2XYSA

Crystal structure of aplysia californica achbp in complex with strychnine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title A Structural and Mutagenic Blueprint for Molecular Recognition of Strychnine and D-Tubocurarine by Different Cys-Loop Receptors.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 48
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xysA00
2BYPA 3WTMA 2BG9C 4HFHA 4TWHA 2XZ5A 2BYQA 2YMEA 4QACA 2W8FA 1I9BA 2X00D 2PGZA 4NPPA 5L4EA 2PH9A 4ZRUA 5JMEA 4UXUA 3ZDGA 2XQ9A 4TWDA 3WTLA 3GUAA 5AFHA 3UU5A 3JAEA 4LMKA 4IREA 3TLSA 5SYOA 3U8LA 4AFTA 3U8NA 3P4WA 3LSVA 5LG3A 3C79A 4WV9A 2YMDA 5AFMB 4NZBA 5HEGA 4HFDA 4Z91A 3UU6A 4IL4A 4HFEA 4QAAA 4HFBA 2XZ6A 3UU4A 5J5GA 3RIFA 4X5TA 4EZ1A 3TLTA 5CO5A 4ZR6A 3TLUA 4TWFA 4ZJSA 3U8JA 4UM3S 2BYNA 4AFHA 3UU3A 3SIOA 4XK9A 5LXBA 3UU8A 3WTKA 2XNTA 2WNLA 4A98A 2BR7A 3UQ7A 4BQTA 2XNUA 3WTOA 3C84A 5BP0A 4TNVA 2X00A 4ZJTA 4BFQA 2XQ6A 4QABA 4F8HA 5J0ZA 2WZYA 2W8GA 5BRXA 3UUBA 5HEHA 4A97A 3U8KA 4QH1A 3IGQA 2XQAA 2XYTA 3EI0A 3JADA 2BYRA 4FRRA 4ILAA 2ZJUA 2BG9E 4XHEA 3ZDHA 3JAFA 5AFNA 2XNVA 1UX2A 5IUXA 5TVCA 3ZKRA 5L4HA 5HEJA 2YN6A 2XYSA 3P50A 2Y54A 3TLWA 4UM3P 5CFBA 5AFLA 3UQ4A 3RHWA 4UM3A 3RQWA 4D01A 4DBMA 5AFKA 5L47A 3EHZA 2BJ0A 3EAMA 4QH4A 3TLVA 2WNJA 1UV6A 4LMLA 5KE4A 4ILBA 4ZZCA 2QC1B 3RI5A 2WNCA 5FJVA 4ZK4A 2BR8A 2C9TA 5KZUA 5BW2A 2XQ7A 4Z90A 3SH1A 4QH5A 2XQ3A 5J5IA 3PEOA 5J5HA 2XQ8A 2Y58A 4COFA 2Y57A 3SQ6A 2YKSA 4LMJA 5HEOA 4PIRA 4ILCA 2WN9A 5HCMA 4UY2A 4ZK1A 4HQPA 5HEUA 3WTIA 4ALXA 5AINA 3T4MA 4HFCA 3WTHA 4AFGA 3PMZA 5AFJA 2XQ5A 5HCJA 2UZ6A 2BG9B 2BYSA 4TNWA 2YOEA 2BG9A 2XQ4A 3RIAA 3WTNA 3WTJA 3U8MA 2Y7YA 5J5FA 4HFIA 3RQUA 5AFMA 4B5DA 2VL0A 4IL9A 4UM1A 4ZZBA 2Y56A 3SQ9A 1UW6A 3WIPA 2ZJVA
chains in the Genus database with same CATH superfamily
2BYPA 3WTMA 2BG9C 4HFHA 4TWHA 2XZ5A 2BYQA 2YMEA 4QACA 2W8FA 1I9BA 2X00D 2PGZA 4NPPA 5L4EA 2PH9A 4ZRUA 5JMEA 4UXUA 3ZDGA 2XQ9A 4TWDA 3WTLA 3GUAA 5AFHA 3UU5A 3JAEA 4LMKA 4IREA 3TLSA 5SYOA 3U8LA 4AFTA 3U8NA 3P4WA 3LSVA 5LG3A 3C79A 4WV9A 2YMDA 5AFMB 4NZBA 5HEGA 4HFDA 4Z91A 3UU6A 4IL4A 4HFEA 4QAAA 4HFBA 2XZ6A 3UU4A 5J5GA 3RIFA 4X5TA 4EZ1A 3TLTA 5CO5A 