2XZEA

Structural basis for amsh-escrt-iii chmp3 interaction
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
141
structure length
141
Chain Sequence
SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAM-BINDING PROTEIN
publication title Structural Basis for Escrt-III Chmp3 Recruitment of Amsh.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein transport
total genus 53
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08969 USP8_dimer USP8 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2xzeA00
3ZT5A 2V6XA 4CN6A 5CGMA 4IT4A 3ZSSA 1WCRA 3ZT7A 1YXRA 4WZXA 3K1SA 3ZT6A 3ZSTA 5CJ5A 2XZEA 2V6YB 2V6YA 4U7IA 4U2YA 2DL1A 5FVLA 4NIQA 4U2ZA 2RPAA 5LB7B 4P1NA 4CN4A 4U3CA 2WY2A 4CN1A 2MPKA 2K3WA 2A9UA 2JQHA 2LRKA 2CPTA 2WWVA 4U33A 5FVKA 2CRBA 4ZEYA 4U31A 2W2UA 3EABA 2LRLA 4A5XA 4U7YA 1WFDA 1WR0A 2JQKA 2JQ9A
chains in the Genus database with same CATH superfamily
1WYCA 5IHYA 2XQ8A 5F3JA 4HFIA 4NXMT 2YDQA 3RF1A 5A1LA 3NWIA 2MAWA 4CQIA 4IHJE 3AVRA 4O2AE 4H9RC 1D0XA 1HTJF 4QKNA 1UX5A 1UX4A 5ABFA 2W61A 2I6HA 3E22E 1MMAA 1KK7A 2XAFB 4I43B 4HWHA 4IE4A 3UU3A 3TLSA 4COFA 4H9SE 3ETUA 2JIWA 3LSVA 4QHOA 5AQHB 3AEGA 2K24A 4K0UA 5CJ5A 2XAHB 2UU9T 2XQ5A 3AEFA 2EHOA 2KWHA 5HEUA 4J2CA 2DI4A 1OEDE 3AB3B 3ETVA 4H63V 4U7YA 1T98A 2Q9QB 3NBXX 3R84B 3ZKRA 3RLFF 2XQ9A 2OA5A 1VOMA 2RP4A 2VKHA 3OTOT 3P4PA 4N78D 2CWOA 3UFGA 3PDYA 1I6ZA 2JMKA 3C64A 3CQXC 4ZI2C 1WFDA 4CI1B 5FKYA 4WW0A 3KINB 1HFAA 1D1CA 2LOSA 2XQ3A 3RYIE 5JRCA 1XNRT 2RA1A 5KDMC 4X65T 2E9XC 4LMLA 4X1KE 4YTNA 3ZC0A 4LMKA 4MLKA 3RQWA 2NWBA 5JREA 3FHNA 4EEBA 4X1IE 3PUAA 2XZEA 1W0AA 3N9MA 4ILBA 5AQOB 2RPAA 3A5XA 5L3GB 2LSYA 2XTLA 3AAEB 4X20E 3PUZF 2KZ7B 2P9BA 2XASB 2VQET 2XAQB 2LT3A 2D2SA 4YSXA 3NVOA 5CGMA 3OBVE 3DTOA 4ZHQE 3UU5A 3N9LA 5LHIB 2UXDT 1IJ5A 1X9BA 2KINB 4NUUA 3QB5K 3C50A 4M1PA 4B3RT 3AE8A 1O3XA 2BDEA 2K48A 4KBMB 2LHRA 2CBJA 2KMFA 3FBZA 3PUYF 3CMLA 4LF8T 3C4XA 4P0BA 4CI2B 2LM2A 3CX6B 5AQPB 2BS2A 4JI0T 3L39A 2E8IA 4IL4A 2VASA 5HYAA 2YU2A 5EK4A 4IT4A 3AXJB 4QH5A 1WYBA 1CUNA 2YINA 3LBXA 5LHGB 4JI4T 2W66A 3IEEA 4HFVA 1KNRA 3RYCE 3UTKA 3CX8B 4JLEA 3L3PA 1BR1A 2W0GA 1XWMA 4HKAA 3O1HA 2BVLA 2XM1A 5AQMB 5ABFB 4AQFC 3PU3A 1ZKEA 3NZQA 2XAGB 5LJMA 4IE0A 4HWFA 3KBTA 4KMCA 2DWKA 5FY7A 4IDZA 3BK9A 3PUVF 1XNQT 3KV9A 3RX6A 3RRWA 2J1DG 3AE6A 2YU1A 4ADZA 4U2YA 5JR9B 5IWAT 2LLYA 4DV2T 4H9PC 1OEDC 4NPPA 4L0RA 1HCIA 4HFCA 2WB5A 3ZSSA 4LF7T 2FJEA 3UUMA 3Q5DA 4DR4T 2A72A 3HKDE 4UF0A 4FI5A 2KLQA 3T8OA 4EV6A 3DJBA 4PJNA 2PFVA 2CLYB 4YHJA 2DHRA 1Z0PA 3MZKB 2LSJA 4AQYT 4DBQA 4EB6E 1G73A 2SPCA 4CXYA 2W00A 3ZPOA 2EHOD 5ABEA 4HFBA 1L0VA 2M67A 1W09A 3Q5XA 4ISTA 4FJOA 4DR6T 5JDLA 4U72A 2XUEA 2H88A 4YLHA 5J1GA 2V5CA 3I0QA 2ACZA 3J9X1 1E1HB 4EZHA 5AQFB 2HN2A 2CRBA 5J2UE 5LMNT 1ZV4X 4ZOLE 3K3NA 1NAFA 3S4UA 4IDNA 2C5KT 3C51A 3ZT6A 