2XZEA

Structural basis for amsh-escrt-iii chmp3 interaction
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
141
structure length
141
Chain Sequence
SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAM-BINDING PROTEIN
publication title Structural Basis for Escrt-III Chmp3 Recruitment of Amsh.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein transport
total genus 53
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08969 USP8_dimer USP8 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2xzeA00
2JQ9A 2MPKA 3K1SA 4U2ZA 4U2YA 3ZT7A 4CN4A 2CRBA 2LRLA 2RPAA 2V6YA 2WY2A 2CPTA 3EABA 4U33A 4A5XA 2A9UA 2XZEA 1WFDA 3ZSSA 5LB7B 2LRKA 5FVLA 2V6YB 4ZEYA 2K3WA 1WCRA 2W2UA 4U31A 4CN1A 5CJ5A 5FVKA 4U7IA 4CN6A 5CGMA 4U3CA 2JQHA 2JQKA 2WWVA 4NIQA 2DL1A 1WR0A 4P1NA 4IT4A 4U7YA 4WZXA 3ZT6A 3ZSTA 1YXRA 2V6XA 3ZT5A
chains in the Genus database with same CATH superfamily
3UUMA 2YINA 2EHOC 3ZT7A 2W00A 1WFDA 3AECA 2ZM6T 3MXZA 1WCRA 2E9XB 4IE7A 4CXYA 4DR5T 3RIUA 2YDRA 4O4HE 1W9RA 1X79A 5HWYA 3PTRB 3PJAA 3T1HT 3P4RA 5L3CB 2C0SA 1MMAA 2VQFT 3T1YT 3UU5A 3ETVA 4ZHQE 5HXHA 3UUBA 3AAIA 4JI7T 1IJ5A 4QX7B 2ZM0A 3VRAA 3Q5DA 3B57A 3Q5WA 3ZSSA 4C91A 3IHRA 3CPZA 4ZEYA 2E8IA 2UUBT 1UCUA 3ZYKA 3HKBE 2BS3A 2X51A 3W15B 3O1HA 4ZI2D 2MTQA 3ZYLA 1HTJF 3OYXA 5AQRB 4FI5A 2X9HA 2L9QA 2BVLA 2HPJA 4YTNA 1D1BA 5LHIB 1VRBA 3EDUA 4DV4T 1S94A 5AQSB 4I0UA 4IREA 5A1LA 3ZT5A 3P50A 3AE9A 4QWNB 3CX6B 2XZEA 2C5JA 5EK4A 3NWIA 2JMHA 5LG4A 4DR6T 4J2CA 3N9OA 5HAXA 4LF9T 2V5DA 5FY0A 1E2AA 4AI6A 2WMNA 4HFDA 4H9NC 1J5ET 4P0BA 1Y01A 3I9YA 3RQWA 4IT4A 4H9PC 4JLEA 2W4XA 1NENA 4LF8T 1ZP0A 5EK2A 4LMJA 3P4QA 2V7MA 4O2BE 1UUSA 2VKDA 2CEAA 5AQNB 4TV8E 2M67A 5IWAT 2JQKA 2V1DB 3KVAA 4O4JE 1XDPA 5AQPB 3RKOA 5LA6E 2CCQA 2V6XA 2JQ9A 2D9DA 3ZJ2A 4I4TE 3KV6A 4PAGA 4IDPA 2VB6A 2W2UA 3NKZA 2EHOA 4ERRA 4KX6A 4ILCA 5AQHB 3HL6A 5JRCA 4WYVA 3EDVA 5BR8T 2EHOD 3QB5K 4N78D 2WS3A 4AKRB 4JI0T 5ETWA 1ZKEA 3L3PA 4GYSA 3UFGA 1ZEEA 2KXPB 3CK6A 3F57A 2UXNB 4I55E 1D1AA 2LM9A 2H7VC 3PUVF 3FZLB 5HEJA 3K3NA 3C64A 4UELA 2Q9QC 5CB4E 1W0BA 5F8PA 4M1PA 2E5VA 2JJ9A 4ISSA 2XQ9A 4CN1A 2WMOA 2KLQA 5LMUT 1YQ3A 2LSJA 3GA8A 4DUZT 2XAJB 2BZBA 1HNWT 1CHUA 4LMLA 2IC6A 3UULA 4DMWA 3TLVA 2CXLA 4YHHT 3UQ7A 3PUGA 2VL0A 4PNIA 5AQUB 4X20E 3C51A 1XNQT 3SFDA 2LKGA 2YK0A 4QXBB 2I59A 2D5UA 2CM0A 4B3MT 2ZM2A 2WU5A 4QHOA 2CLYB 3MK7C 2JPFA 2AXDS 1HX8A 2L3LA 3EAMA 2BKNA 5ABFB 5HCMA 5L3BB 3FZKB 4FJOA 5LYJE 5LP6E 2PTFA 5CJ5A 4U33A 3BK9A 4ZI7E 4XBFB 4X65T 5FVLA 4JI5T 4U7IA 2N9DA 2UUAT 1O3XA 4AQGA 2KMFA 3AE7A 3N9NA 2V7KA 3TLUA 4U2ZA 5LMNT 1FEWA 3N5LA 2LT3A 1OXZA 1H7CA 2LRKA 4ILAA 3VR8A 5FMNA 4DR4T 4PJMA 2SPCA 3RPUA 3CQCB 3IF8B 2QVAA 2X0YA 1YXRA 4QKNA 4IL4A 3DJBA 2LSIA 4PK5A 4OHFA 3M3ZB 5CGMA 2K9AA 3KFWX 4KHPT 4P0AA 3ZSTA 5JDMA 4MFRA 3RI5A 3ZEFB 2WCAA 3QC9A 4EYYR 4U2YA 3QK6A 4DNDA 4HFHA 2XM1A 4ADZA 4X1IE 4TUYE 