4ZR6A 3TLUA 4TWFA 4ZJSA 3U8JA 4UM3S 2BYNA 4AFHA 3UU3A 3SIOA 4XK9A 5LXBA 3UU8A 3WTKA 2XNTA 2WNLA 4A98A 2BR7A 3UQ7A 4BQTA 2XNUA 3WTOA 3C84A 5BP0A 4TNVA 2X00A 4ZJTA 4BFQA 2XQ6A 4QABA 4F8HA 5J0ZA 2WZYA 2W8GA 5BRXA 3UUBA 5HEHA 4A97A 3U8KA 4QH1A 3IGQA 2XQAA 2XYTA 3EI0A 3JADA 2BYRA 4FRRA 4ILAA 2ZJUA 2BG9E 4XHEA 3ZDHA 3JAFA 5AFNA 2XNVA 1UX2A 5IUXA 5TVCA 3ZKRA 5L4HA 5HEJA 2YN6A 2XYSA 3P50A 2Y54A 3TLWA 4UM3P 5CFBA 5AFLA 3UQ4A 3RHWA 4UM3A 3RQWA 4D01A 4DBMA 5AFKA 5L47A 3EHZA 2BJ0A 3EAMA 4QH4A 3TLVA 2WNJA 1UV6A 4LMLA 5KE4A 4ILBA 4ZZCA 2QC1B 3RI5A 2WNCA 5FJVA 4ZK4A 2BR8A 2C9TA 5KZUA 5BW2A 2XQ7A 4Z90A 3SH1A 4QH5A 2XQ3A 5J5IA 3PEOA 5J5HA 2XQ8A 2Y58A 4COFA 2Y57A 3SQ6A 2YKSA 4LMJA 5HEOA 4PIRA 4ILCA 2WN9A 5HCMA 4UY2A 4ZK1A 4HQPA 5HEUA 3WTIA 4ALXA 5AINA 3T4MA 4HFCA 3WTHA 4AFGA 3PMZA 5AFJA 2XQ5A 5HCJA 2UZ6A 2BG9B 2BYSA 4TNWA 2YOEA 2BG9A 2XQ4A 3RIAA 3WTNA 3WTJA 3U8MA 2Y7YA 5J5FA 4HFIA 3RQUA 5AFMA 4B5DA 2VL0A 4IL9A 4UM1A 4ZZBA 2Y56A 3SQ9A 1UW6A 3WIPA 2ZJVA
chains in the Genus database with same CATH topology
2BYPA 3WTMA 2BG9C 4HFHA 4TWHA 2XZ5A 2BYQA 2YMEA 4QACA 2W8FA 1I9BA 2X00D 2PGZA 4NPPA 5L4EA 2PH9A 4ZRUA 5JMEA 4UXUA 3ZDGA 2XQ9A 4TWDA 3WTLA 3GUAA 5AFHA 3UU5A 3JAEA 4LMKA 4IREA 3TLSA 5SYOA 3U8LA 4AFTA 3U8NA 3P4WA 3LSVA 5LG3A 3C79A 4WV9A 2YMDA 5AFMB 4NZBA 5HEGA 4HFDA 4Z91A 3UU6A 4IL4A 4HFEA 4QAAA 4HFBA 2XZ6A 3UU4A 5J5GA 3RIFA 4X5TA 4EZ1A 3TLTA 5CO5A 4ZR6A 3TLUA 4TWFA 4ZJSA 3U8JA 4UM3S 2BYNA 4AFHA 3UU3A 3SIOA 4XK9A 5LXBA 3UU8A 3WTKA 2XNTA 2WNLA 4A98A 2BR7A 3UQ7A 4BQTA 2XNUA 3WTOA 3C84A 5BP0A 4TNVA 2X00A 4ZJTA 4BFQA 2XQ6A 4QABA 4F8HA 5J0ZA 2WZYA 2W8GA 5BRXA 3UUBA 5HEHA 4A97A 3U8KA 4QH1A 3IGQA 2XQAA 2XYTA 3EI0A 3JADA 2BYRA 4FRRA 4ILAA 2ZJUA 2BG9E 4XHEA 3ZDHA 3JAFA 5AFNA 2XNVA 1UX2A 5IUXA 5TVCA 3ZKRA 5L4HA 5HEJA 2YN6A 2XYSA 3P50A 2Y54A 3TLWA 4UM3P 5CFBA 5AFLA 3UQ4A 3RHWA 4UM3A 3RQWA 4D01A 4DBMA 5AFKA 5L47A 3EHZA 2BJ0A 3EAMA 4QH4A 3TLVA 2WNJA 1UV6A 4LMLA 5KE4A 4ILBA 4ZZCA 2QC1B 3RI5A 2WNCA 5FJVA 4ZK4A 2BR8A 2C9TA 5KZUA 5BW2A 2XQ7A 4Z90A 3SH1A 4QH5A 2XQ3A 5J5IA 3PEOA 5J5HA 2XQ8A 2Y58A 4COFA 2Y57A 3SQ6A 2YKSA 4LMJA 5HEOA 4PIRA 4ILCA 2WN9A 5HCMA 4UY2A 4ZK1A 4HQPA 5HEUA 3WTIA 4ALXA 