1YKEB 5FNVE 1IAPA 3TKLB 4ERRA 2WQYA 4YXDA 4CXWA 4DNDA 3HL6A 4EEDA 1M7KA 3UUXB 4H9OC 3ZT5A 4EXTA 3TLUA 3VR8A 1SE7A 2XJ7A 3N9NA 4UELA 3VRAA 3C4ZA 1MMGA 4E7SA 4O4JE 3BQKA 2IHR1 3KFWX 1YQ4A 3AEAA 3EAMA 2Q9QA 2XAJB 1BR2A 3C4WA 4QXBB 3O4XE 5AQTB 3I1AA 1MIYA 4UV9B 5JDHA 4YTMA 3PUGA 1T72A 5HXCA 3RH3A 2XQ4A 5H6RB 4NXNT 2L3LA 2L9QA 5JVDE 1J5ET 2WMOA 3AAIA 5FY0A 4ZI3C 3WAKA 4PK6A 5CA0E 2V6YB 5L3CB 2CA5A 3H37A 2HN1A 3WAJA 4DBRA 2WM9A 2B1EA 5LBMA 2UXXB 3CQCB 4HWDA 4X66T 2EHOC 4PK5A 4AKLA 2UXCT 5LBQB 5F8PA 2LKGA 4UVBB 5HAXA 1Z8UA 2JQQA 5JDNA 3RIUA 3JAFA 3JCFA 2IW5B 2LSGA 2HPLA 2CEAA 4L9IA 2B76A 4LMJA 1CHUA 1LKXA 3AECA 1UGOA 2M6IA 1IBLT 5LCYA 4DR3T 4AKHA 4MALA 1WLXA 2DL1A 5F5WA 2JMHA 3LK3B 4UF0B 3PUWF 5FL1A 5AQLB 1J1JA 3PJAA 3RC3A 1ZOYA 3VU7H 3GWHA 1WR0A 2QVAA 3QC9A 2C0SA 5ADXL 3FZFB 4DV6T 2X9HA 3CPZA 3RYFE 4IGUA 1KNPA 3FXEB 4GK0E 3NRYA 2N9DA 4DR2T 4UEMA 4JV5T 2KWIB 3AXJA 2XPKA 5FXWA 3M65A 5L3DB 4MHCA 4XZCA 2MPKA 4CI3B 4JI7T 1OWAA 2W62A 1NENA 4AIUA 4ILCA 3P4SA 2JPFA 5DABA 4HTEA 1IJ6A 4PAGA 3H3MA 2ES0A 4HWCA 3DP7A 5C3JA 2XY8B 4UR9A 2QRXA 3AA0B 4GIWA 4DVDA 3RKOA 2X66A 3ZMUB 2V1DB 3P7IA 4L5GA 1HX8A 2R6GF 3RRCA 4A56A 5JR9A 4YTPA 4EZ4A 4TWHA 5L4EA 3EDVA 3H3AA 4ZS3A 4OK0A 1BR0A 2WU5A 3OJAA 5CFBA 4Z8XA 3IBPA 2NW7A 4AI6A 3ZYKA 4CXXA 1LVKA 1R8IA 1MIVA 5HEOA 3V5SA 3OYXA 3RC8A 3IHRA 2UUAT 3EABA 4DR5T 1N32T 2W67A 4LF4T 2QGSA 5FYMA 5HEJA 5L3FB 2NOXA 4U7IA 5HCJA 5FVLA 4BAYB 1Y64B 3AE3A 2CM0A 4LF6T 4PJMA 4O4IE 5AQGB 3F31A 4DUYT 5JDGA 3V5UA 2ZM2A 1XDPA 3EDUA 3RI5A 4A97A 3ZMTB 5HWXA 3I9YA 3CX7B 4UVAB 3FB2A 3EVYA 5JDFA 5LA6E 2PG8A 3N2OA 1N33T 3SFDA 3RKGA 4NIQA 3NZPA 4I0UA 1KEYA 3KBUA 4DMWA 2YK0A 5CA1E 4IDPA 4IL9A 3AE9A 4I55E 2H7OA 2AXDS 2LSIA 3W15B 3HA4A 1AJ3A 2WWUA 4DUZT 3TLTA 4ZI7E 3MKDA 3AVSA 3LJCA 4NUVA 2XQYA 4MFRA 5FVKA 1UURA 2K9AA 3RYHE 2D5UA 3JAEA 4P0AA 1IBKT 2FJBA 3N2KE 2CHOA 4UV8B 5L2LA 3AA1B 5HEGA 4PFPA 5E0OA 4LF9T 4HEAA 2ODVA 2WWVA 3CQGB 4JI2T 2BBJA 4HFEA 2XSBA 3Q2MA 3ONLC 3T1HT 2ACXA 2FJDA 3K8PC 3AA6B 5ABGA 2LE8A 2V6YA 1FMVA 1H7CA 1U5PA 3A7MA 3QOFA 4UXNB 1Y01A 1T8BA 2BKNA 5TAOA 4U33A 2CXDA 3P4WA 3PTRB 2W2UA 3PUQA 1IBMT 1GQEA 3R6NA 1SHZC 3K3QC 1YXRA 3IA3A 2XQ7A 3ZJ1A 4GYRA 4WBOA 4KX6A 4CN1A 2WDRA 5JDQA 3SS1A 1DU2A 2E9XA 5JH7E 1JNZA 2VURA 1XMOT 3AA7B 4ISSA 2IAKA 3FZHB 2ZM6T 2K5BB 4ZS2A 4Z91A 3P8CD 4X1YE 4ZI3D 4K0KT 3UUBA 2K3WA 2J47A 4QXCB 5HEHA 5M4YA 4GOUA 5LNKA 2OV9A 3K3OA 2BG9B 2PBIA 3FBLA 2WZIA 5H6QB 4JEHB 3UU6A 3GMIA 5LYJE 3C98B 2IUBA 3J7Yq 2BS3A 3RIUC 3ZCIA 4TV9E 2KXPB 2LM9A 2WCAA 4TUYE 2HHHT 2IIUA 2V7KA 3Q9DA 4QX7B 5LOVE 4AKRB 2PJQA 4YJ3E 2WSSV 4UIGA 3F2EA 4DR1T 5JQGE 1JNRA 2DLRA 3SFEA 2JQKA 3NRXA 3QK6A 2Z6EA 5LGTB 2WZHA 4DO0A 5GONE 3HR0A 5AFUL 2X51A 3FZKB 2L8KA 1HNXT 4IDQA 3N9OA 4PFOA 2I59A 2J62A 2OLTA 2XQAA 2JRKA 3CIRA 2D0UA 3LDQB 4A98A 3ZEFB 1KFYA 5L3EB 3N5LA 1E7PA 