2XYRA

Crystal structure of the nsp16 nsp10 sars coronavirus complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
286
Chain Sequence
QAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPRTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE 2'-O-METHYL TRANSFERASE
publication title Crystal Structure and Functional Analysis of the Sars-Coronavirus RNA CAP 2'-O-Methyltransferase Nsp10/Nsp16 Complex.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Transferase/viral protein
total genus 95
structure length 286
sequence length 290
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2xyrA00
3D2LA 3HA5A 5CCBA 4YV1A 4BLVA 5EEGA 4AZWA 4KDCA 1RI5A 5ICFA 4QTUB 5EC8A 3KQWA 4PINA 1EIZA 1XCJA 1X1BA 1ZHFA 3M6UA 1ZKDA 2OYRA 4E30A 5E2AA 5E9JA 2IBSA 4PYMA 3HVIA 5DTQA 3AXTA 3BGVA 3FUUA 2ZWAA 3A7DA 1EAMA 3LDFA 4RX1A 1TW3A 4RTMA 5E2BA 5E1MA 5K09A 4X63A 1EJ6A 3RIEA 1WZNA 3Q7EA 2AOXA 3UJ9A 5LQKA 3BT7A 3KQMA 5C9ZA 1NV9A 3HEMA 5LQJA 3P2KA 1G8AA 1M6EX 3NDJA 3E23A 4XUCA 5CUQA 5DM2A 3TM5A 1I9GA 4CTKA 1KXZA 1VP3A 4BY9E 3BZBA 3G2PA 1IM8A 3OFKA 3MB5A 5K0NA 1Z3CA 5GM2A 4ER0A 4RTOA 3OZTA 1O54A 2G70A 2FHPA 2IP2A 2WK1A 2AS0A 3ELWA 1VLMA 5E9QA 5FTWA 4IWNA 4RV9A 3E8SA 3OU7A 4XUEA 3RODA 2ZIFA 3A4TA 5ERGB 2PKWA 5HILA 4LWOA 5F2OA 3FTDA 5EVJA 5DT2A 1SUSA 3I9FA 4KIGA 2PV0A 5U4XA 1FP2A 3HNRA 4PIPA 3DTNA 4MQ4A 5EMKA 4DCMA 1FPQA 2P40A 2JHAA 1HNNA 3M6XA 3EPPA 3P71T 5JUWA 2GS9A 5KVAA 3GXOA 2GH1A 3THRA 3LHDA 1DUSA 1NT2A 1AQJA 2CKDA 1O9HA 3VYWA 2PT9A 3KR2A 5HFJA 1VL5A 3HVHA 2ADMA 3UJAA 4PYIA 4UOEA 2GAFA 2ZCJA 3UJ8A 4M38A 4PYJA 3KPJA 2OB1A 5F2KA 2DULA 4ATNA 5CIYA 4EMSA 3CC8A 1NW3A 1NE2A 1R8XA 1JG4A 1X1DA 1EJ0A 3OZRA 3P9CA 3NDIA 4MWZA 1BC5A 3HCCA 1BOOA 2AR0A 3FPEA 3NW9A 3EVBA 4RWZA 5LQRA 3GDHA 2CWWA 4FZVA 3FTCA 4RTQA 2ZZKA 1YUBA 3PVCA 3OE4A 2ZZNA 1R18A 4DCGA 2C7RA 3M6VA 1P91A 3UBTA 1ZG3A 2G8NA 3R9XB 2IBTA 4P7GA 1RI3A 5FCDA 2EG5A 2BR3A 1UFKA 4X61A 2AOUA 5DTRA 1AQIA 5FULA 2Z6QA 2I62A 3A7EA 1X1CA 5E9WA 2F8LA 3PLAE 2PSSA 2IGTA 4IV0A 2VZ9A 4IV8A 3K6RA 3BGDA 3KQQA 5KYGA 5LQUA 2PBFA 3GO4A 3FZGA 3BKWA 4FT4A 4BP1A 4QQKA 3EVGA 3KR0A 5K0EA 5MHTA 4Y2HA 5LQAA 3DMFA 3TOSA 2AOVA 2AOWA 3E7PA 4IKPA 3LDGA 9MHTA 1YZ3A 2GLUA 3QV2A 2XBMA 4LWPA 4CTJA 4KWCA 5DSXA 3DMHA 3EVEA 4OA5A 4YV0A 3H2BA 1P39A 3I5UA 3ELUA 3G2OA 1I4WA 5DX0A 4PYNA 5GOZA 3TKAA 1G38A 1QZZA 1NV8A 2VP3A 2B9EA 2PY6A 4DQ0A 3RW9A 2ERCA 2YXLA 3MQ2A 1JQEA 1G6Q1 2WA2A 4ISCA 1NW8A 3DP7A 4QTTB 3SR4A 2H00A 4YUWA 4DKJA 2EFJA 3ELYA 3GRVA 4PIMA 1VBFA 3NVKI 3B5IA 5BW5A 3PTAA 3EVFA 2G72A 4Y30A 5EKXA 3V97A 3G8BA 4QDJA 5JR3A 5EOVA 3T7RA 5CD1A 1KHHA 3GRYA 3KQTA 4O29A 3HCBA 3P9IA 3R0QA 3ER9A 1KYZA 2ZULA 3FTEA 2AOTB 3AY0A 2N47A 5CVUA 3FUTA 4PYKA 4M37A 5FUBA 4ER3A 3BWCA 5BP7A 2ZIEA 4HSGA 4E2YA 2XYRA 3IEIA 2QRVB 4P58A 4Z2YA 2P35A 2PX5A 2XVAA 3M70A 1YB2A 4G56A 5E1DA 3S68A 1TPYA 5K0CA 3ER8A 2O57A 2OZVA 2ZFUA 3JWIA 4QPPA 4RVHA 1PJZA 3PX3A 4E32A 2P3LA 3UWPA 3FPJA 5FWDA 2C7OA 5GIPE 5DX8A 5KQRA 1QAOA 1VPTA 1F38A 2YTZA 1AF7A 2CMHA 3KQPA 5KS2A 1FP1D 4PYQA 3MGGA 3HTXA 4CKEA 3U81A 5EPEA 2CL5A 4RTKA 1D2CA 2PVCA 5EIWA 4ZTBA 3MCTA 4DMGA 5DM4A 4R6WA 3BKXA 3TQSA 1ORIA 1QYRA 3C3PA 3LPMA 1Q0TA 2H11A 3KPVA 4X60A 5E8RA 4OBWA 3EEOA 2XYVA 3LCCA 2NP7A 1JG1A 4X1OA 1IY9A 3EGVA 3SGLA 1D2GA 2FCAA 5FA8A 1QANA 2AN4A 5EG5A 4YUVA 2IFTA 4BP3A 3HP7A 3KQVA 4RTLA 2ONYA 1JR4A 5CVVA 3VSEA 1L3IA 2G71A 2OY0A 4KW7A 3FYDA 3GRRA 4GUAA 5K03A 2PWYA 5HIKA 2JHCA 2P1DA 3GWZA 5DTMA 4AUKA 1I1NA 2B78A 3UJBA 3F4KA 3KPYA 3G89A 1EG2A 4P7KA 4QDKA 2UYOA 3CGGA 1ZGJA 2ZW9A 4PGHA 3TPZA 3FRHA 3T0IA 5IKMA 3AWIA 4QVGA 5LQNA 3CJRA 3UJ6A 2KW5A 2VDWA 3THSA 3EVCA 5DRTA 1VQ1A 2ORED 3EGIA 4M7RA 3OZSA 1KPIA 4YUYA 2HV9A 3MCZA 3X0DA 3OU6A 5GP1A 1EQAA 2IH4A 5K0JA 2IPXA 4P7FA 2Q41A 4C05A 3A27A 3KQSA 4V0QA 3IV6A 4JXJA 4OA8A 4WXHA 2ESRA 2PX8A 3BWBA 2H1RA 2ZSUA 3MAGA 1N2XA 3ELDA 3Q87B 2NXJA 5EKUA 5F2NA 4KDRA 3T7SA 2NYUA 4X41A 3CVOA 4E2XA 4EVIA 4PNEA 1SUIA 4C04A 3I64A 3O31A 4QVKA 3V8VA 4FSDA 3P9NA 1NW7A 4RVFA 2ZWVA 3R24A 2FK7A 5EEHA 2P3QA 3LKZA 3FPHA 3TFWA 3G88A 3DULA 3G2MA 2OBFA 4F86A 5FHQA 2WA1A 2P8JA 1VIDA 3TKYA 3B3GA 2B3TA 1SKMA 4E33A 2FPOA 3JWJA 5T64A 3KPWA 1XTPA 2P7IA 2NXNA 2JH8A 2YXDA 3B89A 3FUXA 5DM0A 1P1BA 5GWXA 3TM4A 4CKBA 3GIWA 3M33A 1SQFA 3GGDA 3G8AA 4RVGA 4R05A 1UIRA 4HH4A 5EHGA 1FJXA 3DUWA 4FGZA 4EQZA 3BWMA 1INLA 2LD4A 3BXOA 3FUWA 1Q0SA 3KR1A 3BGIA 3LBYA 5K0BA 1KYWA 1R6AA 5M5BA 2ZBRA 4HRAA 1WS6A 3TRKA 4FS8A 3KQYA 4LG1A 4XCXA 4B17A 1X1AA 3EGEA 2PXCA 2YQZA 2FK8A 2HTEA 3A25A 1L9KA 2AVNA 1NBIA 2PJDA 4GC5A 4GF5A 3SVZA 1L3BA 2UYQA 3DMGA 5DWQA 5FADA 2QY6A 1TW2A 5DSTA 1RI1A 4DA4A 4RSRA 1KP9A 4ER7A 2AOTA 3MTEA 2I6GA 3HA3A 3QOXA 3LKDA 3NVMB 2A14A 1L3CA 4PCLA 1JQDA 3O4FA 4HTFA 4PONA 5DXJA 3LSTA 1XDUA 3UA3A 7MHTA 3I53A 2JHPA 5KQSA 3VC1A 4FSXA 3PX2A 2QRVA 2B25A 1ORHA 1BKYA 3EEYA 3VC2A 4DM3A 4AX8A 4A6EA 5DLYA 5FQNA 3UJ7A 5BW4A 5LR6A 1XDSA 2FRXA 1G60A 1KR5A 4P7JA 5K8VA 1H1DA 5K05A 2O0LA 5FHRA 5GM1A 1OR8A 1Y8CA 2GPYA 3HA7A 3R6TA 4GBED 5FA5A 3R3HA 3TMAA 4A6DA 2OO3A 1XVAA 1O9GA 1XJ5A 3C3YA 5K01A 4QPNA 5CVJA 1P1CA 2IDJA 1T43A 2XVMA 