2Q9QA 2WU2A 4KUMB 3ZYMA 3EI0A 4P1NA 3ZLIA 4GYRA 3FBZA 3UU8A 2Q9QD 4CQIA 3ZC1A 4HFEA 2D0TA 4UVBB 4C90A 3L09A 2YEVC 2NR4A 2LSGA 4PFPA 4HKAA 4L5GA 4IHJE 2WWUA 3R6NA 2KNDA 4ISTA 4TWHA 2LM2A 3SRZA 2UU9T 4JYAT 4JI4T 3A8YC 1KK7A 1G73A 5FY7A 4HWCA 3N2GE 2X9XA 2ODVA 4UF0A 5L3EB 4TWDA 3K1SA 2DI4A 4U72A 3WAJA 5EK3A 1HF8A 2UXDT 3C4WA 1OEDC 4G2AA 5HEHA 4ZOLE 2CHNA 3OVUA 3LFMA 4NIQA 4A56A 4IDQA 2YN6A 1FMWA 2XSAA 3U78A 4IGUA 3FHNA 2J4GA 2XTLA 3ZMUB 4X62T 1I6ZA 3LDQB 3AVRA 4DV7T 3UTKA 2FJBA 2HN2A 2KWHA 3UUXB 3RYHE 3QB5A 5LCYA 2YKSA 3AA7B 2PBIA 4EV6A 2UXBT 4LF7T 4LF5T 2HN1A 2IDOB 5JTGA 2V5CA 2WWVA 3O1JA 1WRDA 1WYBA 4H63V 5DABA 3AEBA 2NWBA 4AKGA 2XAFB 3AE4A 2ACZA 4KP3C 2JQHA 1R8IA 3CX8B 4Z90A 1CUNA 4U7YA 3AE1A 4UR9A 1GQEA 4TN7B 1FIOA 5EZYE 4QXHB 4JI2T 3HR0A 5L3GB 3SFEA 4CXXA 4JUYA 1HG5A 2K24A 1XNRT 1B7TA 2IMLA 4P09A 1OEDE 4AQFC 2CHOA 4QXCB 5FYMA 2X67A 3I1AA 2BG9C 2VVNA 4DIDB 4CN4A 5LG3A 1KNZA 3NBXX 2QA7A 4WNKA 2BDEA 2JIWA 3AEAA 1U5PA 4E7ZA 4HWIB 2VWAA 3M65A 1HCIA 3VRBA 3WAKA 4PK4A 3SS1A 4PK6A 3ZJ1A 2V6YB 4IE5A 4YTPA 2NTYA 1QLBA 1OEDA 2XUEA 4DV2T 3C4XA 3PUAA 3ZC0A 1ZHCA 5DQWA 5HEOA 3H3AA 2XQ3A 2K5BB 3KV4A 1W0AA 4LF4T 5H6QB 3J7Yq 3PDYA 5LJMA 4LMKA 2NTXA 5AQJB 4DR7T 3PJAJ 2CRBA 5LXTE 4G63A 1YKEB 4UIGA 5JR9A 3O1IA 5C8YE 3RRCA 3AAAB 4NPPA 5FVKA 3BQLA 1DU2A 4MHCA 4O2AE 2M6BA 2BKPA 4XAXB 2KZ7B 5E0OA 1N32T 2GK9A 3UU4A 2H3RA 3KDSE 4TNVA 2BG9E 3J9X1 5AFUL 4IIJE 4GKJT 3LJCA 3CX7B 3UU6A 3PUYF 4K0KT 2DWKA 2WDVA 2H7OA 4ZZCA 5FL1A 4OYKA 3JAFA 4QH4A 4JI6T 1WR6A 3ETUA 4JEHB 4ZXLA 2CBJA 1VOMA 2BVMA 4X64T 4OK0A 3D0TA 2J62A 3AXJB 3SWHA 2YDQA 4EXTA 3K3QC 4UVAB 2NP9A 3ABVA 4X5TA 4BA9A 1KNRA 3FZFB 2OLTA 2PFVA 2WY2A 4GK0E 2DNXA 5LJNA 4B3TT 3RYCE 2BG9A 3QUJA 2YU1A 4O4IE 3C50A 3PE0A 1IBMT 3I9WA 4EB6E 5J2TE 4ZZBA 2PG8A 4A97A 4B6XA 2E9XC 1T72A 4KI0F 3C98B 3CQGB 3ZT6A 4LF6T 1LKXA 2ZMAA 3H37A 2RPAA 1JNZA 3GN5A 5FXXA 2UUCT 3IA3A 3KV9A 1XMQT 3B5MA 4TV9E 1L0VA 4YJ2E 2CA5A 5FXVA 1UK5A 2FJEA 3QNUA 5LNKA 3ESLA 3GMIA 2UXCT 5FKYA 2P9BA 1MNDA 5LGTB 2RA1A 2VVSA 3ZN0B 5F3JA 4O4LE 5GONE 5AQTB 3CQXC 2RP4A 1WLXA 3RF1A 4JBWF 1SA0E 4YTMA 2MPKA 1HS7A 2W61A 4TZ4C 3CIRA 1EZ3A 1KEYA 2LLYA 2MAWA 3ANWA 2WAUA 3NRXA 2MOZA 3PU8A 4DV3T 2ZLYA 3E08A 2YU2A 2XAQB 2X66A 1V9DA 2X9WA 3MJXA 1J1JA 1UX4A 2LSKA 2K48A 2X0HA 2IW5B 1SUMB 3FBLA 1N34T 4ANJA 1E1HB 3VR9A 2WZIA 3VHLA 5KXJA 3Q2MA 4HFIA 2WDRA 4EOZB 4IE6A 2KINB 2NW9A 3KBUA 1T8BA 5JR9B 1HNXT 1IBKT 4ZS3A 5C3JA 2I6HA 2XAGB 3PU3A 3OKQA 5L4EA 4DBQA 4YXDA 4HN9A 4DUYT 5IUXA 4GOUA 4DR3T 4JEUB 3OYZA 5FY1A 4HGAA 1VCTA 1J5WA 2VKJA 3N9QA 3LBXA 3QOFA 2JQQA 1BR1A 3F31A 2LEHA 1LRZA 3JAEA 3ZMSB 3F2EA 1UURA 3RYFE 3EABA 2E9XA 5LHHB 2OV9A 2NW7A 5HXRA 5LBQB 1T98A 2IC9A 2EHOB 2E9XD 4MALA 1KFYA 3AE6A 1AJ3A 4LFAT 5JRCB 4YY3T 4DMVA 3PUQA 1MIYA 3JADA 4AKHA 4HTEA 2WSSV 4HWHA 4DV0T 1XMOT 1MMGA 3OPCA 1HR0T 4KHZF 1E7PA 4AKIA 4JI3T 4ILUA 1QSDA 5FL0A 5ABHA 