4KP3C 2N1GA 2G0UA 1FMWA 3AAAB 5JTGA 1D1BA 4GKKT 2BKOA 3ZT7A 3GN5A 2UUBT 3ABVA 4TN7B 4B3MT 4GKJT 3RGLA 4TWFA 2YOEA 4HGAA 2XSAA 1MNEA 4DR7T 2YKSA 1ZHCA 3B13A 1OEDA 3K1SA 3ZSTA 5AQKB 3ANWB 4PJLA 2VB6A 5HXEA 4UVCB 2VQFT 5JR9C 2X0LB 3LK42 2VKJA 2C5IT 3KDSE 4EAHA 1NEKA 4P1NA 3WI3A 4QXHB 2M6BA 5IYZE 2BKPA 4IREA 4ZEYA 3AEDA 5BR8T 2E9XB 5LHHB 4F6RC 4CZZB 1WCRA 3I0OA 1XDOA 3HKEE 1LRZA 2VWAA 3A8YC 1VCTA 4DV0T 2YDSA 3ZN1B 4GYSA 5DJQC 5EK2A 5FY1A 3OKQA 3SOLA 3ZYLA 4KUMB 3B57A 4JI5T 2FBWA 3FZMB 3MACA 3VRBA 5FP3A 5AQQB 4AKGA 3TLVA 2JQHA 2DCFA 3ZMVB 2LOPA 4DV5T 3UU4A 5LG3A 2ZMAA 4C91A 3T1YT 3U78A 4TV8E 4G2AA 3RIFA 3ZCJA 2IC6A 2IMLA 5FXZA 4V1Av 2UXBT 2WDVA 4JI6T 3JC6D 1UUSA 1XMQT 3P4QA 5L4HA 1QLBA 2DWGA 4YHHT 5LGUB 3KV4A 5DQVA 2JQ9A 4I50E 4H9NC 1YKHB 3LG7A 2X68A 3HKCE 3NKZA 4P09A 1WR6A 1J5WA 2ZM0A 1HX1B 4U3CA 2A9UA 5EZYE 4JUYA 3UU8A 2C5JA 5LXTE 5AQNB 2D9DA 2CHNA 3LFMA 4IE7A 2UXNB 3BQLA 2CWYA 2Y48B 4O2BE 2NW8A 1IZNB 2HH7A 1WRDA 4AQGA 4DMVA 2VK9A 4KHZF 5LP6E 1FIOA 4HWIB 5HXHA 3UQ4A 3F57A 4O4LE 3GN5B 1US7B 2I0MA 3U3IA 4IE6A 3UFEA 2LRKA 3AEBA 2WDQA 1FJGT 2CXFA 4TWDA 4OYKA 3ONXA 2DNXA 4JBWF 2BG9A 1OEDB 3VHLA 2H89A 4B3TT 2HPJA 2VKDA 1NWMX 4PJJA 3EI0A 2WBLA 2D0TA 1N34T 4JI1T 2LEHA 5AQVB 4JI8T 3OPCA 3X1DA 4ZZCA 2Q9QD 5LJNA 1YD8G 1EZ3A 3UULA 4YFSA 4TNVA 2ZM8A 1W0BA 4WZXA 2MTQA 5JDMA 1MIWA 5HXSA 4PW8A 3E08A 5AQUB 1YQ3A 1ZEEA 1QSDA 3PU8A 3ZMZB 4TNWA 3GA8A 2V7MA 4H9QC 3MA9A 3MK7C 5C8YE 2H3RA 4OHFA 3JC6C 3L8RA 2WP9A 2UUCT 3OYZA 2KNDA 2XHEB 1MMDA 4F8HA 3N9PA 3O1JA 1T7SA 4ANJA 3KVAA 5FXXA 2X0HA 4BJMA 5IUXA 3BQIA 3QNUA 2V26A 4HFDA 2Y8DA 3ZYMA 5CB4E 1SA0E 4YSYA 2NR4A 1X79A 3RHWA 2Y6XA 3AE7A 5AQRB 3D0TA 2A3DA 3VKHA 5FMNA 3HI2A 4JI3T 4LFCT 4EYUA 1KF6A 4Z90A 3N9QA 3M3ZB 2MOZA 2WAUA 1SUMB 2W63A 4MBQA 4H63H 3RIAA 2CE7A 2WY2A 4IIJE 2E5LT 2IC9A 3VR9A 4O4HE 3Q5EA 5FL0A 4GK5E 4KHPT 4BA9A 4LFBT 3I9WA 1UK5A 3ANWA 3UQ7A 2NW9A 4QH4A 3ZMSB 3QB5A 3CWZB 3CK6A 1W9RA 2NTYA 4CN6A 2YN6A 2VVSA 3CKDA 4U2ZA 3ZJ2A 2Q9QC 3AE1A 2ODUA 4DIDB 4YJ2E 5AQIB 1MMNA 4X5TA 3MXZA 3OVUA 3JADA 2V7IA 4KI0F 2X9WA 1XZYA 2W4XA 1BR4A 2MYSA 3SWHA 4XBFB 3TLWA 3E0ZA 2VVNA 4LFAT 2EHOB 2XQ6A 2BG9E 3IF8B 2NP9A 2LSKA 3P50A 5LGNB 1HS7A 2CBIA 2ZLYA 4AKIA 3FZLB 3UUNA 5AQSB 1OXZA 3FXDB 2V8SV 2VL8A 2LJLA 3N2GE 2CCQA 5JRCB 3PE0A 1M62A 3PUSA 3AE4A 3PUXF 1HNZT 3Q5WA 1E2AA 4A5XA 4U74A 2YDRA 2PTFA 2V6XA 3MJXA 4QH1A 2BVMA 5ABHA 1HF8A 5LB7B 1LVFA 1I94T 4HFHA 3KV5A 3EUHA 5L47A 2CPTA 3AEEA 2KSRA 4TZ4C 3PJAJ 5DQWA 3RQUA 4PK4A 3KVBA 4O8SA 4DV7T 2BS4A 2H7VC 3HKBE 5KMGP 3ZLIA 2CMRA 1UCUA 3G06A 3L09A 1ZP0A 4EYYR 1MNDA 4AQFA 4JYAT 3UT5E 3KV6A 4X62T 4BJNA 2J4GA 1KNZA 1D1AA 2QA7A 5ETWA 1VCSA 3AE2A 2E5VA 4JEUB 4IDOA 2BBHA 5HXRA 3RPUA 2X9YA 5KX5E 5J0ZA 2NTXA 4XAXB 2IDOB 2BZBA 4HE8A 4WBNE 1V9DA 2LRLA 2WS3A 3EHZA 3B5MA 3LBXB 1N36T 3ONJA 1S35A 2V7JA 5C2TA 