2XYRA

Crystal structure of the nsp16 nsp10 sars coronavirus complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
286
Chain Sequence
QAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPRTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Analysis of the Sars-Coronavirus RNA CAP 2'-O-Methyltransferase Nsp10/Nsp16 Complex.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Transferase/viral protein
molecule keywords PUTATIVE 2'-O-METHYL TRANSFERASE
total genus 95
structure length 286
sequence length 290
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2xyrA00
4E30A 3C3PA 1DL5A 2BR3A 2FYTA 4KW7A 2EX4A 4QVGA 5LQRA 3FUWA 2XYVA 3I64A 3LBFA 4G56A 1NT2A 1UFKA 4RVGA 4E2WA 4HTFA 1SKMA 1KPHA 3OZTA 4OQEA 3LCUA 3KQWA 2NP6A 3UJ7A 5GINE 4RVFA 4XUDA 3GRYA 4V0RA 2B78A 3HA3A 4EMSA 5LQKA 2A14A 4MWZA 5E1BA 5H02A 5T6BA 2DPMA 3Q87B 2OB2A 4GC9A 1NKVA 4YUZA 2GB4A 2QM3A 4Y30A 5M5BA 1VBFA 1H1DA 3Q7EA 4O29A 3PVCA 5E1OA 1AQIA 4HGZA 1NE2A 1P91A 3I5UA 5CCXA 3GNLA 2EJUA 2P3LA 2PX8A 2K4MA 3NTVA 4PYQA 5DSXA 3A27A 1VE3A 4GQBA 4OA8A 3UJ6A 4RTMA 1TW3A 3HCFA 2ZIGA 4KIGA 5LQCA 3FUTA 1YFLA 2IDJA 2I7CA 3GRRA 3R6TA 3K0BA 1SVUA 5E9JA 4CKCA 1X1CA 2EJTA 4AX8A 3PLAE 4C08A 5FA5A 5F2OA 2ONYA 5CM2Z 5KS2A 5KYGA 1QANA 1G38A 3SXJA 5EMMA 1D2GA 1VL5A 3GCZA 4HH4A 1NW6A 4WXHA 5P8WA 1KP9A 3VC1A 1VP3A 3KR2A 5C0OE 1X1AA 1XDUA 2KW5A 3T0IA 4B17A 3OU6A 4F85A 1Q0SA 2FCAA 4AUKA 2O57A 4C05A 2HTEA 5K01A 3I9FA 2O05A 4E33A 4ER5A 5IKMA 1NV8A 2AOTB 1ZGAA 3BWYA 5HILA 2WA2A 1I1NA 2EG5A 3LDFA 3DR5A 3FTEA 1YZHA 1FP2A 2AR0A 1O9HA 4CWAA 2WK1A 3T7SA 3F4KA 4C04A 1NW7A 3QOXA 3HCBA 1X1DA 2ZIFA 4FSDA 3OPNA 2Y1XA 3UJAA 1XDZA 3P9KA 1AF7A 1RJDA 2ADMA 5DX0A 1ZGJA 5EEHA 3DH0A 3CGGA 3ELYA 3GDHA 4C06A 1FJXA 2BH2A 2GPYA 2G1PA 3M70A 3TKYA 4ER6A 1F3LA 4PINA 4KVZA 4P58A 3ANXA 5DTMA 2PT6A 2ZVJA 4L7VA 3A25A 3SMQA 1R00A 2G8NA 3NWEA 3G2MA 3G2OA 2JH8A 1Z3CA 3KHKA 5FCDA 4DM3A 3HVJA 3DUWA 5ICGA 3TMAA 4YV2A 3OE4A 3GU3A 5CCBA 1EIZA 1VIDA 3PFHA 3P2KA 3CJQA 2PLWA 1YUBA 1JG4A 2YXDA 3CVOA 3OZRA 2AN4A 2GAFA 3LHDA 5DXAA 5ICCA 2Z6AA 2VDWA 3THSA 4GUAA 1Y8CA 2YR0A 3UJBA 1WZNA 5T67A 2IPXA 3FTDA 4BP3A 1SQFA 2YVLA 5EHIA 1NW3A 1V39A 2ZIEA 3EVZA 1B42A 1JQDA 5HIJA 5DLYA 3T7RA 5HOQA 1NBHA 1ZQ9A 2B25A 3GJYA 5CVJA 4LWPA 1M6EX 4EQZA 4U7TB 5F2NA 1WG8A 3R24A 3HA7A 3KQQA 5DWQA 5F2KA 3HNRA 3PFGA 4GOOD 4E2ZA 5D1HA 2FK7A 2YXLA 4FZVA 5EG5A 2AN3A 1I4WA 3JWGA 1AQJA 2H11A 2IBTA 2VDUE 1FP1D 2JG3A 3KPUA 5EMJA 5DPMA 3NDIA 2PX5A 5K0NA 2YTZA 2P7IA 2CWWA 3ELWA 2B3TA 1RJEA 3ORHA 3E23A 5DX8A 2P3QA 2ZFUA 4HGYA 4QTUB 2OYRA 4RV9A 3UFBA 2CMGA 2OPBA 3FUUA 5C1IA 4ER0A 5HZMA 1KYWA 3KQYA 1Q0TA 2Z6UA 2PKWA 7MHTA 1QAMA 3BT7A 2IP2A 4PCAA 1G8AA 2NXJA 3SX0A 3JWJA 4GOMD 3V97A 2IH5A 1BC5A 1L3BA 3EVAA 4X61A 3U81A 4RVHA 5CUQA 3DULA 5BP7A 3SR4A 5E2BA 1BOOA 4YUYA 5K0JA 2C7QA 2NYUA 1INLA 3EMDA 4CTKA 3P97A 2UYCA 5E1DA 4P7JA 4HC4A 2VDVE 3IYLW 3MB5A 5KQSA 2OO3A 1F38A 1ZHFA 3DTNA 4OA5A 1AV6A 3KQVA 3MAGA 3A4TA 3LSTA 3SSNA 4IV0A 4UOEA 5E8JA 1TW2A 3EVFA 1G55A 3FPHA 3LPMA 2AOUA 4YV0A 2DULA 5DM2A 3LL7A 3G7UA 5FHRA 2GLUA 3FPJA 3OFJA 5T64A 4PYOA 5FA8A 4QDKA 3FRIA 4JXJA 5GWXA 4C07A 3P9IA 3UJCA 3EEOA 2ZZKA 3DMFA 2JH9A 3LBYA 3O7WA 4R6WA 2NP7A 2P1DA 1XJ5A 2PVCA 3HVIA 3MCTA 3GXOA 4E2YA 1SG9A 3HVHA 3PB3A 5MHTA 1FPQA 2AOVA 4P7GA 3WSTA 4OX9Y 2ZZNA 3H2BA 4H0NA 3FZGA 5JR3A 3JWHA 2AOWA 4X63A 5D1NA 2P3OA 3TQSA 2YUIA 4CKEA 10MHA 4R6XA 2VZ9A 1NW5A 4OBXA 3GWZA 3M4XA 2V7EA 1UWVA 5CVVA 1KXZA 3A26A 4KDCA 4U7PB 4RTPA 2IH2A 3P9NA 3FTFA 3MCZA 4HSGA 3SGLA 1MJFA 3EGVA 3HCEA 5DM1A 4MHTA 5EIFA 2C7OA 4DF3A 3B5IA 5HEKA 3O31A 4P7KA 2QE6A 4F86A 5K0GA 5LQAA 4MTLA 2IIPA 3R3HA 4Z2YA 5C9ZA 3EVBA 3HM2A 2AVNA 3FUVA 3FYCA 2P35A 1JG3A 4X1OA 4RTQA 2UYHA 3G5TA 3EVEA 5EKXA 3GO4A 1G60A 2QYOA 3C0KA 2PY6A 2ZSUA 2OB1A 4QTTB 4RX1A 3M6WA 1WY7A 1ZKDA 2GH1A 2IBSA 1R8XA 1L1EA 3TKAA 4ZTBA 2ZLBA 3RIEA 1NW8A 3LCVB 4IV8A 3LGAA 3DXXA 4PGHA 1R6AA 5EMLA 3UA3A 4POOA 1DCTA 1X1BA 5FHQA 3EVCA 3NVKI 4M36A 3TFWA 4E31A 4YV1A 3EVGA 3C6KA 3NVMB 4BLVA 3KPJA 5EIWA 2P8JA 1RI2A 2CMHA 1D2HA 3P2IA 2YXEA 4KIFA 2O0LA 1KR5A 3KQMA 1KPGA 3C3YA 5CVUA 3SSMA 4BLUA 5K0BA 3A7EA 4BP1A 4QDJA 1JQEA 1UIRA 4YUWA 4E2XA 2NXCA 3O4FA 3JWIA 3AJDA 3BKWA 2IDKA 3EGEA 5DM4A 1DUSA 1RI5A 2HNKA 3P2EA 1YZ3A 2PXCA 1EAMA 4LG1A 4QVKA 4GEKA 4RTNA 3V8VA 5GM1A 4OBWA 5GM2A 2HV9A 2AS0A 2F8LA 3CBGA 3R0QA 4RVDA 5K09A 1D2CA 1ORIA 1R8YA 2XYRA 2VS1A 1QYRA 1L3CA 4PYNA 2PWPA 1EJ0A 4PYIA 3VYWA 4M7RA 3EVDA 2AOXA 2Q41A 3HCDA 3KR0A 5EEGA 2H00A 3EEYA 4YUVA 2OXTA 3MTIA 3C6MA 3MHTA 2ONZA 3HTXA 3TOSA 2P41A 3KPWA 5EQJB 1O54A 4PYMA 1T43A 5DT2A 4FR0A 4CXMA 2ZULA 3E05A 3OU2A 3KR1A 1SUSA 5EVJA 4DQ0A 5U4XA 4HG2A 5ICEA 1R74A 4C4AA 2YX1A 2JJQA 3KR9A 5EPEA 1WS6A 4X41A 5EMKA 1JR4A 4FS8A 3TM5A 9MHTA 5FUBA 3FPGA 3M6XA 3NWBA 4PYJA 5EHGA 1KYZA 2PJDA 2PXXA 3THRA 1YFJA 4GBED 2I9KA 1JTEA 4RTOA 2JHPA 5HIMA 3S68A 3DLCA 3OCJA 4PIMA 3MQ2A 2E5WA 1SQGA 4YMGA 1QAOA 3LX6A 5CVDA 5LQJA 5LR6A 3EPPA 1PRYA 3B3JA 2NNWB 3G8AA 1KHHA 3QOWA 3B3FA 3DXZA 4HRAA 3G8BA 4DCGA 4KDRA 2R6ZA 2PXAA 4ATNA 2ORED 4IKPA 2LD4A 1L9KA 1XTPA 2AZTA 3CJRA 4RTJA 