3B3JA 3DLIA 4FR0A 4LECA 4R8SA 1R74A 5LSAA 5LQCA 2NXCA 2O05A 3G7UA 3KPUA 2JH9A 4PGGA 3CKKA 4RYLA 1R8YA 2YUIA 3TR6A 4RTJA 4CKCA 4F85A 4BLWA 1PRYA 4CXMA 2C7PA 1YZHA 3HM2A 4RVDA 3SSMA 1RJGA 3PT9A 3DR5A 2NNWB 5EIFA 3PFGA 3EVAA 2GB4A 3P9KA 5DRYA 3SXJA 4U7TB 2ZIGA 4E2ZA 4FT2A 5EZSA 3ANXA 5CCXA 1N7IA 3LGAA 2VDVE 2EX4A 4U7PB 4E2WA 2O06A 2PGXA 3GJYA 4OQEA 4OX9Y 3HCEA 3CJTA 4YV2A 3TLJA 5C0OE 3G5LA 4OBXA 3GCZA 1DCTA 2FYTA 1ZGAA 4E31A 2ZTHA 3ERCA 3NMUF 3LL7A 3P97A 2QE6A 5EMJA 3DXXA 5D1HA 2AZTA 1KPHA 4OQDA 5EMLA 2HR1A 3C6KA 2I7CA 5C1IA 2V74B 8MHTA 4K6MA 1JG2A 1F3LA 1WY7A 4L7VA 3OU2A 4ER6A 3M6WA 3P8ZA 1DL5A 4MHTA 2IIPA 2YX1A 4C4AA 2P41A 5T67A 1VE3A 3MERA 1QAMA 2AN3A 2JG3A 4RTRA 1ZQ9A 4KRGA 2R6ZA 5IH3A 3KR9A 3O7WA 2E5WA 4EK9A 3ME5A 3B7PA 5K0FA 3ID6C 2UYHA 2B2CA 5DXAA 1NW5A 1G8SA 2G1PA 1R00A 2YR0A 3PFHA 4PYLA 2YXEA 3UZUA 2K4MA 3HVKA 5P8WA 3HVJA 2NXEA 3OCJA 3IHTA 1JSXA 1RJEA 1XDZA 4QQNA 5E8JA 2PWPA 4GQBA 2O07A 2VS1A 3EVZA 1SVUA 4HC4A 4YUZA 3PS9A 3I58A 3KQOA 4RTPA 3CCFA 3LBFA 5E1OA 3MHTA 2QYOA 3NWEA 1MJFA 2PX4A 1XCLA 1RJDA 3FYCA 4DZRA 2V7EA 4GEKA 1UWVA 5K0LA 2Z6AA 3UA4A 2I9KA 4C07A 3DOUA 2DPMA 2QM3A 3GRUA 3UJDA 2PX2A 3SMQA 1WXXA 4RTSA 3BWYA 2ZBQA 3AJDA 4HGYA 4POOA 3M4XA 5ICCA 1JTEA 4PYOA 2UYCA 4EKIA 4MIKA 5EMMA 3FRIA 3OPNA 2IDKA 3SM3A 2HMYB 5B1SA 4WVLA 2C7QA 1SG9A 5EQJB 5G02A 3UJCA 1XXLA 1WXWA 5ICGA 2Y1WA 1HMYA 4KVZA 5CVDA 3NTVA 3KHKA 2JJQA 5FQOA 4FP9A 4C06A 4GOND 3OE5A 2ZLBA 3GRZA 1RJFA 3FPGA 2AN5A 3C6MA 1MHTA 4XUDA 2PLWA 3P2IA 4ER5A 3KKZA 4GOLD 4DF3A 1JTFA 1IXKA 3HCDA 3UFBA 1B42A 3SX0A 2OPBA 2P7HA 4AZVA 2EJTA 5HIMA 2NP6A 5HEKA 3DXZA 1U2ZA 1L1EA 3EMDA 4E70A 2BM8A 1NBHA 2HNKA 2Y1XA 5EGSA 2IH2A 3FPFA 3FUVA 5DPMA 1V39A 5H02A 1FBNA 1QAQA 5T6BA 1AV6A 5D1NA 3SSNA 1JQ3A 2ONZA 4HG2A 2PXXA 1M6YA 5DX1A 3ORHA 2BR4A 3SSOA 1G55A 3LDUA 4MTLA 5FWAA 4AZTA 3LCVB 3P2EA 5CM2Z 3WSTA 5HOQA 4YMHA 4YUXA 2HWKA 1BHJA 1NW6A 2BR5A 1JSZA 2P3OA 2ZBPA 5CVEA 2AVDA 4C03A 4GOOD 2ZZMA 4GC9A 4V0RA 4BLUA 1X19A 5BXYA 3A26A 3CJQA 1KIAA 3NJRA 5K0GA 4RTNA 3B3FA 5EHIA 2AOUB 2EJUA 2IH5A 2OXTA 2PT6A 2CMGA 5HIIA 5HZMA 2ZVJA 3PB3A 2YVLA 3JWGA 3DXYA 4EKGA 3LCUA 3BUSA 3AXSA 3EVDA 3G2QA 4R6XA 3IYLW 3G5TA 2BH2A 1YFLA 1RI2A 4CWAA 3T7TA 2PXAA 3CBGA 3L8DA 2BZGA 3HCAA 4YMGA 2UZ4A 4F84A 4NECA 3DLCA 3GU3A 5HIJA 3REOA 4R8RA 3E05A 3C0KA 1N7JA 1RI4A 4H0NA 4PCAA 5ICEA 1SQGA 1M0EA 3FTFA 1D2HA 3GNLA 3LX6A 2R3SA 3MTIA 1JG3A 3KU1A 2GA9A 4C08A 10MHA 2BM9A 5EZQA 4HTFB 5GIOE 4HGZA 1VP9A 4M36A 3EMBA 4AZSA 5E1BA 2OKCA 1WG8A 3DH0A 3HCFA 2Z6UA 4PWYA 5GINE 5DM1A 1YFJA 3QOWA 1KPGA 3JWHA 4KIFA 1YF3A 2OB2A 2XYQA 3NWBA 3K0BA 3OFJA 2VDUE 1NKVA 3LECA 4GOMD
chains in the Genus database with same CATH superfamily
1A7AA 5DHFA 2GF0A 4RVNA 2BBTA 4ZWNA 1Z16A 4PZDA 1R5BA 1I7NA 3NKFA 3TD2A 2ZE7A 4JI4B 4I9GA 3CV3A 4G65A 4LZLA 3TBHA 3TBFA 1YQQA 2EX0A 2RFLA 3L6CA 1ZHFA 4DLPA 3T3NA 1C4WA 2OCIA 3KVNA 1SCUA 3AXTA 3HB1A 3ENWA 3A7DA 5IM4F 3ROMA 2P2YA 3NM6B 2IEAA 3GPLA 3DMDA 2X5XA 1QYXA 1EP3B 1VL8A 1YS9A 2H54A 1X87A 3TK1A 2L82A 2NO4A 1C1YA 3TZCA 1QQ6A 4DCUA 5HMMA 4EB8A 3JVEA 3KQLA 1TT7A 1YKGA 4RSMA 3RTBA 4IWXA 4I1UA 4YRCA 3BXZA 1NX6A 1XZCA 3STYA 3E9NA 3OEED 2FHPA 3ELWA 1EVJA 1EWQA 1PL8A 4W4TA 2PUWA 4IQFA 1AHIA 3AMVA 3L8YA 2ADOA 5DZSA 2ZIFA 3LFUA 4PSVA 4L9WA 3RREA 3ONDA 4PRYA 3BWDD 2KB0A 4KRXA 5KYWA 2BDTA 4HRVA 2P62A 1W6RA 4B3FX 2DR3A 4YJ3B 2LCQA 2I71A 4KWEA 4BKMA 1W0KA 1K75A 3FOZA 2EWMA 4HP8A 1FPQA 1ZOOA 2PMWB 2QSJA 4NS4A 3EPPA 3WRWA 1YZUA 1YSCA 5JUWA 3HYSA 4RKWA 5IF9A 4UREA 3CZPA 4Q4DA 3ZDYB 4B4KA 1OIWA 4MS3B 2HU7A 3HVHA 1Z26A 4L8VA 4L4YA 2OHXA 5HNKA 4A0QA 1BOFA 5IARA 2DULA 3DJYA 2PZAA 2OUIA 1J97A 4L6AA 2JI6A 3GR6A 3RR2A 1KS2A 1HZZA 1N6IA 2IYAA 4BGUA 4CI0B 3GMTA 1K92A 4H7PA 3SZGA 3QE0A 1V9LA 4Y18A 2I2BA 4B5LA 3MCUA 3RADC 2DPHA 5JEDA 2VDWB 1I2DA 1YQUA 2DC1A 4JNCA 3DO6A 5KWSA 4N41A 2HU5A 1OWMA 1YUBA 3R4VA 2W2VA 1E9CA 1KSGA 4DV5B 1FW6A 3QLJA 4YAIA 1UZAA 1G3IA 2D2VA 1JQJC 1KMNA 2TECE 3M1IA 4M9CA 1GGMA 2VPYA 5AUPB 1R0CA 2R7AA 3RS8A 2ZBGA 4P7GA 4UDYX 3U9LA 2B8EA 1GNQA 2EG5A 2QD1A 1JDBC 2W4QA 3L8FA 5FCDA 1EGVB 5SYAA 4M1WA 1OI2A 2X0JA 3IBFA 1G291 2CLLB 1B3BA 4N54A 4LJAA 2FDRA 4EPVA 2IGTA 4WCVA 3K6RA 1UBUS 3G85A 1T9DA 2BMAA 2YZ2A 3P45A 4HTAA 1GEGA 4AWBA 3U4QA 2IVZA 4KMMA 1I2ZA 4G07A 2WU3A 3GGGA 5ALFA 2AIRA 1VPWA 2P8SA 3QH4A 3TZLA 4CFSA 3ZDDA 1X9IA 5JXJA 1DZIA 4PFJA 5AW6A 4Q7QA 3ONEA 3RFCA 1BN6A 2HN9A 4J7XA 1U0GA 5E7JA 3PNOA 5AXDA 1VLQA 4W8GA 4YLYA 1KJZA 1Q0UA 1JRLA 3H2BA 3NEYA 4FTWA 4OD0A 5LBUA 4BVKA 6REQB 2BF7A 4YB8A 4X7MA 4DLTA 1XYYA 3R09A 4N7RA 2A59A 2FPGB 4RY2A 1X1EA 4Y9DA 1E3QA 3UWSA 1XRSB 3NAGA 2YXLA 3RVQA 3JQBA 3DLTA 1JQEA 1N0HA 1CUJA 3X2EA 3N5KA 2O2HA 4C4XA 3WR5A 3ELYA 2JLWA 3VNVA 1A04A 2JGNA 2XB4A 4L75A 3PHBE 4JBIA 2Q9UA 3EF0A 5JR3A 5GONB 2I8LA 4MVXA 4DUYB 4E46A 1USVA 4Z5XA 2N1MA 2J9GA 2IOFK 1K27A 3CBQA 4UBJA 4R7GA 2NVUA 5IC6A 3RF6A 3R2JA 1IWPB 2BEJA 3SBXA 3T99A 2X9GA 4LX0A 5C1PA 3H2HA 1EBBA 1NRWA 5AOCA 5B2ZA 1AGXA 5CDTA 4M37A 1F9AA 2O2YA 3A6EA 3ZUPA 5HCUA 2IKQA 5ERXA 1U9IA 4JMLA 4DTCA 2XYRA 2C2GA 1TKCA 1HYHA 2CNWA 1J2RA 2PVSA 5EJAA 1PCXA 2XVAA 