KWMA 3P5BP 2VB6A 1FRLA 4ZVTB 3CULA 2BBEA 3C15B 3OJSA 4P2XA 2BJ1A 4F2RA 2XYHB 1MN7A 3EDQB 4ANCA 2OAUA 2B0GA 5KG6A 2UVUA 3AFGA 5E5NA 3TAMB 3V4MA 3F56A 1UL3A 4HACA 2J0SD 2GNKA 2DNRA 2CUYA 2OEJA 1NPKA 1B0VA 4N56A 3I55S 1U1RA 1SL0A 1FJ7A 3MAHA 4I7FB 5ETTA 1TVRB 1GMWA 3MFHA 3GYNA 4F67A 2IPOB 4I4BA 4USKA 1F60B 3JAMU 1GX6A 4C7QA 2WTFA 2RUGA 1Q1KA 2RU9A 2UXBJ 2G2YA 2MZSA 3PRVA 4KHMA 1C0UA 1RWKB 1SCJB 2ZH1A 1JWWA 4PKDB 3KTQA 4OYXA 3ISZA 2A10A 4EEYA 2R7UA 4ZVFA 3ETOA 4P74A 2FLOA 3C19A 3IAS9 4EI2A 3IWNC 4RL1A 1EP4B 3H90A 3D6FB 3W7BA 5DGBA 1FDBA 2WAQD 1H72C 3KLIB 5IC6B 1N5VA 1F5BA 3D1QA 3FCVA 2CJBA 4IG3A 3OFHA 3OSPA 4LF4J 1S76D 4B3RJ 3OL6A 2R8JA 2PD1A 3EE3A 4KGVB 2QTWA 4P75A 3ILIA 2FVSA 5K8NA 1HNZF 2HHSA 3M9OB 3FCWA 3AD8C 1EP4A 3CJ5A 5CA5A 5C24B 2ATLA 3NS6A 2FGOA 2MQ8A 3AD7C 1OY9A 1AUDA 1MNEA 3BB5A 2RIJA 4KH0B 2D9PA 3TVKA 5C25A 1IQTA 1JXVA 3EPIA 1U8WA 4IG3B 1N52B 4DXLA 4X62J 2DGVA 3Q8SB 4LF2A 1U09A 3M8QB 4KYZA 2VIHA 5AT1B 3DRPA 3D68A 2LFVA 2HURA 2ZD1A 4QIVA 3DHXA 2GO9A 4GMKA 4URQU 1M90T 1IKVB 2DNPA 3NGUA 4IH6A 4LSZB 4FYWB 3CB4A 4WK3A 4RW7B 3EGNA 5E3PA 2W9AA 3KJFB 1VK8A 1EZZB 3CJ8A 5KFKA 1L3TA 4O4GB 2FUG9 3T9ZA 4DV6F 4E0DA 1XTZA 4C3LA 4ZLPA 2B56A 4QW8A 5C42A 5HLFA 4ZCMA 3M2RA 1LW0B 1BWEA 3QPIA 4N76A 2VFUA 2BW7A 4DL2A 2MKSA 2NSBA 1FRJA 1FHTA 4I6AA 1N8RT 4JI3F 1RLCL 3CCLS 2VC1A 1NDLA 1GXUA 1WACA 4RW7A 3UN3A 4FKXA 5ETRA 2F63A 4P73A 2O1PA 4DV4F 3B82A 4C48A 3QT6A 4P9SA 2XYGB 2EFGA 2LXUA 5AXMA 2MYFA 4PG8A 3RTVA 1UEVA 2NXCA 1H38A 1RISA 3CD5A 1RA7A 2OO4A 2Z2YB 4I64A 4AXJA 2WSCC 3BR9A 2JVRA 4HYKA 2RDJA 1WHVA 5DLFA 4ZVRB 4NLRA 3HFZB 3EZOA 3W2VA 2LU2A 2MY8A 1ELOA 5KFPA 4DZ6A 4RBVA 5EX3A 4LFAJ 2H54B 1U6FA 3GB0A 4YDDB 2P9EA 3IC1A 3GWCA 1S1TB 4UW2A 5J2NB 4FPRA 2YX7A 3R5DA 5L1LA 4ZMMA 3F73A 2E5JA 3R7SB 5GADU 4KJIA 1KVKA 1CJTA 2LEAA 4MFBA 1HWIA 1WG4A 1Y7PA 5A8KB 5EN1A 4UUXA 1RHRB 4J9UE 4KBIA 2FIUA 3T5LA 2HNYA 4S0MA 1KS2A 3QBCA 2YNIB 2DNNA 2ZBPA 4ZVGA 3OXGA 1NK5A 2CNLB 2R7XA 1YJRA 1FDAA 3H5YA 4ED5A 1TL5A 1VOMA 2IMOA 3GR0A 2BXJA 3QT7A 2GQQA 4NRTA 3SDEA 1IBLF 3UW1A 2KT5A 3AQOA 2GAGC 1SB6A 4ZVUB 5KT3A 1N48A 1PYTA 1DAXA 2K06A 3ENWA 2XBPA 2AYMA 2BE2B 1FXRA 4M8LA 1KP6A 4B3MF 5IFMA 4DV7J 4B3TF 3DU6A 4EO6A 5LMNF 2EBGA 5MLCV 1WC4A 3KUHA 3KK3A 1FK9A 2OMOA 4PG5A 5KFSA 5L46A 1G7CB 5EX0A 4YHHF 4DV2J 4BWMA 1XNQJ 1R0AB 1Q53A 1XNRF 4HHUA 3QGGA 2DH9A 3NWGA 1EKSA 3FK4A 4ZKAA 3PX6A 2MGZB 4LR7A 4NE9C 2LMIA 4ZCLA 4RO0A 1VBYA 4LFCF 2J9CA 4ED2A 4RW4B 4CT9A 2VQFJ 1SL2A 3UN2A 2HBQB 2H4WB 3EICA 3BBFA 1ZA1B 4G1IA 2LU1A 4OYMA 4CIOA 2KM8B 3OD2A 5GVQA 4W90B 1O0PA 2DHSA 3CCUS 1WHYA 1FWPA 4OFZA 5DG8A 4K4YA 4XDDA 5M2RA 4C3MA 4IOBA 2UUCJ 1FWLA 1HWLA 1VRTA 4KPYA 3IR6B 1WC0A 2PN6A 2NREA 2BJ8A 3D66A 3H5UA 3UCZP 1C4CA 2DHHA 2VFSA 4LBPA 2N3LA 4LBIA 3ISND 4OMFG 5KG0A 3JB9k 1QTMA 3IGNA 1TKXA 3TR5A 5AJ3J 2CG8A 1TKTB 1YJVA 3GJQB 1NO8A 1NK7A 2FJWA 2EK6A 4DQQA 3BQ1A 4LFAF 1AW0A 2XZTB 1S79A 4B02A 1N0VC 1U26A 1RGVA 2OMLA 3MPWA 1KEKA 1S6QB 4FYYB 2MQQA 2ZE2A 4ILMA 1NSKL 3C16B 3DFEA 3DN9A 3JSYA 3MURP 4WU3A 1HNIB 1W25A 2VJUA 1RT2B 3H5SA 1MMNA 3OLBA 3GG0A 2NXNA 2FZKB 3OBIA 1RTIB 1Z2LA 2ZKTA 3V81A 4JI1F 2VFTA 3NBPB 3BV8A 4DFPA 1T8EA 3MMBB 5D4LA 2N3OA 4J37A 2F3JA 1VIOA 4ZA1A 2D74B 4E2FB 2CQPA 3MOZA 4C0HA 1UVKA 4B9LA 2ZZMA 4FVMA 2D3O1 3R7NB 2HIQA 4K4WA 2LLZA 2V8HA 3RRKA 1I5OB 4DSLA 4HI2A 1CS4A 4M5GA 3Q8RB 1X5TA 3BDEA 2P5VA 5LL6d 2ZH9A 5LSLA 3NS5A 2DD8S 3OTEA 3CDAA 4OZLA 4F04B 1VC5A 1VYAA 1QM9A 1WUUA 2PEHA 4MKAA 4FS1A 1MN9A 1HWKA 2RH3A 3VZIA 2VOPA 1DHMA 1K44A 4O44A 5DDPC 5KFFA 3DGPA 1JNZB 1Q8KA 4YR2A 1VQLS 1PILA 5DZ7A 1FKOA 1KQKA 5L9XA 1GMWD 4I2QA 7FDRA 3CCRS 1RTHA 3UD3P 1SVDA 1C0TB 2AF6A 9RUBA 5KFIA 4WE1B 1L3VA 4CO1A 5FD1A 3TJAA 3FBCA 4QIWD 2G0CA 1C1CA 4RW9A 2D69A 4DL6A 1ZETA 1WORA 3B54A 4UTGA 3CDUA 1VMBA 3OHBA 3BGRB 4U8YA 1TP7A 1GTHA 2V68A 4RU9A 5HBMB 4MYTA 2RB7A 2W2NP 4HH1A 1XQIA 8ATCB 2AYEA 3P96A 1QAYA 2VG7A 3OTDA 1NRKA 4CLLA 1VQ5S 1B64A 5F0UA 3R2CJ 2AD9A 1OYDA 4ZCKA 1JJCB 1GK8A 1TTHB 1VJWA 3TJ8A 3SBMA 4LRAA 2C3MA 2ZC3A 4I1TA 4O3PA 1RAIB 1UWBB 2E5GA 1MU2A 5AE1A 1ZM9A 3HHLB 1HBOA 2MSTA 3CIMA 4HKQA 2Y1LB 4WFNQ 1YKWA 1P27B 1SJFA 1QSSA 5K20B 1SV5B 4ID5A 1SL1A 3KHRA 3A8IA 1F3VA 5A8RB 4U8VA 5L1JA 4K0KF 1WHXA 1MG7A 1LWEA 4Q43A 3RB3A 3DOMA 2HZVA 2J7WA 5B0BA 2AU0A 3HPOA 2HHQA 1PAUB 2WW8A 1RT1A 1Q82T 4L76A 2YBVA 2QL7B 1CSJA 2QN6B 3GFHA 3HI9A 3DI6B 3HKWA 5KFXA 3R6LB 4F4YA 2C2EA 1Q81T 4PR6A 2CPEA 2EBEA 4L3NA 4IFYA 3N0VA 1RE1B 3UNGC 4DV1F 3DLBA 2X51A 4EK2A 1NPPA 4K4UA 2DNQA 3MM6A 1ACMB 2CXEA 2HHUA 3V5RA 3RAXA 1HQEB 3AXKA 4M5KA 2K7JA 4CLSA 1JIHA 1I94F 4DSKA 1RZMA 2Z8QA 3T5KA 3SI8A 2HW3A 4Y3CA 3L3CA 1HW9A 3BGLA 4PQUA 1SH3A 4NX9A 2GW8A 4C8YA 3ILOA 3J80Y 3JSRA 4KSEB 1IR2A 4OYOA 3ZTQA 4F4WA 4NXNJ 1OQ3A 1WHWA 2IJRA 3U1MA 1VLOA 3Q0AA 3CCJS 3KMSA 1VQYA 3CIZA 3MM6B 4U7UK 3SSSA 5E3AA 2CQHA 5IM0B 2DO4A 4A46A 1N5YB 2HYIB 2Y0SD 1T9YA 1VK3A 4ID8A 3LP0A 1U1KA 2DXFA 2HMIA 1NK4A 2E5IA 3MR3A 3GIJA 2PA8D 2XMVA 1HQUB 1I1GA 2I8EA 3KG4A 4UY8T 4PQUB 2RD5C 1HBNA 3C66A 1S6OA 4WXWA 4WFBQ 3GIMA 1FRHA 1T3OA 1HNVB 2OPQB 2Z4PA 3G96A 1SJRA 4WWSA 1S1WB 2V5HG 3WX4A 3TI0A 1SXLA 4LT6A 3KHLA 1JNRB 1NSAA 4X66F 1AUSL 2E1MC 2DGXA 1PKUA 2BKNA 2MZTA 3RBXA 1XIQA 5BYSA 3RBEA 2OTLS 2CJXB 4DUTA 5H9EJ 4YMEA 4LF9J 3HJFA 4G3IA 2JLFA 2HMIB 4J5OA 4NZ0A 4QWBA 3JSBA 4WZQA 3DOKB 2DHGA 2VBZA 1GQEA 1TUVA 2IDEA 5DS7A 3ZZPA 2JEJA 2KXNB 4PXDA 5DETA 5CYQB 3ZFVA 1K8AT 2OUGA 2AYGA 4C6AA 4JI4F 5IT9Y 5L1KA 3IM9A 2DGWA 3UDLA 1B0PA 3FMBA 4RWXA 2HVDA 4X4VA 2HEKA 3I0RA 5K5MA 3TUJC 1KN6A 4Q2MA 2QIFA 3I87A 1EQ0A 1Q79A 2HFUA 3G8TA 1X4GA 4WP8A 4GKJJ 4USJC 3C16A 3GR1A 4K2XA 4NLOA 3GILA 1WJ9A 2H5EA 1TAQA 1OSDA 2PA3A 2RVJA 2MKJA 5J2PB 1N56A 1RT2A 3DRYA 3G87A 4N8NA 2X1FA 2OPPA 4ECSA 8AT1B 2Y1RI 4DMZA 1UVLA 1KC8T 1CJVA 2D7SA 2WZ1A 5I42B 1MWYA 3HXMA 4J9NA 2UU9J 3DLGB 1URRA 2DB1A 4DR1J 2IVYA 4KC5A 1UFKA 4DF4A 2DR5A 3QRQA 1N33J 4JI5J 1HI0P 3THPA 1FDNA 3H5XA 4O3QA 3UCGA 3VVTA 4UZBA 4IQXA 4F0KA 3T41A 1LXJA 1SC6A 3BQ2A 3GMGA 1FE0A 2C2NA 4CLKA 4NWBA 1NK6A 1S49A 4NYPA 2VPYB 4P2SA 4ED7A 2WOMA 5IV4A 5GADI 4HEA9 4DCJB 2VG6A 1U0SA 1LNQA 3SQGB 1BC6A 3W9IA 3PEJA 1CC7A 1RJJA 4O23A 2JSXA 4ZCIA 6FDRA 4NCGA 4OX7A 2BZ2A 4Y28C 4R8UA 1MWQA 4LF6J 1VQSA 2JFDA 4IR9A 1RQ0A 4MKVA 4PRFA 4G1QB 4HL9A 3DRXA 3NAHA 3L7PA 4WU2A 2CPZA 2ZUGA 5D4NA 1KQGB 1U7LA 4OI3A 3MUTP 3H7HB 3BGFA 3GYXB 4C0BA 4K4XA 3K8VA 4DF8A 2EC2A 1R89A 1TUWA 2BACA 2WB1D 2CWKA 2ROPA 3W5XA 5ITHA 2OD4A 3VAGA 2ZUAA 2QLXA 2IRYA 3DYAA 3M32A 5AXKA 5A8WB 4KV8A 5L38A 3CCSS 3OJUA 4PWUA 3J80U 4FZVA 2GHPA 2QX0A 2W2QP 2QA4S 4CLTA 3P6YC 2CQ4A 2ROEA 2U2FA 3WZ0A 4DX8H 1EB0A 2RNEA 1RKIA 2VFRA 4ZLLA 2ZHAA 3RJMB 3W5YA 1RA6A 2BUNA 4DV5J 4JI6J 4ZPDA 1O51A 4U9RA 4BBYA 4U6PA 3SYZA 3ZZYA 4NA1A 3S8SA 2QLWA 1FERA 1EETB 3CGIA 1U2FA 5BJRA 2Y8WA 3N28A 3OT9A 3P5TL 1LWCA 2E7XA 2N7YA 1FVQA 2HHHF 2CKWA 4KHPJ 3LP1A 4OQJA 2DEJA 5HJYA 5IQ6A 2LQBA 1ZM4A 1WEXA 3I4PA 1YZ6A 2X1GA 3R97A 4TQSA 2LECA 1YITS 3NLCA 4QWAA 1K0VA 2AEMA 2W1BA 3BBBA 1BQNA 4AL6A 4ER8A 3OPKA 2ADBA 3G71S 4M95A 3DRSB 3TNVA 2DTJA 2R3VA 2K7KA 4QZVB 4WFZA 3CE8A 1RBAA 2KFZA 1LV5A 4X4RA 1P9QC 2KJWA 5D15A 4WKRA 2IY5B 1KHWA 4Z7YA 1CC8A 5KFBA 1QAIA 2RKIB 5KFQA 1T95A 4KT0C 5I3UB 4DV4J 1CJUB 1IWGA 1NH8A 2IM2A 4ICLA 5ETOA 1WELA 3PX0A 2DRBA 2OPRB 5HQLA 5GAGI 5B0FA 4AD6A 2MJNA 3DLJA 1XR5A 2NXEA 2YKOA 3SCKE 5BR8J 4FYDA 3QYYA 1HYSB 2FTRA 1TFYA 3BN7A 1IKXA 3X1LB 1VQ6S 4USUA 5IT4A 4I56A 5DO2A 4UZCA 2ERRA 4ZPTR 4Z2XA 1NCLA 2LQ9A 3M05A 5K9FA 4JYAF 1V5VA 1ZZFA 1AYEA 2KN4A 1PIEA 1W26A 3UCUP 2E1AA 4K4ZA 1UPMB 3OHAA 3Q86A 2EW9A 3OUYA 2Z30B 4RW6B 2OIHA 4ZN3A 5KFMA 2KFNA 3CDBA 3PYEA 1Y4ZB 3TEGA 2OPSB 4NZ6A 2JL9A 1KRPA 2FHKA 1R7IA 4F7VA 2FDNA 3DMJB 4RWWA 4A47A 4TU9A 2LXIA 2XMAA 3QJPA 3A8KA 3KUEA 5KFJA 4NI2B 2MKYA 3AJDA 4QR0A 1CULA 5DG7A 1G1XA 1B7YB 1X9SA 3K8WA 1HNVA 4RUHA 1M5VC 1D9AA 1YZ7A 1U0HB 1D09B 4QWCA 4GKKJ 1CPZA 3RRGA 4RUBA 2OH2A 2LA4A 4WP9A 3QLHA 5L1IA 4F3OA 2VQFF 1T05B 2V50A 4QU6A 1UW9A 3W62A 2BJ9A 2YNFA 2XCPA 1PYSB 1XR6A 1T03A 4DG1A 1K73T 3FRYA 1UJ6A 2EFOA 5LMNJ 1NJWA 2DY9A 4ZHRB 3KOAA 2DJWA 3GTYX 4TY9A 2QA2A 1XNQF 5IT9U 2HZAA 4MH8A 2FLNA 3NCQA 3NKYA 3X3UA 2X7IA 4LSNA 3Q8PB 2E1PA 3FSXA 1F0XA 2QYCA 1RTIA 4I67A 4B3OA 2GC8A 4Y2IA 2ACYA 5KFLA 3BO4A 2KYZA 3N6NA 4I7FA 1QE1A 2OFHX 2RRBA 4DR4J 1NZAA 4UQGA 1EIYB 2J6TA 2JWNA 4CLYA 4Q44A 3MAAA 5AE3A 1ZAVA 4NLQA 5FDLA 4WZMA 4PPDA 3D5MA 3VAMA 2A6MA 5F8NA 1RWOB 4C0OC 4C98A 3NL0A 2ZVSA 1NSPA 1LWFA 2RQCA 1B99A 3V6JA 1HI1A 2HRYA 2PMHA 3AQPA 1V3ZA 2HVZA 1IKVA 2KVIA 2C3OA 4IDKB 4DCOB 3VTIA 3CCVS 4AQYF 2XNQA 3MM9B 2V2VA 3M8ZA 4DQPA 1ZBTA 1RWUA 4JV5J 1HMVB 1BQXA 1PC4A 4Q0BB 1JMTA 2EC0A 2JEIA 1N5SA 3A4TA 3DHWC 3A3NB 4MKBA 3UVJB 1ZOTA 2CVIA 1HIYA 1KSPA 4NOHA 4EYHB 1YVFA 2F8HA 3OR2B 4JI2F 1DLOA 2QV6A 1NHUA 1RT4B 4LRBA 2V2QA 4MIWA 1R6VA 1HNXJ 1BUXA 4XO0A 1XMQJ 2WOMB 3HT0A 3CTRA 1YBUA 1S7IA 3QAEA 4CLZA 4DUYF 3D6TB 3T5JA 3H59A 4URSA 3AAWB 3D1HA 1RBOB 2M4MA 4A8WA 2QLJB 2XMUA 2HFZA 2OEMA 5HBMA 3CC7S 4B9TA 1I51B 5F8MA 4FVCA 4FBTA 4G1QA 1T9WA 2FY1A 3KDNA 3M8QA 3PW4A 3CO0P 3JXOA 3OR2A 5LJ3Y 2CZVC 2YKPA 2B3TB 3A1YG 2JNJA 2KZMA 1UJ5A 5E33A 2L08A 3HVWA 4NEZA 3FRZA 1TU0B 3K0JA 4A8QA 5A2QU 2XMTA 3I4HX 4KKOB 5B7WA 1X5SA 1S5ZA 4QU7A 1M1HA 1N33F 2GAHC 4QYZJ 3BPDA 3AH6A 5BYRA 1V3SA 1YK9A 2MSSA 3FZBA 3WC0A 1J2VA 4OYBA 4WK1A 1B3TA 3BF4A 3PW5A 1P1LA 4DX6A 2AJQA 3EJMA 3PFEA 1FJGJ 3Q83A 5D3GB 2J0XA 4RW8A 2KRBA 2D3UA 