1BHJA 2NXNA 4KRGA 5EZSA 5ICFA 1P1CA 3RW9A 3DXYA 2FK8A 3DMGA 4PWYA 4A6EA 5DRYA 4F84A 1N7IA 2HMYB 2BR5A 2CKDA 1N7JA 2FRXA 5E1MA 5DTQA 3REOA 4AZWA 1YF3A 1QZZA 3BWCA 4RTLA 5FULA 3X0DA 1KPIA 3HCAA 3UZUA 2UZ4A 3VSEA 2AOUB 3IV6A 3BGVA 2ZBPA 4PGGA 1EG2A 4PYLA 3LECA 2JHCA 3TRKA 2R3SA 3HEMA 1BKYA 2PT9A 4RTSA 2PV0A 5LQUA 2P40A 4NECA 5K05A 2ZW9A 3AXTA 2ESRA 2I62A 3MGGA 4GC5A 3UWPA 3E7PA 5K8VA 4AZSA 4HTFB 2B2CA 3B7PA 5E8RA 2UYQA 4AZTA 1XDSA 2PBFA 5FWDA 5LSAA 5BW5A 2ZCJA 3AXSA 3TLJA 5GIPE 4M38A 3UA4A 4C03A 4M37A 3ER8A 1O9GA 1IY9A 3G88A 2GS9A 4PIPA 4EK9A 5HIIA 3KQOA 5GOZA 1FBNA 3GIWA 1WXXA 5KVAA 1JG1A 4ER7A 8MHTA 2I6GA 1NBIA 2PWYA 3FTCA 3KPVA 4WVLA 4CTJA 3I58A 4RTRA 1G8SA 3FPFA 4ER3A 2V74B 4QQKA 3ELUA 5CVEA 1N2XA 1IM8A 5DTRA 5DX1A 3TM4A 1TPYA 1EJ6A 3KU1A 4E70A 5KQRA 4PONA 2ZWVA 5FTWA 3SSOA 1M6YA 5CIYA 4QQNA 4E32A 4BLWA 2IH4A 3HP7A 5GIOE 1HNNA 3P8ZA 2G72A 2G70A 4AZVA 1ORHA 1ZG3A 4EKIA 2BM9A 3OU7A 1VP9A 2O06A 5K0LA 5K03A 2ZZMA 1XXLA 3ELDA 2P7HA 3IHTA 3TPZA 2BR4A 1RI3A 4YUXA 3B3GA 2WA1A 4Y2HA 3PT9A 3A7DA 4XCXA 5EC8A 3VC2A 3R9XB 1KIAA 1P1BA 5JUWA 4DMGA 2ZWAA 5LQNA 1JSXA 3DP7A 3GRUA 1QAQA 5E9WA 3ER9A 1EQAA 2OZVA 3G5LA 2G71A 3LDGA 3L8DA 3NDJA 4EKGA 5BXYA 2C7PA 5GP1A 2XBMA 2XVAA 3FRHA 2Z6QA 1NV9A 3M6VA 3PX2A 4ISCA 3UJ8A 4OQDA 4CKBA 5DRTA 4A6DA 2QRVA 2FHPA 2VP3A 4KWCA 3UJDA 3G2PA 2OBFA 4QPPA 3LDUA 3FYDA 5DXJA 3BZBA 2N47A 4YMHA 4XUCA 3ERCA 3B89A 3DLIA 1VLMA 3E8SA 5FQOA 3KQSA 4FT4A 4P7FA 3PTAA 1OR8A 1PJZA 3AWIA 3ME5A 4R8RA 2ZBRA 3BGDA 4XUEA 5G02A 5B1SA 4EVIA 4PCLA 5K0EA 3CCFA 3KKZA 4DZRA 1JQ3A 1VPTA 2ERCA 3LCCA 1SUIA 2BZGA 3SVZA 3HCCA 1JG2A 4RWZA 3UBTA 3PX3A 2C7RA 3G2QA 3M33A 2O07A 3GGDA 4X60A 5FQNA 5DM0A 4GOLD 1XCJA 3LKZA 2QRVB 3EMBA 2OY0A 3CC8A 1YB2A 4V0QA 3IEIA 3M6UA 3TR6A 3UJ9A 4PNEA 3FPEA 5HIKA 5K0FA 2GA9A 3KQPA 4LECA 3BUSA 2IGTA 1X19A 1RI1A 3P9CA 3K6RA 2YQZA 5EKUA 3EGIA 2B9EA 3MERA 5ERGB 1IXKA 5E9QA 3PS9A 4RYLA 3MTEA 3QV2A 1JTFA 1U2ZA 3OE5A 4BY9E 2H1RA 4IWNA 3BXOA 3RODA 3CJTA 5EZQA 1RI4A 2AN5A 1G6Q1 2PGXA 1XCLA 3NJRA 5BW4A 5K0CA 1WXWA 3FUXA 5EGSA 4R8SA 4DA4A 3HA5A 5EOVA 1MHTA 1JSZA 3HVKA 3ID6C 3NW9A 5E2AA 2PX4A 2BM8A 2XYQA 2Y1WA 3KQTA 4FSXA 1P39A 4R05A 4GOND 2IFTA 2AVDA 3D2LA 2NXEA 3NMUF 2PX2A 4FT2A 1RJGA 3DOUA 2QY6A 4GF5A 2ZTHA 3LKDA 3P71T 4LWOA 3GRZA 3BWMA 2AOTA 1L3IA 2PSSA 5CD1A 3BGIA 3AY0A 2CL5A 3KPYA 2HR1A 4MIKA 3OFKA 4RTKA 4K6MA 1RJFA 2EFJA 4QPNA 2FPOA 4DCMA 5HFJA 3BKXA 4FP9A 3T7TA 2UYOA 2JHAA 3SM3A 4MQ4A 5IH3A 1XVAA 3GRVA 2OKCA 2ZBQA 2HWKA 3G89A 3I53A 3CKKA 1R18A 1HMYA 3OZSA 5DSTA 5FADA 5FWAA 4DKJA 1M0EA 3DMHA 4FGZA 4RSRA 3BWBA 4PYKA 1VQ1A 1I9GA 2XVMA
chains in the Genus database with same CATH superfamily
2P77A 1B76A 1FNSA 2ZRJA 3JZAA 4QVGA 4YRPA 3RTGA 3SF0A 2OP0A 3H5IA 4PPYA 3HMQA 2O2CA 3NTXA 3RU2A 4CETA 4B71A 2VZ8A 3QBTA 1ISJA 1M3SA 3VHRA 2NP6A 1RAFA 2H07A 1YFZA 1EBFA 1T15A 1GL6A 3DPUA 4LHXA 1P2TA 3PC6A 4FCCA 4GI5A 4X7PA 4YUZA 5ILOA 1Q20A 1O96A 1SBCA 3D2BA 4WI1A 1FX1A 2CWDA 1FVXA 3KT6A 1TKRA 2CUKA 2N9UA 4W5TA 2JCVA 2F1RA 4HGZA 3K8QA 5T4HA 1R50A 3F78A 1ELOA 4NRDA 3GEPA 2XQKA 3TAXA 2WP8J 2DFVA 3PDIB 4JKIA 1HSZA 1GQFA 3GP5A 2JEYA 4MVYA 4RESA 1ABBA 4Y9RA 2DVMA 1KGSA 2P6NA 3DTVA 3HLYA 5FLYA 3VH2A 2OV6A 5F2OA 4BX0A 2C4MA 1KS2A 1OAAA 4I6EA 1WTCA 4RF4A 2VA9A 4WK0B 1E6EA 2Y0BA 3DTVD 2O14A 5A3VA 3U39A 5KWSA 5JAHA 3VHLB 3AOGA 1ZJ5A 2RC5A 3VYSB 4UCFA 3TOXA 1E9FA 3E58A 1CNMA 1ZONA 4UHFA 1JV2B 5K3FB 5KHOC 5A2QA 2Z0MA 2N46A 3WMRA 3KYJB 4E33A 1IPHA 3O2SB 5D7NA 4PRZA 1B6RA 4IG9A 2Q3HA 3CVUA 3UAYA 1TKBA 3CLKA 4G1BA 1XLTA 5AVWA 2FSVA 1G2OA 1LB1B 5U1PA 2JANA 4B84A 1RPZA 4Y2PA 4GI2A 4OD0A 1K0UA 1UFQA 2J5KA 1G3QA 4FSDA 1UKZA 2GNAA 2Y1XA 4QGHA 4D99A 5C5CA 2KB0A 3A10A 5GIPE 1QVAA 1AF7A 5EJ5A 3W5CA 3V1MA 1KDOA 4EG6A 3BL8A 2AI2A 1RAAA 1DO8A 1ZGJA 2WHXA 4Y6GB 4Z9YA 2ZB3A 3CGGA 4TRJA 2ZROA 1WZEA 1IN6A 2QAGC 4G9BA 4C06A 4ENRA 1FJXA 1GKLA 3H7AA 3KO8A 1BXGA 1NM5A 3QLUC 4Y6OA 2IOYA 2VHYA 4IRUB 4JL6A 4ACBA 5AOBA 4W7SA 2ZVJA 4S1OA 3BQMB 1G20E 3SMQA 2FDCA 3L0IB 3BVPA 4H7KA 1JYEA 3P94A 4INPA 5KTRA 2IXEA 3HVJA 3FNFA 3VDMA 4YV2A 4A10A 4R7ZA 4QJ4A 2CV1A 1XU7A 1L7OA 2J5RA 2YC2C 4QWWA 2QRMA 2EEPA 1GGKA 2PMBA 2X8LA 3AMVA 3CVOA 1W4BA 2F8MA 2G17A 3D6VA 3LHDA 4IHQA 4JU9A 4OBBA 4Y7DA 2Z6AA 4BIIA 2WWXA 2FI1A 3BE8A 4TQGA 2QJWA 3WRXA 3I1JA 2FCRA 4MAFA 2FZ4A 3ET4A 1BE6A 1YA8A 2B25A 3U7IA 4OTZA 4OGWA 4LWPA 1FFYA 3GLIB 1ZK2A 3RWMB 1YIAA 4RSGA 2NO1A 3PX7A 3OZIA 3FJ1A 2A5DA 2W6ID 4D9NA 3U37A 3RFUA 1BE0A 3TSCA 5GTDA 1QHXA 5I9TA 3E84A 3QI2A 3WL5A 1HZZC 1PJRA 3EZXA 1O97C 2PX5A 1YL6A 3HV2A 3QYPA 1EDOA 1XD9A 2X8JA 2H5LA 3GVXA 3R0XA 5DBIA 1ISSA 1E69A 3O92A 4HQNA 2ZFUA 2CXTA 3GFQA 3RSOA 4HGQA 5EIAA 2WFLB 1KYWA 2XIQA 3MNFA 2PYIA 1SMKA 2VHCA 1U1EA 1VLZA 5GV7A 3V55A 421PA 1VHDA 4LC9A 3VYRB 5IKEA 3K70D 2GCOB 1CUEA 1ID1A 3EZ7A 5EZYF 3UC5A 1BCSA 4RVHA 4F7DA 3DGFC 5FX2A 1QLJA 1NBMD 2NYUA 3CEJA 3QXSA 2IYXA 5JH7A 3OTOB 2WB4A 1COZA 1XEXB 3QPVA 3VR6H 3V9AA 3IA7A 3COJA 5HJ5A 1LLUA 3AKZA 5HS6A 3IOEA 1UBUS 5ALFA 4OFXA 4PLZA 4ALKA 4BGDA 2NWQA 4K9QA 1OXUA 3GRPA 3R23A 1N2BA 1XK6A 2FPWA 2I78A 2VLIA 4F3YA 1X80A 3L7LA 3G7UA 