5AINA 3T4MA 4HFCA 3WTHA 4AFGA 3PMZA 5AFJA 2XQ5A 5HCJA 2UZ6A 2BG9B 2BYSA 4TNWA 2YOEA 2BG9A 2XQ4A 3RIAA 3WTNA 3WTJA 3U8MA 2Y7YA 5J5FA 4HFIA 3RQUA 5AFMA 4B5DA 2VL0A 4IL9A 4UM1A 4ZZBA 2Y56A 3SQ9A 1UW6A 3WIPA 2ZJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYP A;  3WTM A;  2BG9 C;  4HFH A;  4TWH A;  2XZ5 A;  2BYQ A;  2YME A;  4QAC A;  2W8F A;  1I9B A;  2X00 D;  2PGZ A;  4NPP A;  5L4E A;  2PH9 A;  4ZRU A;  5JME A;  4UXU A;  3ZDG A;  2XQ9 A;  4TWD A;  3WTL A;  3GUA A;  5AFH A;  3UU5 A;  3JAE A;  4LMK A;  4IRE A;  3TLS A;  5SYO A;  3U8L A;  4AFT A;  3U8N A;  3P4W A;  3LSV A;  5LG3 A;  3C79 A;  4WV9 A;  2YMD A;  5AFM B;  4NZB A;  5HEG A;  4HFD A;  4Z91 A;  3UU6 A;  4IL4 A;  4HFE A;  4QAA A;  4HFB A;  2XZ6 A;  3UU4 A;  5J5G A;  3RIF A;  4X5T A;  4EZ1 A;  3TLT A;  5CO5 A;  4ZR6 A;  3TLU A;  4TWF A;  4ZJS A;  3U8J A;  4UM3 S;  2BYN A;  4AFH A;  3UU3 A;  3SIO A;  4XK9 A;  5LXB A;  3UU8 A;  3WTK A;  2XNT A;  2WNL A;  4A98 A;  2BR7 A;  3UQ7 A;  4BQT A;  2XNU A;  3WTO A;  3C84 A;  5BP0 A;  4TNV A;  2X00 A;  4ZJT A;  4BFQ A;  2XQ6 A;  4QAB A;  4F8H A;  5J0Z A;  2WZY A;  2W8G A;  5BRX A;  3UUB A;  5HEH A;  4A97 A;  3U8K A;  4QH1 A;  3IGQ A;  2XQA A;  2XYT A;  3EI0 A;  3JAD A;  2BYR A;  4FRR A;  4ILA A;  2ZJU A;  2BG9 E;  4XHE A;  3ZDH A;  3JAF A;  5AFN A;  2XNV A;  1UX2 A;  5IUX A;  5TVC A;  3ZKR A;  5L4H A;  5HEJ A;  2YN6 A;  2XYS A;  3P50 A;  2Y54 A;  3TLW A;  4UM3 P;  5CFB A;  5AFL A;  3UQ4 A;  3RHW A;  4UM3 A;  3RQW A;  4D01 A;  4DBM A;  5AFK A;  5L47 A;  3EHZ A;  2BJ0 A;  3EAM A;  4QH4 A;  3TLV A;  2WNJ A;  1UV6 A;  4LML A;  5KE4 A;  4ILB A;  4ZZC A;  2QC1 B;  3RI5 A;  2WNC A;  5FJV A;  4ZK4 A;  2BR8 A;  2C9T A;  5KZU A;  5BW2 A;  2XQ7 A;  4Z90 A;  3SH1 A;  4QH5 A;  2XQ3 A;  5J5I A;  3PEO A;  5J5H A;  2XQ8 A;  2Y58 A;  4COF A;  2Y57 A;  3SQ6 A;  2YKS A;  4LMJ A;  5HEO A;  4PIR A;  4ILC A;  2WN9 A;  5HCM A;  4UY2 A;  4ZK1 A;  4HQP A;  5HEU A;  3WTI A;  4ALX A;  5AIN A;  3T4M A;  4HFC A;  3WTH A;  4AFG A;  3PMZ A;  5AFJ A;  2XQ5 A;  5HCJ A;  2UZ6 A;  2BG9 B;  2BYS A;  4TNW A;  2YOE A;  2BG9 A;  2XQ4 A;  3RIA A;  3WTN A;  3WTJ A;  3U8M A;  2Y7Y A;  5J5F A;  4HFI A;  3RQU A;  5AFM A;  4B5D A;  2VL0 A;  4IL9 A;  4UM1 A;  4ZZB A;  2Y56 A;  3SQ9 A;  1UW6 A;  3WIP A;  2ZJV A; 