3O1IA 1HG5A 4ILAA 5HCMA 3LK2B 4AISA 4C90A 4TX5A 4IE5A 4WNKA 4B6XA 5FXVA 4DV3T 2XM2A 1HR0T 4WYVA 4PNIA 1D0ZA 3SRZA 1S94A 2N2NA 4LF5T 2CXLA 1G8XA 3CVRA 4OYJA 4YT0A 5KXJA 5BMVE 3VKGA 2VL0A 1D0YA 3O9XA 2QYWA 4G63A 4EGWA 1U4QA 2JJ9A 4HN9A 3QUJA 4DV1T 5L3BB 4I4TE 1HG2A 2CLYC 2V5DA 2YEVC 2MBGA 5HWYA 4B3ST 3ZC1A 2X0YA 2GK9A 3ESLA 4CN4A 3AE5A 1QUUA 4Q25A 2BG9C 4ZXLA 5LMUT 5J2TE 2VKOA 4EIWA 2KT9A 2FJAA 4EOZB 1VRBA 2V7LA 2AE9A 5LG4A 4ZI2D 4OFZA 2X9XA 4QWNB 1YW0A 3PURA 2E2AA 1B7TA 2WMNA 4ASKA 3PV0F 1HNWT 2E9XD 4X64T 4YY3T 4DV4T 4OX9T 2X67A 2F4VT 2LKHA 2FUPA 5AQJB 4ILUA 2WU2A 2LHNA 4ZZBA 1FEWA 2A2FX 3P4RA 4YSZA 5EK3A 4QX8B 4E7ZA 3ZN0B 4AXPA 4U31A
chains in the Genus database with same CATH topology
3ZT5A 2V6XA 4CN6A 5CGMA 4IT4A 3ZSSA 1WCRA 3ZT7A 1YXRA 4WZXA 3K1SA 3ZT6A 3ZSTA 5CJ5A 2XZEA 2V6YB 2V6YA 4U7IA 4U2YA 2DL1A 5FVLA 4NIQA 4U2ZA 2RPAA 5LB7B 4P1NA 4CN4A 4U3CA 2WY2A 4CN1A 2MPKA 2K3WA 2A9UA 2JQHA 2LRKA 2CPTA 2WWVA 4U33A 5FVKA 2CRBA 4ZEYA 4U31A 2W2UA 3EABA 2LRLA 4A5XA 4U7YA 1WFDA 1WR0A 2JQKA 2JQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZT5 A;  2V6X A;  4CN6 A;  5CGM A;  4IT4 A;  3ZSS A;  1WCR A;  3ZT7 A;  1YXR A;  4WZX A;  3K1S A;  3ZT6 A;  3ZST A;  5CJ5 A;  2XZE A;  2V6Y B;  2V6Y A;  4U7I A;  4U2Y A;  2DL1 A;  5FVL A;  4NIQ A;  4U2Z A;  2RPA A;  5LB7 B;  4P1N A;  4CN4 A;  4U3C A;  2WY2 A;  4CN1 A;  2MPK A;  2K3W A;  2A9U A;  2JQH A;  2LRK A;  2CPT A;  2WWV A;  4U33 A;  5FVK A;  2CRB A;  4ZEY A;  4U31 A;  2W2U A;  3EAB A;  2LRL A;  4A5X A;  4U7Y A;  1WFD A;  1WR0 A;  2JQK A;  2JQ9 A; 
#chains in the Genus database with same CATH topology
 1WYC A;  5IHY A;  2XQ8 A;  5F3J A;  4HFI A;  4NXM T;  2YDQ A;  3RF1 A;  5A1L A;  3NWI A;  2MAW A;  4CQI A;  4IHJ E;  3AVR A;  4O2A E;  4H9R C;  1D0X A;  1HTJ F;  4QKN A;  1UX5 A;  1UX4 A;  5ABF A;  2W61 A;  2I6H A;  3E22 E;  1MMA A;  1KK7 A;  2XAF B;  4I43 B;  4HWH A;  4IE4 A;  3UU3 A;  3TLS A;  4COF A;  4H9S E;  3ETU A;  2JIW A;  3LSV A;  4QHO A;  5AQH B;  3AEG A;  2K24 A;  4K0U A;  5CJ5 A;  2XAH B;  2UU9 T;  2XQ5 A;  3AEF A;  2EHO A;  2KWH A;  5HEU A;  4J2C A;  2DI4 A;  1OED E;  3AB3 B;  3ETV A;  4H63 V;  4U7Y A;  1T98 A;  2Q9Q B;  3NBX X;  3R84 B;  3ZKR A;  3RLF F;  2XQ9 A;  2OA5 A;  1VOM A;  2RP4 A;  2VKH A;  3OTO T;  3P4P A;  4N78 D;  2CWO A;  3UFG A;  3PDY A;  1I6Z A;  2JMK A;  3C64 A;  3CQX C;  4ZI2 C;  1WFD A;  4CI1 B;  5FKY A;  4WW0 A;  3KIN B;  1HFA A;  1D1C A;  2LOS A;  2XQ3 A;  3RYI E;  5JRC A;  1XNR T;  2RA1 A;  5KDM C;  4X65 T;  2E9X C;  4LML A;  4X1K E;  4YTN A;  3ZC0 A;  4LMK A;  4MLK A;  3RQW A;  2NWB A;  5JRE A;  3FHN A;  4EEB A;  4X1I E;  3PUA A;  2XZE A;  1W0A A;  3N9M A;  4ILB A;  5AQO B;  2RPA A;  3A5X A;  5L3G B;  2LSY A;  2XTL A;  3AAE B;  4X20 E;  3PUZ F;  2KZ7 B;  2P9B A;  2XAS B;  2VQE T;  