2NYVA 4ZK2A 1N1EA 1JR6A 3P9QA 5F12A 5GWXA 1KF0A 3MXTA 1VPDA 2XCTB 5LPNA 1EUCB 1UT6A 2HA7A 4D98A 2ZJZA 4DPKA 4R6WA 1R0KA 2C5HA 3K71B 1YS7A 3GJ5A 4UMVA 3TCKA 2GCOA 2EFDB 1T9ZA 3D6UA 1RRKA 2AEJA 1BCSB 3A8TA 3FLBA 3OF3A 3I9V1 3D64A 4X54A 2OQRA 3FZGA 1DQNA 2ZS7A 4DADA 4LOKA 4ZMSA 2W83A 2N1MA 4OK5A 1KZ4A 3S8EA 1E77A 1TUGA 4CBVA 3SQOA 10MHA 2FAXA 2JIMA 1DTSA 3A4MA 4IDNA 1SXJB 1Y37A 3C5HA 3F97A 1G2IA 1O6BA 1VRCA 2PMFA 3EYAA 4E14A 2EBHX 5BUSA 1QO7A 3NEYA 1DAFA 3KTAB 5BRAA 2QZSA 3MM4A 4IQFA 4MVCA 4OFZA 3UGJA 1KI4A 5ELMA 2H54A 4ZVNA 1L1FA 3OEWA 1OYVA 3PQ4A 1BDMA 2HJGA 1NC1A 2QE6A 3IMKA 5TQ0A 3KJGA 3WQQA 4WZZA 4A2WA 2BFPA 4FD3A 5JSZB 3OZFA 2N1BA 5ESWA 5EIBC 2KLHA 4BFSA 2BD0A 2G4CA 2REQA 2ZSBA 4L2IB 4P38A 4B3XA 4E4YA 2F62A 4LXQA 5FTMA 1O08A 2JA1A 3CMMA 2JI8A 4RX1A 3B2EA 2R47A 2QTNA 4IZOA 5COAA 2GJ8A 1RQGA 2ZLBA 4JLAA 4JLSA 4OB8A 3GY0A 2GRAA 4MAAA 4AX4A 4OXNA 1H5NA 1LI4A 4WXPA 5IDVA 2Z83A 2W70A 3JPYA 3KPJA 1U1IA 3PRKE 4FC6A 4NYIR 4YP6A 5TQ0B 1RI2A 1SQ5A 3NASA 5JJLA 3FPAA 2YXEA 4KIFA 4X5OA 4Z4HA 1KPGA 1K7CA 5A4IS 4M0MA 3UVEA 2JHGA 2OV8A 1EK6A 1LVHA 2ANBA 2YW2A 5AHOA 4E2XA 4QRDA 3WLJA 3M5DA 3ZDXB 4E0BA 1A8IA 4NBRA 4U7GA 3BKWA 3QE2A 4IIHA 2DR3A 3F5DA 5CH3A 2X5KO 3B8EA 2O8CB 3CT4A 2WDZA 4ZOEA 1K3TA 1FS4A 3ZJ5A 1VRVA 2IYQA 1NNI1 3HBJA 1NVFA 2CDNA 2HV9A 2QR5A 1NXSA 2LRHA 2R1VA 3H0KA 3HABA 3MIZA 1EGAA 2QD1A 1LLFA 2NO5A 3KD3A 2XYRA 3KOYA 3WLNA 4EPWA 2B1JA 1IK6A 1C4KA 4YGYA 2VDJA 2X3YA 4P31A 3WGGA 1X70A 3QVTA 1IHDA 3UHJA 2QLTA 4GP9A 3ITEA 5B3AA 1FDRA 3TGLA 1T43A 2HSJA 3W2HA 5CG2A 3SF8A 1G3MA 3E05A 2JEOA 3L9WA 1H2EA 3ZY4A 3QEMB 1B8PA 4CCAA 3ABZA 1TJ5A 1Y1KE 3D6FA 2QHXA 4L51A 4OHRA 5FOWA 5FUXA 4KOEC 1OZ0A 4UM5A 4B82A 1TQ4A 1E66A 2YX1A 2EBUA 4S24A 3TJRA 1IULA 1V7CA 2Q2OA 3SS8A 4BUJA 4JR2A 5LDHA 2B1GA 4P81A 2V5VA 2WWYA 1Y8ZA 1GZ7A 4OG2A 5ALRA 1NLZA 4C89A 1QM5A 2LBPA 1XYYA 2H4XA 1BEEA 4KYVA 3THRA 2DQYA 1Q1QA 3LDAA 5JCPA 2HQRA 4GBED 1YFKA 3IXMA 5AKEA 2OYSA 4YXFA 5CFOA 4IIDA 1AKTA 2K6GA 1KXJA 1ZX1A 3S1LA 5CVDA 2IPNA 1FDUA 3EPPA 3DYVA 5KOHA 1PRYA 1ZD3A 1ZVQA 1JLKA 3CNHA 3DEKA 4MKHA 4WLOA 3S0JA 5JAIA 1N2CB 3I45A 1VKOA 2IV2X 3VR4A 4H16A 1O3YA 3O21A 4MPJA 1QIEA 1NDUA 1ECBA 1P6QA 2J5BA 2H9IA 1KSJA 2PXAA 3GPBA 4N54A 1E1NA 2GWHA 1IQ0A 5KBYA 4TRRA 2C1ZA 5TT0A 3F6YA 2MWMA 2XKJE 4PAGA 4AJHA 1CUVA 1SBHA 5H3HA 1E7QA 4F93B 3DE6X 4L8FA 5IAOA 3PXUA 3AF0A 3MJDA 3CONA 1U0EA 5CLHA 4Z0PA 4GVXA 4OGFA 2CKDA 4J16A 4A6EA 4AMZA 1U9YA 4DV1B 3A6LA 5DTQA 4AZWA 1JFFB 4OQNA 2OHGA 4RAOA 2WJ4A 1IY1A 4PRYA 4AJEA 1SEPA 3DEZA 1FMFA 4P8RA 4H77A 1WXQA 3BSWA 4EY8A 2O2JA 2WQ6A 1RC0A 1ECPA 1IAQA 3IKVA 4QXMA 2O8BA 4EGCB 1W34A 3PFNA 5FPHA 4RTSA 4MUYA 1YB4A 3RTDA 3CG4A 5G1NA 1ADFA 1OZGA 3DOJA 4COOA 5CU7A 2VYCA 4BN5A 5CFMA 5IH7A 1ECLA 1M1XB 3O9ZA 5TMDA 1E9BA 1ODJA 1X3LA 1GZHB 3II6X 2ET6A 3P19A 3HR8A 4X0EA 3TRHA 2WU0A 4CM8B 3UOWA 4QULA 2DH5A 3G88A 3PRHA 1KDRA 2GYWA 1QRSA 3EZGA 4DLUA 1OX6A 3IOCA 5K3AA 3RWBA 4QSMA 4Q48A 3AVWA 1TCVA 4MUMA 1JG1A 4C4SA 4MQBA 1OA0A 1RS0A 4GQAA 4WNYA 3TMKA 1XZKA 4CTJA 1K6JA 2BI8A 3I6MA 1XNGA 2V74B 5KX5A 4PEVA 4ZYLA 1QUEA 1ZH4A 1K4MA 4TPKA 5DGDA 4E70A 3ZKWA 1M5RA 5AW1A 2Q8QA 3KP1A 2HLPA 3E81A 2RGBA 4E5VA 4NCBA 4PR0A 1GAXA 2P2SA 2ZQ5A 2CXSA 3SLGA 1ABEA 1T8WA 1H93A 1T24A 2G06A 3NXKA 4C4TA 5L3SB 3SS7X 4ZI7A 3G2KA 1U8AA 4DPMA 2XE8A 4LV8B 3ROKA 3PF9A 3I6IA 2WJZB 4KQGA 3B3GA 3L4BA 4QKQA 3A1WA 2XNDD 4K8OA 1VYTA 3CX7A 3HXLA 4BX9A 1BDBA 1ECGA 3GELA 1JEDA 2ZTUA 4WQMA 5CLGA 5I8ZA 1XJQA 3H6KA 3NNNA 1H8ED 1J8FA 2FQWA 2OBYA 3F5SA 4PSAA 2A7QA 1ZW6A 3CG0A 1A9ZA 4NOKA 3ZWYA 2VC2B 1I4EB 2AYZA 3OIYA 1CY8A 3PX2A 4ISCA 1A50B 4INJA 3TZ6A 4MICA 3B5JA 3QE0A 4A03A 4BLQA 1GRNA 2GZSA 4CKBA 3DP9A 3IBFA 2Z3VA 2OBFA 1EG7A 4NTZA 4ZREA 4F2GA 4W4TA 1KK1A 4TT3D 4ZI7B 3TSWA 4GX1A 4J0CA 2A35A 3A6DA 5FQOA 3RIHA 2HB6A 1NJ2A 3EGDB 4OIMA 4IDDA 2L2QA 3AWIA 4BGUA 1GGEA 2Q46A 4LA4A 1JI3A 4NIMA 3IPCA 4D3FA 1NT4A 1QE3A 2Z2XA 3KKZA 3LU1A 3M8KA 1ZRNA 2Q9BA 4HR7A 5FH9A 3B1XA 1CUYA 1QYXA 2BZGA 2MINA 2IOHA 4ZRNA 3DOEA 2CYAA 4J49A 5H82A 3HR4A 3O74A 4FYIA 2GM3A 4B2PA 1N5RA 1QH8A 1Q74A 4Y2VA 2XVYA 3U60B 3OY2A 4BLOA 1J99A 4DSUA 3AR3A 2ODBA 4N4AA 1XF9A 3LS2A 1ZN8A 4Z4FA 3N2YA 2CMDA 1VHLA 3L4EA 4UVIA 3ORSA 1YOVA 4D4JA 4NXNB 1XRQA 3FMPB 2HJRA 1X8XA 4M8LA 4M1YA 2H1RA 1L4GA 3KT8A 4BE7B 3CJTA 3BICA 3NJRA 4U1RA 4AMVA 1TZJA 1UBFA 1H23A 2QJRA 1WVIA 5JVDA 1IK4A 1AXRA 1NVAA 3AEYA 1N0WA 4KC0A 4OUDA 3RWOA 4EY4A 1Z25A 4K3VA 4UEOA 2C1XA 3LY5A 1W0JA 3GJSA 2P68A 4B3CA 4ZO7A 3G8DA 2O3TA 2ZWOA 4K28A 4ZANA 2JGLA 1ORDA 3CX8A 3NRCA 1RJGA 4QYWA 3R7SA 4ARAA 5LP6C 2Q7DA 3VVMA 4AN0A 4HNVA 1VMAA 5AVXA 1I80A 1YOVB 3QU4A 4MMYB 2IYTA 3ESCA 5JYEA 2OO5C 1T29A 4KIUA 3WJ7A 3NALA 3P9YA 4UC0A 4WL0A 1GZUA 4XCQA 4W8GA 4E1AA 1USGA 4FDUA 1RJFA 4E03A 1KU0A 3L4BC 4ZQFA 1CYDA 3FYHA 3RUHA 1F1JA 1RWNA 1TZBA 2OV3A 5EIOA 1E2HA 4LXHA 5D3QA 3TSZA 2B98A 3D6HA 1H3FA 2CL0X 2FWBA 3AKDA 1JRLA 2JGEA 3L7OA 3G89A 3JAWA 3RIEA 2HJSA 1HMYA 1PQ4A 4DKJA 1T8PA 2XPCA 3HO8A 1HL3A 4EJ0A 4NP6A 1FNDA 3DMHA 4FGZA 3WIVA 5KWEA 4CL2A 3ND8A 4RSRA 2AHOA 1P8AA 3BWBA 1H1TA 1ESCA 5BQOA 4FHGA 5ERYA 1IEWA 4X65B 