3UFXB 4NE7A 1B8UA 1TPYA 3B9PA 4Y9TA 2RK3A 5J2TB 2WG1A 3L4JA 1TT5A 1XTKA 1PS0A 2EKQA 1C1DA 3Q3GE 2H0RA 4QGSA 1R5JA 2YNMD 3L0DA 4GXTA 4LC0A 1MG5A 1AS0A 2P65A 3LAWA 2JAOA 1P2TA 2XCUA 1MDBA 2P9GA 1MNAA 2G07A 3BCSA 3DW1X 4P4NA 4CG0A 3ZTTA 4E7PA 1HT0A 4EUEA 5CA0F 2V65A 2HMVA 4L51A 4UCXA 4FINA 2IXTA 4HDNA 1WZUA 1LV8A 2L18A 2CL6X 2WNHA 3AR8A 4KGDA 1V8ZA 4NVRA 3GK3A 3I37X 1QIHA 3SIRA 2LNDA 1L8AA 5EIWA 4F0JA 4R6WA 1Z0IA 1IOWA 4HFRA 4E5KA 1QZ3A 2AGVA 3KQNA 1ECBA 4LV8B 1Q0TA 1AKYA 1FEZA 1I10A 3ZV3A 2VJDA 2KJQA 2ZS8A 1I2AA 1OAAA 3NG1A 2C4NA 4UE2A 4LA4A 3I6ZA 3ZCXA 1TKBA 2ZJ1A 4NXNB 1ZJ4A 2C2MA 2AN4A 2IC5A 2VYCA 4FLMA 4IJQA 4Q93A 4UUPA 2GJSA 3F49S 3GHHA 4RA9B 1BH2A 1MO4A 1V7QA 2O7VA 2C9BA 2RBGA 4BNLA 4J0JA 1P0CA 2QMHA 5CK4A 1O87A 5H59A 3Q5EA 4DIEA 5K6AA 4LJKA 5KDDA 4YJHA 4EG0A 2GPSA 4WBXC 2QK4A 1GSOA 1Z4QA 2D13A 3AIIA 2ZW9A 4AECA 4JV5B 1Z56C 3MC1A 5IKMA 3B53X 4S0ZA 5C2JB 2DX7A 2WKSA 2C2ZA 1CD5A 3R0JA 3R5FA 1DELA 4G0ZA 5HCNA 5AW7A 2RGGA 5JO9A 4BVJA 2Q1XA 1IN6A 4M53A 5CGZA 4LFCB 3ZYZA 2CN1A 1Q91A 4BOYA 1D04A 3HFJA 5D86A 4L95C 3WNVA 4R31A 3A6FA 5ARBA 2QVYX 5FP0A 5HQ3B 4ND2A 3HQ4O 2Z04A 3R3UA 2DQ4A 2YWXA 2XDWA 4AMUA 5BVHA 1XNGA 3O1HB 3X1KA 3R44A 3RHZA 4F5YA 2P2NA 3C87A 2X3FA 3AFGA 4U5QA 4GBMA 2W83A 3ETNA 4DABA 4DLAA 4WMLA 1TM5E 1V2HE 2XCTB 2Q4OA 2P3QA 3H1BA 3FPHA 5EAIA 3NP9A 5EXPA 2G25A 4FFDA 4G5QA 5CCDA 5B7PA 3G2MA 3SI7A 1EA5A 2X2PA 3C3CA 3RBVA 4JT9A 3ZHUA 3F4LA 5D85A 1QYVA 1X3LA 5BSWA 3TZEA 4RMIA 4QASA 3ZGYA 4HGOA 3TM4A 3W7BA 5DGIA 4FD3A 1JH9A 2QE7D 1FNSA 3NWPA 3I0ZA 2MSLA 1WJGA 1V8OA 2J5QA 2HMAA 2O7SA 3I1FA 3DUWA 3CR3C 1SC4A 1HDCA 5KNBA 4ZOEA 2F3PA 3EWSA 1C3JA 4J1QA 1KKMA 3TRKA 4Z4CA 3KQYA 1XTSA 5DEOA 4B17A 3B12A 3CPEA 5IDVA 2VBFA 3NATA 2WZQA 3NEAA 2CDCA 4OQNA 1AS3A 2MYPA 4P2BA 2O0KA 4YP1A 1C1XA 2HCFA 2F55A 5DISB 3DMGA 3Q3VA 1NQ5A 1Y6JA 2A5DA 3J7AC 4DA0A 1DV1A 3O8OA 1TMYA 3S7ZA 2Z3WA 3CB2A 3MTEA 4HTFA 4OHUA 5EJ5A 2VCHA 4M6WB 3FLEA 3QUSA 1OOEA 3L04A 2YMPA 4AFNA 1Q84A 1NAIA 1T35A 4G1UC 1WVMA 1KO7A 2EAUA 3O90A 3JV7A 3VC2A 1ILEA 1G20E 1RHQA 1KJYA 3A04A 5KYYB 4LJ9A 5COAA 1XDSA 2FRXA 1G60A 2JCSA 2WINI 3CCBA 4KEAA 2C0PA 3OHSX 3D4BA 1ZOLA 4O1IA 4F4CA 3DV9A 3FYTA 4I99A 5JNUA 5TLSA 1Y8CA 3QX9A 3PHIA 2QG6A 2OO3A 5K6AC 1IHXA 4BNHA 4YGYA 2XVXA 2OZPA 3C3YA 3BMNA 3GLHE 5C8XA 1R6UA 1ZBDA 3EIXA 3T3IA 1IEVA 2WSMA 1QJ4A 5F5LA 1ZINA 2JCBA 1PX2A 1YB6A 3KLPX 4PZCA 4TTQA 4X8LA 4BX9A 1JMYA 4DIOA 2F48A 3JQAD 5JYDA 2DUUA 5F35A 2G9UA 1Z73A 3CLUD 2OFWA 1Y4ZA 3EBOA 4FDUA 4NK5A 4CXMA 4DUGA 1MJGA 1O89A 5AW0A 4UJ5A 1M2NA 1PZMA 2PDAA 2NNWB 2OZLB 4TMWA 3R6LA 3I05A 1U1DA 1YHYA 1ZGHA 2N42A 1EB8A 1ZC4A 1WBJB 2B8TA 2X6RA 4FYHA 2CLDX 3H9GA 4N0DA 4AQDA 4HLNA 1ZVVA 5L45A 3TCNA 1BWQA 1DX4A 1JJIA 4YJGB 2FEPA 4XUGB 3TLJA 4BVHA 3OQ1A 4OGWA 2PA0A 4BRUA 4FIZA 4ZZIA 5BYAA 2Q3CA 5BNTA 3WWCA 3ZKWA 2QE6A 4HNVA 3I6MA 4AMGA 3DS8A 3DXXA 2O6LA 1W44A 4K3VA 4E14A 2VTBB 5K8LA 1LEHA 1WXHA 1PQYA 2AJ8A 2B7LA 3ZX5A 4A0HA 1KWKA 2HR1A 2P4UA 1IM5A 1SUEA 3QBDA 1SK8A 1VJRA 4KRFA 4B6FA 1X1SA 1XJWA 1Z9BA 3HB5X 5T57A 4KZKA 3DAHA 1XMJA 3ULKA 4I5EA 2E7ZA 3EUEA 3MLEA 4EB6A 1Z45A 1CFJA 1QAMA 1V1MA 3L1HA 4TSRA 2VPTA 4EITA 2UZ1A 1ZQ9A 3SM9A 2NTVA 2YZMA 4IUDS 2XMGA 3JZDA 3K9QO 1LSJA 3DOHA 3JU3A 1DAMA 4BE9A 3I42A 1R6BX 4GR9A 2XTNA 3WWEA 1DJNA 2MYTA 2C7VA 1U4SA 2ERXA 1W19A 2YXEA 3LT0A 3U3OA 3S1AA 1U7WA 1N5IA 2GEKA 2C3UA 2I3BA 3IEXA 3OE7D 5P21A 5BV1A 1FRFS 4J1SA 1E7YA 3C2QA 4AO7A 4LTNA 5B1EA 1IBLB 2E4XA 5KI6A 4HC4A 1KOJA 4FCCA 2X0NA 4RTPA 3HP4A 2A0XA 3WK5A 1MTOA 1U0OC 2JA1A 2DY1A 3RUHA 1YDEA 1GG2A 3QTBA 1HYGA 2CBZA 1JLHA 2BFBA 2VA9A 3LYAA 5AM0A 4UMDA 3UJDA 2WMNB 1VBMA 4ED9A 3WLLA 1NUHA 2PQ0A 2QX9A 2X4IA 1MQSA 5TVGA 4TT3D 5FEUA 4MIKA 1I6MA 3E5RA 4DQUA 4EYEA 3C98A 4YRJA 3ZQ4A 2W8ZA 3B13B 2BTEA 1DXHA 4JSYA 1PJSA 1ZJJA 2XWBF 3MJSA 3PPXA 4QZVA 4GBGA 4MUYA 5FI1B 1JEQA 2HH9A 3JQAB 3QUTA 3DKRA 3ROTA 2GTIA 2DBYA 1AY0A 5FQOA 5TS3A 2HC9A 1NASA 3D8RA 1SY7A 4HDQB 2QP3A 1LC3A 2PZKA 2UZ3A 4Z9BA 2IYZA 2O19A 1PW7A 3Q7IA 4TV8B 1EWRA 2EW1A 5C4GB 1KRXA 3PI6A 1GCUA 3TL6A 1ODIA 3HCDA 3QOFA 2OBYA 1PWYE 4QOSA 1ESCA 1ECGA 2FFBA 4NENB 121PA 4UVDA 1JS1X 1A5BB 3ZVMA 1Y6FA 3TB4A 4KHZA 2OBNA 3QIVA 5CB4A 1WXEA 1GPH1 4H77A 1NIPA 2Y1XA 4CF4A 2E89A 4JQOA 3W5AA 2WJZB 2Z2XA 1FBNA 1QAQA 2DUNA 2I29A 1ODCA 2HHAA 4ZO6A 4JLNA 2R9VA 3A3PA 3ZY4A 4BFZA 2G9NA 2VXYA 4N5MA 3FHJA 1T3HA 3GL9A 3JAKB 1Y81A 3UK1A 4RJJA 5DX1A 3L1VA 5CPBA 4BVFA 3P2EA 3EFBA 3GJ8A 1A4UA 3ABSB 4YMHA 4X62B 3EPJA 2WD9A 3CNLA 3D8NA 4CDGA 2E82A 4XOIA 1JSZA 1QB7A 3D4NA 3PQ4A 3J81A 3ADKA 4GOOD 1YZKA 5EIBD 2J85A 2IP1A 3ZWMA 5F98A 1XRQA 1R9JA 2J4FA 2J41A 3KHUA 1E92A 4UVIA 2P79A 2D1SA 5AKHA 2WHYA 2RHTA 3NHBA 4FKMA 4YRKA 2R2GA 3DTTA 3G8CA 5T7BA 1VL0A 3N0TA 2TS1A 4BMDA 2J32A 3GRFA 2C95A 2XUFA 3DHEA 5B36A 1JWLA 4J16A 1GPMA 1L7MA 3H4VA 4O2BB 2YS7A 2VF4X 3QJGA 5BMVF 2YMLA 4OK3A 4O1HA 4CEIA 1ADGA 4LJ5A 3ZLBA 3KFLA 1IOLA 1WUKS 2F4VB 4AKHA 1CY4A 3MWDB 5A3RA 3GDGA 2QF7A 3SBEA 1NPTO 2QQGA 3KBOA 3DLPX 4NECA 1AZWA 3ZXXA 2PUAA 1EAYA 5LZ9A 2A1TR 1W49A 3NAMA 4KK4A 2OD7A 4K8OA 3DC2A 3OWXA 2VP4A 1E99A 1JEAA 1IJKA 3LY9A 4XCVA 3JQ6A 