2DNYA 3C46A 1BE4A 1R8HA 4MK8A 5HMXA 4J9OA 3RB6A 2QE5A 5DM7Q 1RT5A 1TZ0A 3L95X 4HHJA 1JLCB 1XBWA 1GEHA 1RT3B 2XTJP 2KL8A 2LVWA 4LQ3A 1PGZA 4EBDA 1HHTP 2OTJS 5F8GA 3G8QA 1Q5VA 4CNYA 2GX8A 4A8KA 1X4CA 1ZA2B 3ENVA 1U2CA 3LANA 4HTIA 3LUYA 5T7LA 1R6YA 1K47A 2UVVA 4ZVEA 4P52A 3HKZD 2DYAA 2V0NA 1AFIA 1S9GB 3JTNA 1H98A 3ONQA 1RAAB 4ED4A 2ZOMA 5FLXU 3IRXA 3KK1A 2RMLA 3KHGA 2E1RA 4H4OA 1HA1A 3R7BB 2RF2B 4UF4A 3RYLA 3PV8A 1F9FA 2B6AA 3QRPA 2KZZA 4NLYA 2QL5B 1HR0F 1U4BA 1S57A 4IO1A 2IBOA 3KUGA 4Y00A 1CG2A 1J5EF 3WIUA 2YH1A 3CJQA 1UETA 2H65B 2BJ3A 3QGHA 4B17A 1UJ4A 1OS5A 1S9GA 2XC9A 4K0KJ 4QCLA 1SJ1A 2GIFA 1N36F 2XSFA 3GPAA 2MPUA 1HBNB 3K2YA 4USWA 2AJ0A 2VL1A 4Y2CA 1S1WA 3PJWA 3D28A 1CQNA 3MGJA 2IYGA 4LBHA 1HD0A 2E7WA 2HLTA 1WNEA 1T0TV 4DQRA 4E98A 2WONB 1LXNA 5JMNA 1GXTA 4RNHA 5B0EA 3LO3A 5KFOA 1DJ0A 3EPGA 1HKAA 2N4DA 4TLRA 3DOLA 4CRJA 2GO8A 4JI7J 2W4PA 2LP4A 4BLGA 3OL7A 2IAJB 4DPOA 2CQ0A 4G6VB 3ZZZA 4K4TA 3EGVA 2RU3A 1FI4A 2E9ZA 2RT3A 1KTVA 3I0SA 5J2QA 3D3CJ 3BREA 3FMWA 2XO6A 2GJ2A 3IN5A 2DY1A 4RNFA 1U6ZA 5EWGA 3MZIA 3NBPA 1S72S 3F0NA 1EARA 1WDDA 1LWXA 4QPXA 1Q7YT 1UVNA 2C2OB 3BM7A 1RDRA 3V2UC 5HN0A 2PI4A 3WC2A 3Q22A 4JI3J 3HD1A 1YSJA 2XG8A 2F40A 5U47A 4J9RA 3ZNUA 5KG3A 1ZH5A 2ZWPA 3MTJA 4WP3A 2QMXA 3FQKA 2WW4A 4LFCJ 3DLKA 2W9BB 1YWXA 3M8PB 1VFJA 4PXCA 2F8EX 1E6YA 1CJKB 3Q2TC 1RAOA 5I3QA 1I94J 1F2HA 1RAFB 2AX0A 1S0MA 2C3UA 1TKTA 4A48A 4JI0F 5B0AA 3BYRA 1RYSA 1MWZA 2M2BA 3BDPA 1Y10A 3IXQA 5KT5A 2AEJA 2CQCA 4YHHJ 2B5JA 3ENAA 2H1YA 4FXWA 2LDYA 3D0GE 4ES2A 1TL7B 4EGLA 3VALA 4UOFA 2HS4A 4FF4A 3GV5B 1D3WA 1GFWB 2GCFA 2ZC4A 3CCTA 1H2TZ 1UCNA 2BANA 1Y5IB 3A8EA 2ZH8A 4PEOA 3DLKB 2ZH3A 2EEYA 2B4UA 3IWXA 4WE1A 4WBFA 2B4PA 3RW7A 5GAEI 2R8IA 2VUGA 2VG6B 2EKYA 2FVPA 1RAGB 1NU4A 3POTA 4U67Q 2P9CA 2VPWB 3LF0A 4GC6A 2UUAF 3GG1A 1RU1A 2JC1A 4K4SA 3MPVA 3S6EA 1JKHA 2PGCA 3CJ3A 3NS7B 1S97A 2UUCF 1Q86T 1M5HA 2VF3A 4DR2F 2C2KB 2AJ1A 1RHUB 1YJ7A 1YRUA 3DRPB 3PG9A 3G4SS 3FGVA 2B43A 4IG0B 2H9ZA 2MHNA 2V4QA 2CPIA 2QGFB 1WI8A 4EFAC 2NZCA 1NK8A 2UXCF 1RWXB 7FD1A 1RLDA 2PFDA 1K1QA 3TW0A 4O3RA 1M1KT 2MEWA 1NBEB 4O0NA 1HWJA 3MCSA 2HNZA 1KONA 1TQLA 2COLA 3ETMA 3H98A 3JYTB 4JBCA 4DR1F 1H6KX 1UVIA 1KVIA 4KPCA 4IOAQ 5HI7A 1X0PA 1SUQA 2FJXA 1L3KA 1VRQC 4GVBB 1YJ9S 3K5MA 1C0TA 5KG2A 4RKUC 5LJ5Y 2DEIA 3B6BA 1TL1B 3PHEA 4CTAB 2Z0GA 1E6VA 2CPJA 4WJBA 2D3OR 4CWBA 2Q6BA 5GMEA 4FP9A 3AT1B 1EKRA 2FHMA 2QMUB 3TO8A 2YKAA 3AB2B 3ZTPA 4AUKA 5KG7A 1ZPVA 2R4FA 4IFYB 1X7VA 2JZ5A 5KT4A 1GNKA 2M5YA 2QMWA 3EGWB 1LKZA 3QRRA 4AXIA 2E7VA 5CZXA 4DV5F 4LF7F 1PJ7A 1ZS6A 3DDNA 4OZJA 4TXSA 1U1QA 1X9WA 2I1RA 5D4PA 5I4MA 3G6VA 1FNXH 3G9CA 1PCAA 1E6VB 1DTTB 2CPXA 4TKTA 1O8BA 3H2LA 1WKKA 5FIIA 1SI9A 2IIHA 1AXQA 4CLPA 3CC4S 4KR0B 1VQ7S 2AW0A 2DNHA 1NDCA 2D3ZA 1XMOJ 1OQ6A 2RKIA 3IS9A 3T9NA 3WIVA 2FHJD 2R42A 3G82B 3M1VA 3KLGA 4DSFA 2DGQA 1YBAA 3QWPA 4K4VA 4OZ0A 3IG1A 4HLBA 1S0NA 2PC6A 1UW4A 1U1PA 2JRSA 2BV3A 3SIPB 3BBCA 1DTTA 3G86A 3FNNA 4CCHA 2UVWA 5DJBA 2AP6A 2VV5A 3J7YU 4L72B 3K5LA 2QYGA 2Q1LA 4BCAA 1N88A 4DQSA 2J0QD 3VVUA 1IN0A 1RAHB 4NLPA 5E41A 5FLXY 3RR7A 2ZOFA 2D9OA 2DKOB 2BEFA 4M5DA 5KT6A 3WHIA 3GIIA 2AHOB 3RZAA 5RUBA 3HK2A 4D3GA 2VDHA 2BVZA 3TZXA 2BE2A 4CO5A 4Q2LA 1L3SA 4NCBA 2EG1A 4X4TA 3G6YA 1Y5NB 4LF8J 2BMBA 1MLAA 2DISA 2V4JB 1PSDA 5GMDA 4JV0A 5D77A 2ZDOA 2J5AA 4QYRA 3KK3B 4PWDB 2FJEB 1Y3JA 4P2FA 1BMQB 1XERA 2C3PA 3MUVP 3MEKA 5JXSA 2WVCA 4CO2A 1WSVA 3HP6A 3NGDA 3OR1A 2FJDB 4AE5A 2BYCA 1VQMS 2Z2LA 2AGOA 1MSWD 2MGZA 1FNOA 2OELA 4CI0B 3MAQA 1N34F 3DC2A 3MM7B 4F3MA 2UXDF 3W8GA 2W4DA 5DLGA 3CJTA 2IDLA 1GMUA 5DQIA 2ZJQQ 3ZTOA 1BQMB 4X84A 2FJVA 1B4SA 3D6MB 4LIWA 5BR8F 2XMWA 1PBAA 1CQMA 2AKWB 2W7OA 3C6TB 3MM5A 3A3OB 3DOLB 4C8NA 2C22A 3MMAA 3TVYA 3S7RA 3SSQA 5EUHA 1NJIT 1H2UX 2GQ2A 4YB7A 1TL3B 1WC6A 5C7PA 2B4OA 2Q6CA 4JOUA 2CPDA 3HVRA 4C8MA 5J2MA 1RTDB 1F3FA 2G2ZA 2KI2A 3VZHA 2K1RB 3FSYA 2JC0A 3FVYA 3MM7A 3M8RA 1C4AA 1Q8IA 4RX6A 3ET6A 4P72A 1H0HB 4KGZB 4QIGA 2FVCA 2PEBA 2GGPB 2MZQA 3KLIA 2ZZNA 1KLMB 2D1CA 2K8GA 4XPCA 1FFGB 2YNHA 5H1SV 3NCRA 1DRZA 5AXNA 2B7CB 1W2IA 2CZ9A 2ZH6A 4MK9A 3DDKA 1N36J 2VD3A 1NJZA 2BQUA 2NR0A 4NMXA 3CC2S 1S99A 2ASDA 1N6QA 3NMRA 4IUFA 1S6PA 1D9FA 2O66A 4CDIA 1UPPA 5CYQA 1E6YB 3OVAA 1HHSA 3W9JA 1SC4B 4DUZF 2NYIA 5KG1A 2ZH5A 3V6HA 1JLGA 4QR1A 4B3SF 4DHVA 4B9MA 3Q8UA 4GKKF 5B0GA 2F4VJ 5FJ4A 2RILA 2QFIA 3BH6B 1UMJA 3BS9A 2FZGB 1IWAA 3UVJA 3ILJA 3KJQB 3VCDA 3F44A 4JI7F 2DBBA 2XI2A 2HWHA 2OSRA 2MZJA 4DN0A 1FJEB 1X5OA 2V2KA 4ANEA 1B70B 2WVFA 3BEGB 3HDSA 3J7Z5 1N6QB 4WTYA 3V4IA 4Y2AA 2Q3PA 2KHDA 2U1AA 3PJ9A 4NLGA 1S4FA 2BKPA 2Q66A 2F9DA 1P1TA 4I6WA 1UEUA 4UOGA 1VJQA 5DRKA 3TA2A 2OEKA 3OLAA 4OHYA 1KVJA 5DM6Q 4P2MA 3MWBA 4KO0A 3PACA 2DXDA 2ZNZA 5C42B 5HLFB 5K8OA 1NB7A 4A8OA 3CEDA 4M5MA 3GONA 5B08A 1RCOB 2DO0A 2HGLA 3Q24A 3ZXWA 4YR3A 2HFOA 2QC3A 2YX4A 3MEGB 1S1XA 2YPZA 4ECQA 1ZM3A 3SMZA 2IYIA 2YKMA 1S10A 1XMQF 1NH7A 1KKHA 1SC3B 3GYGA 1Y5LB 1RXOB 3OVBA 3EZ5A 1KNZA 4ECWA 2HFSA 3E51A 5KFVA 5E3QA 1S1UB 1L3UA 3QWUA 3W66A 4IR1A 5HSPA 1LW2A 2FJBB 3FFIB 4RJVA 4B08A 1WSRA 2HHPA 2QZ8A 3DXBA 3CSKA 5M2PA 1RTJB 3DRRB 2VASA 5CH7B 1M5PC 4DEZA 2PSZA 5D0EA 1S1VB 4ELVA 1IXKA 2V34A 4AL5A 1LFPA 2XB2D 1MW7A 2HQIA 3MR6A 1F5AA 5JVHQ 2QG9B 4A4JA 2CIMA 1NJXA 4C8KA 1HNXF 3ITHB 1HWUA 2CDRB 3KK2A 2BOPA 3GCXP 3UD5A 3RGIA 3HVAA 2B8PA 3FKBA 3NNCA 4DR4F 3CMQA 4Y6IA 1RWNB 3R5GA 1FD2A 2LKZA 1C1BB 1UVMA 2QEXS 5IC4B 1S0OA 1CJUA 2VKRA 1BHNA 2O3DA 4ELUA 4JI8J 1ZYQA 3W60A 1S1VA 2Y1JA 3CWJA 2IA0A 2CYYA 5A8RA 5HMYA 1RUSA 4OV6A 3MR2A 3WDOA 2QA4G 3BH7B 3B8HA 2WRMA 5KFTA 3ZTSA 2R2UA 4ECYA 2YNGA 3ULHA 5KFEA 2R7RA 1VHFA 2V8VA 5D0HA 1FT8A 2W2MP 1T9TA 4TN2A 4TYAA 4YFUA 4F25A 4PUOB 1JQGA 1X4BA 3NXZA 2QJ3A 1PC5A 2HWIA 1Z2ZA 2OHDA 2B9EA 3EWGA 4ZVHA 2PMZD 4DPWA 3BZQA 4TY8B 3CUNA 5HJXA 4IOCQ 4PG4A 2VHGA 4JI6F 5ETMA 1O5JA 1RABB 3M1VB 3OUYB 3UQSA 2YWGA 3GJRB 2W4CA 1NJYA 4F4KA 4OX9J 1S9FA 4PYAA 4DUYJ 3CJKB 3ENQA 2G0JA 4NYOA 4DPTA 5D0GA 5CCLA 2HK3A 3DMJA 4YY3F 2Z2ZA 3UNYA 1OPIA 2QLBB 1U1MA 2YH0A 3J7YI 2YTCA 3KJVB 2Y1IA 3SCLE 5SUHA 1C2PA 3D0IE 4OYPA 3NRBA 4M5DB 1VQOS 5HROA 2JFKA 4AFFA 3IMQJ 2EKNA 4HACB 3R9LA 3K57A 3THVA 4F2SA 4NLDA 4RUCA 1SQGA 2WCXA 5IM0A 5HP1B 1IJEB 2M0GB 3I82A 1IKXB 3LH2S 1FCAA 3HZGA 2AMCB 2XSJA 3M6WA 5A6PA 1U6BA 4DL0C 4J9PA 2A2DA 3JQKA 1D9DA 4MTPA 3MD1A 3J81U 5KFHA 2E66A 2CQ2A 3ZZUA 3LAKA 4ZHRA 1J5OB 2HHHJ 3QJJA 1RHQB 5H9EK 1RHJB 3DDIA 5ADZA 5K8MA 2N82B 1Q95G 3W1YC 4LSNB 4DL4A 4PG7A 1QSLA 1LK7A 2GIRA 3HSGA 4DJBA 2NSCA 4HH0A 3GV8B 1CLFA 2DH8A 1FVSA 2CJ9A 3L7UA 1BQMA 1U45A 1IBKJ 2UUBF 2NZ4A 1IM4A 3SCIE 5CQGA 1X4AA 2YY3A 5J1PA 1FXDA 3HT3A 1SH2A 3Q89A 1S6QA 3R5JB 4NI2A 5FDLB 5BYQA 3CDEA 2MZ1A 5THWA 4L3KA 1XEZA 4ES1A 4B3MJ 3C3LA 2J6SA 4U7CA 1PJ5A 4EZ9A 3D3BJ 3NGTA 4IDKA 4QIEA 2DRDA 2HS0A 3H2UB 4P7TA 2YWWA 2MQOA 3IAM9 2JLGA 1KOHA 1T05A 4OYAA 3BR8A 3I6PA 2FJAB 1X4FA 1KLMA 2YNFB 2AIRB 3FEZA 3TA1A 3IRWP 3MEDB 5CD4H 2HQDA 2JOQA 2AZ1A 2E9TA 3I5BA 1REVB 3C14B 4ZP9A 3TX0A 3LWMA 1ITPA 4OHVA 2BANB 1GAOA 2R9LA 4KFBA 5GAGU 4JB8B 4LMZA 1KHVA 2X1BA 4NXMF 2K3KA 2MLZA 3BN4A 3CW2C 1CJVB 1NKCA 4FDFA 2R2RA 1JLGB 2RQ4A 3QNWB 1WF1A 3DLEB 2M9KA 1RHMB 3SV3A 1K9MT 2NPIA 4M5JA 2RJZA 2OI2A 1DARA 2MLYA 2Z56B 3PM9A 5D0RA 1HPZA 3M8WA 3O44A 2C2DA 2XLKA 2VA2A 4ZS6A 1LW0A 2F9JA 3W3SA 2RE1A 2BKOA 3H4DA 3GJTB 3V4IB 4UOCA 1R27B 1VCTA 4LR9A 4NMLA 3UI3A 4A8MP 3RAMA 4M1KA 2KXHA 4OJGA 2FGCA 4OHWA 3U27A 1XC9A 5J1EB 1LEOA 3AJ1A 1B7FA 1H2VZ 4R8UB 3UFCX 1AROP 1T94A 1Q4RA 1VHIA 2HAFA 3C6UA 2RHSB 2I9SA 2HIYA 4YS2A 1VBKA 4MIBA 4ZN1A 2ASLA 4JI1J 2LQJA 2VDIA 5CYMB 1KBRA 3UR0A 1M5SA 1Q5YA 4MK7A 1A9NB 5D3GA 3MEGA 5EWFA 4M5IA 1RADB 3B4DA 3H0PA 4KHRA 2JJ4D 3MDFA 3SQOP 1WTFA 3JTOA 3NCPA 3T1YJ 1S7HA 2LA6A 4X64J 1M1GA 1NM2A 3ADAC 1N32J 3TUPA 1H7XA 2R7VA 2AJFE 4P6QA 1U1LA 1UWBA 1X5PA 4NRUA 2KYXA 1WI6A 2G13A 1RT3A 2NLWA 2VZ9A 3KLFA 3J7A1 2MQMA 1J27A 2RDIA 4F4ZA 5ETSA 3I9V9 4KGMA 4A8XA 3OTOF 3M2RB 3QZ7A 4I0WA 2HG4A 3N9UC 3D7SB 4DV3F 2LEPA 3H40A 3MEEB 1KFDA 1VLYA 2YQ3A 3CNQP 1YDLA 1YQHA 3Q8YA 4RBTA 1VBXA 2DVIA 2GIQA 4EBCA 1U49A 1WG5A 1PYOB 1JLBA 3TVZA 4LR8A 3PX4A 3RU0A 3PZPA 2JDJA 3U02A 3UE2A 5IV3A 1RACB 5DGAA 1X31C 1C1BA 1NHVA 2KB2A 5DZ6A 1N4LA 4ERDA 4PXEA 3QFHA 3KLHB 1UFLA 3DXSX 2WBMA 1G6BA 2V69A 5IXUA 4L74A 3JS9A 3CF5Q 2H4YB 2HBYB 2XYPB 1TKDA 1LK5A 1RTZA 3MFIA 2CDQA 2OSQA 2VPZB 3N6LA 5F3ZA 3MMCA 1X8DA 2RHQB 1YI2S 2A3JA 1BD6A 2YNGB 1QDUB 4XPEA 5GMKa 4DSJA 1H3DA 4KQZA 4MAKA 4W98A 1OJ4A 3VF0B 1F6TA 2YVSA 1X4DA 5A6WA 3KG0A 4FBUA 3PIPQ 2L9WA 3PKYA 1OWXA 5K8PA 1TELA 4ECXA 2VBWA 3EVMA 5KFNA 2KT3A 2POKA 1DBDA 2J7KA 1PO6A 3UO0A 1UEKA 4DV0F 4TU7A 1A7GE 5CXTA 1JXEA 3LQVA 1WOPA 3R2DJ 1YBTA 3ILLA 2R8HA 2BQ3A 2NQPA 2HHWA 3R8YA 2AX1A 2A2CA 2P2CB 1IM6A 3M4XA 4RR5A 3SDEB 4PCQA 1DQ9A 1WC1A 2KRRA 4QJVA 2F7VA 2MQPA 3M8SA 4OHXA 3OR1B 5EHHA 1GXLA 1YTYA 4DR6F 4DU8A 2CVEA 2FC8A 2HBZB 3RW6A 4X2BA 1RYRA 3VR1A 4Q8FA 3D9BA 4EMDA 3HMJG 3Q8VA 2GVZB 2ASYA 4BC7A 2XMKA 1TKXB 2V8DA 1HBMA 5HVFA 3EUNA 5HP1A 4LF8F 3LTOA 4ZJQA 4ZPVR 2XSJB 1FRKA 5L9NA 3G8SA 4C11A 4DS4A 2PFFB 2R2SA 2EFPA 3DOKA 1RP5A 1KFSA 1TL3A 3BSAA 3KFWX 3ZZRA 1RTDA 3W61A 4ZITA 3M8PA 4ZIWA 2CJYB 4GO5X 2LCWA 2K1RA 2EFVA 3TAMA 1N34J 1U0HA 4KRWA 4JP8A 1BXNA 4RW4A 5HMWA 2D41A 2VH7A 3I5CA 2B9XA 3I56S 3VAIA 1RBLA 2XMMA 3RRHA 4K50A 2ABYA 2R7WA 1TVRA 2UV8G 2MHEA 1RB0A 4C11B 2YNHB 4YY3J 2CADA 2B8QA 2LDIA 2ZH4A 1TAUA 4YOEA 4NXNF 2P9GA 5KFGA 