2VJAA 4GT1A 1DL5A 5LQRA 1RKXA 1ZA2A 2V7QD 2X6RA 3RD5A 5AM0A 4H2DA 5L6LB 3L8YA 4IJ6A 2IYAA 5ALTA 1Q15A 1F2VA 3K5IA 3QVLA 4B80A 3T1NA 2AXPA 3WADA 2DE0X 2MSKA 4I55F 1PR4A 3KL4A 4F8YA 1U81A 1E94E 2H1LA 1Z2AA 2DQKA 3CF4A 4JX9A 2XTZA 1ISPA 2QM3A 3FFWA 1VL6A 3TUJC 2CEAA 2M32A 3HKBA 3WB9A 5AKGA 4DM7A 1VCIA 3HN2A 1EXMA 5C5DA 1YR7A 3EFBA 1B0UA 1REQB 3GFSA 3SJ7A 3VOAA 1GLVA 2DMRA 4ACAA 5T4BA 3C3CA 3IX7A 3Q8MA 1B93A 1HQCA 1GPAA 2WHEA 3QX7A 3SJAA 4OBEA 3PFCA 2FV8A 1RMTA 2BJWA 2WIAA 2FVXA 1YQUA 4DUPA 2MR6A 5DGIA 5FL7A 1WABA 1EX6A 2VUTA 3K3PA 3PLAE 4LZZA 1O6FA 2GPNA 1ZZEA 2OWEA 1EM6A 3ZJUA 1GU0A 4M8NE 2I2FA 4QJBA 3LFUA 4W9MC 2EJBA 3B9BA 2LGJA 2WMNB 4E08A 1CHNA 4GSYA 3CINA 3GEMA 4FGSA 4HZGA 1O8BA 4UCWA 2NM0A 2BKVA 4OO3A 3CE6A 4ZOAA 5L4NA 2Q3JA 1AK9A 5BW8A 3SLKA 1CD5A 4QODA 4MWOA 2NSDA 4C3ZA 5ED4A 1SUPA 4FFBB 1ENYA 1WSAA 8ADHA 3OZGA 1AD2A 1VHTA 2B4YA 2PGDA 3EA4A 3FB4A 2JJ1D 3N8IA 4O1MA 4PG8A 3WWEA 1B8UA 1GYQA 2QRKA 2ZKLA 2UUCB 2VWQA 4Q05A 2BFFB 3ROXA 1J8VA 1QXSA 3L6DA 4JJKA 2JIDA 5JNWA 2WYWA 2V5UA 2Z9DA 4M0EA 4BNMA 3QF7A 4M6WB 4TMFA 5BQ3A 3VPBA 2IODA 1NW7A 3T7KA 2Q5QA 4CMHA 1POWA 4J9VA 1YB7A 1OLXA 3OAAD 1QQ6A 3EA0A 4QO8A 1NVUQ 4ZGWA 3EK2A 2DGDA 3QV1A 1WCWA 4F2HA 4KK3A 1SY7A 2BISA 4JI1B 2YASA 4FFBA 4IJUA 1YJ8A 2HQ1A 1PZXA 4MKFA 4YHHB 1PYDA 4IRXA 3EH2A 2OMEA 3AF1A 4FJ2A 1UFRA 2H2IA 5IT4A 4MP3A 3DLPX 2RCNA 3K2EA 5C7IO 5AM1A 2X4IA 4Y1GA 4KXNA 3QFHA 3CZPA 3KBOA 4GZLA 2XNCA 1U02A 2VFAA 4IIVA 2D59A 3PNSA 3RS9A 5AW0A 3TG2A 1KQ3A 1OLOA 1EVYA 2KHZA 2PLWA 2YJGA 3CEAA 1OTHA 4NWIA 3LQ1A 5DGXA 3T7EA 5DXAA 1KMIY 4WJKB 3SHVA 3QKTA 4KO8A 4UBKA 5F51A 1KJYA 2YVLA 2Z58A 3FAKA 5IEBA 5J2UA 3QKRB 2YZ7A 1CYEA 1KARA 3JASA 5EA2A 4A8HA 2OM2A 1U1CA 3VI4B 3KQQA 3MAAC 5CEJA 4O2AB 1MX3A 3VDNB 4YJHA 4FBLA 1PFGA 4MQUA 4AQ7A 2GUWA 2O8EB 1OI3A 1KJNA 3A6EA 1XZGA 1EHCA 2VDUE 4GGPA 2ZREA 2BCGY 1ZGBA 5TMPA 2JIBA 1JHUA 3I12A 3USZA 3ODGA 2A2ZA 5AVOA 1KQFA 5K0NA 4GIBA 4KFSA 3DTTA 4Q19A 1N57A 4TV9F 2YJTD 5TT1A 3OOYA 1TC2A 3DZJA 4ZT5A 4QATA 4UCQA 3V2GA 1UBMS 3T06B 1DPGA 1JIUA 2Z5FA 2J31A 5C7LO 1G8PA 4KGXA 3R44A 1SQ0A 1QHYA 4DLWA 2ZIZA 3I6QA 4I9FA 3RS0A 3U81A 5BVGB 3L7BA 4NF2A 5K0JA 4RXMA 2XGMA 3ONNA 4UATA 4I6GA 4IZHA 3P97A 4LYFA 3IDQA 4DSTA 5KQSA 2C4WA 5F7OA 5L7YA 5AT1A 1ZUIA 3FKSA 3SM9A 4L8LA 3SSNA 1KAEA 4XXHA 3DT9A 2AK2A 3TWOA 2SICE 4J1TA 3D0QA 1TCBA 3LA8A 1EBBA 4U9HS 1L6IA 5JU6A 1ARZA 2DHCA 2ECQA 2XA9A 3K6JA 2Q3LA 4G2NA 4MROA 2Q28A 5TMBA 4CG1A 1AQNA 3DUFB 2PSDA 5T64A 2Q27A 4OHMA 4M8IA 3R8FA 4Q03A 1BMDA 2ZETA 2ZZKA 4JJZA 5H59A 1C30B 3V6MA 1FSSA 1ZEMA 4YMTA 1FPQA 4ZMRA 3H2BA 2XAUA 4B45A 3F3KA 4DV3B 2EP5A 1MGOA 1OXBB 1TAQA 1FVOA 5DNCA 3AVYA 1EQUA 1PLLA 1U94A 3L1IA 3QOFA 3L82B 4PXYA 3BAZA 1PNVA 2GTHA 1KH1A 2BMWA 3HPRA 1ICEA 5AI8A 2PGIA 2YZKA 4OLAA 4L5IA 1I13A 3K72B 2UKDA 3W5VA 1U7ZA 4H6PA 4WESA 1QQ5A 2G9NA 4EUSA 3HM2A 1ES9A 3QU2A 4QRHA 1JEEA 4Y6RA 1N0IA 4BNYA 3LUHA 4A8PA 2HRRA 3FPBA 4QM7A 4QOHA 1TT5B 3RYFA 1DKNA 1OROA 1GU1A 3GCDA 4FYMA 5LIPA 4Q1EA 3BULA 2X13A 3BD6A 1U3WA 3LK6A 3PDJA 5ANRB 1SVLA 1WHSB 3LNCA 5IBPA 4J6EA 3L05A 3ROTA 5L3ZA 3JW8A 1P5HA 1T0UA 1E59A 4HFJA 5DKFA 4FHZA 2ZJ2A 1B74A 4TN5A 4XI9A 3TQHA 2ZK7A 3IQZA 2BZ0A 4FFMA 2SKEA 2ZE5A 3AJ9A 2P0YA 3B1WA 3RRYA 4ZIRA 4C5AA 3R8CA 5JS8A 4KRYA 3TI7A 5A05A 3I6YA 3BB4A 2O3SA 4X1KB 4C29A 4EYOA 4YLYA 4BO7A 3RNLA 2C8LA 4EG0A 3ESZA 2CMHA 1Z2OX 3HB4X 3INRA 5M7EA 3FOBA 2NT4A 4HUJA 4OSPA 1FTNA 5CX1B 4CUJA 4UUBA 4YUWA 3L7NA 4NONA 1CZKA 2NN3C 4NQRA 4BHTA 3IGFA 4ND7A 2MYUA 5B55A 5J2TA 4CHGA 5T7BA 3EGEA 1GZSA 4CDNA 3RYCA 3NOVA 1DUSA 1RRMA 2DP4E 1MN6A 1M6VB 5ALSA 1T2AA 4LRWA 2ABWA 2Z1DA 1D0SA 2QRNA 5GM2A 4CCYB 4CMAA 4YAEA 1NR5A 1W35A 1Q0ZA 1EPUA 3FW1A 4CODB 5IM4A 2C20A 4MWEA 3BDIA 1XPJA 1Y9DA 1NVWQ 1OREA 4PZAA 5DN9A 4DA7A 2VS1A 5DYTA 3T1YB 5C80A 1ZA1A 4J0JA 1QFZA 5CG1A 1SOMA 3KUDA 4NG5A 3VO8A 4TXMA 5KKAA 3KQUA 3R3WA 1VL8A 1LW6E 5L4SA 4O3FA 3HCRA 1DWUA 2C5GA 3BE6A 4MI6A 1HDIA 3HTXA 1LGYA 1JG6A 2ZS8A 1XWWA 2P2NA 1HK7A 1QE0A 4ZDWA 3HDJA 4RDXA 5JFOA 4L0QA 4HNRA 4HB2A 4LBWA 1IZYA 3DW1X 3AJRA 2YIMA 4HB3A 3KYDA 5CDUA 1F8GA 3OU2A 1HG1A 4MP8A 1SUSA 5IJ9A 3EXG2 1H2HA 2BV3A 1XQYA 3D4IA 3F74A 1L7BA 2SECE 1Z56C 2R7LA 3GG9A 3GMSA 3KR9A 3AZPA 4CG3A 3KXKA 2F64A 5TNXA 3T4EA 3MGCA 2RGGA 1YR3A 1HQYE 4YEDA 2F67A 4QA9A 5A0VA 1IBRA 1L7VC 3UW3A 4JKYA 3QVXA 2NOAA 1YFJA 3EMKA 2EGGA 1XZAA 3BK1A 4MIOA 1WSWA 1S8AA 4GQIA 4DUYB 3DLCA 1XP5A 3F5MA 1U98A 3EGCA 2PEZA 2GSDA 2PYDA 2UZ1A 3PFKA 4PZCA 4Z4QA 2AHRA 2J8ZA 2C4VA 5JWRA 3KCNA 1KVTA 2AJCA 2MSWA 3LO8A 3LUGA 2WUDA 3RRXA 3WXMA 3DFIA 3LH5A 1LJLA 5DIZA 4ZHQA 5IPFA 4HRAA 1FBTA 1NP6A 4RIGA 1ZM2A 2R6ZA 2WTAA 4FX2A 3LYLA 1JW9B 1RFLA 4S1TA 1W5FA 2HUNA 3JQFA 3MA0A 4N5IX 5FUWA 4LQCA 4KRGA 2QP9X 3RW9A 3GA7A 4BFLA 3KZCA 5AM2A 1ZGGA 1NVVR 2JDIA 1D9ZA 4GLOA 4JLUA 2JFNA 2XDWA 2ZSJA 4AG6A 4I50A 4K9LA 1JHPA 4JHLA 2C9ZA 2F4VB 4J1TC 4PBSA 4K46A 4BS9A 1XZIA 3H3JA 4YTEA 5BV7A 2X22A 3D2CA 3S4YA 4DJTA 2JPDA 4N5LA 5TMEA 3I5AA 3T15A 1J7KA 1HY3A 1WXHA 2IELA 3ER6A 3TRKA 3PEWA 4FB5A 3FVVA 3AI3A 5KSWB 4TMZA 1E9SA 4DQUA 2X76A 1NBEA 1Z15A 2JFWA 3LQKA 3QPBA 3RVRA 1CEYA 