1B8OA 2YQ5A 3ZV4A 5CDFE 5LIPA 2R6AA 2EP8A 1KH1A 3BM5A 3FMGA 4UCFA 4WK2B 5CIWA 5H81A 1DKLA 1J9GA 4ND7A 5BN5B 5TSDA 3E3AA 3EWNA 1CQJB 1AQUA 1UJBA 4HYEA 4PYRA 1ZH6A 1L5ZA 1P1FA 4NKRA 1JN0A 4Q3NA 3TRJA 1L5YA 1NVEA 1VSQA 2WTBA 2R751 5E2AA 3B6EA 5H5JA 5ADHA 1NVUQ 1P2FA 3S2SA 1JX6A 3O47A 5KVVA 1TKAA 4M0FA 2WFLB 4QTUB 2JVKA 3T7JA 1EESA 1CE8B 2PSJA 1WUTA 2GMWA 2XF8A 5C31A 3C3JA 4ZI3A 4B6PA 1G17A 2DFPA 1TW3A 3TRDA 1C81A 4JEHA 4DR2B 3VR1A 2XLBA 1QHEA 3WLTA 1PV1A 5FLXA 2XWPA 3PWKA 2WF8A 3AF6A 4OO3A 2LKDA 3KX2A 5IVHA 1O0CA 2B7CA 2JH3A 1PT5A 2HDHA 2CNLA 2FUEA 3GGPA 1SVOA 3X1XA 1XROA 3OECA 2IOYA 3KLMX 4QC2A 1GXSB 5FTWA 3WSWA 4CHTA 4R2XA 1Y5NA 1OIVA 5FJIA 1R0YA 4BEBA 3Q88A 1E77A 1TM7E 3IBCA 1LNZA 3A4IA 3VGJA 3UHAA 3F97A 4YV2A 1Z4PX 2A9JA 4FYKA 2DERA 3ZDFA 1JKIA 2BP7B 5A62A 1CUHA 2SHKA 2HF2A 4UVGA 4R40A 3K70D 5TS2A 3QPUA 3QTLA 1Z39A 3RFUA 1JLMA 2D1YA 3DTNA 1V43A 4TLAA 4WKNA 1N75A 1O96A 1TJYA 4O2AA 3KEFA 4L5AA 1DTEA 3BREA 3JQFA 1XD2A 4ERNA 2O1XA 2GS9A 1E2PA 4Z8XA 1P8AA 1MV5A 1J70A 5FPYA 4B3IA 2I67A 3Q8LA 1M8FA 1Z7WA 3HDJA 2Q5OA 5EXTA 3VSDA 4ND8B 1IPEA 1J0CA 1LPMA 4ZJPA 4J16C 5BVGB 3F90A 2BYTA 1N5MA 1GKUB 3AHCA 2J8ZA 4HY3A 5LP6C 2CJXA 2WWRA 5HF5A 5HUQA 4EYGA 4LGCA 2EKDA 2ODWA 3GV0A 1YQWA 5HS4A 3MWLA 4YT4A 4IGAA 4JT4A 4P38A 1T1GA 4ZI7A 1II8A 3QPAA 1JSLA 1AZLA 4BU1A 5NULA 4ALJA 4P5PA 4JUAA 4URWR 5FPQA 2D2EA 3L49A 1Z06A 3LUFA 4W8HA 1LA2A 3OE4A 4D9CA 3UMMA 3UTDA 5C53B 3ZK7A 2FSVC 2Q49A 3UM9A 3AF5A 4HZIA 3PF8A 1UBOS 2ZWIA 4D4JA 1CG6A 3ESZA 4DAEA 4XDGA 5ALTA 4KXYA 2VJNA 1N0UA 4R1OA 2R6R1 1OFTA 4TOIA 1JYFA 1UFKA 2I91A 3W34A 5E9WA 4E51A 3FA2A 3LP5A 4IIJB 4HJRA 1PHPA 4IV8A 4R2JA 1ZMOA 3WB9A 2RIPA 3TLEA 1NNSA 1EXVA 4NPHA 4JGGA 1CHNA 1U3DA 3Q7TA 4B35A 3FPAA 1FQOA 1HKHA 1FFGA 2FVXA 3BMCB 2HIAA 4JX8A 2AOWA 2B8WA 2HY7A 3E7PA 2RGBA 1ZK3A 2VOEA 1KE1A 2BEVB 5JY1A 4BO8A 4M9ZA 5IVDA 2Z5VA 2ZSHA 4OA5A 4IMRA 2OM6A 3KHTA 4Q9AA 1P39A 3I5UA 3ELUA 1P6XA 4Y2SA 5AHOA 3O8BA 3TNJA 5DM60 4OP2A 4UE3S 2E5LB 1KI3A 1QZZA 1G9XA 1KZ9A 2V0NA 3P9QA 2NUTA 5BN4A 4YQEA 1JE1A 5LQUA 2V7GA 4BO4A 4RPLA 1QOZA 2ZUVA 3RU2A 2C1XA 2WA2A 2HF7A 5FWNA 1NJ1A 3N6RA 4JODA 2VP0A 1Y4DE 4B8YA 4EQ6B 5L7YA 5AUNB 4URFA 3S55A 1NJ5A 3WB1A 2Y99A 1JW9B 1L0BA 4CEJB 4QDJA 1LKZA 3K70B 1IN7A 4K6HA 3T7RA 5DGCA 3P5BA 3PC8A 1W5EA 1CYEA 4O29A 1C9KA 5JW6A 2ZULA 3FNGA 3P9RA 3COYA 4OAQA 5MGNA 3VNUA 4ZOBA 1U8FO 2GZDA 3UT5A 3EASA 2WJYA 2M6KA 3ESYA 2BAGA 4JT8A 4YRGA 5FJJA 3BWCA 1LLCA 3BEDA 3G49A 1U8YA 3NRJA 4D3FA 4F4DA 2C4WA 1QH8B 5DB4A 2CB0A 1VLJA 3PHJA 3HY3A 2GEJA 3KWFA 2ID4A 4DR6B 2P35A 2X86A 2Q07A 4UASA 1QNFA 1TU0A 4X1KA 5BNFA 1YDMA 3HUUA 3OP1A 4W5OA 3Q3HA 4HDSB 3AM5A 4OIFA 2MR5A 4MAAA 3IV7A 4R51A 5FUVA 3HXQA 4J9VA 2GNAA 3AUAA 5KS2A 1SHTX 3AKEA 3JVVA 5FTNA 3GVIA 4D3DA 1YVUA 5KPDA 1U04A 3L3BA 4Z9AA 3OJWA 4REQB 1J2EA 2OTCA 4QPCA 5DM4A 3WNDA 3KZMA 3C3PA 1MQ8B 2J31A 2PUFA 4ILKA 2WSLA 4MV8A 4HNTA 4IJWA 3Q8XB 4BB5A 3P2JA 4MR7B 4X1OA 4MI9A 1EP9A 3URMA 3W3AD 5F9FA 3QW4B 4R68A 2ZUBA 3C7AA 5E6UB 1K88A 4QJ3A 1LUAA 2VUSA 1FP4B 2XT6A 1P7ZA 1T6BY 5LU8A 1HV8A 1AK1A 4KW7A 3VBCA 3FIJA 4GE3A 5IWAB 1Z3IX 4LE0A 5AJTA 2FUNB 2AF3C 13PKA 2B78A 1WUJS 3CWZA 4J2TA 3HEBA 4PTZA 4RLSA 4WN3A 5KAPA 4Z49A 1IBCA 4LV6A 3RTEA 1GU1A 3NBMA 4CN9A 2ZEJA 1T1RA 3KT0A 3B38A 1U28A 1E61A 4PLFA 4QM6A 2RCNA 3N2EA 3HABA 4G0UA 1T9GS 1E63A 1GPDG 4P4GA 3WGUA 3FMPB 2VC2B 1ULSA 2QVXX 2P0AA 2JVJA 3UY4A 2XMCA 2P5YA 4IX9A 4KITB 1V25A 1EFHA 1PTKA 2NXJA 4Q9NA 3LVFO 3ROFA 5ES4B 2XW6A 4XGKA 3VHQA 1QTNA 4X41A 5HQJA 3E3LA 3NJ4A 1NW7A 5DYGA 3T5CA 1YUNA 3EIUA 3IPYA 3MYYA 2Q9BA 3PC8C 1DHRA 3G88A 1OH8A 3GXBA 1PE0A 3ZY6A 3ITDA 1CZNA 3KUCA 1R66A 4LBVA 3ND5A 4IJ6A 4EA9A 3P0HA 4GL2A 2XYGA 4QJ5A 1RXSA 4F5DA 3FRJA 5FTMA 1NW4A 1QMGA 1V6SA 3ANTA 3HL0A 3M4NA 5DM0A 3N2KB 1IH8A 1XTJA 5HCIA 3WGVA 3ZWKA 5PNTA 2HCTA 2OXFA 3SMVA 3X1YA 3WWDA 4KQJA 3O4RA 2PKQO 2BKVA 1LBSA 4PLZA 4RVGA 2JBWA 4TXNA 1KNXA 4Z1MA 1FJXA 3BWMA 4HAWA 4EJ6A 3E9EA 3VPSA 1ZP6A 3ITKA 2JIOA 3IAHA 1F2DA 3FGZA 3VAZA 1HLFA 1I5EA 4AZ3B 4L2IA 1WS6A 4NQRA 2Q5FA 1MB3A 3PR2B 4WY5A 4AQYB 4WRRA 2PXCA 3HKDA 2DJ5A 2BGRA 5KNDA 1CQZA 1Y4AE 3HO8A 2Z5FA 3V1KA 1FYFA 5AD1A 1WXGA 3OKCA 4RESA 3WLFA 5JISA 4JLDA 2UUPA 4AVYA 5C8YB 4DL9A 2AV6A 2GFHA 4RSRA 2ORYA 1DKMA 2AOTA 1TI7A 2RK6A 3VR6H 4A6PA 4PCLA 1OWNA 3WKEA 4B73A 4YT2A 4JYZA 6ABPA 1BCRB 1HOTA 5AHRA 4JWKA 3WOVA 1T9HA 1XO1A 3NT5A 2GHRA 4O4IB 1XDWA 1R3DA 3V7NA 2PKYX 2I76A 2R4QA 4P93A 4RH0A 3PX2A 1FYDA 5I7EA 1PNRA 2WSSA 1UPUA 3K2BA 3SPXA 2NO5A 1UM9A 3JWPA 2JFVA 3DW3X 1EJ2A 4CV2A 3TLAA 3VZRA 3HCNA 3KKOA 1XUOA 2C5AA 3QITA 5G4KB 5C34B 5K6RA 1KI6B 4TRRA 5JCXA 2QVZX 5B7GA 1J5XA 3EHDA 4L16A 4AJ2A 2FN4A 1YVDA 1NF2A 4WASA 2ZIUB 1L8OA 1R74A 3MD9A 2PRSA 4TM7A 4WZAA 5I7SA 1LTQA 1FF9A 3MGCA 3ORQA 4RTJA 4E4TA 3C7CB 2Q3LA 1U28C 3AHFA 4AP5A 3SLGA 1W0KD 3MW8A 3PT9A 4Q1FA 1S5PA 3VPGA 3AB3A 4LC9A 2PX0A 4G24A 4WLVA 2GFQA 2BRUC 3HCWA 4FT2A 5FWYB 4CT4B 2XADA 3VYRB 1B8PA 4QICA 4UNPA 1UJ5A 5A71A 1U0EA 4G4JA 2NSYA 1KMCA 3F7NA 2XWJI 4L07A 1U63A 1RMYA 2O7NA 1T0PA 4N40A 5HFAA 1ZGAA 2P6PA 2V3WA 3GJXC 3PC7A 4RD4A 4GVPA 3FB4A 5KYUB 2XODA 2HUNA 