2XAQ B;  2LT3 A;  2D2S A;  4YSX A;  3NVO A;  5CGM A;  3OBV E;  3DTO A;  4ZHQ E;  3UU5 A;  3N9L A;  5LHI B;  2UXD T;  1IJ5 A;  1X9B A;  2KIN B;  4NUU A;  3QB5 K;  3C50 A;  4M1P A;  4B3R T;  3AE8 A;  1O3X A;  2BDE A;  2K48 A;  4KBM B;  2LHR A;  2CBJ A;  2KMF A;  3FBZ A;  3PUY F;  3CML A;  4LF8 T;  3C4X A;  4P0B A;  4CI2 B;  2LM2 A;  3CX6 B;  5AQP B;  2BS2 A;  4JI0 T;  3L39 A;  2E8I A;  4IL4 A;  2VAS A;  5HYA A;  2YU2 A;  5EK4 A;  4IT4 A;  3AXJ B;  4QH5 A;  1WYB A;  1CUN A;  2YIN A;  3LBX A;  5LHG B;  4JI4 T;  2W66 A;  3IEE A;  4HFV A;  1KNR A;  3RYC E;  3UTK A;  3CX8 B;  4JLE A;  3L3P A;  1BR1 A;  2W0G A;  1XWM A;  4HKA A;  3O1H A;  2BVL A;  2XM1 A;  5AQM B;  5ABF B;  4AQF C;  3PU3 A;  1ZKE A;  3NZQ A;  2XAG B;  5LJM A;  4IE0 A;  4HWF A;  3KBT A;  4KMC A;  2DWK A;  5FY7 A;  4IDZ A;  3BK9 A;  3PUV F;  1XNQ T;  3KV9 A;  3RX6 A;  3RRW A;  2J1D G;  3AE6 A;  2YU1 A;  4ADZ A;  4U2Y A;  5JR9 B;  5IWA T;  2LLY A;  4DV2 T;  4H9P C;  1OED C;  4NPP A;  4L0R A;  1HCI A;  4HFC A;  2WB5 A;  3ZSS A;  4LF7 T;  2FJE A;  3UUM A;  3Q5D A;  4DR4 T;  2A72 A;  3HKD E;  4UF0 A;  4FI5 A;  2KLQ A;  3T8O A;  4EV6 A;  3DJB A;  4PJN A;  2PFV A;  2CLY B;  4YHJ A;  2DHR A;  1Z0P A;  3MZK B;  2LSJ A;  4AQY T;  4DBQ A;  4EB6 E;  1G73 A;  2SPC A;  4CXY A;  2W00 A;  3ZPO A;  2EHO D;  5ABE A;  4HFB A;  1L0V A;  2M67 A;  1W09 A;  3Q5X A;  4IST A;  4FJO A;  4DR6 T;  5JDL A;  4U72 A;  2XUE A;  2H88 A;  4YLH A;  5J1G A;  2V5C A;  3I0Q A;  2ACZ A;  3J9X 1;  1E1H B;  4EZH A;  5AQF B;  2HN2 A;  2CRB A;  5J2U E;  5LMN T;  1ZV4 X;  4ZOL E;  3K3N A;  1NAF A;  3S4U A;  4IDN A;  2C5K T;  3C51 A;  3ZT6 A;  1YKE B;  5FNV E;  1IAP A;  3TKL B;  4ERR A;  2WQY A;  4YXD A;  4CXW A;  4DND A;  3HL6 A;  4EED A;  1M7K A;  3UUX B;  4H9O C;  3ZT5 A;  4EXT A;  3TLU A;  3VR8 A;  1SE7 A;  2XJ7 A;  3N9N A;  4UEL A;  3VRA A;  3C4Z A;  1MMG A;  4E7S A;  4O4J E;  3BQK A;  2IHR 1;  3KFW X;  1YQ4 A;  3AEA A;  3EAM A;  2Q9Q A;  2XAJ B;  1BR2 A;  3C4W A;  4QXB B;  3O4X E;  5AQT B;  3I1A A;  1MIY A;  4UV9 B;  5JDH A;  4YTM A;  3PUG A;  1T72 A;  5HXC A;  3RH3 A;  2XQ4 A;  5H6R B;  4NXN T;  2L3L A;  2L9Q A;  5JVD E;  1J5E T;  2WMO A;  3AAI A;  5FY0 A;  4ZI3 C;  3WAK A;  4PK6 A;  5CA0 E;  2V6Y B;  5L3C B;  2CA5 A;  3H37 A;  2HN1 A;  3WAJ A;  4DBR A;  2WM9 A;  2B1E A;  5LBM A;  2UXX B;  3CQC B;  4HWD A;  4X66 T;  2EHO C;  4PK5 A;  4AKL A;  2UXC T;  5LBQ B;  5F8P A;  2LKG A;  4UVB B;  5HAX A;  1Z8U A;  2JQQ A;  5JDN A;  3RIU A;  3JAF A;  3JCF A;  2IW5 B;  2LSG A;  2HPL A;  2CEA A;  4L9I A;  2B76 A;  4LMJ A;  1CHU A;  1LKX A;  3AEC A;  1UGO A;  2M6I A;  1IBL T;  5LCY A;  4DR3 T;  4AKH A;  4MAL A;  1WLX A;  2DL1 A;  5F5W A;  2JMH A;  3LK3 B;  4UF0 B;  3PUW F;  5FL1 A;  5AQL B;  1J1J A;  3PJA A;  3RC3 A;  1ZOY A;  3VU7 H;  3GWH