1JMKC 3TKLA 2E6UX 3LT4A 3B7PA 3D5TA 1DG9A 2ZYTX 3EF3A 3KD2A 3RUPA 3VNBA 1U9IC 4D43A 3RYIB 1A88A 2BELA 2MMCA 2GF9A 3HHEA 2YOHA 4NATA 1HLPA 1J24A 4EYEA 3VBEA 5IJ0A 5AK3A 5EE9A 3FN4A 4GRAA 1WCYA 1C7IA 5BSMA 2HNBA 2SNIE 1Q2XA 2OG1A 3QBDA 4K6OA 3ORYA 1PSWA 3G59A 3SC6A 3WGOA 4PSDA 5C4IA 4D25A 1E2NA 3BG5A 3G1UA 3JQAA 2E85A 1LDMA 1N2XA 1H4TA 3MCVA 1TUEA 1RADA 1TCCA 3G0BA 4R5MA 1UAGA 2YVQA 4IDEA 1RBYA 2X9GA 1BZYA 3D81A 3N8KA 1E5DA 4URXR 4PC1A 3ETGA 4L8YA 3QXCA 4HDRA 4IKOA 4A3SA 1NUTA 4AZVA 1DV1A 1P19A 1Z83A 4PYRA 4QXAA 3WYFA 2IS2A 3BJIC 3T34A 3GUUA 4QECA 2B8TA 3DNMA 3IB6A 3LWBA 3ELDA 1OHHD 1OD6A 2PBLA 5L3RA 3IULA 4EDFA 4EVRA 2MJLA 2PL1A 3DB1A 2QI9C 3H4TA 2GSWA 2PZAA 1PVVA 2AZDA 4XCXA 1JEQB 3RU9A 4DMGA 2CHVA 2ZYUX 3V2HA 3DP7A 4LHZA 4F2DA 3WLKX 1Y7TA 5K4GA 1FQJA 3SBEA 1W44A 2DWQA 2R8OA 1FJ2A 1SHKA 1WUHS 2XNHA 4C1NA 2JBWA 3THWB 3N9IA 3QE9Y 5LQMA 1MO4A 3DE7X 2IPAB 4UTZA 5HOEA 4UMEA 1C1DA 1UC9A 1IL0A 2QT9A 2WJPA 1UR5A 2XUOA 3MOGA 2GHQA 3MT9A 3NC4A 4KRXA 3UJDA 2PWAA 3LPAA 2X6TA 1U3CA 1FFBA 3WBJA 3OT1B 5CP8A 3H99A 4AJ2A 1QDEA 2O0HA 1A2OA 1M1YB 4LS3A 5FEUA 1RAIA 5JBQA 1GNTA 3PHGA 4UBLA 1P2SA 4DA6A 4I1PA 4RD3A 1H2XA 1WV1A 2CE7A 3H9EO 3PZRA 2L69A 4YUAA 1D4AA 4OREX 2B99A 4GL4A 3ITNA 3P20A 2RHTA 3IQDB 2JGFA 2Y67A 4XWWA 2NSYA 1JG2A 4I1YA 3KZOA 1S3FA 4AUMA 1T9HA 4ZYUA 3I1FA 4TYQA 5C31A 5ULLA 3X1WA 4FHEA 4YAJA 3O1IC 1ABFA 1V8DA 2HF2A 2Q8PA 1AZWA 4HO1X 5HVNA 1YASA 2IPMA 1R66A 1WB4A 2IIBA 5EKUA 4D9JA 3KQKA 2HPVA 4ZGGA 3PS9A 1J1IA 3MTEA 1DAMA 1MUUA 1UJ2A 4F6RB 1E6KA 4UNQA 4DNXA 4OQXA 5IYZA 2QN8A 2O19A 3K6SA 2AN5A 3CUYA 1USIA 3M5PA 1GAJA 2BRUC 2Q0QA 9LDBA 1K68A 2RIRA 4AF7A 3ID6C 2WSYB 3E82A 1AKNA 3WLOA 2Q99A 2OCYC 3KQTA 1J09A 1HMPA 1P39A 3RVQA 4BJ6A 1N5JA 2IFTA 4J0GA 1VPLA 4PHFA 3RC2A 4XDHA 3COZA 5IAJA 1SC6A 3T9AA 4FIZA 2IW3A 2QXTA 2QN6A 3MBIA 1RXIA 1M34E 3NFYA 3W9BA 3ZWMA 3H4MA 4N18A 4IX9A 4V24A 3EQZA 1EP9A 4EO4A 2WSMA 1S7GA 3OFKA 2HBQA 2I3AA 1BVHA 4FM9A 1CJSA 2FW1A 2Q6VA 3OEYA 2J46A 2X7HA 4L2IA 3SN6A 3WGMA 3B82A 3C3KA 4M49A 2WAYA 2Y1CA 2HGZA 3DEIA 5IH3A 5JD6A 1XVAA 4EJ2A 4H7EA 5CA1A 4GL2A 3WX0A 5EIBD 1T4GA 1JH8A 1E5VA 4KXUA 5I3ZA 3T54A 4UEKA 2WW8A 2CE2X 1J33A 1OUMA 3L1JA 2GTIA 1T1RA 1IHYA 1OH8A 1RWVA 3ESDA 3GH3A 1P5FA 2EX4A 1AC5A 3C14C 4YCDA 1I32A 5JQGF 4U4AA 4MQ5A 4X8OA 4ZKDA 1CZLA 1UFKA 3F49S 2UYYA 1W4AA 2JAUA 3HZZA 1PUJA 5F4ZA 3FOZA 2JGIA 3JAMA 2DECA 4UPDA 5H0IA 4JSTA 5DMXA 2Q50A 1KYTA 2OESA 4XUDA 6Q21A 3AF5A 1VE1A 2BHRA 4MMZB 3WQRA 4PW0A 1N9GA 4GC9A 1JEJA 2ZT8A 4H0FA 3RS8A 3FIUA 5HKOA 1C3JA 5KWVA 1XDBA 1NW4A 3OPYI 3W7BA 1ZCBA 2NU7B 3O5AA 4M2LA 3UV3A 2YIDA 1P91A 1DAIA 3HUTA 3K0FB 4FJ0A 2XTAA 1Q1BA 2EJUA 4HYEA 2K4MA 3ED1A 4V1CB 5ALOA 5LDDC 1CERA 1LS6A 1E4EB 1UP6A 1WXEA 3AM5A 5LQUA 3E9RA 1JR3A 3DE5X 3PNKA 4A2PA 2WE7A 3QNWA 4CKCA 5HZHA 4X1IA 2AWOA 3G5AA 3H5VA 2ZCVA 1S8NA 3IQXA 4X1YB 3AI1A 2NVUB 3UMFA 2Q6OA 1IOLA 2PJUA 4MX8A 3PA8A 4URYR 3HI6A 3N58A 4OK3A 2ZANA 4KAAA 1OFTA 1MOZA 1GG9A 4TKMA 1J56A 3KR2A 3QWFA 1X1AA 4TWRA 2FFBA 1XDUA 4N82A 1V1RA 4KXLA 1YC2A 3OU6A 4BVLA 2EERA 5ESDA 4F85A 5A2GA 4B46A 2RCYA 3E2PA 4C05A 3KKNA 3I9FA 2IEDA 1JJBA 2WI8A 3V8QA 1C4XA 3IH5A 4XJTA 3VNVA 2WVGA 4F12A 3NV7A 4AI6A 1F9EA 2IYEA 4MW6A 4OK6A 4AMGA 3PYLA 1V0JA 3FTEA 1N5LA 1FP2A 3K9HA 5BWCA 3W79A 4H0CA 2QPTA 4OHOA 1NVKA 1I0LA 3VX4A 5JZBA 3L0YA 1G21E 2NX2A 3FTNA 3ZWCA 3TZHA 2VJDA 4JBYA 2GARA 4Q01A 4XASA 3AQ4A 2VBIA 3D4LA 3HP4A 5CURA 3TNJA 1NY6A 4FN4A 4J03A 5IFLA 2JVIA 1YZFA 1M6HA 2PRIA 1CJKC 3DH0A 1SRQA 1L4LA 3HU3A 3AESB 2QMHA 4PR3A 1CSEE 3B20A 4KVZA 4TWIA 2CSXA 1CY4A 3BRCA 1A7AA 1DKLA 3QVOA 2Y4OA 2NU8B 3U7QA 3EFHA 3G2OA 1OU4A 1PAUA 3DL2A 3I0ZA 5D6OA 5AOCA 4LDRA 3K8ZA 3QLJA 2RIPA 4RJTA 5CW2A 1V11A 5CCBA 4G1CA 4OJQA 5CDGA 3P2KA 5IVKA 4DJAA 2QW0X 1XL0A 1PJLA 2O9JA 1GTL1 2NT3A 3QWAA 3LIPA 5ALMA 2ORWA 3KUXA 1J0XO 3UMMA 1IBMB 2AC7A 4NZZA 5CMLA 5T67A 2Z5VA 1MQSA 1YZTA 1CWUA 2E4ZA 1PEAA 2I2XB 3DAGA 3OT5A 3U4IA 4Q3DA 4TTTS 3N1UA 1PKXA 1IFXA 4UU0A 3Q9LA 1KEPA 4REQA 1E0KA 3M6AA 1SURA 3UAOA 3HUFA 5BOSB 4RFVA 5HYVA 4TV8F 1YCGA 2D2IA 4MQLA 3OETA 4BVFA 5KNBH 2PSHA 2E21A 4G85A 4JSYA 5T8KA 5D1HA 1U7PA 2O48X 1XDWA 5LBUA 1GNRA 1STOA 2PM8A 5KNDD 3A6FA 3KBBA 3PQEA 1WIWA 1BVYF 3OMWA 2OECA 4LN1A 2CLFB 4PZPA 4EBFA 3AI7A 1U80A 2D4HA 2QVXX 4LXYA 4ZI7F 4NOMA 2OHOA 3ORHA 1PK7A 1L8LA 2W6ZA 4IF6A 1D1TA 1E3JA 1QX4A 1ZBDA 1BWSA 5GZ6A 1IE3A 3B3AA 4ZT2A 1G63A 4ALIA 3F6EX 1PFKA 4OQYA 3BMCA 4N39A 2P9GA 2OBBA 1ODSA 1U0GA 1VSQA 4IDCA 2YXPX 2GJKA 2VJQA 2B35A 2XW6A 4KR3A 3SR4A 4FQ7A 2AKEA 4ARVA 4X3OA 1Z18A 3ZDQA 5CH5A 4B2LA 5BSKA 5CAEA 1EX1A 2H92A 2M6KA 4YRAA 4E4TA 1I3NA 2HOQA 3W5DA 1RD4A 1YIDA 3OKFA 3QXXA 1B0AA 4JJ7A 5L3SA 2XF8A 4JYZA 4JQSA 5C35A 2YZ2A 1ORVA 4L8GA 2BI7A 2FNAA 4EFKA 1QBKC 2GWRA 2ZSKA 3PJDA 3GF4A 2HWYA 3VJLA 5FHRA 2H7YA 3FPJA 3OFJA 3KG2A 1ONPA 4FOOA 3PDHA 2BMEA 2I2AA 1ZXXA 3BREA 3VSCA 3PGVA 5KQLA 1A7KA 1ISFA 2HO5A 4OJYA 3DOOA 3H0EA 1PFVA 1JALA 1YWGO 2QW1A 3OX4A 4O33A 3MINA 4NHEA 4NV0A 3IELA 3GLFE 3ZS8A 1Y34E 3NAGA 4IUBS 2AOWA 3AIMA 3AVOA 3ANMA 1J22A 2C54A 2VDRB 3PNYA 4LPKA 4WRRA 2NADA 3RPEA 3PRJA 1B8OA 3DKIA 1MVLA 