2WWWA 4B3DA 4C6RA 1EXWA 3D4LA 4R41A 5JIBA 1UPBA 4C5BA 4EBBA 2WQ6A 3L9WA 1AB6A 3ANMA 2EP5A 4LRXA 1A50B 2PH5A 3G6WA 4H16A 3CNEA 2ZR7A 3JASA 4ND1A 2GTPA 1ZRSA 3H5VA 3WIUA 1BDJA 1UQTA 2X8LA 3T5BA 4R1TA 1PZHA 2ZREA 3COZA 3K2QA 1TTQB 4CE6A 2XTZA 4ZVPA 3SKYA 1UFVA 1CJMA 1RXEA 4YVFA 5I3CA 4NP6A 4ESVA 4JL8A 3O7WA 3Q8WA 4EK9A 3ME5A 2ZSIA 3E0XA 3D8SA 3OQHA 4O8ZA 2Z8XA 5K0FA 3ISTA 1EYZA 2XCQA 4DYDA 4DB4A 3T1VA 4BB6A 1ZJ5A 3CT4A 3ZVKA 1WBDA 3KAPA 3PDIA 2PBRA 1GUFA 4RWEA 5IUJC 2B2NA 3PA6A 1N6LA 3HSKA 3K73O 4K0KB 4BV2A 3P0IA 5B1IA 4BVBA 1NVDA 4DFDA 5JFOA 2FMHA 1SCUB 3C85A 2FHSA 2GK3A 1Y3AA 3K09C 3PS9A 1ZL0A 4Y2VA 1TE2A 3V1TC 1EWTA 3WXBA 3P5SA 3L1IA 1MJFA 3AVTA 1UKYA 3ABRB 1Z34A 2V7EA 5AKZA 3LYUA 4YAUA 3B6MA 2A67A 3PUIA 4ID9A 3F5QA 1E7SA 1MX5A 5AT1A 4AS3A 5IFKA 2RK4A 3OF2A 2PX2A 3WLKX 2IV7A 4KYVA 4HGYA 3AJDA 2WM9B 1C7RA 4XB1A 5EKTA 4HADA 3EN0A 1UFRA 4E22A 2IA5A 3EC7A 3PXUA 3LX5A 3UENA 2WIKA 1CHDA 3AHGA 2BFCB 2QZZA 2AFHA 2ZITA 3K5WA 3X1ZA 5HJEA 5G02A 4KQKA 8AT1A 3T3PB 5K4GA 1OX4A 5DSZA 2JGLA 1ZHOA 3D0RA 2GNOA 4JHLA 1A9ZA 3B36A 4PTYA 4XH9B 5BUQA 5KYWB 4FWIB 1VSUA 4FP9A 1Y1TA 2ZSKA 3K05A 1BG6A 1Z5ZA 4K1XA 4NJMB 4FKZA 4MLCA 4OTZA 4U7FA 4GMHA 3V2HA 3P2IA 2E55A 4GKVA 4IY1A 1CZOA 4G8JA 4CEHA 1NZDA 3EY4A 2DH6A 3G0GA 1KMHA 1PFGA 2P7HA 4IMJB 4MYSA 4D81A 4E5MA 2ATXA 3WAKA 5KVSA 4U63A 5L4LA 4R3UC 1M34A 2W2PA 5M2QA 4IXDA 3V4LA 5ITZA 3Q8MA 1BHQ1 1EFUA 2CNWD 4L08A 2WUDA 1A4RA 4FYWA 5LVAA 3FYUA 2CK3A 3BFPA 3C6QA 4CJXA 1FLAA 3K9NA 3AYXB 4WKBA 1MMFB 1WV0A 4TL8A 3LLSA 5KMGA 1SHJA 1TGYA 1WCWA 4B9AA 3UW3A 4K81B 2R85A 1LTHR 4KBFA 4CV3A 4EW2A 3WSTA 2JEOA 1Y3CE 4LYYA 2FEAA 5BWCA 1VGQA 3AINA 4JASB 5DI3A 3L0SA 1HDEA 5ILGA 4KTTE 4C03A 2GAJA 2D62A 1L9XA 5CM9C 3C1TA 3WJAA 1EUDA 1YS1X 3HDGA 4WJKB 1CRZA 5FV4A 4UTNA 3U1BA 3HXTA 1SVKA 4LQCA 1NMYA 4LDNA 2BBOA 2V6MA 1QUEA 2RHMA 3YASA 2FSSA 3UV6A 3A6HA 5CITA 4M1EA 4M89A 2OXTA 2LBPA 3LHSA 1M2JA 4FMBB 4AT1A 3QE3A 2P6UA 1B41A 4N0MA 3X44A 2XEXA 1FFCA 1YOVB 1GGHA 2Z8YM 3ICPA 3JWGA 4FZJA 3C8DA 1GCIA 5BV7A 3RUFA 3U4QB 5AOVA 1QRSA 1OKKA 4JOCA 3HADA 4F9GA 5BWLA 2GJAA 3P2OA 3WBBA 1DO8A 3D7MA 5JCOC 4LJSA 4BRWA 5CYGA 1STOA 3FDJA 3GG2A 3FPSA 3DE0X 1DRWA 1NUAA 2AB0A 4IUCS 4J43A 4BAUA 1WHSA 2OESA 2FJPA 4B9EA 3LW7A 1SBCA 3PVZA 1TTTA 1Z22A 1K6EA 2WV9A 3PQ5A 1KEEA 3EAQA 1L8LA 3WDKA 3VSBA 2ZYGA 5AW8A 1QFYA 4L22A 3KU1A 1LI7A 3K1YA 1W7AA 10MHA 3L0CA 1TAQA 2WHPA 1HFKA 1DWPA 2EW8A 2BSXA 3JATA 4MCJA 4TUYF 3IAS6 3ZOZA 4B3JA 3EXFA 5K8JB 2DYKA 4ZHQA 2P9YA 1YTUA 2OUKA 3IRVA 1DAIA 2EZ9A 3OP4A 4EGFA 1UEIA 1DTSA 1JIJA 2A35A 3F67A 4KDEA 3OKAA 3QX8A 2H0QA 3LNTA 4LJ8A 1ECFA 4FBMA 4ISBA 3Q6NA 2PYIA 2Z2JA 4WY8A 3LECA 2ZRGA 3FCOA 3FVWA 3PXDA 2OK8A 4P1ZA 2NVUB 3EHEA 2PK3A 4DG8A 3S7TA 5C7LO 3AEQA 3RNLA 4CTOA 1IJEA 4DILA 4IZ6A 4ZC8A 3F71A 1XF9A 3BD9A 5AJUA 5EJEA 2G40A 3NT4A 1OV4A 2PZLA 3C41J 5ALLA 1C3LA 4EJ0A 1PBNA 4G36A 2F00A 2OV2A 3VC3A 3BEOA 4EAAA 4C89A 4YAWA 1VM6A 1EAMA 1SC1A 4X8MA 2J5RA 2NOAA 3ZWOA 1CTQA 2E49A 2I3DA 2J9XB 4LF4B 1TT5B 3TDKA 3K1JA 3K6KA 1J20A 1M2WA 2PS3A 3BJZA 3KQMA 1VG1A 2G5CA 2JA2A 4AD8A 1XCMA 1MB4A 1PL6A 2V5UA 2XMBA 2AMJA 3U3MA 1VL2A 1K0UA 5F23A 3RGGA 1KL7A 3DEHA 1WULS 4OHWA 3QEAZ 5IT9A 3Q12A 5KNBD 3PEYA 3FYUC 3K2IA 1SCDA 2C59A 3MM4A 3PNQA 3QNMA 4HDNB 3FG9A 2W48A 1XQWA 2HWYA 3E8SA 4M98A 4L4UA 4XUEA 5F9HA 3E58A 4I6EA 4HKTA 1DEXA 3I01M 2ZS7A 3HBJA 1LPPA 3ZHRA 1QHYA 1U98A 2D4HA 4RF2A 1MVNA 2Y68A 4Q6WA 1NN5A 3GDWA 2CLCX 2GARA 3JZIA 3TG2A 1XRMA 4YP6A 4M9SA 1RQNA 3FZNA 1JQKA 3GXOA 4KE6A 3S5JA 3C48A 2X7HA 3UG6A 1TD9A 2NUPA 3ZJ4A 2X13A 2WU8A 1Z35A 2QU7A 4IHQA 1CX9B 1M8JA 1VL5A 4WECA 1BGWA 4BC1A 5JMTA 1SHUX 2R8ZA 4LRUA 4ND5A 1L5OA 5J2TF 5JZMA 1QGOA 2K87A 2V9CA 3V3KA 4YJHB 1RWMA 5CIYA 1FYWA 4O8CA 1YB5A 1Q19A 6LDHA 6PFKA 4EHJA 2XA2A 4CMGA 2QN7A 3IHWA 3RHFA 3R7SA 1J1IA 3TJMA 5AM3A 1SBZA 3OG9A 3OCCA 4M9XA 3RT9A 4UTVA 2RHBA 2Y67A 4LGVA 5CFZA 3F8SA 5B7QA 5DW3A 2CNNA 1JZSA 4R1LA 4RWZA 3PVCA 4QLBA 5KTYA 4FXOA 3B8EA 1YMVA 3SYNA 3UBTA 2LWIA 1U94A 2ZCVA 1PSZA 4MA0A 4WFQA 9LDTA 4DY4A 2YWHA 4LDAA 4DUGD 2VEDA 4PZEA 3ZYCA 5BVHB 5KWJA 3GROA 1K6IA 5LL6P 3VTFA 4CM9A 1R27A 3BN3A 3IB6A 3NKLA 5JRZA 4ZREA 2VT7A 5G0WA 2PBFA 4NAHA 1V37A 4F45A 2XWSA 5FPPA 1FUKA 1KKLA 1Y3DE 4DV3B 4MK4A 1NVBA 4CIBA 1K3FA 5K8TA 2D8AA 2FUKA 2POQX 1FY2A 2HHCA 3FNQA 3SYKA 2H59A 1AE1A 4LJLA 3ELBA 3ZZ0A 2ES4A 1Z4NA 2AN9A 3RVNA 3MTGA 2B9EA 4JR2A 1TA9A 2EWWA 4DCSA 3U4GA 3O4VA 5IRCD 2QV7A 1U8XX 3UUGA 2ST1A 4AIIA 1WXIA 4RZQA 1LDGA 5BNWA 1GCGA 4JI0B 5BW5A 4EIWA 4DBVO 1MC5A 2BHNA 4Y30A 5B1HA 2ZIXB 1KZ1A 4COOA 1C1XB 1W85A 4ZVTA 4U7WA 3GRYA 5D5QA 3DAGA 1KQGA 3IX7A 3Q7RA 2WYVA 3AX6A 3O8OB 1G0OA 3R75A 3V48A 2JIBA 4DUZB 4EX7A 4RMJA 1W6UA 2N47A 2O2EA 3CNHA 1YVEI 1ZH8A 1NFRA 5TVKA 1VCOA 1O8CA 5IBPA 1XV5A 2F3UA 4TMXA 3WAJA 1G1MA 2V5AA 3HCOA 3R3XA 5CFPA 3SJZA 1AQNA 2PSFA 2I4MA 2MSCB 1QKKA 2P75A 3IIJA 4O4HA 5DP2A 2VH1A 3R7FA 1RYFA 3VZCA 3GLIE 1A3CA 4DWOA 5A4DA 3OQOA 1KO5A 4IW3B 1F8UA 2XTAA 2JLUA 3TTSA 4E32A 1TCVA 5IDQA 1RM0A 1XIVA 2PMKA 3CLTD 3GY0A 1MPTA 3RLFA 4B2LA 4D2IA 1K9SA 4FNGA 1VPTA 2V1UA 1JDJA 2HDWA 3BMNB 2CMHA 1G6KA 3KQPA 