2G0UA 5ADXL 2A3DA 2W0GA 3RIAA 4ZS2A 4PJLA 5LHGB 4NXNT 1IAPA 3BQKA 3E0ZA 2WM9A 2WZHA 4EZ4A 4OX9T 3HKDE 3O9XA 4H9QC 4DV1T 1MIVA 2LHNA 2A2FX 4WW0A 1XWMA 2CLYC 2MYSA 2XQ4A 3ONXA 3KBTA 3UFEA 2CWYA 3FXEB 2LSYA 4JI1T 4OFZA 1ZV4X 3PUWF 2M6IA 5HXCA 1U4QA 3AE3A 3P8CD 2HHHT 4YSZA 2F4VT 3VKGA 3G06A 3P4SA 2IHR1 4YLHA 5JH7E 4UV9B 3R84B 5LGNB 2V7IA 1D0YA 2XQ7A 1YD8G 3MA9A 4NUUA 3ZCJA 3P7IA 2FUPA 4H9OC 1I94T 1HG2A 2BKOA 3AEEA 2JRKA 4AISA 4EGWA 3MACA 5IHYA 4GK5E 4WBNE 4I43B 5HWXA 5CA0E 5AQMB 2V8SV 2VKOA 3JCFA 3UUNA 3BQIA 4PJJA 1S35A 3GWHA 4YSXA 4DR2T 3UQ4A 2FBWA 2JMKA 3KV5A 4F8HA 3Q9DA 2X0LB 5AQOB 4HEAA 4H9SE 1M7KA 2C5KT 4PW8A 4Z91A 3N9PA 3PUZF 5FNVE 2K3WA 5L2LA 1QUUA 5J1GA 4EIWA 4EEBA 5JDLA 3EVYA 5C2TA 1WR0A 3JC6D 5L3FB 2CE7A 4UXNB 3AA6B 3T8OA 1BR2A 3N9MA 4HFCA 1X9BA 2QYWA 4MLKA 2VL8A 1Z0PA 3VKHA 1MMNA 4DBRA 1FMVA 2Q9QB 5DJQC 2UXXB 1MNEA 2OA5A 2W66A 4IDZA 3RYIE 2XQAA 3Q5XA 3FB2A 3OTOT 3N2OA 3KINB 4V1Av 4WBOA 2X9YA 2LJLA 4HE8A 4I50E 5KDMC 4DV6T 2IAKA 3LK42 3RX6A 5HEGA 2ODUA 2A9UA 4A98A 4UVCB 2VQET 4HFBA 5ABFA 1IBLT 3LK2B 3AEDA 3A7MA 3PV0F 1YQ4A 2DL1A 2N2NA 4XZCA 3ZMVB 4AXPA 4UV8B 4BJMA 2LKHA 3L8RA 3CVRA 5ABGA 4UF0B 3PUSA 4ILBA 1N36T 1SE7A 2QRXA 5H6RB 5ABEA 2XPKA 1HNZT 2CXFA 2XASB 5HCJA 3V5SA 4B3ST 2W62A 4JI8T 3N2KE 5HXSA 4QH1A 5FXWA 5CA1E 2PJQA 4OYJA 5J0ZA 2XAHB 4DVDA 3ZMZB 2KT9A 2FJAA 2NW8A 2CBIA 3L39A 4YHJA 2A72A 1UX5A 4A5XA 3ONJA 2XY8B 4U74A 3O4XE 2WDQA 2B1EA 2XJ7A 4PFOA 1VCSA 3AA1B 4YJ3E 2DLRA 3KVBA 5JDFA 1D0ZA 1N33T 3ZPOA 4AQFA 5HEUA 2NOXA 2CPTA 1D0XA 2W63A 5AQVB 3TKLB 3NVOA 4HFVA 3OBVE 2LE8A 5JREA 3X1DA 4X66T 3NZPA 4CXWA 5LGUB 2I0MA 5JVDE 1MIWA 4UEMA 2WBLA 3B13A 2IUBA 4NUVA 3TLWA 5AQFB 4CZZB 2V7LA 3DTOA 3FXDB 4AQYT 1T7SA 1W09A 3TLTA 1KNPA 4BAYB 3RC8A 4Z8XA 2BBHA 3LSVA 4BJNA 2XQ8A 3NZQA 4JV5T 3N9LA 2LOPA 4ZI3C 4E7SA 3K8PC 1NEKA 1IJ6A 4PJNA 5IYZE 5FXZA 4CI1B 3P4PA 2Y6XA 3E22E 1WYCA 5LBMA 4X1YE 2Y8DA 3P4WA 1XDOA 1MMDA 4U31A 3ZKRA 4H63H 3Q5EA 1YKHB 3LG7A 3PUXF 2W67A 2XM2A 3AEFA 3HI2A 2D2SA 4X1KE 2KSRA 5L47A 4LFCT 1OEDB 2ES0A 3DP7A 4Q25A 4KBMB 2E2AA 4EAHA 3NRYA 1US7B 1LVFA 4ASKA 5DQVA 1YW0A 4IL9A 2CWOA 1HFAA 3AVSA 4TNWA 3CMLA 2XQYA 4DR1T 4CI3B 2AE9A 4MBQA 4IDOA 3WI3A 4IE4A 3AA0B 2HH7A 5LB7B 4IE0A 4IDNA 3VU7H 3AE5A 4GIWA 2YOEA 2MBGA 2XSBA 3RKGA 4DO0A 2V26A 5LOVE 4B3RT 2LHRA 4YSYA 2VK9A 5J2UE 2YDSA 3AAEB 3HKCE 4DV5T 5M4YA 4TWFA 3LK3B 2VKHA 3AB3B 3A5XA 3RC3A 5AQGB 3HA4A 5JDQA 2WQYA 2CXDA 5BMVE 1NAFA 1OWAA 1BR0A 3JC6C 4WZXA 2HPLA 1UGOA 3H3MA 2LRLA 4YT0A 1KF6A 5JDGA 1IZNB 3RLFF 2V7JA 5L4HA 4CI2B 5AQLB 3ONLC 2BG9B 1Y64B 2VURA 2IIUA 1M62A 2DWGA 3RIFA 4HWDA 2VASA 3UT5E 4TX5A 3PURA 2LOSA 2V6YA 4LFBT 3I0OA 3GN5B 3RIUC 2J1DG 5L3DB 4ZI3D 1HX1B 4H9RC 3S4UA 2R6GF 2ZM8A 2CMRA 3U3IA 5JDHA 2WB5A 3FZMB 3I0QA 4QX8B 3CKDA 3MZKB 5AQKB 3TLSA 2X68A 2B76A 3EUHA 4YFSA 4AKLA 2KWIB 2XHEB 4AIUA 2BS2A 3V5UA 3RHWA 4ZI2C 4KMCA 3RGLA 4HWFA 5JQGE 