1OPZA 2NYHA 1NMEB 2DNGA 1YX2A 5E0OA 1VC6A 1FKPA 1ZAWA 2EG2A 1VI7A 3GFXA 4WFAQ 3KJNB 1EQMA 1V5IB 3SCJE 4LFBJ 4PABA 3POTB 5E2QA 2XGQA 2B7BB 1RAEB 2EVZA 1R8CA 1Z4UA 4DL3A 1QVFR 3SV4A 3MF5A 3UWTA 3PHTA 1REVA 5M2UA 4OYZA 3K5NA 3V6DA 4I2QB 1SBRA 3ZC4A 3C2PA 3NMAA 5LM7E 4M5LA 1LWFB 1IKWB 2G9OA 2XHCA 4M63A 1CJKA 3UPFA 1RHKB 3HSZA 4KGKA 5DDRC 3FSIA 1T9XA 4L75A 4PXBA 2IRUA 4WCEQ 3DM2A 1A0OB 1XJWB 2XHWA 3DLEA 1HARA 5F8IA 5JVGQ 1NPRA 3BGRA 4LRCA 3T5HA 4KO0B 2QSFA 1AB8A 1SC1B 2Y0BB 3LP2A 2C42A 2E44A 2HFVA 1LOUA 3NGSA 3G6XA 3EZUA 1U1NA 1FKAF 2WVBA 3V6DB 4U7UD 2VBXA 1OY6A 4OZ3A 5E7OB 1U1OA 2W9CB 3J81j 1NSQA 3M30A 1LQ9A 2NPFA 4RNOA 3FCHA 2BE7D 3OXLA 3P45B 4IKAA 5MAOA 4O0IA 2DXEA 2ZVIA 1TFWA 4OL8A 1IVZA 4OJ3A 1I6JA 4X4QA 2V4RA 1HHQA 4HI1A 3UDEA 1WF0A 2GMJA 4DSIA 1VR6A 4R0EA 4RUAA 3C6UB 3SZ2A 3RB0A 5F8HA 2OJ3A 1VQ8S 2UV8A 3IR7B 3GV7B 3B78A 2AGPA 1YG0A 1RTHB 4QBUA 3NGRA 3P8BB 4OHZA 2KG0A 1TL4A 2Z2MA 1ZAXA 3AD9C 4IRCA 4PZVA 4C8ZA 2JLEA 1FEHA 2DR6A 2KTQA 6AT1B 2HVIA 1XK8A 3CCWA 3NOCA 2X1AA 4ZP8A 3T3FA 4XIUA 4ED3A 3RR8A 4HR2A 4RNMA 1JLFB 1HBUB 2CNKB 2NXJA 3LP1B 1TK8A 2DNZA 4GO7X 3KLGB 2A0FB 1YLXA 2KG1A 1XNRJ 5KFRA 3FDSA 4ANDA 1U47A 4QYZK 4DCPB 3PW0A 2GJFA 2BM1A 1CBKA 3MEEA 4K2JA 5C2GA 1MROA 4LSLB 5DQGA 3PW7A 4B3SJ 1T9UA 3SEOA 4WFYA 4PUOA 2HAIA 3EXCX 4DPYA 2UUAJ 3TAQA 1I3OB 3AA8A 2NUUG 3HHLA 3OV7A 1YRXA 1HBUA 1JLFA 1U8SA 2F65A 3TRGA 5JJBA 3K58A 2MQNA 1CJTB 1RWWB 3CJ4A 3KWMA 3R5CA 4ICLB 4Q7AA 3CMAS 3IA0A 4FNHA 2DNMA 4JI8F 3EX7B 3PNIA 4LVOP 5T7LB 3CJ0A 5LSOA 3RAQA 2YWFA 3KKFA 1YHQS 3MMCB 2KKHA 3OL8A 3TYTA 3T1YF 4WPAA 1V6HA 5LMUF 1V9OA 3QFWA 3ZZTA 3EXYA 4QOTA 2XO7A 4EYIB 2BQRA 1SQFA 2FC9A 1JX4A 3MOJB 2VG5A 1UP1A 3K5PA 1IBMJ 4F26A 1HQUA 4BC9A 1TK5A 1WWHA 2YQ1A 5HVGA 1DTQB 2KFYA 5B0DA 3FQLA 4K8RA 2GVDA 2RS8A 3NEKA 1S0VA 1F1BB 1S12A 2F4FA 3FEYB 2L41A 4JUZA 4JV1A 1FDDA 4F0MA 1NDPA 3LPEA 4G1PA 3I31A 4N7TA 1FTRA 1YGYA 4R5PB 1YJWS 1NKEA 3KMQA 1R0AA 1HI8A 2X3GA 3L9ZA 2NS1B 5T41A 2YXLA 4PYDA 4USMA 5BXIA 5F9NA 2E5LF 2HVHA 2FZCB 4CH1A 1DTQA 4ZPWR 3PCOB 4CH7A 3AOBA 1J5EJ 3AY0A 3QT5A 1YIJS 3GIRA 5LXRA 1OMSA 2CPFA 2VC0A 2V9WA 4OJ1A 2CQ1A 2PO4A 3PKMA 4OX9F 5D6GA 2NXUA 1U25A 1IKYB 5A0YB 3V6KA 4IH7A 2VOOA 4WF9Q 5KAKA 4R5PA 2XWYA 4YDXA 2GV1A 1DZ5A 1X9MA 5F9LA 2M70A 4OI6A 4J9MA 1WD6A 1F9HA 2XEXA 1RKJA 1NK0A 1KR4A 1REGX 1S6PB 2ZM6J 3NGKA 4ECRA 2AJ4A 1KLNA 2GQCA 1VQKS 2Z58B 1X4HA 2ACMA 3CD7A 2IC3B 4DR7F 1QUPA 1EJ7L 1H73A 3O3LA 4FN5A 3H25A 2HQGA 4X65F 4ECZA 4DV0J 1UA0A 1VQ9S 1VISA 1JLQB 1T9VA 1IKYA 2FY8A 2R7QA 3MEDA 3MAAB 1IBCB 3W8PA 4UQTA 3U1NA 2DR8A 4B9VA 1JXLA 3MMAB 3A13A 5HAOA 5IS2A 2C2RA 4KY3A 1FRMA 3ZTRA 4KH1B 3UD4P 4LRFA 3VQSA 1ZM2A 1T3NA 2B9WA 1NHKL 3N5FA 2DNOA 4DL5A 3V81B 6FD1A 1R3NA 3KG1A 1R0CB 2XI3A 4J9KA 1SKRA 3TARA 2XS2A 1VDHA 2BABA 2GGPA 3I0RB 1FD8A 2G2OA 3D67A 1JLQA 2IFXA 2HNDB 3LGHA 1TUGB 2DGSA 4LJMA 4NA2A 4UOHA 4CLUA 4R0JA 4RZRA 2M88A 1PAEX 1HNWJ 2QRRA 2XCAA 5KOXA 3I96A 3R1HA 2XGPA 3CCZA 1SKWA 1SIWB 2GFFA 1RCXB 1RT4A 1U24A 1IKWA 3ZZOA 4I2PB 4X4UA 4KB7A 3OFEA 2ZH7A 3GQCA 3U7JA 1N32F 2JH3A 5I42A 4EBEA 4RU2A 3HD2A 1F2GA 1JLEB 3DM2B 2EK1A 2RRNA 4OJHA 4CYUA 4B9UA 2DPIA 2FYXA 3PRDA 1WKLA 4M5NA 4ELTA 4O4GA 2BA9A 5KOWA 1JKHB 4OLOA 3LP2B 3GFYA 4L6V3 1X4EA 3QO9B 1FJCA 3OFFA 3PTWA 2CWXA 4PPZA 3TP2A 3TZYA 4USVA 2BJ7A 3PYFA 4M5HA 3QZ8A 1NNDA 4CLFA 4BWJA 2B9YA 2XULA 2VQEJ 2BE9B 3KK2B 1P8GA 4KKOA 2C28A 4CQ1A 2JEFA 3TQEA 2HNZB 1VQNS 5EGYA 2RQMA 4H54A 3M2VA 4K59A 5I3PA 4CT8A 4D3HA 4HVZA 3QO9A 5HANA 4AQYJ 4ED1A 2XLIA 4OI0A 2PIIA 3C8YA 2C3YA 2QSWA 1XMBA 2FVQA 3TUIC 4IO9Q 1S1XB 2UXCJ 1NAQA 1QAXA 2E29A 4FYVB 2YKMB 4FPIA 4DUZJ 3JAMY 1WC5A 3BO2A 3L7OA 4YN3B 3R27A 2F4VF 3NWRA 3GJSB 2M8HA 3BSCA 1MU2B 4FXVA 1RT5B 1R8PA 4HDGA 4Q0BA 2YWHA 3RUBL 2HRTA 2UZAA 4YEAA 2LXFA 2OD6A 2QL9B 3AJ2A 3MCNA 2OLWA 3W2WA 4BDPA 2LQ5A 2J6UA 3P3DA 1WTBA 4DSEA 2KDOA 2MKHA 3QIDA 3W9HA 3CVKA 4OZ1A 2DT9A 1R31A 2LEBA 3MUMP 1V3RA 4YQWA 2H51B 3JQJA 2VFVA 3H20A 3HHKA 1EETA 2OGUA 3OTBA 3TANA 2A18A 3BGOP 2RSQA 2VICA 1YJUA 1S9EB 1TKZB 1UAWA 1Y3KA 2YKNA 4H4OB 2RQKA 3IWLA 5IOLA 2CRLA 2ASJA 3MM8A 5ETVA 4DLEA 1KTQA 2UXBF 2G4BA 1ZTTA 4DDFA 3K7RA 5LXYA 5KT7A 4ZDNA 5HROB 1Q8BA 2DNLA 4RW6A 2W7PA 4YB6A 2AJ2A 1APSA 1JJ2R 1BQNB 2HK2A 4LREA 4ECUA 2IM3A 4DS5A 4OLPA 3W64A 2R7TA 2FB0A 2YX1A 2ZBQA 4K7QA 1JLAB 5LOQA 1ZPWX 5IT0A 1G3OA 3EDRB 4X4OA 3CPWR 1WC3A 2V67A 1XMOF 1UZHA 2BOAA 1F9EB 2ZEJA 2MKIA 2ZNYA 4C8LA 1IR1A 3QGPA 2ZH2A 3RBZA 2OPRA 2QFJA 1HFEL 2IM0A 3EM1A 2GVDB 4V19X 2EWHA 3GP9A 3WQPA 3PO4A 5AJ3F 1QVGR 4J90A 3PR5B 5IZHA 2WONA 2HFNA 3K5OA 1S77D 1WEYA 4IH5A 2LYVA 4I68A 2R8KA 5F8LA 3H8YA 4ZPBA 1N0UA 5E3RA 2HPUA 3FBBA 3TZWA 3BPSP 2Q79A 1PBUA 1VRTB 4ECTA 3GFZA 4DR6J 4LF4F 2VU5A 3HFVA 4USHA 1DQAA 3CMES 1AA1B 4B3RF 1IJFB 5ETLA 4O3SA 5J2QB 4AT1B 1S59A 2CJAA 4K5SA 4ZVPB 4YP3A 3DNCA 2B4VA 2KXFA 2PMWA 4ZPAA 4LVNP 1Z1ZA 4EUVA 4ZOSA 5IWAJ 3OQ2A 4DBQA 3IBCB 1HR0J 3U1LA 1GTEA 2DGUA 2I2YA 3C14A 2G1HA 3A3PB 3VAJA 3N01A 1HNIA 1CULB 4MJKA 5G4DA 3WBZA 3TUZC 5J2MB 2V2ZA 2CAJA 4KFBB 4MIAA 1ZZNA 2KHCA 5C5JA 5KFWA 7AT1B 1D8YA 2QLFB 2MY7A 4OI1A 5D78A 3MM9A 1QJHA 4K5RA 3P4UB 1FNMA 1K0TA 3CCMS 3TJ9A 3HULA 2G0IA 4IRDA 4FF2A 1FX2A 3MMBA 1XR7A 3PFOA 4JV2A 4FF3A 3OFGA 1BY9A 4NLTA 4OZ2A 1IR0A 3MPDA 4QIFA 4QPTA 4DG1B 1VQPS 2KU7A 4TNOA 1HPZB 1BWVA 1FTCA 2J9DA 3MMJA 4W4MA 3VGTA 3NG8A 3OL9A 1SJQA 2ZDPA 3AB4B 5LSRA 2AQ4A 4NL5A 1DLOB 3PEHA 2WK4A 3M6VA 4EWTA 2BW2A 1DFDA 4FNIA 1IBKF 3VQTA 2UUBJ 4OX8A 3AOAA 1VRUA 3HHLC 1VQ4S 4B3OB 4LFBF 2JEGA 3E8OA 4C4WA 4CO3A 5KG5A 3AHPA 3BKFA 2DR9A 3F41A 2MB0B 2MTLA 3PIOQ 4O44B 4KGXB 1X0FA 3UDCA 2CQBA 2DPJA 3HLUA 1SPBP 5G0RB 2MDAA 3DU5A 5B0CA 2GZOA 1NK9A 1Q7LB 1WEZA 4ZLJA 1GT8A 3EVWA 4DR5F 4IG0A 2UP1A 4I2PA 5A2QY 2DCUB 2DIVA 3DCAA 1N54B 2VPXB 1VRUB 4O3OA 2DCLA 2VA3A 1TV6B 2M8DB 4J9QA 1IBLJ 5C25B 1GX5A 4WKYA 3JYTA 4C2MA 2RRAA 1FO1A 3QT8A 4I69A 4XDCA 3KLFB 1SH0A 2J8SA 5DG9A 4DN9A 4X4SA 4HHHA 2L3MA 4V1Ak 2A1BA 3SFUA 2R7SA 1RT7A 2RAQA 1Y00A 3PRBA 4DI6A 1WOOA 2KO1A 1ICEB 4NXMJ 1NKBA 3PDNA 4JI0J 4RPFA 4GVLA 3MXHP 3NP5A 2H3EB 1O6XA 3QSIA 1HLWA 2BJEA
chains in the Genus database with same CATH topology
1GFWB 3R7NB 3D6MB 2CJXB 2C2ZB 3GJRB 2XYGB 1RHKB 4ZVQB 2QLBB 4ZVRB 3EDRB 3NS7B 1SC1B 2Y0BB 1F9EB 3D6HB 2C2KB 1RHUB 2H54B 1PYOB 3R6GB 1IBCB 3R7SB 1RWXB 2C1EB 4ZVSB 3P45B 1RHRB 3IBFB 2H4YB 2HBYB 2XYPB 4ZVTB 1SC4B 1RHQB 2H5IB 1RHJB 2FQQB 2CNLB 2XYHB 3EDQB 1QDUB 4ZVPB 3R7BB 3KJQB 4ZVUB 2QL5B 1RWVB 3IBCB 3R5JB 2CNKB 4DCJB 2Y1LB 1RWKB 2H65B 5K20B 2P2CB 2QLFB 4DCPB 3D6FB 3P4UB 4ZVOB 2HBZB 1PAUB 5IC6B 1I3OB 2QL7B 3R6LB 2CNNB 2HBQB 2H4WB 2HBRB 1SC3B 1RWOB 2CNOB 1RE1B 1RWWB 4JB8B 2H5JB 4DCOB 3SIPB 3QNWB 1RHMB 2CJYB 3RJMB 1RWPB 3GJQB 2DKOB 2CDRB 2XZTB 2C2OB 3GJSB 3GJTB 1RWNB 2XZDB 4LSZB 1QTNB 1NMEB 2QL9B 5IC4B 2C2MB 2QLJB 1BMQB 3KJFB 1RWMB 2H48B 3KJNB 1I51B 2H51B 1ICEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFW B;  3R7N B;  3D6M B;  2CJX B;  2C2Z B;  3GJR B;  2XYG B;  1RHK B;  4ZVQ B;  2QLB B;  4ZVR B;  3EDR B;  3NS7 B;  1SC1 B;  2Y0B B;  1F9E B;  3D6H B;  2C2K B;  1RHU B;  2H54 B;  1PYO B;  3R6G B;  1IBC B;  3R7S B;  1RWX B;  2C1E B;  4ZVS B;  3P45 B;  1RHR B;  3IBF B;  2H4Y B;  2HBY B;  2XYP B;  4ZVT B;  1SC4 B;  1RHQ B;  2H5I B;  1RHJ B;  2FQQ B;  2CNL B;  2XYH B;  3EDQ B;  1QDU B;  4ZVP B;  3R7B B;  3KJQ B;  4ZVU B;  2QL5 B;  1RWV B;  3IBC B;  3R5J B;  2CNK B;  4DCJ B;  2Y1L B;  1RWK B;  2H65 B;  5K20 B;  2P2C B;  2QLF B;  4DCP B;  3D6F B;  3P4U B;  4ZVO B;  2HBZ B;  1PAU B;  5IC6 B;  1I3O B;  2QL7 B;  3R6L B;  2CNN B;  2HBQ B;  2H4W B;  2HBR B;  1SC3 B;  1RWO B;  2CNO B;  1RE1 B;  1RWW B;  4JB8 B;  2H5J B;  4DCO B;  3SIP B;  3QNW B;  1RHM B;  2CJY B;  3RJM B;  1RWP B;  3GJQ B;  2DKO B;  2CDR B;  2XZT B;  2C2O B;  3GJS B;  3GJT B;  1RWN B;  2XZD B;  4LSZ B;  1QTN B;  1NME B;  2QL9 B;  5IC4 B;  2C2M B;  2QLJ B;  1BMQ B;  3KJF B;  1RWM B;  2H48 B;  3KJN B;  1I51 B;  2H51 B;  1ICE B; 
#chains in the Genus database with same CATH topology