4C2BA 1NZFA 1ZIDA 1PZGA 2QIOA 1UOQA 3F47A 2IA5A 1WXGA 3MG9A 1O89A 3UANA 3W7AA 1OB2A 1OPXA 3GHHA 3HN7A 2PAAA 1QGUA 2XEDA 2FFAA 3HACA 2CHUA 3KKPA 1KS9A 3DQZA 7REQA 3EGVA 4LJRA 3KWJA 3RC9A 2LDBA 4TL8A 1UINA 3ZWPA 1E1RA 3V9PA 5BOVA 3FPKA 1W46A 4HI0E 1LPNA 2X8WA 3JQBA 3LI2A 2AD1A 1YRQA 4Z2YA 1SOAA 4IQ8A 4HAIA 4I3GA 3I39X 1OFUA 3P0IA 2XUQA 4KUEA 1SB8A 5F73A 3PYMA 4AY3A 3ZDFA 2AI1A 4BO1A 4UTNA 3F3YA 2QYOA 3C0KA 1QH8B 1ZI6A 3JR7A 3NHWA 1QNLA 2BSQA 2JK0A 5K5EA 2GH1A 3FTQA 5KSYA 3WJ1A 2YNMA 4B9EA 1L1EA 3CPHA 4C88A 1Z0SA 4O4IB 2GLXA 4D4LA 2RDMA 5KJ6A 5EMLA 5TS2A 2IJGX 5IJAA 3B6MA 2IXDA 1SXQA 4CM9D 1L5QA 1I14A 5ECWA 1R64A 5GGXA 1GM5A 3HWRA 2V4UA 4HLNA 4RL6A 4BEBA 3C7KA 4GXRA 2JI4A 3CUKA 4B3TB 3HJNA 3SE0A 1U2SA 2WZBA 3KQMA 3EPLA 4G1MB 4CLHA 3CNEA 3E4CA 2JIRA 1B7GO 1SXHA 1Y1LA 5KTTA 1JQEA 4U9IS 5FUYA 5P21A 1KYIA 3EUEA 4CDMA 3EXFB 1DWPA 4BB5A 1NF3A 4FYYA 4A8JB 4YLEA 3CR7A 4M1TA 4U5QA 1APBA 1TF7A 5E2IA 1IJBA 2BEJA 2KWIA 1AK1A 2W7TA 3V8VA 2QMQA 3HRKA 1HYHA 4P34A 2ZDHA 2ERYA 4UUQA 2AMLA 2XNJA 3CBGA 4BV3A 3KEFA 3TX2A 2CCGA 2Q3CA 1OXVA 3TZKA 3KVRA 4ZU1X 2ZI7A 4PYIA 1EJ0A 1WKBA 4RXTA 2JZCA 4EHIA 4GRDA 2EFEB 1GTJ1 3A6KA 3FCAA 2FSSA 1XUOA 3UT6A 4WKBA 5YASA 1DDGA 1RXEA 3NJ8A 4UREA 4FZ5A 4Y2UA 5DI3A 3H17A 4AY2A 5CBPA 4OKNA 1QPGA 1EX9A 4F06A 2VT3A 3KB1A 2QWXA 3G2NA 1Y5RA 4LNUA 4MINA 4NU8X 5EVJA 3NBFA 1K89A 3CEHA 3IAS6 1SKQA 4YVFA 5JAMA 3IOYA 1UDXA 2C8VA 4Q4AB 5AUQA 2QR2A 4DZTA 2VJNA 2AF4C 4B6RA 4NICA 4FS8A 3V4PB 3E6AA 1C8BA 4UZEA 2VYVD 3H42B 3G0CA 3PGJA 1XWFA 2JGDB 4P36A 1TZ2A 2JAHA 3C2QA 2QD2A 1V8PA 3VSBA 1E3IA 2V7BA 4RVNA 4RCYA 2QQEA 3G2LA 4AKEA 5HIMA 2G4LA 3PUVA 4EY6A 2XWBF 1QR2A 3OCJA 1N8TA 2X8AA 5ADWA 2PUEA 2E89A 1M2HA 1N3YA 3H04A 2C1EA 3L8HA 1E1KA 4NK4A 4NJMB 3TDMA 4JZYA 3AR8A 1HEUA 1VXOA 4JUIA 2VWPA 4KPUA 1JSCA 3DFUA 1DB3A 3KV3O 3QPDA 3V32A 3S1AB 1TA9A 1FFSA 4P6VF 5KNBD 2I7DA 1AIPA 4AWAA 1UQTA 5IHXA 1P77A 4KDRA 5LOVB 3CRZA 1SZJG 3PPIA 4R1QA 4WK2B 4WK6A 2FZGA 1LLQA 2JBAA 4PCUA 2DU8A 3VPXA 3ML1A 2IITA 3H3FA 4FQ5A 3LXXA 4PWYA 5F35A 2B4AA 1Z5ZA 4MUFA 3MT0A 1N7JA 1X7ZA 4O4HB 4MKIA 3K31A 1F2DA 3BMNA 3NBZC 3PXCX 1A9XA 1P3Y1 2JVKA 3OLZA 4QT4A 2QTVB 3N0RA 4EBBA 1I6MA 2GA8A 5THQA 3I30X 5G0UA 1E4VA 3I0MA 5C32A 1ZVJA 2QNIA 2TS1A 1RR6A 3TX6A 1XN1A 1Z0JA 2V96A 4QSHA 4CIXA 3ZZUA 1J6UA 1SHZA 1WMEA 4UQOA 7GPBA 4YXWA 3ZVRA 4F3CA 2X0RA 3CH5A 4MVJD 4Y9SA 1SPXA 5K05A 4I5DA 4HWTA 1J8QA 2Q6TA 4L3VA 4I5FA 5E8RA 2OPHA 1CS0A 3GLUA 2Q62A 2PBFA 4AD8A 4M6WA 3I1IA 3LX5A 3MLBA 5KYKA 3FWYA 5CFLA 1JJ7A 1P5RA 1XTIA 4X92A 3QX8A 1MIOA 2WYVA 1TE2A 4KGDA 5ECGC 3U16A 1UEIA 3LPDA 1D7OA 1TVCA 1Q7EA 1WUYA 2A8YA 2P79A 4IGEA 5CRIA 4BGEA 4XWAA 2BH9A 4C7OA 4IGKA 1P62B 1U3DA 1ZN9A 2BHNA 2IW1A 2NUTB 3R41A 4HH3C 1P9OA 4DA8A 1WULS 4U7JA 2CNOA 4D4GA 3N3BC 5KZMB 1U0RA 4LHSA 5EERA 1E92A 2P75A 4NH0A 4PONA 3L7CA 2BDTA 1X7DA 5EJ7A 4R40A 1QG2A 1OXMA 2C29D 3FWZA 4Y2SA 5LZ5A 5FWXA 1F5NA 2Y1EA 1KTIA 2YQ5A 3JATA 1EFCA 1F60A 5B4UA 2WFAA 1ZMOA 4CCWA 2ZI9A 2G72A 4JLWA 2X15A 1Q1AA 5F5NA 2WNIA 2Y3IA 4YNBA 5JCJD 4ALLA 2V0NA 4KI0A 4WNCA 5JLJA 3VISA 2J4DA 4P93A 3RC8A 1A8PA 1P4SA 1UBCA 4RORA 3PE4A 3KHUA 2I9PA 1NBWB 2XNDA 3QKRA 2O54A 2ZSHA 1Z06A 1P1BA 3ZX5A 1PS9A 1YL7A 1K6EA 3JASB 1PBTA 2IZZA 4G37A 5KEIA 3V34A 3ZV6A 4C0KA 2QQGA 3GRUA 1MG0A 2NUAB 3B52X 3WG9A 1CETA 4MW0A 5JNVA 4EJSC 2GEUA 4G63A 1EQAA 4EKGA 1E9RA 3KKEA 2YRXA 3FAZA 4G01B 1MAVA 4M1WA 4RL4A 5DTEA 1MO3A 3HC7A 1H1LB 2Z5GA 4OQDA 3N2GA 3ZDCA 1DRUA 1JAHA 1QCZA 2VF2A 2V0GA 3IRUA 2CJXA 4AICA 2BT4A 4NE9A 3FRJA 4CEJB 4UDOA 3TF5A 2FPPB 3ACDA 1BEUB 1TPZA 3L7MA 1PD1A 1MV8A 3E8SA 4FT4A 4D8WA 1ZUNB 4NJEB 1P73A 3B60A 1S2OA 3D3KA 4FOTA 1EFVB 4RVSA 4DE5A 2QA5A 4EECA 3CCBA 2WVHA 1IUOA 3AQIA 3CF2A 4FOPA 2FRDC 1I7NA 3GQBB 2O7SA 4AN4A 4HNUA 1Z33A 3G2IA 5GV8A 3VBCA 5KU1A 5DNAA 2NSLA 3FUCA 4D6YA 3ZH2A 3R7BA 1HX7A 3UK2A 5IARA 3WV5A 3A9UA 4IVRA 4AIIA 3GVPA 5MF6A 3ZCQA 1QV7A 1EP1B 1MNQA 1UXOA 1W0JD 2FMKA 3QNUA 5G40A 3UCFA 4ARSA 4LJKA 1Z7BA 4DJ5X 1DKOA 4LECA 4L8VA 2IS6A 4WT7A 3GH1A 1I94B 3V1NA 5WRFA 3IVGA 1Q11A 2B61A 4RYLA 1DOHA 1K98A 2OGZA 3OKAA 4ZODA 3T5GA 4AP9A 2JIZA 4NJEA 2RSLA 4KL8S 4MS3B 2OE2A 2O8FB 1WOYA 3AYXB 3GJZA 1V1MA 1GTZA 3PC7A 3X1KA 1G1MA 5KMGB 3KETA 1OC2A 2HDHA 2ZWIA 4ZCQA 2P11A 3I9LA 5IDYA 2I1WA 4EG3A 4OX9B 5DLDA 1K5PA 5JANA 4YASA 5IXYA 5KDOA 2CD7A 2HCFA 4F5DA 4FIDA 4PQEA 2J45A 5ITZA 1AXEA 3A6HA 3PUJA 4IEEA 4M87A 4P3XA 2FW0A 3AEKA 1IQUA 3FE2A 3A11A 4X91A 4MS4B 4LRQA 2XYPA 5CHYA 4MRRA 4LGVA 4BZWA 2KBFA 3IMEA 5ADVA 2X9VA 3QXHA 4HATA 5HS4A 3IDOA 2HV8A 1X7YA 1LI5A 4ZHSA 4LJ8A 3OEHA 1VYUA 2WHQA 3HYLA 4RFSB 4DLBA 5LNK1 1MXFA 3VVCA 3VR3A 4A6XA 4OHFA 3E22B 4V0KA 5JD4A 2FWNA 1QRAA 4MCAA 2D54A 4YT4A 1S7CA 1TAGA 4W1QA 1PQUA 1XKQA 2ZJ4A 1QCDA 3CLTC 3B3QA 4Q6BA 1VMEA 5DYWA 3M5WA 3DEHA 3IDFA 3BKXA 3T7TA 5K0SA 5ISMA 3C3EA 1JU4A 1SELA 4RKEA 3T3EA 3P32A 1NDQA 3FCUB 1LF5A 4ZKEA 4DLZA 3AFIA 2OXIA 3WGVA 4ZEVA 1QO0D 3F6SA 4TMKA 1R18A 2DKOA 1C1HA 3B7GA 3NCTA 1WU7A 4Z1MA 3TGPA 4N3AA 4AJOA 4LZNA 4BO4A 2OCLA 4V3BA 1Y1TA 3AP2A 1CG6A 1QJ4A 1JLMA 3BCSA 4C9BA 2OCXA 2SCUA 3LK7A 4V03A 3K1AB 4ZYTA 3LD9A 