4F6RC 5AQIB 4EZHA 2H89A 3RRWA 1G8XA 3AEGA 3SOLA 5HXEA 2FJDA 2C5IT 4EEDA 3ZMTB 3ANWB 5HYAA 2H88A 2N1GA 3CWZB 5JDNA 3IBPA 1LVKA 3IEEA 2BS4A 2J47A 2Y48B 5FP3A 3K3OA 4NXMT 3RQUA 3ZN1B 1ZOYA 3UU3A 2D0UA 2Z6EA 3OJAA 3EHZA 4CN6A 5CFBA 3AE2A 4L9IA 1SHZC 4COFA 1Z8UA 5KX5E 5JR9C 2E5LT 1NWMX 5TAOA 2ACXA 3RH3A 2XQ5A 5F5WA 3AE8A 2XQ6A 4QH5A 2DCFA 3AXJA 2QGSA 4EYUA 3ZCIA 2DHRA 1D1CA 4K0UA 3C4ZA 1FJGT 3FZHB 2L8KA 4O8SA 3HKEE 2BBJA 1JNRA 3MKDA 2WP9A 5KMGP 1BR4A 4U3CA 4GKKT 1XZYA 4L0RA 5AQQB 3LBXB
chains in the Genus database with same CATH topology
2JQ9A 2MPKA 3K1SA 4U2ZA 4U2YA 3ZT7A 4CN4A 2CRBA 2LRLA 2RPAA 2V6YA 2WY2A 2CPTA 3EABA 4U33A 4A5XA 2A9UA 2XZEA 1WFDA 3ZSSA 5LB7B 2LRKA 5FVLA 2V6YB 4ZEYA 2K3WA 1WCRA 2W2UA 4U31A 4CN1A 5CJ5A 5FVKA 4U7IA 4CN6A 5CGMA 4U3CA 2JQHA 2JQKA 2WWVA 4NIQA 2DL1A 1WR0A 4P1NA 4IT4A 4U7YA 4WZXA 3ZT6A 3ZSTA 1YXRA 2V6XA 3ZT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQ9 A;  2MPK A;  3K1S A;  4U2Z A;  4U2Y A;  3ZT7 A;  4CN4 A;  2CRB A;  2LRL A;  2RPA A;  2V6Y A;  2WY2 A;  2CPT A;  3EAB A;  4U33 A;  4A5X A;  2A9U A;  2XZE A;  1WFD A;  3ZSS A;  5LB7 B;  2LRK A;  5FVL A;  2V6Y B;  4ZEY A;  2K3W A;  1WCR A;  2W2U A;  4U31 A;  4CN1 A;  5CJ5 A;  5FVK A;  4U7I A;  4CN6 A;  5CGM A;  4U3C A;  2JQH A;  2JQK A;  2WWV A;  4NIQ A;  2DL1 A;  1WR0 A;  4P1N A;  4IT4 A;  4U7Y A;  4WZX A;  3ZT6 A;  3ZST A;  1YXR A;  2V6X A;  3ZT5 A; 
#chains in the Genus database with same CATH topology
 3UUM A;  2YIN A;  2EHO C;  3ZT7 A;  2W00 A;  1WFD A;  3AEC A;  2ZM6 T;  3MXZ A;  1WCR A;  2E9X B;  4IE7 A;  4CXY A;  4DR5 T;  3RIU A;  2YDR A;  4O4H E;  1W9R A;  1X79 A;  5HWY A;  3PTR B;  3PJA A;  3T1H T;  3P4R A;  5L3C B;  2C0S A;  1MMA A;  2VQF T;  3T1Y T;  3UU5 A;  3ETV A;  4ZHQ E;  5HXH A;  3UUB A;  3AAI A;  4JI7 T;  1IJ5 A;  4QX7 B;  2ZM0 A;  3VRA A;  3Q5D A;  3B57 A;  3Q5W A;  3ZSS A;  4C91 A;  3IHR A;  3CPZ A;  4ZEY A;  2E8I A;  2UUB T;  1UCU A;  3ZYK A;  3HKB E;  2BS3 A;  2X51 A;  3W15 B;  3O1H A;  4ZI2 D;  2MTQ A;  3ZYL A;  1HTJ F;  3OYX A;  5AQR B;  4FI5 A;  2X9H A;  2L9Q A;  2BVL A;  2HPJ A;  4YTN A;  1D1B A;  5LHI B;  1VRB A;  3EDU A;  4DV4 T;  1S94 A;  5AQS B;  4I0U A;  4IRE A;  5A1L A;  3ZT5 A;  3P50 A;  3AE9 A;  4QWN B;  3CX6 B;  2XZE A;  2C5J A;  5EK4 A;  3NWI A;  2JMH A;  5LG4 A;  4DR6 T;  4J2C A;  3N9O A;  5HAX A;  4LF9 T;  2V5D A;  5FY0 A;  1E2A A;  4AI6 A;  2WMN A;  4HFD A;  4H9N C;  1J5E T;  4P0B A;  1Y01 A;  3I9Y A;  3RQW A;  4IT4 A;  4H9P C;  4JLE A;  2W4X A;  1NEN A;  4LF8 T;  1ZP0 A;  5EK2 A;  4LMJ A;  3P4Q A;  2V7M A;  4O2B E;  1UUS A;  2VKD A;  2CEA A;  5AQN B;  4TV8 E;  2M67 A;  5IWA T;  2JQK A;  2V1D B;  3KVA A;  4O4J E;  1XDP A;  5AQP B;  3RKO A;  5LA6 E;  2CCQ A;  2V6X A;  2JQ9 A;  2D9D A;  3ZJ2 A;  4I4T E;  3KV6 A;  4PAG A;  4IDP A;  2VB6 A;  2W2U A;  3NKZ A;  2EHO A;  4ERR A;  4KX6 A;  