 5F41 A;  1IUJ A;  3E3X A;  4JV5 F;  2I5J A;  2CQD A;  1JLB B;  3D54 A;  3MCM A;  5A8W A;  5HMZ A;  2GJI A;  1S1U A;  4WII A;  1URN A;  2L9D A;  4C9D A;  1HBO B;  1LW2 B;  1JLC A;  1S6U A;  2GA7 A;  2V63 A;  3CDW A;  4IQM A;  2RDD A;  4UUW A;  4ZVQ B;  2BDP A;  2BRK A;  3NNH A;  4Q45 A;  2CQI A;  5CAA A;  4JYA J;  1RT7 B;  4DV1 J;  4FYX B;  1L5U A;  4Y34 A;  1UFW A;  4ZK7 M;  3H2V E;  1P6T A;  2DGT A;  4H4K C;  2IHR 1;  3DLH A;  5F0W A;  4FXD A;  2W8K A;  3ITH A;  1S48 A;  2F1F A;  2RUS A;  3FBE A;  3FJ2 A;  3OXF A;  4CP5 A;  1KDN A;  5LT5 A;  2FLL A;  3IFE A;  4DR2 J;  4DPX A;  4CO4 A;  2B6A B;  2CFX A;  2WSE C;  4ZVS B;  3M8Y A;  3MPY A;  3IS9 B;  4A8F A;  2ZIT A;  4A8S A;  4UT4 A;  2F5G A;  3LAL A;  3G82 A;  5KTQ A;  2HWT A;  1WDT A;  1N5T A;  3E01 A;  3GCW P;  3I9Z A;  2AEF A;  4Z37 A;  1FRX A;  2HGM A;  2J7U A;  4NPO A;  2H5I B;  4DR3 F;  3DLL Q;  1AZS B;  2P6S A;  3HFK A;  2I0X A;  3DRS A;  4DX5 A;  2BX6 A;  2HQ3 A;  1AFJ A;  1TKZ A;  1S1T A;  3BKT A;  3NAI A;  4LUB A;  4NLX A;  5J2N A;  3CT9 A;  5GAH I;  3QSY B;  4DX7 A;  4N77 A;  1T7P A;  2HRU A;  3IGV A;  2XQC A;  1W7W A;  1FES A;  1Y0H A;  4J9V A;  4MFB B;  4R25 A;  1EX8 A;  4CNZ A;  4LRD A;  4QWE A;  4OYW A;  4HT7 A;  1KQF B;  3VAK A;  3CO9 A;  3TOQ A;  2V4J A;  2YNI A;  2AYB A;  3MD3 A;  2PDA A;  2EI5 A;  5HO4 A;  1JLA A;  4H4K A;  4AL7 A;  1G4C A;  3ISN C;  2KH9 A;  4NA3 A;  2L48 A;  2OP5 A;  1ULR A;  1RK8 A;  3CCE S;  3M9N B;  4PG6 A;  2RF2 A;  2IAJ A;  4X62 F;  2AV5 A;  5KFC A;  4WTO B;  3OVS A;  3CJR A;  3E2E A;  3VWS A;  2GML A;  2VON A;  3AXM A;  5JUM A;  2XY6 A;  4MKY A;  1UTA A;  3J81 Y;  3VAH A;  4EZ6 A;  4LF5 F;  1D8Z A;  2WHO A;  4DFJ A;  2N4C A;  4O4R A;  5A0Y A;  3MI7 X;  2Z57 B;  2H5J B;  3PXG a;  2ZE2 B;  3GSI A;  3VGV A;  4DOZ A;  2O67 A;  5AXL A;  2QO3 A;  2IJF A;  5LMU J;  2DRA A;  1UWA A;  8RUC A;  3C15 A;  3FC9 A;  4DV6 J;  2F8M A;  4CH0 S;  4OZN A;  1ZTW A;  1HD1 A;  3KDO A;  3CD0 A;  3R1L A;  1HYS A;  1TK0 A;  1FKP B;  2EFQ A;  5D4O A;  1WKJ A;  2IC3 A;  4ATN A;  1FEE A;  2DGO A;  2ZKU A;  1WG1 A;  2IVM A;  3ET6 B;  3GZ7 A;  3UR3 C;  1SKU B;  4RBU A;  4J9L A;  1B0T A;  4H4M A;  3HHE A;  1K1S A;  2O01 C;  2XMJ A;  3M6U A;  5KG4 A;  2XM3 A;  2B5J B;  4TU8 A;  4XK8 C;  2BM0 A;  2B51 A;  4OZ5 A;  3KLE B;  4ZJL A;  1QTN B;  2BRL A;  3HHD A;  4XTT A;  3D0H E;  1C0U B;  5J2P A;  1NDK A;  1HNZ J;  2NUH A;  1X60 A;  1FXL A;  2NCK L;  3SFG A;  1CS4 B;  2FHO B;  3DGV A;  2IVF B;  4C3K A;  4CZC A;  3KYL A;  2RS2 A;  2H48 B;  3RBD A;  2Y3Y A;  3T6J A;  4E8U A;  4WIQ A;  2HGN A;  5CCM A;  3HHN B;  2FVR A;  1QE1 B;  1OIA A;  1JJH A;  2HSE B;  2YQ0 A;  3AOC A;  3N79 A;  4HTJ A;  3IR5 B;  3TA0 A;  2HND A;  4Y2K A;  4YR0 A;  2I6W A;  2Q43 A;  2XNR A;  2V94 A;  3LW5 C;  1SIZ A;  1QUV A;  2KJV A;  3JTP A;  2AT1 B;  3BGU A;  4NZ7 A;  1N5Q A;  2AWZ A;  2CG4 A;  4USI A;  1FF2 A;  4MYU A;  3EMT A;  4Y2M A;  3O2I A;  2IJN A;  1XN9 A;  4ETX A;  1Y11 A;  4NYZ A;  3SQG A;  1JLE A;  5SZT A;  5GAH U;  1HMV A;  5KT2 A;  3P49 B;  2ILZ A;  5A76 A;  5IWA F;  4F3Q A;  1VGY A;  3IO1 A;  3A8J A;  4KAI A;  4OV1 A;  2ZHO A;  2XLJ A;  2MKC A;  2CPY A;  3GU0 A;  2XZW A;  3PJX A;  1SUQ B;  5G0R A;  3HM9 A;  1TR0 A;  1VBZ A;  3NOG A;  3R6G B;  1NEE A;  2DIU A;  4DQI A;  1QY7 A;  2SXL A;  5KFD A;  2BJD A;  4ALZ A;  4ED8 A;  2W2O P;  2R7O A;  3S1T A;  3W5Z A;  3IP0 A;  1FRI A;  4DV7 F;  4B3T J;  4L73 A;  4ILL A;  4CM0 A;  1OSC A;  1TV6 A;  2AZ3 A;  3ICL A;  2YKQ A;  3QMQ A;  4UST A;  4KIA A;  4KV8 B;  4C8O A;  4WYL A;  2P8I A;  2WSF C;  4W92 B;  3R5B A;  5EDW A;  2ZZT A;  3M2V B;  1LFW A;  4KHP F;  3DGP B;  2FQQ B;  3T19 A;  1RTJ A;  3DRR A;  3LOU A;  4HDH A;  3VHQ A;  4DPU A;  5HQ8 A;  1EHW A;  4ID5 B;  3TZZ A;  3OSN A;  2ADC A;  5CYM A;  1MMD A;  1RI7 A;  4N47 A;  2DH7 A;  2W9C A;  2P6T A;  3VAF A;  2XY7 A;  3I32 A;  1LWE B;  1W2B R;  1FA0 A;  3M30 B;  4M94 A;  1MRO B;  1R0B G;  4LSL A;  1HQ2 A;  1DY3 A;  4OI2 A;  2KT2 A;  4DZD A;  4N5S A;  2CA9 A;  1BLU A;  3LAM A;  3T1H F;  3ZNJ 1;  3HVT A;  3PYD A;  3GLJ A;  3QQC D;  1M5K C;  3IM8 A;  1NB2 A;  3K17 A;  2ALZ A;  3PYG A;  4NAS A;  5ETQ A;  1UVJ A;  2XS5 A;  2VG7 B;  2MXY A;  4OI4 A;  3MR5 A;  4GVB A;  1GMV A;  3IG1 B;  3D2W A;  5T14 A;  4LIR A;  4X64 F;  5CD4 A;  4RW8 B;  4X66 J;  5DDQ C;  2MMY A;  1TL1 A;  4CTA A;  4ZVO B;  1NXI A;  2DHX A;  3DKD A;  4YUD A;  3ELH A;  5KFA A;  1JB0 C;  2ZBC A;  2DHA A;  2M7S A;  5H9F J;  3CXC R;  4LF9 F;  1CVJ A;  3GSD A;  1FX4 A;  3HVT B;  4Y65 A;  5IQQ A;  2MKK A;  4Q8E A;  2ZOG A;  3EGZ A;  1ROF A;  2CNN B;  1JK9 B;  3Q2S C;  4OX6 A;  2X3D A;  4GC7 A;  3SXL A;  2HBR B;  2EXU A;  2A6O A;  3CD6 S;  2I38 A;  2CNO B;  4RNN A;  3BJY A;  2IBK A;  3HX9 A;  5HQM A;  1M5O C;  2HNY B;  4IRK A;  2PE8 A;  5H9F K;  3CJK A;  5AE2 A;  4X4N A;  3DOM B;  3HCX A;  4HT5 A;  2GMH A;  1VS3 A;  5L8R C;  3LPY A;  3BO3 A;  3THT A;  1RT1 B;  3IRX B;  4J7C A;  1TMM A;  3KJV A;  5EWE A;  2E5H A;  4BHQ A;  4ES3 A;  2DIT A;  3O8W A;  4GKJ F;  3D4J A;  3BKU A;  3TAP A;  1WF2 A;  5ETK A;  5CYJ A;  3QIP B;  2J0W A;  4CO0 A;  1FWK A;  4B9N A;  1FE4 A;  2UUT A;  3FZ2 A;  4F36 A;  4URG A;  2UVR A;  3TEH B;  3M2U A;  3HHL D;  3VGS A;  2UU9 F;  2R2T A;  2VQE F;  4WYW A;  2JX2 A;  3PVX A;  5KFY A;  3NY0 A;  4JI4 J;  1HQE A;  2FHJ A;  4ZIV A;  4ZPC A;  4ILR A;  4YB5 A;  4JI5 F;  1FK9 B;  2QT7 A;  2V6A A;  3C6T A;  3MM5 B;  3N4W A;  3US5 A;  2VG5 B;  1J5O A;  1RWM B;  1SKS A;  2ZFH A;  3CJS A;  2HHV A;  2BR0 A;  2R8G A;  4ITS A;  1D0E A;  1FJG F;  1F5C A;  4ECV A;  4G65 A;  3BSN A;  4MMO A;  5ETP A;  1QD1 A;  2HLU A;  3KNG A;  3KNA A;  2EPI A;  3M2U B;  4F0H A;  3QLH B;  2CQG A;  1N5Y A;  2HHT A;  4LQ9 A;  3UDV A;  1NLK L;  1YJT A;  1T03 B;  2E9R X;  2C2Z B;  2HVE A;  4PWD A;  3LP0 B;  5CZV A;  5K14 A;  2ALY B;  3HF5 A;  4DU7 A;  1Q16 B;  2MJU A;  2PT0 A;  2W01 A;  3ZZ0 A;  4YB1 P;  2M3D A;  3T1A A;  3FEX B;  3O1L A;  4B9S A;  3G6E S;  4DFM A;  2GHW A;  2OPP B;  2OPQ A;  2ILY A;  3I0S B;  3MCO A;  5HAT A;  4DL7 A;  2N7C A;  1QLN A;  5CAB A;  1SJ3 P;  5F8J A;  3D6H B;  3SSR A;  1H74 A;  2W8L A;  3GE9 A;  4H4M B;  2HQF A;  2YWK A;  1U2R A;  2FD2 A;  2JVO A;  2KVQ E;  2VBY A;  2WBR A;  4NLW A;  4TVA B;  1RSC A;  2DK2 A;  5K14 B;  2UXD J;  2E5L J;  2HZC A;  2FLP A;  3KLE A;  4AYB D;  1IBM F;  3QAT A;  1KD1 T;  3H4B A;  4LF6 F;  5HK4 A;  3D1O A;  4BS2 A;  2W9B A;  3JSM A;  4JI2 J;  1UZD A;  3IBF B;  3HZE A;  1RT6 B;  4U95 A;  4Y0F A;  4F8R A;  3LGM A;  4IFV B;  2IA6 A;  1KQS R;  1NUE A;  3VV2 B;  2XY5 A;  5C24 A;  1U48 A;  3UN5 A;  1U02 A;  4A8Y A;  4NLV A;  4U96 A;  4QR2 A;  3S01 A;  4CYU B;  4X4P A;  3CCQ S;  4F4X A;  5HVH A;  1H7W A;  2K2P A;  2O5D A;  2WB4 A;  4LF5 J;  2GHV C;  1BGX T;  2J8A A;  1TL7 A;  3N5B A;  3EYZ A;  1DQ8 A;  1Q8L A;  2ZM6 F;  2DNK A;  2ZBR A;  3ZO7 A;  3KLV A;  1QSY A;  4F02 A;  2DR7 A;  2ZD1 B;  3JSM B;  1D1U A;  2CPH A;  1YJN S;  4WXO A;  1RWV B;  1Y9O A;  2EFN A;  2QA1 A;  1RT6 A;  3EVO A;  3WX8 A;  3R5A A;  3HJV A;  4X65 J;  1SJ4 P;  1S4E A;  2V9K A;  3O6Q A;  4IFV A;  4TLQ A;  3DLG A;  4DWI A;  4LF7 J;  3DYA B;  3M32 B;  5J1E A;  5HL7 Q;  3PW2 A;  4Q5V A;  1RAJ A;  2W2P P;  3FFI A;  1WOS A;  1G2E A;  2M52 A;  2MQL A;  5DDO C;  4ETZ A;  5E3C A;  4CM2 A;  1FKO B;  1PG5 B;  3FBF A;  4P10 A;  2FPH X;  2WVD A;  2J76 E;  3O5T B;  4ZP6 A;  4ZP7 A;  3TX8 A;  3QJL A;  2W7A A;  4Z7C A;  2W24 A;  3IBW A;  1UA1 A;  1IQZ A;  4KTQ A;  4ED0 A;  5DQH A;  2K3I A;  4DR7 J;  1EAY C;  2I5J B;  1RU2 A;  3K89 A;  1C1C B;  1M0S A;  4RW9 B;  2W25 A;  3TWZ A;  3AA9 A;  2Y9H A;  1LWC B;  5KFU A;  4EU0 A;  4NCG B;  4UY8 5;  4FF1 A;  2WVE A;  3N6M A;  4PQA A;  1MML A;  5ETN A;  1UKU A;  3M9M B;  2V8P A;  2YPY A;  3LWL A;  4V19 J;  1AT1 B;  4OYI A;  4O3N A;  3TQ1 A;  4IYQ A;  1JJ4 A;  1RWP B;  1Q0N A;  1NZ8 A;  4FKY A;  3W2V B;  2ZJP Q;  1DUR A;  4FS2 A;  3KXD A;  4EO8 A;  3PR4 A;  2ZHB A;  4P7V A;  4DR5 J;  1HL6 A;  1R8B A;  2HQC A;  4PWW A;  3H42 A;  4CLW A;  4DV2 F;  4LF1 A;  1S9E A;  4ED6 A;  1CEZ A;  4DLG A;  3QGI A;  2XWX A;  2VJV A;  2ATC B;  3AOD A;  3NNA A;  2XZD B;  4WFX A;  1Q78 A;  5D8H B;  2J9E A;  2LQ8 A;  3PY8 A;  1HNW F;  5I3U A;  4NEY A;  2HHX A;  2YWE A;  4NLS A;  1HW8 A;  4QQB A;  3BYP A;  5A8K A;  3RB4 A;  5F3T A;  1SV5 A;  3W65 A;  3KLH A;  4RLE A;  2C2M B;  3FUY A;  3BSO A;  2HKE A;  3E01 B;  3K59 A;  3HSJ A;  1OO0 B;  2ROG A;  4F50 A;  3B4M A;  2J9D E;  3BQ0 A;  4NCA A;  1AZS A;  1SQE A;  2ZWO A;  4NLU A;  1T11 A;  3MEC A;  1OY8 A;  5KFZ A;  3HSD A;  4ZJO A;  3KK1 B;  4N8O A;  2GS8 A;  3KHH A;  3LGN A;  4ENO A;  3HO1 A;  2CZ4 A;  2OKQ A;  1P9Y A;  1XWL A;  3DI6 A;  2VKZ G;  4QWD A;  3CJ2 A;  2IMW P;  1R43 A;  3R3T A;  2HS3 A;  2CJK A;  1PJ6 A;  3M7V A;  3MHY A;  3M6X A;  4TYB A;  3L4B C;  3W2W B;  4F4A A;  3Q23 A;  4J91 A;  2G1D A;  2XS7 A;  4C97 A;  3OW2 R;  2MLX A;  2OFG X;  3VGU A;  4ZLN A;  4PAA A;  3J7A N;  2OPS A;  5C2C A;  3W63 A;  4DR3 J;  1TMJ A;  1VIX A;  2APO A;  4XAK A;  2V8G A;  3MEC B;  4TQR A;  2ZBI A;  1OYE A;  3OTC A;  2IM1 A;  2CQ3 A;  3JQM A;  4KE5 A;  3T1H J;  5B09 A;  1GH8 A;  2YKN B;  3Q8Q B;  3OTO J;  1QAJ A;  3MM8 B;  2CJQ A;  3MTK A;  4TY8 A;  9ATC B;  2JHE A;  4J9S A;  3MR7 A;  4DV3 J;  1R8A A;  3G2X A;  5GAE U;  1FFW B;  3I5A A;  4MT1 A;  2E1C A;  3QIP A;  3PO5 A;  3RG6 A;  2VOD A;  3MPU B;  1A6L A;  2GVZ A;  3QAU A;  5J1N A;  4P71 A;  4GRS A;  2UUW A;  3A12 A;  3L09 A;  4OIX A;  5CHC B;  1VC0 A;  1HBM B;  3GIK A;  2ZJR Q;  4I6Y A;  2C1E B;  2IRX A;  3LA0 A;  3T6B A;  2MZR A;  5L39 A;  4QW9 A;  2AGQ A;  2PI5 A;  4N41 A;  2L9N A;  2KM8 C;  4DFK A;  2Y8Y A;  1YRT A;  1T02 A;  3J7Z T;  1KOO A;  1FFS B;  1KWM A;  3P5B P;  2VB6 A;  1FRL A;  4ZVT B;  3CUL A;  2BBE A;  3C15 B;  3OJS A;  4P2X A;  2BJ1 A;  4F2R A;  2XYH B;  1MN7 A;  3EDQ B;  4ANC A;  2OAU A;  2B0G A;  5KG6 A;  2UVU A;  3AFG A;  5E5N A;  3TAM B;  3V4M A;  3F56 A;  1UL3 A;  4HAC A;  2J0S D;  2GNK A;  2DNR A;  2CUY A;  2OEJ A;  1NPK A;  1B0V A;  4N56 A;  3I55 S;  1U1R A;  1SL0 A;  1FJ7 A;  3MAH A;  4I7F B;  5ETT A;  1TVR B;  1GMW A;  3MFH A;  3GYN A;  4F67 A;  2IPO B;  4I4B A;  4USK A;  1F60 B;  3JAM U;  1GX6 A;  4C7Q A;  2WTF A;  2RUG A;  1Q1K A;  2RU9 A;  2UXB J;  2G2Y A;  2MZS A;  3PRV A;  4KHM A;  1C0U A;  1RWK B;  1SCJ B;  2ZH1 A;  1JWW A;  4PKD B;  3KTQ A;  4OYX A;  3ISZ A;  2A10 A;  4EEY A;  2R7U A;  4ZVF A;  3ETO A;  4P74 A;  2FLO A;  3C19 A;  3IAS 9;  4EI2 A;  3IWN C;  4RL1 A;  1EP4 B;  3H90 A;  3D6F B;  3W7B A;  5DGB A;  1FDB A;  2WAQ D;  1H72 C;  3KLI B;  5IC6 B;  1N5V A;  