5HOEA 1QHHA 4PYQA 3UVEA 4A10A 5DOVA 3G59A 4B2IA 2C9DA 2XUQA 4S1OA 1EB9A 4RTKA 2I78A 1A8HA 1MO2A 2YWBA 2JGIA 3CRMA 1E7QA 2KYRA 3W8FA 2XMPA 4PG5A 1IHUA 2C4UA 2GN2A 3GNSA 5KOIA 2AFIA 2EHDA 4IIUA 1K3UB 2AZ4A 2FLKA 1ZFNA 3JSXA 3LCCA 3HPRA 1VPLA 3NTUA 1XU9A 2Q5CA 3OC0A 4CFZA 3EGVA 4MAFA 5FA8A 3PE4A 1UC5B 4KHPB 2H5IA 2YOFA 5HS6A 3TXAA 4GDMA 4EY6A 4QO8A 1PS8A 3ZKWB 4UU1A 2JI9A 4Q82A 4BJ3A 1A7UA 2FWNA 1BDMA 4YDRA 4DA7A 1I5OA 4CF3A 2LVBA 2OCLA 2BM1A 2WFMA 4DG9A 1ZGJA 1WMAA 1PZGA 5LDHA 1Q5PA 1WTAA 4A03A 4PRZA 1Y80A 3THSA 4DANA 1TECE 1S6YA 1RYHA 2Z4SA 1J5EB 1CV2A 1B8NA 3QLUA 2C8KA 1V1MB 3L7NA 3NQ41 5DIFA 3GEPA 2UZ1B 4MVJA 4AWXA 3G0OA 2MWMA 2JRCA 4V0MA 4V0QA 5E3HA 2DKOA 2O23A 5DTEA 4HDKA 1ACLA 2NO1A 2Q2OA 1J90A 3Q87B 4TQUS 4L4ZA 2JJ2A 2BFFA 2JKVA 2GCPA 2X23A 3PA8A 3S28A 3GQBB 4D5EA 1Z0JA 2X7JA 1FSGA 3Q3JB 1TIBA 3A1UA 4QYXA 1N6KA 3QXHA 4NAVA 1ZD5A 4WHMA 3S1AB 1PSWA 2BFDA 2AW3A 2FQXA 4HEJA 3K6SA 4D9GA 5TQVA 4ZJZA 1TLTA 1I94B 4JLJA 2HRDA 2OBFA 2I3ZA 2C5GA 5F51A 5FHQA 4EHBA 3KYIB 5JD4A 2BFBB 1O9BA 3QVLA 4HX9A 3TJZA 1KU0A 1B4DA 2JH8A 3HBAA 1P1BA 5ETJA 1JMVA 3MIZA 3GGDA 1U6IA 4NBKA 3KOWA 1UIRA 4GX1A 4F5ZA 3GGCA 4WGFA 5ECGC 4UNIA 3LQ1A 3S2EA 1G7SA 3BGIA 3STHA 1DKQA 1EFPA 4CUKA 2MSDB 4AK9A 2TMYA 1JTVA 4FLFA 4HYTA 5EMHA 3IEMA 1DEHA 1WNTA 1I0IA 1EZ1A 4UZEA 6Q21A 4D74A 3UG7A 3I92A 4GM4A 1L3BA 1X14A 1UEJA 5CGQB 4OHOA 3VR3D 2UXBB 1CDEA 2BFWA 4KQMA 2RGDA 1TCBA 4G5GA 3LGSA 3FZEA 1L4FA 4FNMA 3SD7A 4DCOA 3BFKA 3PK0A 4F91B 2FPPA 2WFZA 2Z08A 2QM0A 2ZJBA 2E87A 3FSJX 5CB4B 1ZVJA 5AW1A 2BFNA 4Z4EA 1MIOA 4GOJA 1I3KA 2OFOA 3ABIA 5A0FA 3SDBA 1P45A 3ZJVA 3W1VA 4I50F 1GL6A 3D6NB 5DBIA 5DLYA 1ADYA 4WCDA 3UJ7A 3R7LA 1GM5A 4KFRA 2OHGA 2YW9A 1LZKA 2QQ0A 3KB1A 1CY2A 1C3EA 1MT3A 1SBTA 2J1LA 4YAOA 3WYDA 3I72A 3U5TA 3ZU5A 2YWJA 4UNSA 1T2AA 3G9QA 3H9JA 4MCAA 5K3EA 5KHLB 1YZTA 2FEWB 4OXKA 4BX0A 2FE4A 4YYEA 2O05A 1JG7A 1VE7A 4XWGA 4YRBA 2O8CA 4R9NA 3I6YA 1SFRA 4PGGA 2XMSA 1I36A 3ED5A 3FNBA 4JBLA 1Y6ZA 3HGMA 3SIXA 4EFLA 1QO0A 5JRDS 1RR6A 4TV8F 1C14A 1RNLA 5ITVA 2ZSDA 3G5UA 4KXLA 3OX4A 1HEYA 1N3BA 1HRDA 2CVFA 3F3MA 1OVGA 4HEA1 4D9EA 1PFWA 2J67A 4CEIB 3SXUA 3HUEA 2X7XA 1BFUA 4D0RA 2WSIA 4EYSA 1LFDB 4BP9A 3DF7A 2C8JA 3RYCA 5IBCA 1OXVA 2AQ8A 3C3WA 2QRNA 4JJEA 1LPNA 4OBXA 2GM4A 1NQAO 4EF4A 1PG2A 1PGQA 3TTTA 1XZJA 4RZIA 1WSDA 1T8UA 2ZJ5A 5CLLA 3AR7A 4YBZA 5ED0A 1JXMA 5J1SB 4GYWA 1CETA 4OQFA 1TUEA 1NP6A 1RYYA 3EFEA 1IIRA 4FGSA 5TQ0A 4BO0A 4BE4A 4V39A 2VHEA 2RAVA 3E9YA 3LIPA 1GLGA 3IAS1 1JWAB 2VBCA 3AVYA 4L7VA 1L5LA 4AJNA 4E3WA 4Q66C 1DL5A 4BNUA 4JXXA 1IEWA 5EA2A 3VHRA 1A5ZA 1COWA 2AN3A 4BMZA 4DSNA 1J2YA 4R7TA 2DBRA 3LWDA 3ZE0B 4HN2A 1IEXA 4RTRA 4L15A 2WWFA 1RRFA 2YRFA 4RSGA 1YZNA 2PUEA 3RKUA 1W5FA 4LMAA 2BFOA 1V35A 4FFSA 3TQIA 1J07A 3CONA 3ZXYA 3I9NA 1YJAA 4LOJA 4O2BF 5FYDA 1L4YA 1ORWA 4MMXB 3ZHXA 3OFND 1TK9A 3LX8A 4XWTA 4KR3A 3IP8A 3PFHA 5JADA 1JQLB 3VVCA 3RI3A 3R0XA 4BO3A 2CZQA 4MLPA 3H0CA 2HLHA 4GQBA 5KQPA 1CY8A 3NRBA 1SVUA 3QENA 3QM1A 5T8KC 2E4ZA 4POAA 3CCFA 2GZMA 3TLGA 3QIAA 3NWEA 2QG9A 4K9PA 3D6JA 5CH3A 3WB2A 1E64A 1ONPA 1UWVA 4XGIA 5LXTF 3UAZA 4D9FA 4IGIA 3DOUA 5CBPA 1JHQA 1JWBB 1XZKA 1VPVA 2DUMA 1NA5A 2HYDA 3EZ7A 3HR4A 3UKOA 3VQTA 3NBUA 1L6RA 1VGRA 4QPDA 2IZ7A 4ZVNA 1J9ZA 1MW9X 1XQ6A 1W2WB 2RHCA 3HBFA 3NIBA 1FUIA 2HMYB 1HQYE 3F5SA 2VDKB 2ZQ5A 3LSYA 1TO6A 3MVEA 4G89A 4KWTA 3P0RA 1WPRA 4MKFA 3WV4A 5HIAA 1D0SA 3DOEA 3M3PA 4AICA 2H2IA 2ZDGA 2HI0A 5IASA 3I6BA 4PS0A 4N76A 2YV1A 4IBOA 4X5OA 5B37A 3CLHA 5G4LA 1IM2A 4BFSA 3EC2A 2PJRA 1FBTA 2XJ4A 3DJFA 3FPGA 4TMFA 3RIYA 4EGQA 4C88A 1XD2B 2H06A 3N59A 2EDAA 3AHEA 3GCXA 4TM8A 4CM4A 2RC5A 4ZT7A 5IH7A 3OZWA 3JQ9A 1WBBA 3TFOA 2HEGA 3H5OA 3QHAA 3HACA 4MYDA 4AZVA 1OZ0A 2EZ8A 3VJRA 5SYNA 1CUAA 3DXZA 3JYPA 1L1EA 2PV7A 5BNIA 3WLQA 4UUMA 1K8QA 5IUNC 4GU5A 1XTTA 1YRLA 4M55A 3OX2A 2QPLA 1RLIA 4Q3AA 3CUVA 4ERXA 2JFHA 3QUAA 3W04A 4DDWA 3H6HA 3OSZA 4IVRA 3CNNA 4P4SA 4AULA 2PE5A 1YJCA 4RPJA 4MKXA 4ZI7B 2GBCA 1Z4IA 1A9QA 1IXZA 1G55A 2TMKA 3KB2A 4X91A 3G2HA 2NU8B 2HCJB 2G0TA 3WP1B 1RMQA 2HSEA 3VI3B 1GL7A 2PH7A 3GZNA 1EE1A 4FFWA 2BR5A 1XLTA 4N5IX 5AI6A 4OK5A 4E6PA 2WQ7A 3I04A 2D06A 1PUIA 3N8DA 4R3WA 3EWIA 4KQ9A 4LJ7A 4QIHA 2AWOA 5EWMA 1GVNB 3FLAA 2HW8A 5A0TA 4XGRA 4ZYLA 5I8ZA 5GVSA 2HF8A 2JD0A 2ODBA 5EUQB 2PT6A 2JI8A 1BGXT 2PKQP 2W37A 1OBOA 5J1TB 3CH5A 4KXFB 1KI8A 3B1WA 1U8TA 3A4MA 4LEIA 3VH2A 2ZXUA 4KPYA 2A92A 4EUSA 2X2FA 3QEMB 2IOFA 5SY4A 3OTOB 2PCJA 3N53A 2YY5A 3B1YA 3FZYA 1N2JA 4OG2A 2QYTA 2ZOSA 5FTJA 1SIOA 3X43A 2D00A 2HEIA 4OLBA 2QRKA 1NQOA 4UM8B 4MUBA 1FSSA 2QUAA 3U62A 4RIHA 3HCPA 1LBTA 1DUIA 2XIQA 4F7WA 1HF3A 4KFTA 1U2GA 2OAP1 3G2IA 3MJVA 3FTFA 3BWEA 1TQHA 4MUJA 3L79A 4NBTA 3IL2A 3BFJA 4R5MA 1FIUA 2NUTB 2PJUA 2ZYDA 2PX6A 5BN4B 2H2GA 3DWFA 3GFFA 3CPJB 3CZCA 3UB2A 4IFEA 2ZRLA 4BFWA 1DBWA 1YU6A 3AGQA 1VP9A 2VF5X 4QDZA 2O1WA 3ICVA 4CBVA 4DBLC 4HL6A 2FSGA 4WXRA 3HCFA 3I73A 3O8DA 2VUTA 5GINE 3QOWA 2BELA 4C01A 3QUBA 1V41E 2ZYUX 1MDFA 4Q4LA 4IZHA 3KJZA 1H0SA 4TL6A 1L7BA 2IYNA 5AK4A 2IBMA 2ZJ0A 2IYPA 3I61A 5E95A 3GA7A 3GB9A 4I4NA 4YMUA 3BD6A 3UOWA 3UT5B 2MCFA 2FWMX 5LIRA 