4ILC A;  5AQH B;  3HL6 A;  5JRC A;  4WYV A;  3EDV A;  5BR8 T;  2EHO D;  3QB5 K;  4N78 D;  2WS3 A;  4AKR B;  4JI0 T;  5ETW A;  1ZKE A;  3L3P A;  4GYS A;  3UFG A;  1ZEE A;  2KXP B;  3CK6 A;  3F57 A;  2UXN B;  4I55 E;  1D1A A;  2LM9 A;  2H7V C;  3PUV F;  3FZL B;  5HEJ A;  3K3N A;  3C64 A;  4UEL A;  2Q9Q C;  5CB4 E;  1W0B A;  5F8P A;  4M1P A;  2E5V A;  2JJ9 A;  4ISS A;  2XQ9 A;  4CN1 A;  2WMO A;  2KLQ A;  5LMU T;  1YQ3 A;  2LSJ A;  3GA8 A;  4DUZ T;  2XAJ B;  2BZB A;  1HNW T;  1CHU A;  4LML A;  2IC6 A;  3UUL A;  4DMW A;  3TLV A;  2CXL A;  4YHH T;  3UQ7 A;  3PUG A;  2VL0 A;  4PNI A;  5AQU B;  4X20 E;  3C51 A;  1XNQ T;  3SFD A;  2LKG A;  2YK0 A;  4QXB B;  2I59 A;  2D5U A;  2CM0 A;  4B3M T;  2ZM2 A;  2WU5 A;  4QHO A;  2CLY B;  3MK7 C;  2JPF A;  2AXD S;  1HX8 A;  2L3L A;  3EAM A;  2BKN A;  5ABF B;  5HCM A;  5L3B B;  3FZK B;  4FJO A;  5LYJ E;  5LP6 E;  2PTF A;  5CJ5 A;  4U33 A;  3BK9 A;  4ZI7 E;  4XBF B;  4X65 T;  5FVL A;  4JI5 T;  4U7I A;  2N9D A;  2UUA T;  1O3X A;  4AQG A;  2KMF A;  3AE7 A;  3N9N A;  2V7K A;  3TLU A;  4U2Z A;  5LMN T;  1FEW A;  3N5L A;  2LT3 A;  1OXZ A;  1H7C A;  2LRK A;  4ILA A;  3VR8 A;  5FMN A;  4DR4 T;  4PJM A;  2SPC A;  3RPU A;  3CQC B;  3IF8 B;  2QVA A;  2X0Y A;  1YXR A;  4QKN A;  4IL4 A;  3DJB A;  2LSI A;  4PK5 A;  4OHF A;  3M3Z B;  5CGM A;  2K9A A;  3KFW X;  4KHP T;  4P0A A;  3ZST A;  5JDM A;  4MFR A;  3RI5 A;  3ZEF B;  2WCA A;  3QC9 A;  4EYY R;  4U2Y A;  3QK6 A;  4DND A;  4HFH A;  2XM1 A;  4ADZ A;  4X1I E;  4TUY E;  2Q9Q A;  2WU2 A;  4KUM B;  3ZYM A;  3EI0 A;  4P1N A;  3ZLI A;  4GYR A;  3FBZ A;  3UU8 A;  2Q9Q D;  4CQI A;  3ZC1 A;  4HFE A;  2D0T A;  4UVB B;  4C90 A;  3L09 A;  2YEV C;  2NR4 A;  2LSG A;  4PFP A;  4HKA A;  4L5G A;  4IHJ E;  2WWU A;  3R6N A;  2KND A;  4IST A;  4TWH A;  2LM2 A;  3SRZ A;  2UU9 T;  4JYA T;  4JI4 T;  3A8Y C;  1KK7 A;  1G73 A;  5FY7 A;  4HWC A;  3N2G E;  2X9X A;  2ODV A;  4UF0 A;  5L3E B;  4TWD A;  3K1S A;  2DI4 A;  4U72 A;  3WAJ A;  5EK3 A;  1HF8 A;  2UXD T;  3C4W A;  1OED C;  4G2A A;  5HEH A;  4ZOL E;  2CHN A;  3OVU A;  3LFM A;  4NIQ A;  4A56 A;  4IDQ A;  2YN6 A;  1FMW A;  2XSA A;  3U78 A;  4IGU A;  3FHN A;  2J4G A;  2XTL A;  3ZMU B;  4X62 T;  1I6Z A;  3LDQ B;  3AVR A;  4DV7 T;  3UTK A;  2FJB A;  2HN2 A;  2KWH A;  3UUX B;  3RYH E;  3QB5 A;  5LCY A;  2YKS A;  3AA7 B;  2PBI A;  4EV6 A;  2UXB T;  4LF7 T;  4LF5 T;  2HN1 A;  2IDO B;  5JTG A;  2V5C A;  2WWV A;  3O1J A;  1WRD A;  1WYB A;  4H63 V;  5DAB A;  3AEB A;  2NWB A;  4AKG A;  2XAF B;  3AE4 A;  2ACZ A;  4KP3 C;  2JQH A;  1R8I A;  3CX8 B;  4Z90 A;  1CUN A;  4U7Y A;  3AE1 A;  4UR9 A;  1GQE A;  4TN7 B;  1FIO A;  5EZY E;  4QXH B;  4JI2 T;  3HR0 A;  5L3G B;  3SFE A;  4CXX A;  4JUY A;  1HG5 A;  2K24 A;  1XNR T;  1B7T A;  2IML A;  4P09 A;  1OED E;  4AQF C;  2CHO A;  4QXC B;  5FYM A;  2X67 A;  3I1A A;  2BG9 C;  2VVN