1F5B A;  3D1Q A;  3FCV A;  2CJB A;  4IG3 A;  3OFH A;  3OSP A;  4LF4 J;  1S76 D;  4B3R J;  3OL6 A;  2R8J A;  2PD1 A;  3EE3 A;  4KGV B;  2QTW A;  4P75 A;  3ILI A;  2FVS A;  5K8N A;  1HNZ F;  2HHS A;  3M9O B;  3FCW A;  3AD8 C;  1EP4 A;  3CJ5 A;  5CA5 A;  5C24 B;  2ATL A;  3NS6 A;  2FGO A;  2MQ8 A;  3AD7 C;  1OY9 A;  1AUD A;  1MNE A;  3BB5 A;  2RIJ A;  4KH0 B;  2D9P A;  3TVK A;  5C25 A;  1IQT A;  1JXV A;  3EPI A;  1U8W A;  4IG3 B;  1N52 B;  4DXL A;  4X62 J;  2DGV A;  3Q8S B;  4LF2 A;  1U09 A;  3M8Q B;  4KYZ A;  2VIH A;  5AT1 B;  3DRP A;  3D68 A;  2LFV A;  2HUR A;  2ZD1 A;  4QIV A;  3DHX A;  2GO9 A;  4GMK A;  4URQ U;  1M90 T;  1IKV B;  2DNP A;  3NGU A;  4IH6 A;  4LSZ B;  4FYW B;  3CB4 A;  4WK3 A;  4RW7 B;  3EGN A;  5E3P A;  2W9A A;  3KJF B;  1VK8 A;  1EZZ B;  3CJ8 A;  5KFK A;  1L3T A;  4O4G B;  2FUG 9;  3T9Z A;  4DV6 F;  4E0D A;  1XTZ A;  4C3L A;  4ZLP A;  2B56 A;  4QW8 A;  5C42 A;  5HLF A;  4ZCM A;  3M2R A;  1LW0 B;  1BWE A;  3QPI A;  4N76 A;  2VFU A;  2BW7 A;  4DL2 A;  2MKS A;  2NSB A;  1FRJ A;  1FHT A;  4I6A A;  1N8R T;  4JI3 F;  1RLC L;  3CCL S;  2VC1 A;  1NDL A;  1GXU A;  1WAC A;  4RW7 A;  3UN3 A;  4FKX A;  5ETR A;  2F63 A;  4P73 A;  2O1P A;  4DV4 F;  3B82 A;  4C48 A;  3QT6 A;  4P9S A;  2XYG B;  2EFG A;  2LXU A;  5AXM A;  2MYF A;  4PG8 A;  3RTV A;  1UEV A;  2NXC A;  1H38 A;  1RIS A;  3CD5 A;  1RA7 A;  2OO4 A;  2Z2Y B;  4I64 A;  4AXJ A;  2WSC C;  3BR9 A;  2JVR A;  4HYK A;  2RDJ A;  1WHV A;  5DLF A;  4ZVR B;  4NLR A;  3HFZ B;  3EZO A;  3W2V A;  2LU2 A;  2MY8 A;  1ELO A;  5KFP A;  4DZ6 A;  4RBV A;  5EX3 A;  4LFA J;  2H54 B;  1U6F A;  3GB0 A;  4YDD B;  2P9E A;  3IC1 A;  3GWC A;  1S1T B;  4UW2 A;  5J2N B;  4FPR A;  2YX7 A;  3R5D A;  5L1L A;  4ZMM A;  3F73 A;  2E5J A;  3R7S B;  5GAD U;  4KJI A;  1KVK A;  1CJT A;  2LEA A;  4MFB A;  1HWI A;  1WG4 A;  1Y7P A;  5A8K B;  5EN1 A;  4UUX A;  1RHR B;  4J9U E;  4KBI A;  2FIU A;  3T5L A;  2HNY A;  4S0M A;  1KS2 A;  3QBC A;  2YNI B;  2DNN A;  2ZBP A;  4ZVG A;  3OXG A;  1NK5 A;  2CNL B;  2R7X A;  1YJR A;  1FDA A;  3H5Y A;  4ED5 A;  1TL5 A;  1VOM A;  2IMO A;  3GR0 A;  2BXJ A;  3QT7 A;  2GQQ A;  4NRT A;  3SDE A;  1IBL F;  3UW1 A;  2KT5 A;  3AQO A;  2GAG C;  1SB6 A;  4ZVU B;  5KT3 A;  1N48 A;  1PYT A;  1DAX A;  2K06 A;  3ENW A;  2XBP A;  2AYM A;  2BE2 B;  1FXR A;  4M8L A;  1KP6 A;  4B3M F;  5IFM A;  4DV7 J;  4B3T F;  3DU6 A;  4EO6 A;  5LMN F;  2EBG A;  5MLC V;  1WC4 A;  3KUH A;  3KK3 A;  1FK9 A;  2OMO A;  4PG5 A;  5KFS A;  5L46 A;  1G7C B;  5EX0 A;  4YHH F;  4DV2 J;  4BWM A;  1XNQ J;  1R0A B;  1Q53 A;  1XNR F;  4HHU A;  3QGG A;  2DH9 A;  3NWG A;  1EKS A;  3FK4 A;  4ZKA A;  3PX6 A;  2MGZ B;  4LR7 A;  4NE9 C;  2LMI A;  4ZCL A;  4RO0 A;  1VBY A;  4LFC F;  2J9C A;  4ED2 A;  4RW4 B;  4CT9 A;  2VQF J;  1SL2 A;  3UN2 A;  2HBQ B;  2H4W B;  3EIC A;  3BBF A;  1ZA1 B;  4G1I A;  2LU1 A;  4OYM A;  4CIO A;  2KM8 B;  3OD2 A;  5GVQ A;  4W90 B;  1O0P A;  2DHS A;  3CCU S;  1WHY A;  1FWP A;  4OFZ A;  5DG8 A;  4K4Y A;  4XDD A;  5M2R A;  4C3M A;  4IOB A;  2UUC J;  1FWL A;  1HWL A;  1VRT A;  4KPY A;  3IR6 B;  1WC0 A;  2PN6 A;  2NRE A;  2BJ8 A;  3D66 A;  3H5U A;  3UCZ P;  1C4C A;  2DHH A;  2VFS A;  4LBP A;  2N3L A;  4LBI A;  3ISN D;  4OMF G;  5KG0 A;  3JB9 k;  1QTM A;  3IGN A;  1TKX A;  3TR5 A;  5AJ3 J;  2CG8 A;  1TKT B;  1YJV A;  3GJQ B;  1NO8 A;  1NK7 A;  2FJW A;  2EK6 A;  4DQQ A;  3BQ1 A;  4LFA F;  1AW0 A;  2XZT B;  1S79 A;  4B02 A;  1N0V C;  1U26 A;  1RGV A;  2OML A;  3MPW A;  1KEK A;  1S6Q B;  4FYY B;  2MQQ A;  2ZE2 A;  4ILM A;  1NSK L;  3C16 B;  3DFE A;  3DN9 A;  3JSY A;  3MUR P;  4WU3 A;  1HNI B;  1W25 A;  2VJU A;  1RT2 B;  3H5S A;  1MMN A;  3OLB A;  3GG0 A;  2NXN A;  2FZK B;  3OBI A;  1RTI B;  1Z2L A;  2ZKT A;  3V81 A;  4JI1 F;  2VFT A;  3NBP B;  3BV8 A;  4DFP A;  1T8E A;  3MMB B;  5D4L A;  2N3O A;  4J37 A;  2F3J A;  1VIO A;  4ZA1 A;  2D74 B;  4E2F B;  2CQP A;  3MOZ A;  4C0H A;  1UVK A;  4B9L A;  2ZZM A;  4FVM A;  2D3O 1;  3R7N B;  2HIQ A;  4K4W A;  2LLZ A;  2V8H A;  3RRK A;  1I5O B;  4DSL A;  4HI2 A;  1CS4 A;  4M5G A;  3Q8R B;  1X5T A;  3BDE A;  2P5V A;  5LL6 d;  2ZH9 A;  5LSL A;  3NS5 A;  2DD8 S;  3OTE A;  3CDA A;  4OZL A;  4F04 B;  1VC5 A;  1VYA A;  1QM9 A;  1WUU A;  2PEH A;  4MKA A;  4FS1 A;  1MN9 A;  1HWK A;  2RH3 A;  3VZI A;  2VOP A;  1DHM A;  1K44 A;  4O44 A;  5DDP C;  5KFF A;  3DGP A;  1JNZ B;  1Q8K A;  4YR2 A;  1VQL S;  1PIL A;  5DZ7 A;  1FKO A;  1KQK A;  5L9X A;  1GMW D;  4I2Q A;  7FDR A;  3CCR S;  1RTH A;  3UD3 P;  1SVD A;  1C0T B;  2AF6 A;  9RUB A;  5KFI A;  4WE1 B;  1L3V A;  4CO1 A;  5FD1 A;  3TJA A;  3FBC A;  4QIW D;  2G0C A;  1C1C A;  4RW9 A;  2D69 A;  4DL6 A;  1ZET A;  1WOR A;  3B54 A;  4UTG A;  3CDU A;  1VMB A;  3OHB A;  3BGR B;  4U8Y A;  1TP7 A;  1GTH A;  2V68 A;  4RU9 A;  5HBM B;  4MYT A;  2RB7 A;  2W2N P;  4HH1 A;  1XQI A;  8ATC B;  2AYE A;  3P96 A;  1QAY A;  2VG7 A;  3OTD A;  1NRK A;  4CLL A;  1VQ5 S;  1B64 A;  5F0U A;  3R2C J;  2AD9 A;  1OYD A;  4ZCK A;  1JJC B;  1GK8 A;  1TTH B;  1VJW A;  3TJ8 A;  3SBM A;  4LRA A;  2C3M A;  2ZC3 A;  4I1T A;  4O3P A;  1RAI B;  1UWB B;  2E5G A;  1MU2 A;  5AE1 A;  1ZM9 A;  3HHL B;  1HBO A;  2MST A;  3CIM A;  4HKQ A;  2Y1L B;  4WFN Q;  1YKW A;  1P27 B;  1SJF A;  1QSS A;  5K20 B;  1SV5 B;  4ID5 A;  1SL1 A;  3KHR A;  3A8I A;  1F3V A;  5A8R B;  4U8V A;  5L1J A;  4K0K F;  1WHX A;  1MG7 A;  1LWE A;  4Q43 A;  3RB3 A;  3DOM A;  2HZV A;  2J7W A;  5B0B A;  2AU0 A;  3HPO A;  2HHQ A;  1PAU B;  2WW8 A;  1RT1 A;  1Q82 T;  4L76 A;  2YBV A;  2QL7 B;  1CSJ A;  2QN6 B;  3GFH A;  3HI9 A;  3DI6 B;  3HKW A;  5KFX A;  3R6L B;  4F4Y A;  2C2E A;  1Q81 T;  4PR6 A;  2CPE A;  2EBE A;  4L3N A;  4IFY A;  3N0V A;  1RE1 B;  3UNG C;  4DV1 F;  3DLB A;  2X51 A;  4EK2 A;  1NPP A;  4K4U A;  2DNQ A;  3MM6 A;  1ACM B;  2CXE A;  2HHU A;  3V5R A;  3RAX A;  1HQE B;  3AXK A;  4M5K A;  2K7J A;  4CLS A;  1JIH A;  1I94 F;  4DSK A;  1RZM A;  2Z8Q A;  3T5K A;  3SI8 A;  2HW3 A;  4Y3C A;  3L3C A;  1HW9 A;  3BGL A;  4PQU A;  1SH3 A;  4NX9 A;  2GW8 A;  4C8Y A;  3ILO A;  3J80 Y;  3JSR A;  4KSE B;  1IR2 A;  4OYO A;  3ZTQ A;  4F4W A;  4NXN J;  1OQ3 A;  1WHW A;  2IJR A;  3U1M A;  1VLO A;  3Q0A A;  3CCJ S;  3KMS A;  1VQY A;  3CIZ A;  3MM6 B;  4U7U K;  3SSS A;  5E3A A;  2CQH A;  5IM0 B;  2DO4 A;  4A46 A;  1N5Y B;  2HYI B;  2Y0S D;  1T9Y A;  1VK3 A;  4ID8 A;  3LP0 A;  1U1K A;  2DXF A;  2HMI A;  1NK4 A;  2E5I A;  3MR3 A;  3GIJ A;  2PA8 D;  2XMV A;  1HQU B;  1I1G A;  2I8E A;  3KG4 A;  4UY8 T;  4PQU B;  2RD5 C;  1HBN A;  3C66 A;  1S6O A;  4WXW A;  4WFB Q;  3GIM A;  1FRH A;  1T3O A;  1HNV B;  2OPQ B;  2Z4P A;  3G96 A;  1SJR A;  4WWS A;  1S1W B;  2V5H G;  3WX4 A;  3TI0 A;  1SXL A;  4LT6 A;  3KHL A;  1JNR B;  1NSA A;  4X66 F;  1AUS L;  2E1M C;  2DGX A;  1PKU A;  2BKN A;  2MZT A;  3RBX A;  1XIQ A;  5BYS A;  3RBE A;  2OTL S;  2CJX B;  4DUT A;  5H9E J;  4YME A;  4LF9 J;  3HJF A;  4G3I A;  2JLF A;  2HMI B;  4J5O A;  4NZ0 A;  4QWB A;  3JSB A;  4WZQ A;  3DOK B;  2DHG A;  2VBZ A;  1GQE A;  1TUV A;  2IDE A;  5DS7 A;  3ZZP A;  2JEJ A;  2KXN B;  4PXD A;  5DET A;  5CYQ B;  3ZFV A;  1K8A T;  2OUG A;  2AYG A;  4C6A A;  4JI4 F;  5IT9 Y;  5L1K A;  3IM9 A;  2DGW A;  3UDL A;  1B0P A;  3FMB A;  4RWX A;  2HVD A;  4X4V A;  2HEK A;  3I0R A;  5K5M A;  3TUJ C;  1KN6 A;  4Q2M A;  2QIF A;  3I87 A;  1EQ0 A;  1Q79 A;  2HFU A;  3G8T A;  1X4G A;  4WP8 A;  4GKJ J;  4USJ C;  3C16 A;  3GR1 A;  4K2X A;  4NLO A;  3GIL A;  1WJ9 A;  2H5E A;  1TAQ A;  1OSD A;  2PA3 A;  2RVJ A;  2MKJ A;  5J2P B;  1N56 A;  1RT2 A;  3DRY A;  3G87 A;  4N8N A;  2X1F A;  2OPP A;  4ECS A;  8AT1 B;  2Y1R I;  4DMZ A;  1UVL A;  1KC8 T;  1CJV A;  2D7S A;  2WZ1 A;  5I42 B;  1MWY A;  3HXM A;  4J9N A;  2UU9 J;  3DLG B;  1URR A;  2DB1 A;  4DR1 J;  2IVY A;  4KC5 A;  1UFK A;  4DF4 A;  2DR5 A;  3QRQ A;  1N33 J;  4JI5 J;  1HI0 P;  3THP A;  1FDN A;  3H5X A;  4O3Q A;  3UCG A;  3VVT A;  4UZB A;  4IQX A;  4F0K A;  3T41 A;  1LXJ A;  1SC6 A;  3BQ2 A;  3GMG A;  1FE0 A;  2C2N A;  4CLK A;  4NWB A;  1NK6 A;  1S49 A;  4NYP A;  2VPY B;  4P2S A;  4ED7 A;  2WOM A;  5IV4 A;  5GAD I;  4HEA 9;  4DCJ B;  2VG6 A;  1U0S A;  1LNQ A;  3SQG B;  1BC6 A;  3W9I A;  3PEJ A;  1CC7 A;  1RJJ A;  4O23 A;  2JSX A;  4ZCI A;  6FDR A;  4NCG A;  4OX7 A;  2BZ2 A;  4Y28 C;  4R8U A;  1MWQ A;  4LF6 J;  1VQS A;  2JFD A;  4IR9 A;  1RQ0 A;  4MKV A;  4PRF A;  4G1Q B;  4HL9 A;  3DRX A;  3NAH A;  3L7P A;  4WU2 A;  2CPZ A;  2ZUG A;  5D4N A;  1KQG B;  1U7L A;  4OI3 A;  3MUT P;  3H7H B;  3BGF A;  3GYX B;  4C0B A;  4K4X A;  3K8V A;  4DF8 A;  2EC2 A;  1R89 A;  1TUW A;  2BAC A;  2WB1 D;  2CWK A;  2ROP A;  3W5X A;  5ITH A;  2OD4 A;  3VAG A;  2ZUA A;  2QLX A;  2IRY A;  3DYA A;  3M32 A;  5AXK A;  5A8W B;  4KV8 A;  5L38 A;  3CCS S;  3OJU A;  4PWU A;  3J80 U;  4FZV A;  2GHP A;  2QX0 A;  2W2Q P;  2QA4 S;  4CLT A;  3P6Y C;  2CQ4 A;  2ROE A;  2U2F A;  3WZ0 A;  4DX8 H;  1EB0 A;  2RNE A;  1RKI A;  2VFR A;  4ZLL A;  2ZHA A;  3RJM B;  3W5Y A;  1RA6 A;  2BUN A;  4DV5 J;  4JI6 J;  4ZPD A;  1O51 A;  4U9R A;  4BBY A;  4U6P A;  3SYZ A;  3ZZY A;  4NA1 A;  3S8S A;  2QLW A;  1FER A;  1EET B;  3CGI A;  1U2F A;  5BJR A;  2Y8W A;  3N28 A;  3OT9 A;  3P5T L;  1LWC A;  2E7X A;  2N7Y A;  1FVQ A;  2HHH F;  2CKW A;  4KHP J;  3LP1 A;  4OQJ A;  2DEJ A;  