#chains in the Genus database with same CATH topology
 2BYP A;  3WTM A;  2BG9 C;  4HFH A;  4TWH A;  2XZ5 A;  2BYQ A;  2YME A;  4QAC A;  2W8F A;  1I9B A;  2X00 D;  2PGZ A;  4NPP A;  5L4E A;  2PH9 A;  4ZRU A;  5JME A;  4UXU A;  3ZDG A;  2XQ9 A;  4TWD A;  3WTL A;  3GUA A;  5AFH A;  3UU5 A;  3JAE A;  4LMK A;  4IRE A;  3TLS A;  5SYO A;  3U8L A;  4AFT A;  3U8N A;  3P4W A;  3LSV A;  5LG3 A;  3C79 A;  4WV9 A;  2YMD A;  5AFM B;  4NZB A;  5HEG A;  4HFD A;  4Z91 A;  3UU6 A;  4IL4 A;  4HFE A;  4QAA A;  4HFB A;  2XZ6 A;  3UU4 A;  5J5G A;  3RIF A;  4X5T A;  4EZ1 A;  3TLT A;  5CO5 A;  4ZR6 A;  3TLU A;  4TWF A;  4ZJS A;  3U8J A;  4UM3 S;  2BYN A;  4AFH A;  3UU3 A;  3SIO A;  4XK9 A;  5LXB A;  3UU8 A;  3WTK A;  2XNT A;  2WNL A;  4A98 A;  2BR7 A;  3UQ7 A;  4BQT A;  2XNU A;  3WTO A;  3C84 A;  5BP0 A;  4TNV A;  2X00 A;  4ZJT A;  4BFQ A;  2XQ6 A;  4QAB A;  4F8H A;  5J0Z A;  2WZY A;  2W8G A;  5BRX A;  3UUB A;  5HEH A;  4A97 A;  3U8K A;  4QH1 A;  3IGQ A;  2XQA A;  2XYT A;  3EI0 A;  3JAD A;  2BYR A;  4FRR A;  4ILA A;  2ZJU A;  2BG9 E;  4XHE A;  3ZDH A;  3JAF A;  5AFN A;  2XNV A;  1UX2 A;  5IUX A;  5TVC A;  3ZKR A;  5L4H A;  5HEJ A;  2YN6 A;  2XYS A;  3P50 A;  2Y54 A;  3TLW A;  4UM3 P;  5CFB A;  5AFL A;  3UQ4 A;  3RHW A;  4UM3 A;  3RQW A;  4D01 A;  4DBM A;  5AFK A;  5L47 A;  3EHZ A;  2BJ0 A;  3EAM A;  4QH4 A;  3TLV A;  2WNJ A;  1UV6 A;  4LML A;  5KE4 A;  4ILB A;  4ZZC A;  2QC1 B;  3RI5 A;  2WNC A;  5FJV A;  4ZK4 A;  2BR8 A;  2C9T A;  5KZU A;  5BW2 A;  2XQ7 A;  4Z90 A;  3SH1 A;  4QH5 A;  2XQ3 A;  5J5I A;  3PEO A;  5J5H A;  2XQ8 A;  2Y58 A;  4COF A;  2Y57 A;  3SQ6 A;  2YKS A;  4LMJ A;  5HEO A;  4PIR A;  4ILC A;  2WN9 A;  5HCM A;  4UY2 A;  4ZK1 A;  4HQP A;  5HEU A;  3WTI A;  4ALX A;  5AIN A;  3T4M A;  4HFC A;  3WTH A;  4AFG A;  3PMZ A;  5AFJ A;  2XQ5 A;  5HCJ A;  2UZ6 A;  2BG9 B;  2BYS A;  4TNW A;  2YOE A;  2BG9 A;  2XQ4 A;  3RIA A;  3WTN A;  3WTJ A;  3U8M A;  2Y7Y A;  5J5F A;  4HFI A;  3RQU A;  5AFM A;  4B5D A;  2VL0 A;  4IL9 A;  4UM1 A;  4ZZB A;  2Y56 A;  3SQ9 A;  1UW6 A;  3WIP A;  2ZJV A; 