A;  4DID B;  4CN4 A;  5LG3 A;  1KNZ A;  3NBX X;  2QA7 A;  4WNK A;  2BDE A;  2JIW A;  3AEA A;  1U5P A;  4E7Z A;  4HWI B;  2VWA A;  3M65 A;  1HCI A;  3VRB A;  3WAK A;  4PK4 A;  3SS1 A;  4PK6 A;  3ZJ1 A;  2V6Y B;  4IE5 A;  4YTP A;  2NTY A;  1QLB A;  1OED A;  2XUE A;  4DV2 T;  3C4X A;  3PUA A;  3ZC0 A;  1ZHC A;  5DQW A;  5HEO A;  3H3A A;  2XQ3 A;  2K5B B;  3KV4 A;  1W0A A;  4LF4 T;  5H6Q B;  3J7Y q;  3PDY A;  5LJM A;  4LMK A;  2NTX A;  5AQJ B;  4DR7 T;  3PJA J;  2CRB A;  5LXT E;  4G63 A;  1YKE B;  4UIG A;  5JR9 A;  3O1I A;  5C8Y E;  3RRC A;  3AAA B;  4NPP A;  5FVK A;  3BQL A;  1DU2 A;  4MHC A;  4O2A E;  2M6B A;  2BKP A;  4XAX B;  2KZ7 B;  5E0O A;  1N32 T;  2GK9 A;  3UU4 A;  2H3R A;  3KDS E;  4TNV A;  2BG9 E;  3J9X 1;  5AFU L;  4IIJ E;  4GKJ T;  3LJC A;  3CX7 B;  3UU6 A;  3PUY F;  4K0K T;  2DWK A;  2WDV A;  2H7O A;  4ZZC A;  5FL1 A;  4OYK A;  3JAF A;  4QH4 A;  4JI6 T;  1WR6 A;  3ETU A;  4JEH B;  4ZXL A;  2CBJ A;  1VOM A;  2BVM A;  4X64 T;  4OK0 A;  3D0T A;  2J62 A;  3AXJ B;  3SWH A;  2YDQ A;  4EXT A;  3K3Q C;  4UVA B;  2NP9 A;  3ABV A;  4X5T A;  4BA9 A;  1KNR A;  3FZF B;  2OLT A;  2PFV A;  2WY2 A;  4GK0 E;  2DNX A;  5LJN A;  4B3T T;  3RYC E;  2BG9 A;  3QUJ A;  2YU1 A;  4O4I E;  3C50 A;  3PE0 A;  1IBM T;  3I9W A;  4EB6 E;  5J2T E;  4ZZB A;  2PG8 A;  4A97 A;  4B6X A;  2E9X C;  1T72 A;  4KI0 F;  3C98 B;  3CQG B;  3ZT6 A;  4LF6 T;  1LKX A;  2ZMA A;  3H37 A;  2RPA A;  1JNZ A;  3GN5 A;  5FXX A;  2UUC T;  3IA3 A;  3KV9 A;  1XMQ T;  3B5M A;  4TV9 E;  1L0V A;  4YJ2 E;  2CA5 A;  5FXV A;  1UK5 A;  2FJE A;  3QNU A;  5LNK A;  3ESL A;  3GMI A;  2UXC T;  5FKY A;  2P9B A;  1MND A;  5LGT B;  2RA1 A;  2VVS A;  3ZN0 B;  5F3J A;  4O4L E;  5GON E;  5AQT B;  3CQX C;  2RP4 A;  1WLX A;  3RF1 A;  4JBW F;  1SA0 E;  4YTM A;  2MPK A;  1HS7 A;  2W61 A;  4TZ4 C;  3CIR A;  1EZ3 A;  1KEY A;  2LLY A;  2MAW A;  3ANW A;  2WAU A;  3NRX A;  2MOZ A;  3PU8 A;  4DV3 T;  2ZLY A;  3E08 A;  2YU2 A;  2XAQ B;  2X66 A;  1V9D A;  2X9W A;  3MJX A;  1J1J A;  1UX4 A;  2LSK A;  2K48 A;  2X0H A;  2IW5 B;  1SUM B;  3FBL A;  1N34 T;  4ANJ A;  1E1H B;  3VR9 A;  2WZI A;  3VHL A;  5KXJ A;  3Q2M A;  4HFI A;  2WDR A;  4EOZ B;  4IE6 A;  2KIN B;  2NW9 A;  3KBU A;  1T8B A;  5JR9 B;  1HNX T;  1IBK T;  4ZS3 A;  5C3J A;  2I6H A;  2XAG B;  3PU3 A;  3OKQ A;  5L4E A;  4DBQ A;  4YXD A;  4HN9 A;  4DUY T;  5IUX A;  4GOU A;  4DR3 T;  4JEU B;  3OYZ A;  5FY1 A;  4HGA A;  1VCT A;  1J5W A;  2VKJ A;  3N9Q A;  3LBX A;  3QOF A;  2JQQ A;  1BR1 A;  3F31 A;  2LEH A;  1LRZ A;  3JAE A;  3ZMS B;  3F2E A;  1UUR A;  3RYF E;  3EAB A;  2E9X A;  5LHH B;  2OV9 A;  2NW7 A;  5HXR A;  5LBQ B;  1T98 A;  2IC9 A;  2EHO B;  2E9X D;  4MAL A;  1KFY A;  3AE6 A;  1AJ3 A;  4LFA T;  5JRC B;  4YY3 T;  4DMV A;  3PUQ A;  1MIY A;  3JAD A;  4AKH A;  4HTE A;  2WSS V;  4HWH A;  4DV0 T;  1XMO T;  1MMG A;  3OPC A;  