5HJY A;  5IQ6 A;  2LQB A;  1ZM4 A;  1WEX A;  3I4P A;  1YZ6 A;  2X1G A;  3R97 A;  4TQS A;  2LEC A;  1YIT S;  3NLC A;  4QWA A;  1K0V A;  2AEM A;  2W1B A;  3BBB A;  1BQN A;  4AL6 A;  4ER8 A;  3OPK A;  2ADB A;  3G71 S;  4M95 A;  3DRS B;  3TNV A;  2DTJ A;  2R3V A;  2K7K A;  4QZV B;  4WFZ A;  3CE8 A;  1RBA A;  2KFZ A;  1LV5 A;  4X4R A;  1P9Q C;  2KJW A;  5D15 A;  4WKR A;  2IY5 B;  1KHW A;  4Z7Y A;  1CC8 A;  5KFB A;  1QAI A;  2RKI B;  5KFQ A;  1T95 A;  4KT0 C;  5I3U B;  4DV4 J;  1CJU B;  1IWG A;  1NH8 A;  2IM2 A;  4ICL A;  5ETO A;  1WEL A;  3PX0 A;  2DRB A;  2OPR B;  5HQL A;  5GAG I;  5B0F A;  4AD6 A;  2MJN A;  3DLJ A;  1XR5 A;  2NXE A;  2YKO A;  3SCK E;  5BR8 J;  4FYD A;  3QYY A;  1HYS B;  2FTR A;  1TFY A;  3BN7 A;  1IKX A;  3X1L B;  1VQ6 S;  4USU A;  5IT4 A;  4I56 A;  5DO2 A;  4UZC A;  2ERR A;  4ZPT R;  4Z2X A;  1NCL A;  2LQ9 A;  3M05 A;  5K9F A;  4JYA F;  1V5V A;  1ZZF A;  1AYE A;  2KN4 A;  1PIE A;  1W26 A;  3UCU P;  2E1A A;  4K4Z A;  1UPM B;  3OHA A;  3Q86 A;  2EW9 A;  3OUY A;  2Z30 B;  4RW6 B;  2OIH A;  4ZN3 A;  5KFM A;  2KFN A;  3CDB A;  3PYE A;  1Y4Z B;  3TEG A;  2OPS B;  4NZ6 A;  2JL9 A;  1KRP A;  2FHK A;  1R7I A;  4F7V A;  2FDN A;  3DMJ B;  4RWW A;  4A47 A;  4TU9 A;  2LXI A;  2XMA A;  3QJP A;  3A8K A;  3KUE A;  5KFJ A;  4NI2 B;  2MKY A;  3AJD A;  4QR0 A;  1CUL A;  5DG7 A;  1G1X A;  1B7Y B;  1X9S A;  3K8W A;  1HNV A;  4RUH A;  1M5V C;  1D9A A;  1YZ7 A;  1U0H B;  1D09 B;  4QWC A;  4GKK J;  1CPZ A;  3RRG A;  4RUB A;  2OH2 A;  2LA4 A;  4WP9 A;  3QLH A;  5L1I A;  4F3O A;  2VQF F;  1T05 B;  2V50 A;  4QU6 A;  1UW9 A;  3W62 A;  2BJ9 A;  2YNF A;  2XCP A;  1PYS B;  1XR6 A;  1T03 A;  4DG1 A;  1K73 T;  3FRY A;  1UJ6 A;  2EFO A;  5LMN J;  1NJW A;  2DY9 A;  4ZHR B;  3KOA A;  2DJW A;  3GTY X;  4TY9 A;  2QA2 A;  1XNQ F;  5IT9 U;  2HZA A;  4MH8 A;  2FLN A;  3NCQ A;  3NKY A;  3X3U A;  2X7I A;  4LSN A;  3Q8P B;  2E1P A;  3FSX A;  1F0X A;  2QYC A;  1RTI A;  4I67 A;  4B3O A;  2GC8 A;  4Y2I A;  2ACY A;  5KFL A;  3BO4 A;  2KYZ A;  3N6N A;  4I7F A;  1QE1 A;  2OFH X;  2RRB A;  4DR4 J;  1NZA A;  4UQG A;  1EIY B;  2J6T A;  2JWN A;  4CLY A;  4Q44 A;  3MAA A;  5AE3 A;  1ZAV A;  4NLQ A;  5FDL A;  4WZM A;  4PPD A;  3D5M A;  3VAM A;  2A6M A;  5F8N A;  1RWO B;  4C0O C;  4C98 A;  3NL0 A;  2ZVS A;  1NSP A;  1LWF A;  2RQC A;  1B99 A;  3V6J A;  1HI1 A;  2HRY A;  2PMH A;  3AQP A;  1V3Z A;  2HVZ A;  1IKV A;  2KVI A;  2C3O A;  4IDK B;  4DCO B;  3VTI A;  3CCV S;  4AQY F;  2XNQ A;  3MM9 B;  2V2V A;  3M8Z A;  4DQP A;  1ZBT A;  1RWU A;  4JV5 J;  1HMV B;  1BQX A;  1PC4 A;  4Q0B B;  1JMT A;  2EC0 A;  2JEI A;  1N5S A;  3A4T A;  3DHW C;  3A3N B;  4MKB A;  3UVJ B;  1ZOT A;  2CVI A;  1HIY A;  1KSP A;  4NOH A;  4EYH B;  1YVF A;  2F8H A;  3OR2 B;  4JI2 F;  1DLO A;  2QV6 A;  1NHU A;  1RT4 B;  4LRB A;  2V2Q A;  4MIW A;  1R6V A;  1HNX J;  1BUX A;  4XO0 A;  1XMQ J;  2WOM B;  3HT0 A;  3CTR A;  1YBU A;  1S7I A;  3QAE A;  4CLZ A;  4DUY F;  3D6T B;  3T5J A;  3H59 A;  4URS A;  3AAW B;  3D1H A;  1RBO B;  2M4M A;  4A8W A;  2QLJ B;  2XMU A;  2HFZ A;  2OEM A;  5HBM A;  3CC7 S;  4B9T A;  1I51 B;  5F8M A;  4FVC A;  4FBT A;  4G1Q A;  1T9W A;  2FY1 A;  3KDN A;  3M8Q A;  3PW4 A;  3CO0 P;  3JXO A;  3OR2 A;  5LJ3 Y;  2CZV C;  2YKP A;  2B3T B;  3A1Y G;  2JNJ A;  2KZM A;  1UJ5 A;  5E33 A;  2L08 A;  3HVW A;  4NEZ A;  3FRZ A;  1TU0 B;  3K0J A;  4A8Q A;  5A2Q U;  2XMT A;  3I4H X;  4KKO B;  5B7W A;  1X5S A;  1S5Z A;  4QU7 A;  1M1H A;  1N33 F;  2GAH C;  4QYZ J;  3BPD A;  3AH6 A;  5BYR A;  1V3S A;  1YK9 A;  2MSS A;  3FZB A;  3WC0 A;  1J2V A;  4OYB A;  4WK1 A;  1B3T A;  3BF4 A;  3PW5 A;  1P1L A;  4DX6 A;  2AJQ A;  3EJM A;  3PFE A;  1FJG J;  3Q83 A;  5D3G B;  2J0X A;  4RW8 A;  2KRB A;  2D3U A;  2DNY A;  3C46 A;  1BE4 A;  1R8H A;  4MK8 A;  5HMX A;  4J9O A;  3RB6 A;  2QE5 A;  5DM7 Q;  1RT5 A;  1TZ0 A;  3L95 X;  4HHJ A;  1JLC B;  1XBW A;  1GEH A;  1RT3 B;  2XTJ P;  2KL8 A;  2LVW A;  4LQ3 A;  1PGZ A;  4EBD A;  1HHT P;  2OTJ S;  5F8G A;  3G8Q A;  1Q5V A;  4CNY A;  2GX8 A;  4A8K A;  1X4C A;  1ZA2 B;  3ENV A;  1U2C A;  3LAN A;  4HTI A;  3LUY A;  5T7L A;  1R6Y A;  1K47 A;  2UVV A;  4ZVE A;  4P52 A;  3HKZ D;  2DYA A;  2V0N A;  1AFI A;  1S9G B;  3JTN A;  1H98 A;  3ONQ A;  1RAA B;  4ED4 A;  2ZOM A;  5FLX U;  3IRX A;  3KK1 A;  2RML A;  3KHG A;  2E1R A;  4H4O A;  1HA1 A;  3R7B B;  2RF2 B;  4UF4 A;  3RYL A;  3PV8 A;  1F9F A;  2B6A A;  3QRP A;  2KZZ A;  4NLY A;  2QL5 B;  1HR0 F;  1U4B A;  1S57 A;  4IO1 A;  2IBO A;  3KUG A;  4Y00 A;  1CG2 A;  1J5E F;  3WIU A;  2YH1 A;  3CJQ A;  1UET A;  2H65 B;  2BJ3 A;  3QGH A;  4B17 A;  1UJ4 A;  1OS5 A;  1S9G A;  2XC9 A;  4K0K J;  4QCL A;  1SJ1 A;  2GIF A;  1N36 F;  2XSF A;  3GPA A;  2MPU A;  1HBN B;  3K2Y A;  4USW A;  2AJ0 A;  2VL1 A;  4Y2C A;  1S1W A;  3PJW A;  3D28 A;  1CQN A;  3MGJ A;  2IYG A;  4LBH A;  1HD0 A;  2E7W A;  2HLT A;  1WNE A;  1T0T V;  4DQR A;  4E98 A;  2WON B;  1LXN A;  5JMN A;  1GXT A;  4RNH A;  5B0E A;  3LO3 A;  5KFO A;  1DJ0 A;  3EPG A;  1HKA A;  2N4D A;  4TLR A;  3DOL A;  4CRJ A;  2GO8 A;  4JI7 J;  2W4P A;  2LP4 A;  4BLG A;  3OL7 A;  2IAJ B;  4DPO A;  2CQ0 A;  4G6V B;  3ZZZ A;  4K4T A;  3EGV A;  2RU3 A;  1FI4 A;  2E9Z A;  2RT3 A;  1KTV A;  3I0S A;  5J2Q A;  3D3C J;  3BRE A;  3FMW A;  2XO6 A;  2GJ2 A;  3IN5 A;  2DY1 A;  4RNF A;  1U6Z A;  5EWG A;  3MZI A;  3NBP A;  1S72 S;  3F0N A;  1EAR A;  1WDD A;  1LWX A;  4QPX A;  1Q7Y T;  1UVN A;  2C2O B;  3BM7 A;  1RDR A;  3V2U C;  5HN0 A;  2PI4 A;  3WC2 A;  3Q22 A;  4JI3 J;  3HD1 A;  1YSJ A;  2XG8 A;  2F40 A;  5U47 A;  4J9R A;  3ZNU A;  5KG3 A;  1ZH5 A;  2ZWP A;  3MTJ A;  4WP3 A;  2QMX A;  3FQK A;  2WW4 A;  4LFC J;  3DLK A;  2W9B B;  1YWX A;  3M8P B;  1VFJ A;  4PXC A;  2F8E X;  1E6Y A;  1CJK B;  3Q2T C;  1RAO A;  5I3Q A;  1I94 J;  1F2H A;  1RAF B;  2AX0 A;  1S0M A;  2C3U A;  1TKT A;  4A48 A;  4JI0 F;  5B0A A;  3BYR A;  1RYS A;  1MWZ A;  2M2B A;  3BDP A;  1Y10 A;  3IXQ A;  5KT5 A;  2AEJ A;  2CQC A;  4YHH J;  2B5J A;  3ENA A;  2H1Y A;  4FXW A;  2LDY A;  3D0G E;  4ES2 A;  1TL7 B;  4EGL A;  3VAL A;  4UOF A;  2HS4 A;  4FF4 A;  3GV5 B;  1D3W A;  1GFW B;  2GCF A;  2ZC4 A;  3CCT A;  1H2T Z;  1UCN A;  2BAN A;  1Y5I B;  3A8E A;  2ZH8 A;  4PEO A;  3DLK B;  2ZH3 A;  2EEY A;  2B4U A;  3IWX A;  4WE1 A;  4WBF A;  2B4P A;  3RW7 A;  5GAE I;  2R8I A;  2VUG A;  2VG6 B;  2EKY A;  2FVP A;  1RAG B;  1NU4 A;  3POT A;  4U67 Q;  2P9C A;  2VPW B;  3LF0 A;  4GC6 A;  2UUA F;  3GG1 A;  1RU1 A;  2JC1 A;  4K4S A;  3MPV A;  3S6E A;  1JKH A;  2PGC A;  3CJ3 A;  3NS7 B;  1S97 A;  2UUC F;  1Q86 T;  1M5H A;  2VF3 A;  4DR2 F;  2C2K B;  2AJ1 A;  1RHU B;  1YJ7 A;  1YRU A;  3DRP B;  3PG9 A;  3G4S S;  3FGV A;  2B43 A;  4IG0 B;  2H9Z A;  2MHN A;  2V4Q A;  2CPI A;  2QGF B;  1WI8 A;  4EFA C;  2NZC A;  1NK8 A;  2UXC F;  1RWX B;  7FD1 A;  1RLD A;  2PFD A;  1K1Q A;  3TW0 A;  4O3R A;  1M1K T;  2MEW A;  1NBE B;  4O0N A;  1HWJ A;  3MCS A;  2HNZ A;  1KON A;  1TQL A;  2COL A;  3ETM A;  3H98 A;  3JYT B;  4JBC A;  4DR1 F;  1H6K X;  1UVI A;  1KVI A;  4KPC A;  4IOA Q;  5HI7 A;  1X0P A;  1SUQ A;  2FJX A;  1L3K A;  1VRQ C;  4GVB B;  1YJ9 S;  3K5M A;  1C0T A;  5KG2 A;  4RKU C;  5LJ5 Y;  2DEI A;  3B6B A;  1TL1 B;  3PHE A;  4CTA B;  2Z0G A;  1E6V A;  2CPJ A;  4WJB A;  2D3O R;  4CWB A;  2Q6B A;  5GME A;  4FP9 A;  3AT1 B;  1EKR A;  2FHM A;  2QMU B;  3TO8 A;  2YKA A;  3AB2 B;  3ZTP A;  4AUK A;  5KG7 A;  1ZPV A;  2R4F A;  4IFY B;  1X7V A;  2JZ5 A;  5KT4 A;  1GNK A;  2M5Y A;  2QMW A;  3EGW B;  1LKZ A;  3QRR A;  4AXI A;  2E7V A;  5CZX A;  4DV5 F;  4LF7 F;  1PJ7 A;  1ZS6 A;  3DDN A;  4OZJ A;  4TXS A;  1U1Q A;  1X9W A;  2I1R A;  5D4P A;  5I4M A;  3G6V A;  1FNX H;  3G9C A;  1PCA A;  1E6V B;  1DTT B;  2CPX A;  4TKT A;  1O8B A;  3H2L A;  1WKK A;  5FII A;  1SI9 A;  2IIH A;  1AXQ A;  4CLP A;  3CC4 S;  4KR0 B;  1VQ7 S;  2AW0 A;  2DNH A;  1NDC A;  2D3Z A;  1XMO J;  1OQ6 A;  2RKI A;  3IS9 A;  3T9N A;  3WIV A;  2FHJ D;  2R42 A;  3G82 B;  3M1V A;  3KLG A;  4DSF A;  2DGQ A;  1YBA A;  3QWP A;  4K4V A;  4OZ0 A;  3IG1 A;  4HLB A;  1S0N A;  2PC6 A;  1UW4 A;  1U1P A;  2JRS A;  2BV3 A;  3SIP B;  3BBC A;  1DTT A;  3G86 A;  3FNN A;  4CCH A;  2UVW A;  5DJB A;  2AP6 A;  2VV5 A;  3J7Y U;  4L72 B;  3K5L A;  2QYG A;  2Q1L A;  4BCA A;  1N88 A;  4DQS A;  2J0Q D;  3VVU A;  1IN0 A;  1RAH B;  4NLP A;  5E41 A;  5FLX Y;  3RR7 A;  2ZOF A;  2D9O A;  2DKO B;  2BEF A;  4M5D A;  5KT6 A;  3WHI A;  3GII A;  2AHO B;  3RZA A;  5RUB A;  3HK2 A;  4D3G A;  2VDH A;  2BVZ A;  3TZX A;  2BE2 A;  4CO5 A;  4Q2L A;  1L3S A;  4NCB A;  2EG1 A;  4X4T A;  3G6Y A;  1Y5N B;  4LF8 J;  2BMB A;  1MLA A;  2DIS A;  2V4J B;  1PSD A;  5GMD A;  4JV0 A;  5D77 A;  2ZDO A;  2J5A A;  4QYR A;  3KK3 B;  4PWD B;  2FJE B;  1Y3J A;  4P2F A;  1BMQ B;  1XER A;  2C3P A;  3MUV P;  3MEK A;  5JXS A;  2WVC A;  4CO2 A;  1WSV A;  3HP6 A;  3NGD A;  3OR1 A;  2FJD B;  4AE5 A;  2BYC A;  1VQM S;  2Z2L A;  2AGO A;  1MSW D;  2MGZ A;  1FNO A;  2OEL A;  4CI0 B;  3MAQ A;  1N34 F;  3DC2 A;  3MM7 B;  4F3M A;  2UXD F;  3W8G A;  2W4D A;  5DLG A;  3CJT A;  2IDL A;  1GMU A;  5DQI A;  2ZJQ Q;  3ZTO A;  1BQM B;  4X84 A;  2FJV A;  1B4S A;  3D6M B;  4LIW A;  5BR8 F;  2XMW A;  1PBA A;  1CQM A;  2AKW B;  2W7O A;  3C6T B;  3MM5 A;  3A3O B;  3DOL B;  4C8N A;  2C22 A;  3MMA