#chains in the Genus database with same CATH homology
 2BYP A;  3WTM A;  2BG9 C;  4HFH A;  4TWH A;  2XZ5 A;  2BYQ A;  2YME A;  4QAC A;  2W8F A;  1I9B A;  2X00 D;  2PGZ A;  4NPP A;  5L4E A;  2PH9 A;  4ZRU A;  5JME A;  4UXU A;  3ZDG A;  2XQ9 A;  4TWD A;  3WTL A;  3GUA A;  5AFH A;  3UU5 A;  3JAE A;  4LMK A;  4IRE A;  3TLS A;  5SYO A;  3U8L A;  4AFT A;  3U8N A;  3P4W A;  3LSV A;  5LG3 A;  3C79 A;  4WV9 A;  2YMD A;  5AFM B;  4NZB A;  5HEG A;  4HFD A;  4Z91 A;  3UU6 A;  4IL4 A;  4HFE A;  4QAA A;  4HFB A;  2XZ6 A;  3UU4 A;  5J5G A;  3RIF A;  4X5T A;  4EZ1 A;  3TLT A;  5CO5 A;  4ZR6 A;  3TLU A;  4TWF A;  4ZJS A;  3U8J A;  4UM3 S;  2BYN A;  4AFH A;  3UU3 A;  3SIO A;  4XK9 A;  5LXB A;  3UU8 A;  3WTK A;  2XNT A;  2WNL A;  4A98 A;  2BR7 A;  3UQ7 A;  4BQT A;  2XNU A;  3WTO A;  3C84 A;  5BP0 A;  4TNV A;  2X00 A;  4ZJT A;  4BFQ A;  2XQ6 A;  4QAB A;  4F8H A;  5J0Z A;  2WZY A;  2W8G A;  5BRX A;  3UUB A;  5HEH A;  4A97 A;  3U8K A;  4QH1 A;  3IGQ A;  2XQA A;  2XYT A;  3EI0 A;  3JAD A;  2BYR A;  4FRR A;  4ILA A;  2ZJU A;  2BG9 E;  4XHE A;  3ZDH A;  3JAF A;  5AFN A;  2XNV A;  1UX2 A;  5IUX A;  5TVC A;  3ZKR A;  5L4H A;  5HEJ A;  2YN6 A;  2XYS A;  3P50 A;  2Y54 A;  3TLW A;  4UM3 P;  5CFB A;  5AFL A;  3UQ4 A;  3RHW A;  4UM3 A;  3RQW A;  4D01 A;  4DBM A;  5AFK A;  5L47 A;  3EHZ A;  2BJ0 A;  3EAM A;  4QH4 A;  3TLV A;  2WNJ A;  1UV6 A;  4LML A;  5KE4 A;  4ILB A;  4ZZC A;  2QC1 B;  3RI5 A;  2WNC A;  5FJV A;  4ZK4 A;  2BR8 A;  2C9T A;  5KZU A;  5BW2 A;  2XQ7 A;  4Z90 A;  3SH1 A;  4QH5 A;  2XQ3 A;  5J5I A;  3PEO A;  5J5H A;  2XQ8 A;  2Y58 A;  4COF A;  2Y57 A;  3SQ6 A;  2YKS A;  4LMJ A;  5HEO A;  4PIR A;  4ILC A;  2WN9 A;  5HCM A;  4UY2 A;  4ZK1 A;  4HQP A;  5HEU A;  3WTI A;  4ALX A;  5AIN A;  3T4M A;  4HFC A;  3WTH A;  4AFG A;  3PMZ A;  5AFJ A;  2XQ5 A;  5HCJ A;  2UZ6 A;  2BG9 B;  2BYS A;  4TNW A;  2YOE A;  2BG9 A;  2XQ4 A;  3RIA A;  3WTN A;  3WTJ A;  3U8M A;  2Y7Y A;  5J5F A;  4HFI A;  3RQU A;  5AFM A;  4B5D A;  2VL0 A;  4IL9 A;  4UM1 A;  4ZZB A;  2Y56 A;  3SQ9 A;  1UW6 A;  3WIP A;  2ZJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...