1HR0 T;  4KHZ F;  1E7P A;  4AKI A;  4JI3 T;  4ILU A;  1QSD A;  5FL0 A;  5ABH A;  2G0U A;  5ADX L;  2A3D A;  2W0G A;  3RIA A;  4ZS2 A;  4PJL A;  5LHG B;  4NXN T;  1IAP A;  3BQK A;  3E0Z A;  2WM9 A;  2WZH A;  4EZ4 A;  4OX9 T;  3HKD E;  3O9X A;  4H9Q C;  4DV1 T;  1MIV A;  2LHN A;  2A2F X;  4WW0 A;  1XWM A;  2CLY C;  2MYS A;  2XQ4 A;  3ONX A;  3KBT A;  3UFE A;  2CWY A;  3FXE B;  2LSY A;  4JI1 T;  4OFZ A;  1ZV4 X;  3PUW F;  2M6I A;  5HXC A;  1U4Q A;  3AE3 A;  3P8C D;  2HHH T;  4YSZ A;  2F4V T;  3VKG A;  3G06 A;  3P4S A;  2IHR 1;  4YLH A;  5JH7 E;  4UV9 B;  3R84 B;  5LGN B;  2V7I A;  1D0Y A;  2XQ7 A;  1YD8 G;  3MA9 A;  4NUU A;  3ZCJ A;  3P7I A;  2FUP A;  4H9O C;  1I94 T;  1HG2 A;  2BKO A;  3AEE A;  2JRK A;  4AIS A;  4EGW A;  3MAC A;  5IHY A;  4GK5 E;  4WBN E;  4I43 B;  5HWX A;  5CA0 E;  5AQM B;  2V8S V;  2VKO A;  3JCF A;  3UUN A;  3BQI A;  4PJJ A;  1S35 A;  3GWH A;  4YSX A;  4DR2 T;  3UQ4 A;  2FBW A;  2JMK A;  3KV5 A;  4F8H A;  3Q9D A;  2X0L B;  5AQO B;  4HEA A;  4H9S E;  1M7K A;  2C5K T;  4PW8 A;  4Z91 A;  3N9P A;  3PUZ F;  5FNV E;  2K3W A;  5L2L A;  1QUU A;  5J1G A;  4EIW A;  4EEB A;  5JDL A;  3EVY A;  5C2T A;  1WR0 A;  3JC6 D;  5L3F B;  2CE7 A;  4UXN B;  3AA6 B;  3T8O A;  1BR2 A;  3N9M A;  4HFC A;  1X9B A;  2QYW A;  4MLK A;  2VL8 A;  1Z0P A;  3VKH A;  1MMN A;  4DBR A;  1FMV A;  2Q9Q B;  5DJQ C;  2UXX B;  1MNE A;  2OA5 A;  2W66 A;  4IDZ A;  3RYI E;  2XQA A;  3Q5X A;  3FB2 A;  3OTO T;  3N2O A;  3KIN B;  4V1A v;  4WBO A;  2X9Y A;  2LJL A;  4HE8 A;  4I50 E;  5KDM C;  4DV6 T;  2IAK A;  3LK4 2;  3RX6 A;  5HEG A;  2ODU A;  2A9U A;  4A98 A;  4UVC B;  2VQE T;  4HFB A;  5ABF A;  1IBL T;  3LK2 B;  3AED A;  3A7M A;  3PV0 F;  1YQ4 A;  2DL1 A;  2N2N A;  4XZC A;  3ZMV B;  4AXP A;  4UV8 B;  4BJM A;  2LKH A;  3L8R A;  3CVR A;  5ABG A;  4UF0 B;  3PUS A;  4ILB A;  1N36 T;  1SE7 A;  2QRX A;  5H6R B;  5ABE A;  2XPK A;  1HNZ T;  2CXF A;  2XAS B;  5HCJ A;  3V5S A;  4B3S T;  2W62 A;  4JI8 T;  3N2K E;  5HXS A;  4QH1 A;  5FXW A;  5CA1 E;  2PJQ A;  4OYJ A;  5J0Z A;  2XAH B;  4DVD A;  3ZMZ B;  2KT9 A;  2FJA A;  2NW8 A;  2CBI A;  3L39 A;  4YHJ A;  2A72 A;  1UX5 A;  4A5X A;  3ONJ A;  2XY8 B;  4U74 A;  3O4X E;  2WDQ A;  2B1E A;  2XJ7 A;  4PFO A;  1VCS A;  3AA1 B;  4YJ3 E;  2DLR A;  3KVB A;  5JDF A;  1D0Z A;  1N33 T;  3ZPO A;  4AQF A;  5HEU A;  2NOX A;  2CPT A;  1D0X A;  2W63 A;  5AQV B;  3TKL B;  3NVO A;  4HFV A;  3OBV E;  2LE8 A;  5JRE A;  3X1D A;  4X66 T;  3NZP A;  4CXW A;  5LGU B;  2I0M A;  5JVD E;  1MIW A;  4UEM A;  2WBL A;  3B13 A;  2IUB A;  4NUV A;  3TLW A;  5AQF B;  4CZZ B;  2V7L A;  3DTO A;  3FXD B;  4AQY T;  1T7S A;  1W09 A;  3TLT A;  1KNP A;  4BAY B;  3RC8 A;  4Z8X A;  2BBH A;  3LSV A;  4BJN A;  2XQ8 A;  3NZQ A;  4JV5 T;  3N9L A;  2LOP A;  4ZI3 C;  4E7S A;  3K8P C;  1NEK A;  1IJ6 A;  4PJN A;  5IYZ E;  5FXZ A;  4CI1 B;  