A;  3TVY A;  3S7R A;  3SSQ A;  5EUH A;  1NJI T;  1H2U X;  2GQ2 A;  4YB7 A;  1TL3 B;  1WC6 A;  5C7P A;  2B4O A;  2Q6C A;  4JOU A;  2CPD A;  3HVR A;  4C8M A;  5J2M A;  1RTD B;  1F3F A;  2G2Z A;  2KI2 A;  3VZH A;  2K1R B;  3FSY A;  2JC0 A;  3FVY A;  3MM7 A;  3M8R A;  1C4A A;  1Q8I A;  4RX6 A;  3ET6 A;  4P72 A;  1H0H B;  4KGZ B;  4QIG A;  2FVC A;  2PEB A;  2GGP B;  2MZQ A;  3KLI A;  2ZZN A;  1KLM B;  2D1C A;  2K8G A;  4XPC A;  1FFG B;  2YNH A;  5H1S V;  3NCR A;  1DRZ A;  5AXN A;  2B7C B;  1W2I A;  2CZ9 A;  2ZH6 A;  4MK9 A;  3DDK A;  1N36 J;  2VD3 A;  1NJZ A;  2BQU A;  2NR0 A;  4NMX A;  3CC2 S;  1S99 A;  2ASD A;  1N6Q A;  3NMR A;  4IUF A;  1S6P A;  1D9F A;  2O66 A;  4CDI A;  1UPP A;  5CYQ A;  1E6Y B;  3OVA A;  1HHS A;  3W9J A;  1SC4 B;  4DUZ F;  2NYI A;  5KG1 A;  2ZH5 A;  3V6H A;  1JLG A;  4QR1 A;  4B3S F;  4DHV A;  4B9M A;  3Q8U A;  4GKK F;  5B0G A;  2F4V J;  5FJ4 A;  2RIL A;  2QFI A;  3BH6 B;  1UMJ A;  3BS9 A;  2FZG B;  1IWA A;  3UVJ A;  3ILJ A;  3KJQ B;  3VCD A;  3F44 A;  4JI7 F;  2DBB A;  2XI2 A;  2HWH A;  2OSR A;  2MZJ A;  4DN0 A;  1FJE B;  1X5O A;  2V2K A;  4ANE A;  1B70 B;  2WVF A;  3BEG B;  3HDS A;  3J7Z 5;  1N6Q B;  4WTY A;  3V4I A;  4Y2A A;  2Q3P A;  2KHD A;  2U1A A;  3PJ9 A;  4NLG A;  1S4F A;  2BKP A;  2Q66 A;  2F9D A;  1P1T A;  4I6W A;  1UEU A;  4UOG A;  1VJQ A;  5DRK A;  3TA2 A;  2OEK A;  3OLA A;  4OHY A;  1KVJ A;  5DM6 Q;  4P2M A;  3MWB A;  4KO0 A;  3PAC A;  2DXD A;  2ZNZ A;  5C42 B;  5HLF B;  5K8O A;  1NB7 A;  4A8O A;  3CED A;  4M5M A;  3GON A;  5B08 A;  1RCO B;  2DO0 A;  2HGL A;  3Q24 A;  3ZXW A;  4YR3 A;  2HFO A;  2QC3 A;  2YX4 A;  3MEG B;  1S1X A;  2YPZ A;  4ECQ A;  1ZM3 A;  3SMZ A;  2IYI A;  2YKM A;  1S10 A;  1XMQ F;  1NH7 A;  1KKH A;  1SC3 B;  3GYG A;  1Y5L B;  1RXO B;  3OVB A;  3EZ5 A;  1KNZ A;  4ECW A;  2HFS A;  3E51 A;  5KFV A;  5E3Q A;  1S1U B;  1L3U A;  3QWU A;  3W66 A;  4IR1 A;  5HSP A;  1LW2 A;  2FJB B;  3FFI B;  4RJV A;  4B08 A;  1WSR A;  2HHP A;  2QZ8 A;  3DXB A;  3CSK A;  5M2P A;  1RTJ B;  3DRR B;  2VAS A;  5CH7 B;  1M5P C;  4DEZ A;  2PSZ A;  5D0E A;  1S1V B;  4ELV A;  1IXK A;  2V34 A;  4AL5 A;  1LFP A;  2XB2 D;  1MW7 A;  2HQI A;  3MR6 A;  1F5A A;  5JVH Q;  2QG9 B;  4A4J A;  2CIM A;  1NJX A;  4C8K A;  1HNX F;  3ITH B;  1HWU A;  2CDR B;  3KK2 A;  2BOP A;  3GCX P;  3UD5 A;  3RGI A;  3HVA A;  2B8P A;  3FKB A;  3NNC A;  4DR4 F;  3CMQ A;  4Y6I A;  1RWN B;  3R5G A;  1FD2 A;  2LKZ A;  1C1B B;  1UVM A;  2QEX S;  5IC4 B;  1S0O A;  1CJU A;  2VKR A;  1BHN A;  2O3D A;  4ELU A;  4JI8 J;  1ZYQ A;  3W60 A;  1S1V A;  2Y1J A;  3CWJ A;  2IA0 A;  2CYY A;  5A8R A;  5HMY A;  1RUS A;  4OV6 A;  3MR2 A;  3WDO A;  2QA4 G;  3BH7 B;  3B8H A;  2WRM A;  5KFT A;  3ZTS A;  2R2U A;  4ECY A;  2YNG A;  3ULH A;  5KFE A;  2R7R A;  1VHF A;  2V8V A;  5D0H A;  1FT8 A;  2W2M P;  1T9T A;  4TN2 A;  4TYA A;  4YFU A;  4F25 A;  4PUO B;  1JQG A;  1X4B A;  3NXZ A;  2QJ3 A;  1PC5 A;  2HWI A;  1Z2Z A;  2OHD A;  2B9E A;  3EWG A;  4ZVH A;  2PMZ D;  4DPW A;  3BZQ A;  4TY8 B;  3CUN A;  5HJX A;  4IOC Q;  4PG4 A;  2VHG A;  4JI6 F;  5ETM A;  1O5J A;  1RAB B;  3M1V B;  3OUY B;  3UQS A;  2YWG A;  3GJR B;  2W4C A;  1NJY A;  4F4K A;  4OX9 J;  1S9F A;  4PYA A;  4DUY J;  3CJK B;  3ENQ A;  2G0J A;  4NYO A;  4DPT A;  5D0G A;  5CCL A;  2HK3 A;  3DMJ A;  4YY3 F;  2Z2Z A;  3UNY A;  1OPI A;  2QLB B;  1U1M A;  2YH0 A;  3J7Y I;  2YTC A;  3KJV B;  2Y1I A;  3SCL E;  5SUH A;  1C2P A;  3D0I E;  4OYP A;  3NRB A;  4M5D B;  1VQO S;  5HRO A;  2JFK A;  4AFF A;  3IMQ J;  2EKN A;  4HAC B;  3R9L A;  3K57 A;  3THV A;  4F2S A;  4NLD A;  4RUC A;  1SQG A;  2WCX A;  5IM0 A;  5HP1 B;  1IJE B;  2M0G B;  3I82 A;  1IKX B;  3LH2 S;  1FCA A;  3HZG A;  2AMC B;  2XSJ A;  3M6W A;  5A6P A;  1U6B A;  4DL0 C;  4J9P A;  2A2D A;  3JQK A;  1D9D A;  4MTP A;  3MD1 A;  3J81 U;  5KFH A;  2E66 A;  2CQ2 A;  3ZZU A;  3LAK A;  4ZHR A;  1J5O B;  2HHH J;  3QJJ A;  1RHQ B;  5H9E K;  1RHJ B;  3DDI A;  5ADZ A;  5K8M A;  2N82 B;  1Q95 G;  3W1Y C;  4LSN B;  4DL4 A;  4PG7 A;  1QSL A;  1LK7 A;  2GIR A;  3HSG A;  4DJB A;  2NSC A;  4HH0 A;  3GV8 B;  1CLF A;  2DH8 A;  1FVS A;  2CJ9 A;  3L7U A;  1BQM A;  1U45 A;  1IBK J;  2UUB F;  2NZ4 A;  1IM4 A;  3SCI E;  5CQG A;  1X4A A;  2YY3 A;  5J1P A;  1FXD A;  3HT3 A;  1SH2 A;  3Q89 A;  1S6Q A;  3R5J B;  4NI2 A;  5FDL B;  5BYQ A;  3CDE A;  2MZ1 A;  5THW A;  4L3K A;  1XEZ A;  4ES1 A;  4B3M J;  3C3L A;  2J6S A;  4U7C A;  1PJ5 A;  4EZ9 A;  3D3B J;  3NGT A;  4IDK A;  4QIE A;  2DRD A;  2HS0 A;  3H2U B;  4P7T A;  2YWW A;  2MQO A;  3IAM 9;  2JLG A;  1KOH A;  1T05 A;  4OYA A;  3BR8 A;  3I6P A;  2FJA B;  1X4F A;  1KLM A;  2YNF B;  2AIR B;  3FEZ A;  3TA1 A;  3IRW P;  3MED B;  5CD4 H;  2HQD A;  2JOQ A;  2AZ1 A;  2E9T A;  3I5B A;  1REV B;  3C14 B;  4ZP9 A;  3TX0 A;  3LWM A;  1ITP A;  4OHV A;  2BAN B;  1GAO A;  2R9L A;  4KFB A;  5GAG U;  4JB8 B;  4LMZ A;  1KHV A;  2X1B A;  4NXM F;  2K3K A;  2MLZ A;  3BN4 A;  3CW2 C;  1CJV B;  1NKC A;  4FDF A;  2R2R A;  1JLG B;  2RQ4 A;  3QNW B;  1WF1 A;  3DLE B;  2M9K A;  1RHM B;  3SV3 A;  1K9M T;  2NPI A;  4M5J A;  2RJZ A;  2OI2 A;  1DAR A;  2MLY A;  2Z56 B;  3PM9 A;  5D0R A;  1HPZ A;  3M8W A;  3O44 A;  2C2D A;  2XLK A;  2VA2 A;  4ZS6 A;  1LW0 A;  2F9J A;  3W3S A;  2RE1 A;  2BKO A;  3H4D A;  3GJT B;  3V4I B;  4UOC A;  1R27 B;  1VCT A;  4LR9 A;  4NML A;  3UI3 A;  4A8M P;  3RAM A;  4M1K A;  2KXH A;  4OJG A;  2FGC A;  4OHW A;  3U27 A;  1XC9 A;  5J1E B;  1LEO A;  3AJ1 A;  1B7F A;  1H2V Z;  4R8U B;  3UFC X;  1ARO P;  1T94 A;  1Q4R A;  1VHI A;  2HAF A;  3C6U A;  2RHS B;  2I9S A;  2HIY A;  4YS2 A;  1VBK A;  4MIB A;  4ZN1 A;  2ASL A;  4JI1 J;  2LQJ A;  2VDI A;  5CYM B;  1KBR A;  3UR0 A;  1M5S A;  1Q5Y A;  4MK7 A;  1A9N B;  5D3G A;  3MEG A;  5EWF A;  4M5I A;  1RAD B;  3B4D A;  3H0P A;  4KHR A;  2JJ4 D;  3MDF A;  3SQO P;  1WTF A;  3JTO A;  3NCP A;  3T1Y J;  1S7H A;  2LA6 A;  4X64 J;  1M1G A;  1NM2 A;  3ADA C;  1N32 J;  3TUP A;  1H7X A;  2R7V A;  2AJF E;  4P6Q A;  1U1L A;  1UWB A;  1X5P A;  4NRU A;  2KYX A;  1WI6 A;  2G13 A;  1RT3 A;  2NLW A;  2VZ9 A;  3KLF A;  3J7A 1;  2MQM A;  1J27 A;  2RDI A;  4F4Z A;  5ETS A;  3I9V 9;  4KGM A;  4A8X A;  3OTO F;  3M2R B;  3QZ7 A;  4I0W A;  2HG4 A;  3N9U C;  3D7S B;  4DV3 F;  2LEP A;  3H40 A;  3MEE B;  1KFD A;  1VLY A;  2YQ3 A;  3CNQ P;  1YDL A;  1YQH A;  3Q8Y A;  4RBT A;  1VBX A;  2DVI A;  2GIQ A;  4EBC A;  1U49 A;  1WG5 A;  1PYO B;  1JLB A;  3TVZ A;  4LR8 A;  3PX4 A;  3RU0 A;  3PZP A;  2JDJ A;  3U02 A;  3UE2 A;  5IV3 A;  1RAC B;  5DGA A;  1X31 C;  1C1B A;  1NHV A;  2KB2 A;  5DZ6 A;  1N4L A;  4ERD A;  4PXE A;  3QFH A;  3KLH B;  1UFL A;  3DXS X;  2WBM A;  1G6B A;  2V69 A;  5IXU A;  4L74 A;  3JS9 A;  3CF5 Q;  2H4Y B;  2HBY B;  2XYP B;  1TKD A;  1LK5 A;  1RTZ A;  3MFI A;  2CDQ A;  2OSQ A;  2VPZ B;  3N6L A;  5F3Z A;  3MMC A;  1X8D A;  2RHQ B;  1YI2 S;  2A3J A;  1BD6 A;  2YNG B;  1QDU B;  4XPE A;  5GMK a;  4DSJ A;  1H3D A;  4KQZ A;  4MAK A;  4W98 A;  1OJ4 A;  3VF0 B;  1F6T A;  2YVS A;  1X4D A;  5A6W A;  3KG0 A;  4FBU A;  3PIP Q;  2L9W A;  3PKY A;  1OWX A;  5K8P A;  1TEL A;  4ECX A;  2VBW A;  3EVM A;  5KFN A;  2KT3 A;  2POK A;  1DBD A;  2J7K A;  1PO6 A;  3UO0 A;  1UEK A;  4DV0 F;  4TU7 A;  1A7G E;  5CXT A;  1JXE A;  3LQV A;  1WOP A;  3R2D J;  1YBT A;  3ILL A;  2R8H A;  2BQ3 A;  2NQP A;  2HHW A;  3R8Y A;  2AX1 A;  2A2C A;  2P2C B;  1IM6 A;  3M4X A;  4RR5 A;  3SDE B;  4PCQ A;  1DQ9 A;  1WC1 A;  2KRR A;  4QJV A;  2F7V A;  2MQP A;  3M8S A;  4OHX A;  3OR1 B;  5EHH A;  1GXL A;  1YTY A;  4DR6 F;  4DU8 A;  2CVE A;  2FC8 A;  2HBZ B;  3RW6 A;  4X2B A;  1RYR A;  3VR1 A;  4Q8F A;  3D9B A;  4EMD A;  3HMJ G;  3Q8V A;  2GVZ B;  2ASY A;  4BC7 A;  2XMK A;  1TKX B;  2V8D A;  1HBM A;  5HVF A;  3EUN A;  5HP1 A;  4LF8 F;  3LTO A;  4ZJQ A;  4ZPV R;  2XSJ B;  1FRK A;  5L9N A;  3G8S A;  4C11 A;  4DS4 A;  2PFF B;  2R2S A;  2EFP A;  3DOK A;  1RP5 A;  1KFS A;  1TL3 A;  3BSA A;  3KFW X;  3ZZR A;  1RTD A;  3W61 A;  4ZIT A;  3M8P A;  4ZIW A;  2CJY B;  4GO5 X;  2LCW A;  2K1R A;  2EFV A;  3TAM A;  1N34 J;  1U0H A;  4KRW A;  4JP8 A;  1BXN A;  4RW4 A;  5HMW A;  2D41 A;  2VH7 A;  3I5C A;  2B9X A;  3I56 S;  3VAI A;  1RBL A;  2XMM A;  3RRH A;  4K50 A;  2ABY A;  2R7W A;  1TVR A;  2UV8 G;  2MHE A;  1RB0 A;  4C11 B;  2YNH B;  4YY3 J;  2CAD A;  2B8Q A;  2LDI A;  2ZH4 A;  1TAU A;  4YOE A;  4NXN F;  2P9G A;  5KFG A;  1OPZ A;  2NYH A;  1NME B;  2DNG A;  1YX2 A;  5E0O A;  1VC6 A;  1FKP A;  1ZAW A;  2EG2 A;  1VI7 A;  3GFX A;  4WFA Q;  3KJN B;  1EQM A;  1V5I B;  3SCJ E;  4LFB J;  4PAB A;  3POT B;  5E2Q A;  2XGQ A;  2B7B B;  1RAE B;  2EVZ A;  1R8C A;  1Z4U A;  4DL3 A;  1QVF R;  3SV4 A;  3MF5 A;  3UWT A;  3PHT A;  1REV A;  5M2U A;  4OYZ A;  3K5N A;  3V6D A;  4I2Q B;  1SBR A;  3ZC4 A;  3C2P A;  3NMA A;  5LM7 E;  4M5L A;  1LWF B;  1IKW B;  2G9O A;  2XHC A;  4M63 A;  1CJK A;  3UPF A;  1RHK B;  3HSZ A;  4KGK A;  5DDR C;  3FSI A;  1T9X A;  4L75 A;  4PXB A;  2IRU A;  4WCE Q;  3DM2 A;  1A0O B;  1XJW B;  2XHW A;  3DLE A;  1HAR A;  5F8I A;  5JVG Q;  1NPR A;  3BGR A;  4LRC A;  3T5H A;  4KO0 B;  2QSF A;  1AB8 A;  1SC1 B;  2Y0B B;  3LP2 A;  2C42 A;  2E44 A;  2HFV A;  1LOU A;  3NGS A;  3G6X A;  3EZU A;  1U1N A;  1FKA F;  2WVB A;  3V6D B;  4U7U D;  2VBX A;  1OY6 A;  4OZ3 A;  