2CSUA 4NEGA 5JHGB 3KQWA 3OSUA 1CUFA 1SZDA 3I9KA 4A0GA 1EWYA 1X8KA 1JYSA 4D9NA 1JG6A 2VLBA 3D7KA 1KDRA 5A6VA 8ADHA 1DXYA 1XALA 3WK4A 3VH4A 4V24A 3DVRX 4CV0A 4B82A 5JS1A 3PFIA 4G9BA 1E6MA 5E2BA 2I54A 4D43A 4TVSA 1GTSA 5FOXA 2LR0A 2C99A 4FONA 3F5FA 4OXQA 2VAXA 3CZRA 4R4JA 4QGGA 4CTKA 3GNTA 2HJHA 2XA9A 1VP3A 3LGXA 4LXTA 3M1AA 3D64A 4AP6A 1Y34E 3A1WA 4Z1MD 4C6HA 1HWYA 5K0NA 4EWLA 3OZBA 3DFUA 1FMCA 1WDWB 2PGNA 3OZTA 3D4PA 5FNVA 2NG1A 2QW0X 3DFIA 5E9QA 4XVCA 2ODAA 3K3PA 4W5HA 3A4TA 3DOFA 1PL7A 3VTAA 2PKEA 1YB1A 2YHSA 1N6NA 2J87A 5J4KA 5KNDD 5IJXA 3EF1A 3ZVRA 1V1JA 2NZ2A 1XLTC 5EMKA 3U7RA 4C21A 4BE7B 4HXFB 3M6XA 3O8LA 4FJ1A 1VRWA 1DT3A 4LHYA 4YJ2A 2OG1A 2ODQA 2PA3A 4H1VA 4MVYA 3DE7X 4G26A 4W7HA 5LYYA 5I9IA 1QHSA 3ZIDA 3ZGXA 4GXQA 4UOEA 5B3LA 5AR1A 2ZCJA 2C84A 3HJAA 2NV6A 3EA4A 4UAGA 2F1HA 4QARA 3HU1A 3EVTA 4Q1DA 1XZDA 5GZ6A 2FA9A 2RHLA 4ATNA 2I2CA 4B6OA 3HO1A 2FW6A 3I0MA 2X19A 1NE2A 3MCVA 4MW6A 2D7DA 4KH0A 2W58A 4XVRA 4UATA 3LP6A 1E6UA 3N2LA 4S35A 1S4QA 1Z7BA 4ZGBA 2JLQA 1Z2PX 3FPEA 1GPYA 1ISFA 3HV0A 3P9PA 5AFSA 3JW8A 3OJLA 2BBSA 3RC9A 4MUEA 2JFYA 4ITRC 1U2GC 1UKBA 2EG9A 2H4HA 3DHNA 3NHLA 4KC0A 3LT1A 4TTJA 4BQPA 3WGGA 3IMGA 4P35A 2V55B 4YMLA 3DB2A 3DCYA 3O2NA 3QWFA 2G5GX 3F6CA 3K31A 5J4YA 3ZIAA 5AM4A 2BR3A 1C5KA 1EDDA 1X2BA 4WACA 3U4DA 3GEGA 3K8QA 5HMLA 5FRDA 3SYLA 2Y9PB 3HY6A 3MMNA 3AF3A 5AKXA 3BGSA 5MDHA 4UUAA 3T4XA 1U2DA 2WD8A 3NHPA 2OO7A 3BTUA 4MUGA 3KR0A 5ALYA 2RHHA 3CS3A 4RENA 3NCHA 4NDNE 3HJRA 2ZDHA 3DPUA 4EARA 1GR1A 2RGNA 3OMLA 4KWCA 4GPZA 5ECDA 4B4UA 4KMRA 5A06A 3H0EA 3IDAA 3WJ7A 2DFKB 2SKEA 3OCZA 3A8TA 4M88A 4N4AA 2K7ZA 4NBRA 4YONB 1IY0A 2PNJA 1OCEA 4D0GA 3DQQA 4TSKA 5L40A 3PQCA 4R54A 1C7FA 2P5UA 3R77A 3K32A 2EKZA 1FFDA 2Z8ZA 5B3AA 2NQ2C 4Q7KA 3GIDA 5A2GA 1NW8A 3DP7A 3OZAA 4L2IB 4NCAA 3M82A 3RB8A 3ZU4A 4O5AA 4BCDA 1VBFA 3WK9A 3VFDA 3MINA 1NMEA 3U3JA 3HXKA 2G9ZA 2L19A 2FI1A 4LRWA 4U6NA 2ZUUA 5LA6F 4CL3A 5IMBA 1UKAA 2KS6A 2O2DA 1C8KA 1E2LA 3GEHA 1ZD3A 4Q18A 5FTKA 3UV3A 4F6LA 2QQFA 2FXVA 2AOTB 3CFYA 3UJPA 1SG6A 3ZK8A 1Q50A 2AC7A 4J8PA 5BR8B 5FX2A 1YR7A 4TZTA 4TS9A 3MIIA 4HQFA 1YIAA 4QE3A 2HIGA 3S1SA 1ITZA 2RB5A 3DZDA 3LF2A 2O59A 2Y76A 3HHEA 3S68A 2BE7A 3OMXA 3PNSA 4MHOA 1UM9B 3TEJA 4EFMA 5BR1A 4OMUA 1HK7A 2ZSEA 3JWIA 4BO9A 3WHLA 2XIJA 5IXYA 2TMDA 1T2CA 1LZLA 2NW6A 4IIEA 3HN6A 2RG7A 5GIPE 2A88A 1JUDA 1S1MA 4PAWA 3AL2A 2B69A 1WWKA 4I46A 1U3GA 5G0TA 1A95A 1P77A 3PI7A 4YA6A 2JCYA 2P3SA 2PRJA 3O5AA 3MMXA 5EJIA 5JCOA 2CNBA 3GN1A 1RPTA 4LZOA 5D7BA 4NU8X 2VDNB 2FJ0A 5KTPA 2CL5A 1N7GA 1WB4A 2QAJA 3HWWA 4YCDA 4BMCA 3LVRE 5ELLA 3PR1A 2QWXA 4ZT2A 4H7IA 4N8DA 4UEKA 5TRTA 4CIYA 1NNUA 2NU7A 3S44A 1PR0A 1NZFA 2VSFA 1EUYA 2H11A 3F6SA 5C1OA 1Z33A 1KOGA 4QYIA 1E9EA 4NCNA 1HYQA 1N6PA 2XE4A 2WIDA 1SURA 4URZR 5ALWA 4A9AA 5DJ5A 2XI4A 1F2TB 3CVYA 4O4IF 1PQWA 2H5JA 4B31A 2EW2A 4UBLA 1Z6GA 3L1KA 4FQ5A 3WO0A 2I1QA 4JVSB 2G71A 2R4TA 3BRWA 1R5OA 2CK3D 2QAIA 4IILA 3ZWCA 4BAGA 2P1DA 1TD1A 1GNRA 1L4BA 1U1GA 4PC7A 4AUKA 5I7RA 2GKGA 4RLFA 1DOHA 1TK3A 1JFVA 1A2OA 1LBHA 1OGIA 1RM5A 2ENWA 2D1RA 221PA 2GAIA 3CGGA 2I4LA 3IUJA 3JASB 1TCCA 4JYMA 4PIVA 3S5UA 2IELA 4YRIA 4JOQA 2RGNC 2NYVA 3TLMA 1Z4MA 1X77A 1FLNA 1KDZA 2FY8A 1QZTA 4D57A 3DBIA 3E2MA 4P7FA 2OAEA 1NVWQ 1J21A 3GLGE 2Z9CA 2G04A 1MAVA 1W46A 4N18A 4EABA 1T0JB 4OH1A 3MAGA 5HE8A 1RAEA 4YTEA 3HYNA 1WMFA 3AI3A 4XYBA 2FZKA 4E12A 4K46A 2J3KA 3FVVA 5IZCC 5J3JA 2PUBA 3PDIB 3CX7A 3I64A 2FETA 1JDSA 4JI3B 1ID1A 4YFYA 2G80A 3TRHA 2V4ZA 3DBLA 3MMZA 4H4EA 4K9OA 1EINA 4AKIA 3ADPA 1X8JA 2IKSA 3A1EA 4KXQA 2Z2YA 2R8PA 5CDHA 1JKFA 1NJ8A 3RSZA 4F86A 1WDMA 1BRTA 1MRNA 7GPBA 3GAFA 3TAHA 1YNSA 4NIMA 2GDZA 2NQTA 2A9OA 1G4AE 1I1HA 3KPWA 4WI1A 2GHTA 2HFKA 1FX0A 2A5YB 2YVKA 3BCHA 1RZRA 2HBQA 1RZVA 2VXBA 2V8BA 1MN6A 3WGNA 2XRZA 2AE2A 4OGGA 1ZRHA 1S3SA 1MO6A 1UP7A 3CZMA 4I9HA 3T7DA 4UXHA 4O3FA 4OSEA 4R1QA 1YR2A 2AFHB 1OYOA 3H5RA 3KQHA 4QYWA 4ZOLA 1OX4B 1HT1E 3LUBA 2A94A 1Z8FA 1SXQA 1KY2A 3NOVA 2O8DB 1H3FA 4TTPA 3EGEA 3AUKA 1IVNA 3D3EA 3DCJA 3GWGA 1TIPA 4C0HA 1NBIA 3A3NA 1Z37A 1EFRA 1HDXA 1T1SA 2DE0X 2UYQA 4DLLA 3LWZA 1CUXA 1Z38A 3AZOA 4J9UE 4C4SA 1K7XB 4FGUA 1KMHB 1XE3A 3HA3A 4H4CA 4RJ2A 3WYGA 3CUEF 3V00A 1X0XA 4F7DA 1M34B 4QT4A 4QKQA 5ITZB 2TYSB 1NP7A 1OXUA 4Y1GA 3STUA 2YIDA 5SICE 1PJ4A 4GICA 4NPCA 4QUBA 4QRDA 1LRKA 4ZP1A 3S6JA 2NZVG 1FS5A 1R9GA 4DXAA 2Y2VA 3FOAA 3V8NA 3GUCA 1LSOA 5LR6A 1T0BA 2J6CA 5KDLA 3NDBB 4U2GA 5KHOC 3CGWA 4QAJA 3UHPA 2F9MA 2O0LA 4DZZA 2D3TA 1FW8A 3TMAA 1M1ZA 5DI3B 2FQYA 4JCOA 2WLSA 1XVAA 2DH5A 3LZDA 3BHIA 4MQFA 5AYVA 4AMZA 4EB3A 3GVCA 3B3JA 3TZHA 4C4YA 2Y0BA 2FQWA 5LC1A 2ZYWX 2RG1A 1JILA 4QJIA 3FSRA 3GJRA 1JF8A 2H9IA 4NX2A 2HHJA 1PYGA 1IBSA 1Q1GA 2YUIA 3BA1A 4UCQA 4WLEA 4CKCA 1Y7LA 4IPTA 1P73A 3KOOA 3IT3A 1JGTA 2P0EA 2HAEA 4OHMA 2J3MA 1BWSA 4ITVA 1QDEA 2QA5A 3MGBA 5TF4A 3D7RA 2UZIR 2VRBA 3P9KA 5B55A 2PWZA 3RVBA 5AIAA 3WL8A 4DDUA 3LY5A 5EZSA 4BMVA 5AXCA 1MJ5A 2I9PA 5LBTA 2QAGC 1RRVA 4K6FA 1H4TA 2ZAYA 1LCIA 1DQRA 2AQIA 3L01A 3ETCA 4OHBA 3R9KA 2W2LA 4BTEA 4LCBA 3ZZMA 2OT3B 3ND9A 2LDBA 4LN1A 2FYTA 4CMJA 1WHSB 2IF2A 4H15A 2BVNA 3QVJA 