A;  1WR0 A;  2QVA A;  3QC9 A;  2C0S A;  5ADX L;  3FZF B;  4DV6 T;  2X9H A;  3CPZ A;  3RYF E;  4IGU A;  1KNP A;  3FXE B;  4GK0 E;  3NRY A;  2N9D A;  4DR2 T;  4UEM A;  4JV5 T;  2KWI B;  3AXJ A;  2XPK A;  5FXW A;  3M65 A;  5L3D B;  4MHC A;  4XZC A;  2MPK A;  4CI3 B;  4JI7 T;  1OWA A;  2W62 A;  1NEN A;  4AIU A;  4ILC A;  3P4S A;  2JPF A;  5DAB A;  4HTE A;  1IJ6 A;  4PAG A;  3H3M A;  2ES0 A;  4HWC A;  3DP7 A;  5C3J A;  2XY8 B;  4UR9 A;  2QRX A;  3AA0 B;  4GIW A;  4DVD A;  3RKO A;  2X66 A;  3ZMU B;  2V1D B;  3P7I A;  4L5G A;  1HX8 A;  2R6G F;  3RRC A;  4A56 A;  5JR9 A;  4YTP A;  4EZ4 A;  4TWH A;  5L4E A;  3EDV A;  3H3A A;  4ZS3 A;  4OK0 A;  1BR0 A;  2WU5 A;  3OJA A;  5CFB A;  4Z8X A;  3IBP A;  2NW7 A;  4AI6 A;  3ZYK A;  4CXX A;  1LVK A;  1R8I A;  1MIV A;  5HEO A;  3V5S A;  3OYX A;  3RC8 A;  3IHR A;  2UUA T;  3EAB A;  4DR5 T;  1N32 T;  2W67 A;  4LF4 T;  2QGS A;  5FYM A;  5HEJ A;  5L3F B;  2NOX A;  4U7I A;  5HCJ A;  5FVL A;  4BAY B;  1Y64 B;  3AE3 A;  2CM0 A;  4LF6 T;  4PJM A;  4O4I E;  5AQG B;  3F31 A;  4DUY T;  5JDG A;  3V5U A;  2ZM2 A;  1XDP A;  3EDU A;  3RI5 A;  4A97 A;  3ZMT B;  5HWX A;  3I9Y A;  3CX7 B;  4UVA B;  3FB2 A;  3EVY A;  5JDF A;  5LA6 E;  2PG8 A;  3N2O A;  1N33 T;  3SFD A;  3RKG A;  4NIQ A;  3NZP A;  4I0U A;  1KEY A;  3KBU A;  4DMW A;  2YK0 A;  5CA1 E;  4IDP A;  4IL9 A;  3AE9 A;  4I55 E;  2H7O A;  2AXD S;  2LSI A;  3W15 B;  3HA4 A;  1AJ3 A;  2WWU A;  4DUZ T;  3TLT A;  4ZI7 E;  3MKD A;  3AVS A;  3LJC A;  4NUV A;  2XQY A;  4MFR A;  5FVK A;  1UUR A;  2K9A A;  3RYH E;  2D5U A;  3JAE A;  4P0A A;  1IBK T;  2FJB A;  3N2K E;  2CHO A;  4UV8 B;  5L2L A;  3AA1 B;  5HEG A;  4PFP A;  5E0O A;  4LF9 T;  4HEA A;  2ODV A;  2WWV A;  3CQG B;  4JI2 T;  2BBJ A;  4HFE A;  2XSB A;  3Q2M A;  3ONL C;  3T1H T;  2ACX A;  2FJD A;  3K8P C;  3AA6 B;  5ABG A;  2LE8 A;  2V6Y A;  1FMV A;  1H7C A;  1U5P A;  3A7M A;  3QOF A;  4UXN B;  1Y01 A;  1T8B A;  2BKN A;  5TAO A;  4U33 A;  2CXD A;  3P4W A;  3PTR B;  2W2U A;  3PUQ A;  1IBM T;  1GQE A;  3R6N A;  1SHZ C;  3K3Q C;  1YXR A;  3IA3 A;  2XQ7 A;  3ZJ1 A;  4GYR A;  4WBO A;  4KX6 A;  4CN1 A;  2WDR A;  5JDQ A;  3SS1 A;  1DU2 A;  2E9X A;  5JH7 E;  1JNZ A;  2VUR A;  1XMO T;  3AA7 B;  4ISS A;  2IAK A;  3FZH B;  2ZM6 T;  2K5B B;  4ZS2 A;  4Z91 A;  3P8C D;  4X1Y E;  4ZI3 D;  4K0K T;  3UUB A;  2K3W A;  2J47 A;  4QXC B;  5HEH A;  5M4Y A;  4GOU A;  5LNK A;  2OV9 A;  3K3O A;  2BG9 B;  2PBI A;  3FBL A;  2WZI A;  5H6Q B;  4JEH B;  3UU6 A;  3GMI A;  5LYJ E;  3C98 B;  2IUB A;  3J7Y q;  2BS3 A;  3RIU C;  3ZCI A;  4TV9 E;  2KXP B;  2LM9 A;  2WCA A;  4TUY E;  2HHH T;  2IIU A;  2V7K A;  3Q9D A;  4QX7 B;  5LOV E;  4AKR B;  2PJQ A;  4YJ3 E;  2WSS V;  4UIG A;  3F2E A;  4DR1 T;  5JQG E;  1JNR A;  2DLR A;  3SFE A;  2JQK A;  3NRX A;  3QK6 A;  2Z6E A;  