5E7O B;  1U1O A;  2W9C B;  3J81 j;  1NSQ A;  3M30 A;  1LQ9 A;  2NPF A;  4RNO A;  3FCH A;  2BE7 D;  3OXL A;  3P45 B;  4IKA A;  5MAO A;  4O0I A;  2DXE A;  2ZVI A;  1TFW A;  4OL8 A;  1IVZ A;  4OJ3 A;  1I6J A;  4X4Q A;  2V4R A;  1HHQ A;  4HI1 A;  3UDE A;  1WF0 A;  2GMJ A;  4DSI A;  1VR6 A;  4R0E A;  4RUA A;  3C6U B;  3SZ2 A;  3RB0 A;  5F8H A;  2OJ3 A;  1VQ8 S;  2UV8 A;  3IR7 B;  3GV7 B;  3B78 A;  2AGP A;  1YG0 A;  1RTH B;  4QBU A;  3NGR A;  3P8B B;  4OHZ A;  2KG0 A;  1TL4 A;  2Z2M A;  1ZAX A;  3AD9 C;  4IRC A;  4PZV A;  4C8Z A;  2JLE A;  1FEH A;  2DR6 A;  2KTQ A;  6AT1 B;  2HVI A;  1XK8 A;  3CCW A;  3NOC A;  2X1A A;  4ZP8 A;  3T3F A;  4XIU A;  4ED3 A;  3RR8 A;  4HR2 A;  4RNM A;  1JLF B;  1HBU B;  2CNK B;  2NXJ A;  3LP1 B;  1TK8 A;  2DNZ A;  4GO7 X;  3KLG B;  2A0F B;  1YLX A;  2KG1 A;  1XNR J;  5KFR A;  3FDS A;  4AND A;  1U47 A;  4QYZ K;  4DCP B;  3PW0 A;  2GJF A;  2BM1 A;  1CBK A;  3MEE A;  4K2J A;  5C2G A;  1MRO A;  4LSL B;  5DQG A;  3PW7 A;  4B3S J;  1T9U A;  3SEO A;  4WFY A;  4PUO A;  2HAI A;  3EXC X;  4DPY A;  2UUA J;  3TAQ A;  1I3O B;  3AA8 A;  2NUU G;  3HHL A;  3OV7 A;  1YRX A;  1HBU A;  1JLF A;  1U8S A;  2F65 A;  3TRG A;  5JJB A;  3K58 A;  2MQN A;  1CJT B;  1RWW B;  3CJ4 A;  3KWM A;  3R5C A;  4ICL B;  4Q7A A;  3CMA S;  3IA0 A;  4FNH A;  2DNM A;  4JI8 F;  3EX7 B;  3PNI A;  4LVO P;  5T7L B;  3CJ0 A;  5LSO A;  3RAQ A;  2YWF A;  3KKF A;  1YHQ S;  3MMC B;  2KKH A;  3OL8 A;  3TYT A;  3T1Y F;  4WPA A;  1V6H A;  5LMU F;  1V9O A;  3QFW A;  3ZZT A;  3EXY A;  4QOT A;  2XO7 A;  4EYI B;  2BQR A;  1SQF A;  2FC9 A;  1JX4 A;  3MOJ B;  2VG5 A;  1UP1 A;  3K5P A;  1IBM J;  4F26 A;  1HQU A;  4BC9 A;  1TK5 A;  1WWH A;  2YQ1 A;  5HVG A;  1DTQ B;  2KFY A;  5B0D A;  3FQL A;  4K8R A;  2GVD A;  2RS8 A;  3NEK A;  1S0V A;  1F1B B;  1S12 A;  2F4F A;  3FEY B;  2L41 A;  4JUZ A;  4JV1 A;  1FDD A;  4F0M A;  1NDP A;  3LPE A;  4G1P A;  3I31 A;  4N7T A;  1FTR A;  1YGY A;  4R5P B;  1YJW S;  1NKE A;  3KMQ A;  1R0A A;  1HI8 A;  2X3G A;  3L9Z A;  2NS1 B;  5T41 A;  2YXL A;  4PYD A;  4USM A;  5BXI A;  5F9N A;  2E5L F;  2HVH A;  2FZC B;  4CH1 A;  1DTQ A;  4ZPW R;  3PCO B;  4CH7 A;  3AOB A;  1J5E J;  3AY0 A;  3QT5 A;  1YIJ S;  3GIR A;  5LXR A;  1OMS A;  2CPF A;  2VC0 A;  2V9W A;  4OJ1 A;  2CQ1 A;  2PO4 A;  3PKM A;  4OX9 F;  5D6G A;  2NXU A;  1U25 A;  1IKY B;  5A0Y B;  3V6K A;  4IH7 A;  2VOO A;  4WF9 Q;  5KAK A;  4R5P A;  2XWY A;  4YDX A;  2GV1 A;  1DZ5 A;  1X9M A;  5F9L A;  2M70 A;  4OI6 A;  4J9M A;  1WD6 A;  1F9H A;  2XEX A;  1RKJ A;  1NK0 A;  1KR4 A;  1REG X;  1S6P B;  2ZM6 J;  3NGK A;  4ECR A;  2AJ4 A;  1KLN A;  2GQC A;  1VQK S;  2Z58 B;  1X4H A;  2ACM A;  3CD7 A;  2IC3 B;  4DR7 F;  1QUP A;  1EJ7 L;  1H73 A;  3O3L A;  4FN5 A;  3H25 A;  2HQG A;  4X65 F;  4ECZ A;  4DV0 J;  1UA0 A;  1VQ9 S;  1VIS A;  1JLQ B;  1T9V A;  1IKY A;  2FY8 A;  2R7Q A;  3MED A;  3MAA B;  1IBC B;  3W8P A;  4UQT A;  3U1N A;  2DR8 A;  4B9V A;  1JXL A;  3MMA B;  3A13 A;  5HAO A;  5IS2 A;  2C2R A;  4KY3 A;  1FRM A;  3ZTR A;  4KH1 B;  3UD4 P;  4LRF A;  3VQS A;  1ZM2 A;  1T3N A;  2B9W A;  1NHK L;  3N5F A;  2DNO A;  4DL5 A;  3V81 B;  6FD1 A;  1R3N A;  3KG1 A;  1R0C B;  2XI3 A;  4J9K A;  1SKR A;  3TAR A;  2XS2 A;  1VDH A;  2BAB A;  2GGP A;  3I0R B;  1FD8 A;  2G2O A;  3D67 A;  1JLQ A;  2IFX A;  2HND B;  3LGH A;  1TUG B;  2DGS A;  4LJM A;  4NA2 A;  4UOH A;  4CLU A;  4R0J A;  4RZR A;  2M88 A;  1PAE X;  1HNW J;  2QRR A;  2XCA A;  5KOX A;  3I96 A;  3R1H A;  2XGP A;  3CCZ A;  1SKW A;  1SIW B;  2GFF A;  1RCX B;  1RT4 A;  1U24 A;  1IKW A;  3ZZO A;  4I2P B;  4X4U A;  4KB7 A;  3OFE A;  2ZH7 A;  3GQC A;  3U7J A;  1N32 F;  2JH3 A;  5I42 A;  4EBE A;  4RU2 A;  3HD2 A;  1F2G A;  1JLE B;  3DM2 B;  2EK1 A;  2RRN A;  4OJH A;  4CYU A;  4B9U A;  2DPI A;  2FYX A;  3PRD A;  1WKL A;  4M5N A;  4ELT A;  4O4G A;  2BA9 A;  5KOW A;  1JKH B;  4OLO A;  3LP2 B;  3GFY A;  4L6V 3;  1X4E A;  3QO9 B;  1FJC A;  3OFF A;  3PTW A;  2CWX A;  4PPZ A;  3TP2 A;  3TZY A;  4USV A;  2BJ7 A;  3PYF A;  4M5H A;  3QZ8 A;  1NND A;  4CLF A;  4BWJ A;  2B9Y A;  2XUL A;  2VQE J;  2BE9 B;  3KK2 B;  1P8G A;  4KKO A;  2C28 A;  4CQ1 A;  2JEF A;  3TQE A;  2HNZ B;  1VQN S;  5EGY A;  2RQM A;  4H54 A;  3M2V A;  4K59 A;  5I3P A;  4CT8 A;  4D3H A;  4HVZ A;  3QO9 A;  5HAN A;  4AQY J;  4ED1 A;  2XLI A;  4OI0 A;  2PII A;  3C8Y A;  2C3Y A;  2QSW A;  1XMB A;  2FVQ A;  3TUI C;  4IO9 Q;  1S1X B;  2UXC J;  1NAQ A;  1QAX A;  2E29 A;  4FYV B;  2YKM B;  4FPI A;  4DUZ J;  3JAM Y;  1WC5 A;  3BO2 A;  3L7O A;  4YN3 B;  3R27 A;  2F4V F;  3NWR A;  3GJS B;  2M8H A;  3BSC A;  1MU2 B;  4FXV A;  1RT5 B;  1R8P A;  4HDG A;  4Q0B A;  2YWH A;  3RUB L;  2HRT A;  2UZA A;  4YEA A;  2LXF A;  2OD6 A;  2QL9 B;  3AJ2 A;  3MCN A;  2OLW A;  3W2W A;  4BDP A;  2LQ5 A;  2J6U A;  3P3D A;  1WTB A;  4DSE A;  2KDO A;  2MKH A;  3QID A;  3W9H A;  3CVK A;  4OZ1 A;  2DT9 A;  1R31 A;  2LEB A;  3MUM P;  1V3R A;  4YQW A;  2H51 B;  3JQJ A;  2VFV A;  3H20 A;  3HHK A;  1EET A;  2OGU A;  3OTB A;  3TAN A;  2A18 A;  3BGO P;  2RSQ A;  2VIC A;  1YJU A;  1S9E B;  1TKZ B;  1UAW A;  1Y3K A;  2YKN A;  4H4O B;  2RQK A;  3IWL A;  5IOL A;  2CRL A;  2ASJ A;  3MM8 A;  5ETV A;  4DLE A;  1KTQ A;  2UXB F;  2G4B A;  1ZTT A;  4DDF A;  3K7R A;  5LXY A;  5KT7 A;  4ZDN A;  5HRO B;  1Q8B A;  2DNL A;  4RW6 A;  2W7P A;  4YB6 A;  2AJ2 A;  1APS A;  1JJ2 R;  1BQN B;  2HK2 A;  4LRE A;  4ECU A;  2IM3 A;  4DS5 A;  4OLP A;  3W64 A;  2R7T A;  2FB0 A;  2YX1 A;  2ZBQ A;  4K7Q A;  1JLA B;  5LOQ A;  1ZPW X;  5IT0 A;  1G3O A;  3EDR B;  4X4O A;  3CPW R;  1WC3 A;  2V67 A;  1XMO F;  1UZH A;  2BOA A;  1F9E B;  2ZEJ A;  2MKI A;  2ZNY A;  4C8L A;  1IR1 A;  3QGP A;  2ZH2 A;  3RBZ A;  2OPR A;  2QFJ A;  1HFE L;  2IM0 A;  3EM1 A;  2GVD B;  4V19 X;  2EWH A;  3GP9 A;  3WQP A;  3PO4 A;  5AJ3 F;  1QVG R;  4J90 A;  3PR5 B;  5IZH A;  2WON A;  2HFN A;  3K5O A;  1S77 D;  1WEY A;  4IH5 A;  2LYV A;  4I68 A;  2R8K A;  5F8L A;  3H8Y A;  4ZPB A;  1N0U A;  5E3R A;  2HPU A;  3FBB A;  3TZW A;  3BPS P;  2Q79 A;  1PBU A;  1VRT B;  4ECT A;  3GFZ A;  4DR6 J;  4LF4 F;  2VU5 A;  3HFV A;  4USH A;  1DQA A;  3CME S;  1AA1 B;  4B3R F;  1IJF B;  5ETL A;  4O3S A;  5J2Q B;  4AT1 B;  1S59 A;  2CJA A;  4K5S A;  4ZVP B;  4YP3 A;  3DNC A;  2B4V A;  2KXF A;  2PMW A;  4ZPA A;  4LVN P;  1Z1Z A;  4EUV A;  4ZOS A;  5IWA J;  3OQ2 A;  4DBQ A;  3IBC B;  1HR0 J;  3U1L A;  1GTE A;  2DGU A;  2I2Y A;  3C14 A;  2G1H A;  3A3P B;  3VAJ A;  3N01 A;  1HNI A;  1CUL B;  4MJK A;  5G4D A;  3WBZ A;  3TUZ C;  5J2M B;  2V2Z A;  2CAJ A;  4KFB B;  4MIA A;  1ZZN A;  2KHC A;  5C5J A;  5KFW A;  7AT1 B;  1D8Y A;  2QLF B;  2MY7 A;  4OI1 A;  5D78 A;  3MM9 A;  1QJH A;  4K5R A;  3P4U B;  1FNM A;  1K0T A;  3CCM S;  3TJ9 A;  3HUL A;  2G0I A;  4IRD A;  4FF2 A;  1FX2 A;  3MMB A;  1XR7 A;  3PFO A;  4JV2 A;  4FF3 A;  3OFG A;  1BY9 A;  4NLT A;  4OZ2 A;  1IR0 A;  3MPD A;  4QIF A;  4QPT A;  4DG1 B;  1VQP S;  2KU7 A;  4TNO A;  1HPZ B;  1BWV A;  1FTC A;  2J9D A;  3MMJ A;  4W4M A;  3VGT A;  3NG8 A;  3OL9 A;  1SJQ A;  2ZDP A;  3AB4 B;  5LSR A;  2AQ4 A;  4NL5 A;  1DLO B;  3PEH A;  2WK4 A;  3M6V A;  4EWT A;  2BW2 A;  1DFD A;  4FNI A;  1IBK F;  3VQT A;  2UUB J;  4OX8 A;  3AOA A;  1VRU A;  3HHL C;  1VQ4 S;  4B3O B;  4LFB F;  2JEG A;  3E8O A;  4C4W A;  4CO3 A;  5KG5 A;  3AHP A;  3BKF A;  2DR9 A;  3F41 A;  2MB0 B;  2MTL A;  3PIO Q;  4O44 B;  4KGX B;  1X0F A;  3UDC A;  2CQB A;  2DPJ A;  3HLU A;  1SPB P;  5G0R B;  2MDA A;  3DU5 A;  5B0C A;  2GZO A;  1NK9 A;  1Q7L B;  1WEZ A;  4ZLJ A;  1GT8 A;  3EVW A;  4DR5 F;  4IG0 A;  2UP1 A;  4I2P A;  5A2Q Y;  2DCU B;  2DIV A;  3DCA A;  1N54 B;  2VPX B;  1VRU B;  4O3O A;  2DCL A;  2VA3 A;  1TV6 B;  2M8D B;  4J9Q A;  1IBL J;  5C25 B;  1GX5 A;  4WKY A;  3JYT A;  4C2M A;  2RRA A;  1FO1 A;  3QT8 A;  4I69 A;  4XDC A;  3KLF B;  1SH0 A;  2J8S A;  5DG9 A;  4DN9 A;  4X4S A;  4HHH A;  2L3M A;  4V1A k;  2A1B A;  3SFU A;  2R7S A;  1RT7 A;  2RAQ A;  1Y00 A;  3PRB A;  4DI6 A;  1WOO A;  2KO1 A;  1ICE B;  4NXM J;  1NKB A;  3PDN A;  4JI0 J;  4RPF A;  4GVL A;  3MXH P;  3NP5 A;  2H3E B;  1O6X A;  3QSI A;  1HLW A;  2BJE A; 
#chains in the Genus database with same CATH homology
 1GFW B;  3R7N B;  3D6M B;  2CJX B;  2C2Z B;  3GJR B;  2XYG B;  1RHK B;  4ZVQ B;  2QLB B;  4ZVR B;  3EDR B;  3NS7 B;  1SC1 B;  2Y0B B;  1F9E B;  3D6H B;  2C2K B;  1RHU B;  2H54 B;  1PYO B;  3R6G B;  1IBC B;  3R7S B;  1RWX B;  2C1E B;  4ZVS B;  3P45 B;  1RHR B;  3IBF B;  2H4Y B;  2HBY B;  2XYP B;  4ZVT B;  1SC4 B;  1RHQ B;  2H5I B;  1RHJ B;  2FQQ B;  2CNL B;  2XYH B;  3EDQ B;  1QDU B;  4ZVP B;  3R7B B;  3KJQ B;  4ZVU B;  2QL5 B;  1RWV B;  3IBC B;  3R5J B;  2CNK B;  4DCJ B;  2Y1L B;  1RWK B;  2H65 B;  5K20 B;  2P2C B;  2QLF B;  4DCP B;  3D6F B;  3P4U B;  4ZVO B;  2HBZ B;  1PAU B;  5IC6 B;  1I3O B;  2QL7 B;  3R6L B;  2CNN B;  2HBQ B;  2H4W B;  2HBR B;  1SC3 B;  1RWO B;  2CNO B;  1RE1 B;  1RWW B;  4JB8 B;  2H5J B;  4DCO B;  3SIP B;  3QNW B;  1RHM B;  2CJY B;  3RJM B;  1RWP B;  3GJQ B;  2DKO B;  2CDR B;  2XZT B;  2C2O B;  3GJS B;  3GJT B;  1RWN B;  2XZD B;  4LSZ B;  1QTN B;  1NME B;  2QL9 B;  5IC4 B;  2C2M B;  2QLJ B;  1BMQ B;  3KJF B;  1RWM B;  2H48 B;  3KJN B;  1I51 B;  2H51 B;  1ICE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...