4R3WA 1HOTA 4J7UA 4WLUA 3JQBC 2GPSA 4XUGB 1RKQA 3JRNA 3UJ7A 1MFZA 1AGRA 3FVTA 1II9A 2EW2A 3KWFA 4FMDB 4KPYA 5E1BA 4N5MA 3EEFA 1F14A 1NTRA 1SK9A 4UUMA 2GB4A 3FLMA 3SBDA 4QTYA 1RNLA 5JDIA 2VJYA 4LMBA 3GVHA 1L7NA 3R8XA 2M6LA 1NE2A 4IIGA 1UF9A 3I5UA 1C7FA 4XGRA 3O0DA 2XUPA 3GNLA 2BE7A 4YPVA 4LC0A 4R8LA 2A1TR 3HVUA 3MMZA 4DC9A 4OA8A 1JDNA 1VE3A 2GBPA 4JVMA 3QSYA 5SYMA 3M4JA 1XZEA 4MUGA 2V6IA 1JA0A 2WM3A 3HCPA 2VSXA 2ZIVB 4HJRA 1UT5A 1PFQA 3FUTA 3R6TA 1M34A 2ODWA 1UKBA 2FOXA 1QNFA 1Z4MA 5AKZA 4D96A 5JS6A 3OLCX 1MAWA 5BUQA 1OBFO 2ZR9A 4JENA 1S8OA 1XTSA 3MTDA 1E6CA 1U7UA 3EARA 3PTLA 4GR5A 4JYAB 1TQ2A 5D84A 3EQ2A 3H5WA 3GGPA 1GCOA 2VDQB 4XYLA 3QELB 4N7MA 3KVVA 2EGUA 4ENSA 3KFLA 4O4LA 5KCZA 2BFBA 1SXIA 1XMPA 2Q5OA 3E0XA 2WAMA 4MWBA 4E51A 5LMZA 4E21A 1VLQA 2VYQA 1MOQA 4AYWA 1NUPA 4F97A 1NXTA 1SU4A 4KQMA 4B09A 5IKMA 3U4GA 4CKZA 3PPXA 3VSDA 1H9CA 1SXJD 2J6CA 3OHMA 1VLVA 3CVYA 5ESXA 3H1BA 3DTVB 2LR0A 3WMFA 1VKJA 4M0UA 4HNTA 3T7SA 3GLGA 4I2VA 4HVLA 1Q5PA 4CU2A 1LNZA 2XXAA 2R6GA 2ZJ5A 1VSUA 3ABQB 3D0RA 3F7OA 3QELA 1PDVA 4NC9A 3BE4A 1V5EA 2ADMA 3RTBA 3S2ZA 3I61A 2Q5IA 4ZHQB 3NB0A 3HBNA 1RP1A 4R84A 2AA3A 1OH7A 4LGYA 2GD6A 1KQOA 1F6DA 5JQWA 2QX7A 2JFVA 1TM5E 1YKSA 3H86A 2C5FA 3KELA 4P58A 3UMVA 1O5IA 3FIJA 4Z1MD 3ENVA 5IHPA 2MSEB 1JXAA 5EI5A 4JCCA 2JH8A 5EAIA 3SX4A 4DM3A 1P17A 4OP3A 4PZEA 4L50A 4Q0MA 3SYKA 1L8XA 2GAAA 4UDNA 4EAQA 1XSEA 3WS7A 4WACA 2IU6A 1P0FA 3IAEA 3LVQE 1Z29A 2P78A 1Z12A 4UE6A 1EAYA 4EFDA 3B2NA 4V2UA 5FWYA 1BWQA 1MX9A 1RRPA 4OHVA 3GFOA 2WLTA 4FSHA 1PV2A 5GONB 1ISMA 3V33A 3RABA 1AKVA 2IE0A 3H13A 2X1LA 3Q85A 1QVWA 5DWQA 5B1YA 2RH5A 5SZHB 2CDBA 2PZJA 3WBKA 4D3XA 1EUDA 4LDQA 2GHIA 3DC7A 4W5OA 1OKKA 4Q39A 2PU5A 2H11A 3JQ7A 5E7MA 3WZLA 4C4RA 4HT3B 3A37A 3D7MA 3WNBA 2CB0A 5EMJA 5I47A 1LI7A 3A4IA 5B3JC 3DLHA 3QPUA 2FUEA 4XQEA 3H16A 5DYNA 2GD2A 1JQ5A 4G0OA 5DX8A 4BX2A 4ESVA 2J3KA 2HRBA 3QYAA 1I7SB 1E2IA 3MFQA 3DE4X 2OBMA 3QQ5A 1G8AA 1QZUA 4X61A 4D82A 4B7UA 2R68A 2VQSA 3DONA 2Y99A 4YRNA 5A4MS 1FNNA 3T5TA 2PH7A 1J49A 4UNIA 1AKUA 2BFDB 4QU8A 4CFSA 4LISA 1Y6RA 2IF2A 4XOIA 3ESBA 4BNZA 1R0XA 2A33A 2OO3A 3DFMA 2AC2A 4IOLA 1NF2A 2O2SA 1GPJA 1ZI9A 5GJVC 4E3WA 1AB6A 2DHQA 3S99A 3CWZA 1XVVA 5CFNA 1B4DA 2C4KA 4IJMA 3BK2A 4G6ZA 5BN5B 4EHBA 4CQLA 3ENQA 4IX1A 3NHRA 4CG2A 3W5BA 2PUFA 4M1ZA 3TFQA 3GLIE 1H65A 3R0JA 1FTSA 4NU5A 4P54A 2NP7A 1Q7BA 2I4TA 1PNOA 2Y4NA 3AEZA 3HVHA 4EKNB 1DVRA 3RT1A 3T3NA 2HLDA 1MX1A 2VQDA 4KOAA 2W90A 4H1WA 1EUZA 2HEIA 3EG5A 3PGXA 4PLCA 3NPMA 1WB6A 5EHQA 2GETA 5DHSA 5IBRA 3N2KA 4WY2A 1ZUWA 4YY3B 3FLAA 1SHUX 3ZD8A 2GM4A 4N76A 1Z6AA 1CQZA 2GKGA 3EH1A 3MPUA 1CUAA 1W85B 4OM7A 4OQLA 4OKSA 1YZKA 2VDKB 3EFOB 1ZO8A 4PY2A 5F64A 3AKEA 3LGSA 2G5PA 4D8YA 4GVLA 3GN1A 3FTFA 3O8OA 1LRJA 2J5QA 4WKOA 2PJZA 2WIDA 4F60A 4WH0A 5IYZF 1N77A 1LZKA 1T4DA 3TUIC 2WSSD 4KG7A 2WLSA 1TL7C 3AP1A 5I01A 2ETVA 3RQSA 1QKIA 5JISA 5H1YA 3IQEA 4MQ6A 1PE0A 1DJMA 1YRAA 1ZNZA 5J43A 2GT1A 3Q9UA 5L40A 2PR7A 2FG7C 3RRJA 4NJOA 4Q9DA 3H1PA 4XEHA 2P2YA 3S6JA 2GZMA 4GPAA 4WY5A 2A88A 1G60A 1GAQA 1M72A 5H81A 4CQMD 3CE9A 3U61B 3TKAA 3N8NA 5EWMA 2F9LA 3GYBA 1GV0A 4OJMX 2V7WA 3KTAA 4PGHA 1A76A 5EWLB 4POOA 5FHQA 3BWXA 2VYFA 3TQQA 2RGUA 4LFAB 1O1YA 3IVRA 2A3RA 2QYTA 3U0BA 1PQYA 3TQIA 5F21A 4JI7B 1IG3A 5CVUA 3OI7A 2H59A 4U3JA 1QOZA 1E62A 2B1RA 4UQPA 3RVOA 4V3CA 1UMBB 4TLCA 3RS5A 1XLTC 1BYIA 5EZ6B 1Y6ZA 1VHJA 4UU7A 1G0OA 2C9YA 2GJSA 5LP1A 3H19A 2HI0A 1JAYA 2O2ZA 3MMPA 2YWGA 4XWYA 3R3YA 2FUG1 3ZLUA 1JDZA 4MVJA 2VF5X 1AB5A 4OBWA 5GM1A 4DCSA 2VIIA 3R76A 2KMLA 3W8DA 3V8MA 3IKLA 3EODA 4O4HF 5A9RA 4NEQA 2G77B 2IEZA 2QUBA 5JXJA 5DP2A 1S1MA 1XNHA 3OMLA 4Q1VA 5EEGA 4S1NA 3SFVA 3SQDA 2HUPA 2ZJBA 3MHTA 5J5CA 3CNQS 1RLUA 1CC1S 1H6AA 1CQIB 3L1VA 4HWKA 1YDMA 4KMRA 1TAUA 1XVIA 4GLBA 3L43A 4W5NA 1MOPA 1V26A 1Z4JA 3DZFA 1XCBA 4HXEB 4UHEA 2NV6A 3UC9A 2D1FA 2XUGA 3ZEIA 2JATA 3VOSA 1NQWA 4AZ0A 5U4XA 5GZ3A 4H59A 3KAPA 2PK3A 1X7GA 4M83A 2PUDA 4JOCA 4ME6A 4RSMA 5G0SA 1HYQA 4IILA 5FNVF 4CV1A 1H94A 4DYVA 5LMUB 1E9CA 4EY3A 3OQOA 4X7MA 4IIEA 4KYIB 4K0KB 2CLMB 1UPTA 3LV8A 4O2BB 1KYZA 1VI6A 2QL5A 4LBVA 3ZWXA 1W52X 5KJEA 3ONEA 3UH1A 3CLRD 3JD2A 2XZOA 2OAGA 1YULA 4R8VA 4OHYA 4UMFA 4KQHA 2GK7A 2IY9A 4ZVLA 4D42A 4KO4S 3ULKA 4KN8A 1QAOA 1YXMA 2PKRA 5FTJA 5F23A 1UAYA 4NCIA 1A4RA 4RW0A 5DLPA 4JGBA 1ESMA 2VQFB 1HEYA 2NZYA 4HS9A 3L1KA 3QOWA 1AM4D 4TROA 3RJTA 1BMTA 1I2MA 3K0FA 3I9NA 2GRJA 1KEVA 3A58B 1BJRE 3UN1A 4I55B 1OFGA 4D2IA 4TWAA 3IERA 1SKUA 3SG0A 2EKPA 3IS3A 2N75A 5FEMA 3ZHRA 2MT9A 3EPJA 4AN1A 5AIBA 2BBWA 5TEVA 1AJEA 2WFMA 3OTIA 1ZOPA 2NACA 2P0AA 3P0RA 4ICIA 4MGHA 3PNPA 4OJKA 3E9MA 3AIKA 4HAXA 4HY3A 3W4KA 1GGMA 2V45A 1I7LA 2Z43A 3RAJA 3LOQA 3T7AA 5AW3A 4YP0A 1FDSA 2NTYC 5FIUA 1XYVA 1OBVA 1UK9A 2IYWA 1E2LA 3MD0A 4HUTA 5IN4A 5JSFA 4HPJB 4XOUA 1PO7A 3QVVA 4BJ3A 2J0EA 3AVUA 3L8MA 2D3TA 3NEJA 3SZRA 1LWOA 2ZBPA 1EG2A 4XYGA 3WFJA 2I0FA 3HSSA 1K88A 1ZVKA 2LCFA 3ZHQA 1H22A 9LDTA 3RANA 1A0OA 2R6R1 1KBZA 1FZQA 1PL0A 2YYSA 1WPGA 4PLWA 1ZRSA 4I55A 2ID4A 4GC5A 2V9PA 3MGGA 1NFFA 4FGWA 3UWPA 3VU1A 4KH0A 5K8VA 1GCIA 3WK8A 4EPXA 2QYSA 5JY1A 