3C45A 1JDZA 5H83A 3H2YA 1KEEB 2XBUA 3IILA 3Q3EA 4QO7A 1QRUA 3N8KA 1NNEA 1T8TA 1D1TA 1M1YA 5HDBB 2Q99A 4AMYA 1B0PA 2F1IA 2I7CA 2WHPB 3NGLA 5LDGA 8MHTA 3JATB 4RADA 2M32A 1UMCA 5K2OA 1O6ZA 4ZHQB 4JI7B 1J8VA 1VLZA 4ZRNA 3QX3A 4XYLA 4FFRA 1MAUA 2PKXA 1GU7A 1OYYA 2AKEA 1HM5A 2BKUA 721PA 4MW0A 2ZP1A 4PPYA 3IQEA 1E2BA 2XUKA 4NV1A 1UBGA 2IEGA 3O2JA 5L95A 3U26A 1XA4A 3EW7A 2NSDA 3U6KA 5DXAA 1P81A 5BPFA 3DNMA 1DIOB 3AEQB 5KUTA 1LJ8A 3OQPA 2IK8A 3BMOA 3TMKA 1W36B 5P8WA 3RFXA 2YJNA 3W9YA 2QMUA 2BOVA 2NUAA 3DMPA 2AJLI 4X7PA 3VM6A 2YASA 3W9SA 4DT1A 2A3RA 2IYVA 1PHRA 4M9QA 1UXOA 3W7VA 4Z6KA 3LBFA 1MPXA 4IFBA 4QOJA 3JQ8A 4L85A 4D0LB 5JXHA 4FU0A 3BSSA 5KNLA 4M0KA 4M7OA 3O94A 3X2FA 3NEPX 1XBTA 1KJJA 4CPDA 1E62A 2XGJA 5CK5A 3WL5A 5IHPA 3SZRA 2AQKA 3SX4A 3D5QA 3S3TA 4R0MA 1WKBA 3V2UA 4GFDA 3OPNA 3BK1A 3HH8A 4UTRA 5JD5A 2ZT5A 1XXLA 1CP3A 1KYQA 2FFRA 1XVVA 1OQAA 1HMYA 1RQRA 1XVLA 1T6NA 3JPWA 4E1AA 3OZGA 3U1TA 4Y2TA 3QVGA 3LXRA 2YV5A 1JT9A 1DDGA 1YS4A 2IEYA 2XZTA 3NTLA 3R7BA 4BFVA 1P74A 4EHAA 1QQ7A 3CEHA 3ITNA 3KKZA 1TQ8A 3E4CA 5LYJA 3DNPA 3SQLA 2NUPB 1B42A 4C7BA 1P1IA 4LYHA 4XIGS 4B3CA 3GVXA 4DEXA 3EQ9A 4DJFC 3AFNA 1OW3B 3HB4X 4B0PA 4KYUA 2VG8A 3I34X 4D8TA 1R50A 2G06A 4ZN6A 1CJUC 5JWHA 4A26A 3BL5A 4ZT5A 1SQ0A 2IYXA 1SCAA 3DBRA 4LRYA 5H3LA 2RBKA 4GRDA 3ZDRA 3JARB 4B44A 4BFTA 5B2EA 4LXYA 2CYAA 3T5DA 1WP9A 5LQSA 4FB4A 1H2RS 9ABPA 3WGYA 1G5QA 1NM5A 3EARA 3RD5A 1NW6A 1NLYA 5EWLA 2P3OA 1Z5OA 4NYIQ 4GC9A 4C0JA 1OLUA 1QIGA 2AD1A 1QVZA 1U3TA 1TMOA 2PFGA 1MUUA 3KUUA 2PO7A 4G3XA 4OF4A 1C3VA 4OXRA 5E0KB 3P9SA 5H16A 6AT1A 1KKUA 1QVRA 2VO1A 4I4LA 3U31A 2OCGA 4GX2A 3TX2A 3UXHA 3OD5A 2ZRQA 4DC9A 3HB0A 4MVJP 4U9IS 1QBKC 2H1HA 4J4BA 1NJGA 4JN6B 3D8BA 4UMFA 5CLQA 2AK2A 5AW3A 1RS0A 5G41A 1A9PA 2VYVA 1ODSA 4Z0PA 2UUBB 6GPBA 3OLXA 3OURA 2QQ5A 3H5AA 3PUYA 4IVQA 2GD2A 2HA7A 4LNAA 4Y3UA 4OI0A 2XB2A 4AUMA 1YZQA 1O95C 4YMGA 1OYWA 2EL7A 1NBWB 2E48A 4EMUA 5CYOA 3VPHA 1GDHA 1XZ8A 3G23A 4HDOB 3WNZA 3AF2A 3GPIA 3MOGA 1IE3A 4EAQA 1ISGA 2FKAA 4MWSA 5A04A 2QR3A 5LZ5A 3H6GA 2V6BA 4Q12A 3KKKA 4MVJD 3SF8A 3VVMA 1Q2XA 1M2HA 5JO0A 4J0IA 4ODIA 2CLEB 4ZJYA 2L2QA 1JYEA 3LBAA 1SUCA 4H18A 3EG9A 1BD3A 4S1WA 4NBLA 4RABA 3TIVA 2XZPA 4HUQA 5BWMA 4RD0A 4JI8B 2JJ2D 3OFJA 3NTQA 1SBHA 1QONA 2VNIA 2Q4EA 3MBIA 4D25A 1E1DA 3L5OA 4AZWA 4AB1A 2Q8QA 4FFBA 5TPWA 1EX9A 2ZRHA 3RG2A 4F11A 1OA1A 4JOSA 1J5PA 2P9QA 5CX1A 4E30A 4EPRA 5I7VA 1JEYB 4C1BA 1TVCA 1GUDA 1EH5A 1VYUA 3OX3A 3U9TA 1U5AA 1W4BA 1Z13A 3BGVA 4YAFA 3IDQA 4O4HB 2ZRCA 4YDSA 4EZIA 4FOTA 3K1TA 1CRQA 3L4KA 3CRRA 1EJ6A 4XB6B 1NE7A 1C0IA 1X7YA 2PMFA 1LLUA 3HEMA 2GAOA 3KB8A 3P2KA 5DM2A 4XUCA 1EU1A 2X42A 4W7IA 4UDOA 1H23A 1V7ZA 4LMPA 4LZPA 2I22A 2WU0A 2A6PA 3AFOA 5GTDA 3G0HA 1QHHB 1U2TA 2WK1A 4CM1A 3EDRA 1NQXA 1I7SB 2OORA 4CM3A 2RGRA 4AF6A 1K8XB 1UK9A 3IVXA 4IFTA 1JHPA 3PGJA 4RKFA 3CLRC 4DSUA 2AFIB 2QN8A 4WLOA 5TIIA 3DKPA 4JEMA 2EGUA 4FYJA 3SF0A 3STTA 4V03A 1MC4A 1QTRA 2JI7A 1N5DA 1P6UA 4ML3A 1F6BA 5DIZA 3RAFC 4WL0A 4WOCA 5HKKA 3O8QA 1IC6A 2BI4A 5C4MA 1UXKA 3ONFA 4QHTA 1YASA 4MCHA 4OXXA 2GRJA 3D6MA 2QIPA 1NT2A 1R4ZA 2HX1A 3AJEA 2YN0A 3DT9A 4QTZA 2V59A 3PNYA 4CI9A 4G4IA 1CQWA 1UIMA 1OZAA 4FILA 5FR1A 5CLFA 2XTMA 4PYIA 3TQFA 1HFJA 2UZAA 4G4GA 4M1QA 2X3YA 1CDZA 3M6IA 5BQOA 2XUIA 1K8ZB 1W2HA 4Y1FA 3UAGA 1GUAA 2OB1A 1EGAA 2V98A 4JYBA 4G8CA 2WC1A 1DWOA 4ENWA 1JSRA 4MJXA 1E6WA 1AKEA 1IWBB 1ZD2P 1E0SA 3KZ1E 3QMPA 1QB8A 4M1OA 5J4VA 3WAGA 3O8CA 1UPTA 3UT6A 3GUUA 4X97A 4JAVC 4NESA 2EBFX 3EVNA 2OCXA 5K0ZA 1YT5A 5A03A 1VG8A 1Y7TA 1XX6A 4ZVMA 1VKHA 4LVCA 3RSLA 4BIMA 4ENSA 3U09A 4XVQA 4Z4IA 2KM1A 4HDKB 3U2QA 2JF0A 3ZU3A 1QO0D 2PTHA 1RI3A 1CBUA 2BFFB 3IO3A 3JRNA 2WIAA 2BFMA 4NCJA 1E3DA 1NR5A 4O33A 3WKCA 3CX3A 4PG7A 2ZU0C 2D5IA 3NHYA 5H68A 1TJ4A 4HNRA 5CXQA 3DMTA 2BFDB 9LDBA 4A4DA 5BORA 1HE2A 1ONNA 4AP9A 2IDMA 1L4NA 2PQ2A 3RVMA 4H1TA 4MLZA 3BKWA 1L7RA 1IUPA 3HM9A 5CX4A 5B6PA 4KQCA 3COVA 4RKEA 3V42A 5MHTA 2VN8A 4OXYA 5KBYA 4XLTA 4P53A 2XBMA 5AJVB 4WOKA 1I4EB 3D6UA 3W6NA 5ALZA 4JFAA 2QTTA 5L6MB 4I55A 3DOJA 3KS9A 5AQEA 1DQSA 4PICA 3TNYA 1VFNA 3B2NA 4HBZA 1XKQA 4LI0A 1MORA 3TKAA 1YBAA 4HZUA 3SNKA 4HB0A 1HDGO 4EGAA 2X8JA 1EFPB 4A0RA 1PUXA 3MQ2A 1COWD 3P20A 4D44A 3MT8A 2CFOA 4QTTB 1FNCA 1W47A 1NYRA 2IHUA 4LZAA 2OXIA 2EFJA 2YXPX 2C77A 3JQEA 1KFCB 2REOA 3B5IA 4QEDA 3SYTA 2C88A 3RVRA 5E9AA 3SG0A 2ECKA 3IALA 2XUHA 4DRYA 2RGYA 1E3MA 2XCLA 4QXOA 2PAFA 4X1YA 4EFKA 2JFNA 3KE8A 3AV0B 3VH1A 1IPFA 2Q4DA 2QXYA 1GQ2A 3ACDA 4JB2A 3UV7A 3ZHYA 1U2QA 2ZTUA 4BBPA 5JH7F 3A2KA 4HPWA 2FPPB 3FUTA 3IUMA 1DARA 2PX3A 4Z2AA 1KAQA 4IF4A 1CF4A 1PGNA 3ON5A 3IEIA 4ILEA 4BECA 4LY6A 5IAAA 1YB2A 3DKVA 5IDXA 5BRNA 3TS1A 2O57A 3U13A 2XH8A 2ZFUA 4IICA 4RVHA 4Q4AA 4EYQA 2FLVA 2QBYA 3CH4B 1M83A 3DQZA 3ZWNA 1N77A 1G2QA 3CMMA 3PWTA 4OFZA 4QXMA 3LUDA 1TJ5A 3FETA 1QR6A 5JSHA 4EFNA 1T5SA 4A2WA 2H3HA 4I3GA 3RHSA 4NH0A 1W4AA 2O8CB 1N5OX 1Q0PA 4PF1A 5EESA 2IU0A 4LF5B 3EUAA 3TNDA 3KYBA 4FW9A 1Q1QA 3IBSA 1V7CA 3N2NA 1DSSG 4LYAA 4U9HS 1DEOA 4EB0A 4OBWA 3EEOA 3I5YA 3PITA 3EOZA 2PGAA 1V8FA 3PQ2A 2Q1WA 1EHCA 2G83A 3SXUB 3UF0A 4UFPA 1D2GA 1BE1A