5LGT B;  2WZH A;  4DO0 A;  5GON E;  3HR0 A;  5AFU L;  2X51 A;  3FZK B;  2L8K A;  1HNX T;  4IDQ A;  3N9O A;  4PFO A;  2I59 A;  2J62 A;  2OLT A;  2XQA A;  2JRK A;  3CIR A;  2D0U A;  3LDQ B;  4A98 A;  3ZEF B;  1KFY A;  5L3E B;  3N5L A;  1E7P A;  4KP3 C;  2N1G A;  2G0U A;  1FMW A;  3AAA B;  5JTG A;  1D1B A;  4GKK T;  2BKO A;  3ZT7 A;  3GN5 A;  2UUB T;  3ABV A;  4TN7 B;  4B3M T;  4GKJ T;  3RGL A;  4TWF A;  2YOE A;  4HGA A;  2XSA A;  1MNE A;  4DR7 T;  2YKS A;  1ZHC A;  3B13 A;  1OED A;  3K1S A;  3ZST A;  5AQK B;  3ANW B;  4PJL A;  2VB6 A;  5HXE A;  4UVC B;  2VQF T;  5JR9 C;  2X0L B;  3LK4 2;  2VKJ A;  2C5I T;  3KDS E;  4EAH A;  1NEK A;  4P1N A;  3WI3 A;  4QXH B;  2M6B A;  5IYZ E;  2BKP A;  4IRE A;  4ZEY A;  3AED A;  5BR8 T;  2E9X B;  5LHH B;  4F6R C;  4CZZ B;  1WCR A;  3I0O A;  1XDO A;  3HKE E;  1LRZ A;  2VWA A;  3A8Y C;  1VCT A;  4DV0 T;  2YDS A;  3ZN1 B;  4GYS A;  5DJQ C;  5EK2 A;  5FY1 A;  3OKQ A;  3SOL A;  3ZYL A;  4KUM B;  3B57 A;  4JI5 T;  2FBW A;  3FZM B;  3MAC A;  3VRB A;  5FP3 A;  5AQQ B;  4AKG A;  3TLV A;  2JQH A;  2DCF A;  3ZMV B;  2LOP A;  4DV5 T;  3UU4 A;  5LG3 A;  2ZMA A;  4C91 A;  3T1Y T;  3U78 A;  4TV8 E;  4G2A A;  3RIF A;  3ZCJ A;  2IC6 A;  2IML A;  5FXZ A;  4V1A v;  2UXB T;  2WDV A;  4JI6 T;  3JC6 D;  1UUS A;  1XMQ T;  3P4Q A;  5L4H A;  1QLB A;  2DWG A;  4YHH T;  5LGU B;  3KV4 A;  5DQV A;  2JQ9 A;  4I50 E;  4H9N C;  1YKH B;  3LG7 A;  2X68 A;  3HKC E;  3NKZ A;  4P09 A;  1WR6 A;  1J5W A;  2ZM0 A;  1HX1 B;  4U3C A;  2A9U A;  5EZY E;  4JUY A;  3UU8 A;  2C5J A;  5LXT E;  5AQN B;  2D9D A;  2CHN A;  3LFM A;  4IE7 A;  2UXN B;  3BQL A;  2CWY A;  2Y48 B;  4O2B E;  2NW8 A;  1IZN B;  2HH7 A;  1WRD A;  4AQG A;  4DMV A;  2VK9 A;  4KHZ F;  5LP6 E;  1FIO A;  4HWI B;  5HXH A;  3UQ4 A;  3F57 A;  4O4L E;  3GN5 B;  1US7 B;  2I0M A;  3U3I A;  4IE6 A;  3UFE A;  2LRK A;  3AEB A;  2WDQ A;  1FJG T;  2CXF A;  4TWD A;  4OYK A;  3ONX A;  2DNX A;  4JBW F;  2BG9 A;  1OED B;  3VHL A;  2H89 A;  4B3T T;  2HPJ A;  2VKD A;  1NWM X;  4PJJ A;  3EI0 A;  2WBL A;  2D0T A;  1N34 T;  4JI1 T;  2LEH A;  5AQV B;  4JI8 T;  3OPC A;  3X1D A;  4ZZC A;  2Q9Q D;  5LJN A;  1YD8 G;  1EZ3 A;  3UUL A;  4YFS A;  4TNV A;  2ZM8 A;  1W0B A;  4WZX A;  2MTQ A;  5JDM A;  1MIW A;  5HXS A;  4PW8 A;  3E08 A;  5AQU B;  1YQ3 A;  1ZEE A;  1QSD A;  3PU8 A;  3ZMZ B;  4TNW A;  3GA8 A;  2V7M A;  4H9Q C;  3MA9 A;  3MK7 C;  5C8Y E;  2H3R A;  4OHF A;  3JC6 C;  3L8R A;  2WP9 A;  2UUC T;  3OYZ A;  2KND A;  2XHE B;  1MMD A;  4F8H A;  3N9P A;  3O1J A;  1T7S A;  4ANJ A;  3KVA A;  5FXX A;  2X0H A;  4BJM A;  5IUX A;  3BQI A;  3QNU A;  2V26 A;  4HFD A;  2Y8D A;  3ZYM A;  5CB4 E;  1SA0 E;  4YSY A;  2NR4 A;  1X79 A;  3RHW A;  2Y6X A;  3AE7 A;  5AQR B;  3D0T A;  2A3D A;  3VKH A;  5FMN A;  3HI2 A;  4JI3 T;  4LFC T;  4EYU