3P4P A;  2Y6X A;  3E22 E;  1WYC A;  5LBM A;  4X1Y E;  2Y8D A;  3P4W A;  1XDO A;  1MMD A;  4U31 A;  3ZKR A;  4H63 H;  3Q5E A;  1YKH B;  3LG7 A;  3PUX F;  2W67 A;  2XM2 A;  3AEF A;  3HI2 A;  2D2S A;  4X1K E;  2KSR A;  5L47 A;  4LFC T;  1OED B;  2ES0 A;  3DP7 A;  4Q25 A;  4KBM B;  2E2A A;  4EAH A;  3NRY A;  1US7 B;  1LVF A;  4ASK A;  5DQV A;  1YW0 A;  4IL9 A;  2CWO A;  1HFA A;  3AVS A;  4TNW A;  3CML A;  2XQY A;  4DR1 T;  4CI3 B;  2AE9 A;  4MBQ A;  4IDO A;  3WI3 A;  4IE4 A;  3AA0 B;  2HH7 A;  5LB7 B;  4IE0 A;  4IDN A;  3VU7 H;  3AE5 A;  4GIW A;  2YOE A;  2MBG A;  2XSB A;  3RKG A;  4DO0 A;  2V26 A;  5LOV E;  4B3R T;  2LHR A;  4YSY A;  2VK9 A;  5J2U E;  2YDS A;  3AAE B;  3HKC E;  4DV5 T;  5M4Y A;  4TWF A;  3LK3 B;  2VKH A;  3AB3 B;  3A5X A;  3RC3 A;  5AQG B;  3HA4 A;  5JDQ A;  2WQY A;  2CXD A;  5BMV E;  1NAF A;  1OWA A;  1BR0 A;  3JC6 C;  4WZX A;  2HPL A;  1UGO A;  3H3M A;  2LRL A;  4YT0 A;  1KF6 A;  5JDG A;  1IZN B;  3RLF F;  2V7J A;  5L4H A;  4CI2 B;  5AQL B;  3ONL C;  2BG9 B;  1Y64 B;  2VUR A;  2IIU A;  1M62 A;  2DWG A;  3RIF A;  4HWD A;  2VAS A;  3UT5 E;  4TX5 A;  3PUR A;  2LOS A;  2V6Y A;  4LFB T;  3I0O A;  3GN5 B;  3RIU C;  2J1D G;  5L3D B;  4ZI3 D;  1HX1 B;  4H9R C;  3S4U A;  2R6G F;  2ZM8 A;  2CMR A;  3U3I A;  5JDH A;  2WB5 A;  3FZM B;  3I0Q A;  4QX8 B;  3CKD A;  3MZK B;  5AQK B;  3TLS A;  2X68 A;  2B76 A;  3EUH A;  4YFS A;  4AKL A;  2KWI B;  2XHE B;  4AIU A;  2BS2 A;  3V5U A;  3RHW A;  4ZI2 C;  4KMC A;  3RGL A;  4HWF A;  5JQG E;  4F6R C;  5AQI B;  4EZH A;  2H89 A;  3RRW A;  1G8X A;  3AEG A;  3SOL A;  5HXE A;  2FJD A;  2C5I T;  4EED A;  3ZMT B;  3ANW B;  5HYA A;  2H88 A;  2N1G A;  3CWZ B;  5JDN A;  3IBP A;  1LVK A;  3IEE A;  2BS4 A;  2J47 A;  2Y48 B;  5FP3 A;  3K3O A;  4NXM T;  3RQU A;  3ZN1 B;  1ZOY A;  3UU3 A;  2D0U A;  2Z6E A;  3OJA A;  3EHZ A;  4CN6 A;  5CFB A;  3AE2 A;  4L9I A;  1SHZ C;  4COF A;  1Z8U A;  5KX5 E;  5JR9 C;  2E5L T;  1NWM X;  5TAO A;  2ACX A;  3RH3 A;  2XQ5 A;  5F5W A;  3AE8 A;  2XQ6 A;  4QH5 A;  2DCF A;  3AXJ A;  2QGS A;  4EYU A;  3ZCI A;  2DHR A;  1D1C A;  4K0U A;  3C4Z A;  1FJG T;  3FZH B;  2L8K A;  4O8S A;  3HKE E;  2BBJ A;  1JNR A;  3MKD A;  2WP9 A;  5KMG P;  1BR4 A;  4U3C A;  4GKK T;  1XZY A;  4L0R A;  5AQQ B;  3LBX B; 
#chains in the Genus database with same CATH homology
 2JQ9 A;  2MPK A;  3K1S A;  4U2Z A;  4U2Y A;  3ZT7 A;  4CN4 A;  2CRB A;  2LRL A;  2RPA A;  2V6Y A;  2WY2 A;  2CPT A;  3EAB A;  4U33 A;  4A5X A;  2A9U A;  2XZE A;  1WFD A;  3ZSS A;  5LB7 B;  2LRK A;  5FVL A;  2V6Y B;  4ZEY A;  2K3W A;  1WCR A;  2W2U A;  4U31 A;  4CN1 A;  5CJ5 A;  5FVK A;  4U7I A;  4CN6 A;  5CGM A;  4U3C A;  2JQH A;  2JQK A;  2WWV A;  4NIQ A;  2DL1 A;  1WR0 A;  4P1N A;  4IT4 A;  4U7Y A;  4WZX A;  3ZT6 A;  3ZST A;  1YXR A;  2V6X A;  3ZT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...