4C6HA 3PQ7A 2BZSA 4GS5A 3ZUPA 1DT3A 1MU0A 5BW5A 4J94A 4X8LA 4JY7A 3B78A 1D8TA 4IO0A 3AUJB 4K2HA 4MLZA 1WAMA 1MZVA 4ETMA 1QHHA 4K9DA 1FIUA 1XTZA 1QZTA 4EUFA 4XWOA 3GZNA 1E64A 3KPVA 3TLKA 4BNUA 1GUBA 1TZKA 4WVLA 4AU1A 2VRCD 4RTRA 2ZRFA 3NCHA 2EKLA 1Q1ZA 4XPIA 2IEGA 1A3CA 3DLBA 4KDEA 1HDZA 1KOJA 2ZBUA 4FZRA 1PNQA 3WWYA 4Y8VA 2FZ5A 1KI8A 4CM8A 1ZD4A 2ALJA 3RHSA 1NX6A 4DEYA 1T36A 1NLYA 2BM9A 3BXGA 1L8AA 3DAFA 4G5OA 4A26A 3IPAA 5C53B 1BMFD 1G5HA 4DR1B 1R6BX 3TH5A 4UEJA 3RAFC 2XMCA 2XHZA 2ODQA 4Y2XA 1XC7A 4IOJA 3SR0A 2FEAA 1T8UA 1DAOA 1JWAB 3D2AA 3PRYA 4B6QA 2QZ4A 1FW6A 1YHYA 3IP7A 4DLYA 5DNVA 1NZDA 3G5LA 2FSFA 1V2GA 5BN4B 2IZ0A 3VHQA 1EVIA 1OZHA 1YRYE 3LTEA 1PYGA 4NBWA 4PXAA 4XWGA 4URZR 1G21B 3M81A 1SRRA 4ZCRA 3QVSA 5DRTA 2WUWE 3DT8A 4F5YA 2I67A 4IIXA 1WU8A 1WP4A 2C78A 4KGZA 2W6CX 1U2EA 1GKUB 5KDLA 3AFNA 3TYXA 3TLEA 2FJUA 4I8DA 4EJMA 4BWVA 4LOIA 3ZJ4A 5DVZA 1MBZA 3VR0A 1W4LA 4ZTZB 3BGDA 2H1FA 5C1BA 5HQTA 4K03A 3PPWA 4M98A 3ZXSA 5HR5A 3KEQA 3GROA 2VJMA 2PPLA 3CUWA 1RWOA 4I9NA 3RRFA 4AROA 5BQ5A 1XBTA 3F3SA 1ZRMA 2W6MA 4MUEA 4D4IA 5B2FA 1WD7A 2AMJA 4CKBB 1M1YE 1OLSA 5C3MA 3TR6A 1TMOA 4YK7A 1UBJS 4JWTA 5GGYA 5IC5A 5KNDH 1BQEA 1YBAA 2H29A 1P74A 2IGTA 5HFAA 1XTRA 4B6JA 4KQWA 3Q2OA 1G8YA 2Y1KA 4L57A 5ERGB 5JQGB 3ABOB 1JR2A 3WQBA 3LWZA 2F6RA 1R0YA 2Z4RA 5BV2P 2HF7A 4RF3A 5FKJA 5FOSA 5CD9A 5LL6P 4EIWA 3E5RA 2R4QA 4L6CA 2WKSA 1U90A 4GNKA 3IUSA 4TKUB 5J9FA 1TMGE 1P9NA 2H4HA 3E3LA 4GYWA 5C8YF 1PT5A 1EDDA 5AW6A 2CJFA 3SOZA 1HM5A 4DDVA 2GQ0A 1FVHA 4DQDA 1V7ZA 2JS7A 1MW9X 1ZS9A 1NQXA 3O84A 4LWOA 4QJ5A 1U7OA 4KFTA 4FC7A 1RLOA 1SCJA 4EM6A 5CD1A 4D45A 4ZAGA 1IZ8A 2PQ6A 4WKCA 5F3DA 3K0CA 2JAPA 2RGNA 3GK3A 4WCFB 2PG3A 3I01A 1V9CA 5TR9A 2X0DA 1RJ9A 2DFPA 2W6QA 4DCMA 3E61A 1ZYUA 4RZHA 4DMUB 4TKUA 1QR6A 2JHAA 5E0OA 1ZN7A 2R7AA 2AN9A 4CEIB 2ZWPA 1X9HA 2FB9A 3UUWA 3RADC 2HWKA 3OZSA 3EBLA 1G16A 1Z0DA 1V6AA 5LMCA 1UJ6A 2XMZA 3W2FA 2XGGA 4TL7A 1FDOA 1E1CA 2ZB7A 4Q4HA 3NHYA 4YAKA 3PEVA 3HDYA 4EQ6B 3SKYA 4H60A 3DA8A 4Z3DA 5TE9A 3RKRA 2QUHA 1Z4KA 3RRBA 3ZS9A 4E2WA 1Q0PA 2HHCA 3C85A 2QRHA 3B6EA 3A9CA 4OQEA 3U3MA 1PT9A 3DPSA 2QAGA 3ZIAA 1J8DA 2OMKA 2R62A 3GRYA 4TMTA 3LDHA 1N0VC 4XQGA 5DBGA 5LWQA 1Z0AA 4CEIA 3OQMA 3D8TA 2C9DA 1RZUA 1DKPA 1VFPA 1YRLA 3ORFA 1H1DA 3FNGA 3Q0IA 3Q7EA 4RK0A 4Y3UA 3HQ4O 3HY4A 1NY5A 1N5IA 2HSEA 4YRTA 3W7VA 2OGUA 1NNEA 1NYLA 3ZJVA 1JKIA 4DJFC 2DXIA 1OWLA 2QTFA 4GSLA 4WFQA 5F1YA 2G63A 1K86A 4G1UC 1H66A 3PPYA 3L7JA 5EMHA 1Z68A 3AHGA 4AX8A 1JYFA 3ZDRA 4C08A 4RM3A 4IVPA 1RHRA 1I2AA 4E4RA 1K8ZB 4JC0A 3SXJA 3ZD7A 3IQFA 1RLIA 1FRZA 5B2EA 1YZUA 1VP3A 3L0DA 1ZCFA 4XQ9A 4XWKA 5JH7F 1GDTA 1SCUA 1XMSA 1QO9A 3ONVA 4UTOA 5SICE 4HLUC 3C3MA 4Q4AA 5DLEA 2HTEA 3D1VA 5FPKA 2ZIXA 4G4SO 1X1RA 1BA2A 3U2QA 4HDSA 2YKGA 2VAWA 2EG5A 1YJAA 4L16A 2X0JA 3LA6A 3EDYA 4R16A 3BZUA 4BRWA 1J9ZA 4WN9A 3A4YA 1Q1NA 1EDEA 4KHPB 2BTQA 3H5LA 2Y0DA 4XD7D 2X19A 2JAOA 3ZZMA 1NOKA 3ZK9A 1UWCA 3IIEA 3SE7A 5DTJA 5BNZA 4W5WA 1HKHA 3P0EA 1XTVA 1W0KA 7AT1A 3TDNA 1CRLA 2BGWA 4KPUB 3F2VA 2OXFA 1EDBA 2Z04A 2XCLA 2G07A 2J7KA 1M1NA 3MOIA 5EEHA 2ZRHA 3PYXA 4JBNA 2J85A 3JALB 4O1IA 3WHLA 2B7BA 4OM8A 4EENA 4L08A 1NMZA 1OKKD 3ENNA 4HFMA 4MA4A 4YFYA 4QYMA 5AK0A 4MUNA 4BNGA 1KHTA 1XRPA 5DTMA 5DOZA 2XE4A 3EZ9A 2VP4A 3HB9A 3JYOA 5AQ1A 1B6GA 2P9JA 2PGJA 1TZCA 5JCXA 3TMAA 3L7DA 4UM7A 2XMBA 1L8OA 1M7GA 5A5EA 4B3FX 1GAEO 2ZYVX 4E46A 2X58A 3IMCA 2GI4A 2PKCA 3TD6A 2J3DA 3THSA 3C4VA 3SKVA 4FYHA 4EPTA 4LZOA 4ZDIA 2FQXA 2OGTA 4QDOA 3CW9A 3C6QA 4KHZA 1A69A 2ONJA 2P90A 3UO8B 3CB4A 2GFIA 4DS3A 2O1WA 4Q93A 1KOGA 1KFKB 2PUVA 1G7SA 3H9GA 4PLVA 5IZCA 1TQHA 4F4UA 4UEWA 4UE3S 2WHYA 1Z6GA 3NT4A 3GNTA 3NHMA 5AW4A 4B3SB 1R6VA 1XIVA 2HCTA 3E48A 4KXXA 1DHRA 3Q3VA 1RKUA 4LI3X 5J4YA 3JS5A 4Q3CA 5DTIA 4BFXA 2K7FA 1X3SA 4KN6A 1Y8QB 2FTKE 2J4CA 2QSJA 4M55A 3DV0A 3ZYZA 1ZJ6A 1IATA 4PVDA 3V1UA 3TO5A 3BMOA 4AK9A 4R5HA 2B3TA 2UUPA 1Y9AA 2W98A 3AF6A 2J5XA 5JO0A 4WD3A 2GMWA 4P3KA 4JFAA 1RZRA 3LSYA 4O4JA 4YREA 4RV9A 4YCNA 2DLCX 3FUUA 4ER0A 2DWOA 3D7KA 2P9QA 3TE7A 3QLVA 4J2OA 1CZUA 3ZE8A 2XUDA 3X1XA 2NU9B 4RC9A 2F55A 4GOMD 2A1TS 3C6XA 2F8SA 1L3BA 3WICA 4EHFA 5HE8A 3ZNPA 5CB6A 2HREA 4N7BA 1LRLA 1YZYA 1RHKA 1X86B 4KYTA 2HHJA 2QL6A 3NKVA 2HADA 5E1DA 4QHSA 3GLHA 5A6SA 1FP7A 3HXMA 2ENWA 2RBGA 3VKGA 4B4UA 3V4RA 3BRWD 2RG7A 1ATZA 4F6LA 3O1JC 3AWDA 3SQXA 5H9WA 3BJZA 2DULA 4RZ3A 3V3KA 1FU4A 4O08A 5K1ZA 3ZZNA 3WA6A 3CY6A 3Q3HA 3EXEB 4NEGA 4I3HA 4WMLA 3X44A 3FRIA 4AJ1A 3ER9A 2PV7A 2ZSDA 4NLLA 1DQYA 3HRHA 3IO5A 1T9BA 5LOVF 4QNMA 1Z8HA 4FDTA 4MYHA 3VTFA 4L5YA 3UMYA 1QRUA 2RH9B 2NMVA 4L0DA 4G1EB 4GH5A 4QJ3A 1M73E 2HA3A 5F52A 4RMGA 3RYHB 1K9SA 4YN3A 4BQFA 5I51A 1UM9A 2L18A 3I09A 4LC1A 2DH6A 1DFHA 3OTHA 2C04A 3D31A 3PUZA 4BIMA 2VATA 1JSRA 5KYXA 3M4XA 2JAWA 2P6PA 4X6XA 2IH2A 1IB6A 1E5TA 3UNXA 4UDYX 1H8EA 3AZOA 1H4SA 2CVOA 3CZCA 3N8DA 1D2RA 3HCWA 5LQDA 1R16A 1ZUNA 5DMHA 3RV4A 3SEZA 3DYIA 3GLFB 1JT2A 2C7BA 2J3QA 5C9ZA 1XDGA 2VJPA 4EHHA 5KSZA 1TB4A 2QX9A 4LKRA 3FVRA 1AZSC 2FG6C 1FUUA 1JYSA 3D8BA 1KFCB 1NMXA 3OM0A 3ZCTA 4LBYA 4KN5A 2FU5C 4WCDA 2PY6A 3R4CA 5PNTA 3TLMA 4KX3A