A;  1KF6 A;  4Z90 A;  3N9Q A;  3M3Z B;  2MOZ A;  2WAU A;  1SUM B;  2W63 A;  4MBQ A;  4H63 H;  3RIA A;  2CE7 A;  2WY2 A;  4IIJ E;  2E5L T;  2IC9 A;  3VR9 A;  4O4H E;  3Q5E A;  5FL0 A;  4GK5 E;  4KHP T;  4BA9 A;  4LFB T;  3I9W A;  1UK5 A;  3ANW A;  3UQ7 A;  2NW9 A;  4QH4 A;  3ZMS B;  3QB5 A;  3CWZ B;  3CK6 A;  1W9R A;  2NTY A;  4CN6 A;  2YN6 A;  2VVS A;  3CKD A;  4U2Z A;  3ZJ2 A;  2Q9Q C;  3AE1 A;  2ODU A;  4DID B;  4YJ2 E;  5AQI B;  1MMN A;  4X5T A;  3MXZ A;  3OVU A;  3JAD A;  2V7I A;  4KI0 F;  2X9W A;  1XZY A;  2W4X A;  1BR4 A;  2MYS A;  3SWH A;  4XBF B;  3TLW A;  3E0Z A;  2VVN A;  4LFA T;  2EHO B;  2XQ6 A;  2BG9 E;  3IF8 B;  2NP9 A;  2LSK A;  3P50 A;  5LGN B;  1HS7 A;  2CBI A;  2ZLY A;  4AKI A;  3FZL B;  3UUN A;  5AQS B;  1OXZ A;  3FXD B;  2V8S V;  2VL8 A;  2LJL A;  3N2G E;  2CCQ A;  5JRC B;  3PE0 A;  1M62 A;  3PUS A;  3AE4 A;  3PUX F;  1HNZ T;  3Q5W A;  1E2A A;  4A5X A;  4U74 A;  2YDR A;  2PTF A;  2V6X A;  3MJX A;  4QH1 A;  2BVM A;  5ABH A;  1HF8 A;  5LB7 B;  1LVF A;  1I94 T;  4HFH A;  3KV5 A;  3EUH A;  5L47 A;  2CPT A;  3AEE A;  2KSR A;  4TZ4 C;  3PJA J;  5DQW A;  3RQU A;  4PK4 A;  3KVB A;  4O8S A;  4DV7 T;  2BS4 A;  2H7V C;  3HKB E;  5KMG P;  3ZLI A;  2CMR A;  1UCU A;  3G06 A;  3L09 A;  1ZP0 A;  4EYY R;  1MND A;  4AQF A;  4JYA T;  3UT5 E;  3KV6 A;  4X62 T;  4BJN A;  2J4G A;  1KNZ A;  1D1A A;  2QA7 A;  5ETW A;  1VCS A;  3AE2 A;  2E5V A;  4JEU B;  4IDO A;  2BBH A;  5HXR A;  3RPU A;  2X9Y A;  5KX5 E;  5J0Z A;  2NTX A;  4XAX B;  2IDO B;  2BZB A;  4HE8 A;  4WBN E;  1V9D A;  2LRL A;  2WS3 A;  3EHZ A;  3B5M A;  3LBX B;  1N36 T;  3ONJ A;  1S35 A;  2V7J A;  5C2T A;  3O1I A;  1HG5 A;  4ILA A;  5HCM A;  3LK2 B;  4AIS A;  4C90 A;  4TX5 A;  4IE5 A;  4WNK A;  4B6X A;  5FXV A;  4DV3 T;  2XM2 A;  1HR0 T;  4WYV A;  4PNI A;  1D0Z A;  3SRZ A;  1S94 A;  2N2N A;  4LF5 T;  2CXL A;  1G8X A;  3CVR A;  4OYJ A;  4YT0 A;  5KXJ A;  5BMV E;  3VKG A;  2VL0 A;  1D0Y A;  3O9X A;  2QYW A;  4G63 A;  4EGW A;  1U4Q A;  2JJ9 A;  4HN9 A;  3QUJ A;  4DV1 T;  5L3B B;  4I4T E;  1HG2 A;  2CLY C;  2V5D A;  2YEV C;  2MBG A;  5HWY A;  4B3S T;  3ZC1 A;  2X0Y A;  2GK9 A;  3ESL A;  4CN4 A;  3AE5 A;  1QUU A;  4Q25 A;  2BG9 C;  4ZXL A;  5LMU T;  5J2T E;  2VKO A;  4EIW A;  2KT9 A;  2FJA A;  4EOZ B;  1VRB A;  2V7L A;  2AE9 A;  5LG4 A;  4ZI2 D;  4OFZ A;  2X9X A;  4QWN B;  1YW0 A;  3PUR A;  2E2A A;  1B7T A;  2WMN A;  4ASK A;  3PV0 F;  1HNW T;  2E9X D;  4X64 T;  4YY3 T;  4DV4 T;  4OX9 T;  2X67 A;  2F4V T;  2LKH A;  2FUP A;  5AQJ B;  4ILU A;  2WU2 A;  2LHN A;  4ZZB A;  1FEW A;  2A2F X;  3P4R A;  4YSZ A;  5EK3 A;  4QX8 B;  4E7Z A;  3ZN0 B;  4AXP A;  4U31 A; 
#chains in the Genus database with same CATH homology
 3ZT5 A;  2V6X A;  4CN6 A;  5CGM A;  4IT4 A;  3ZSS A;  1WCR A;  3ZT7 A;  1YXR A;  4WZX A;  3K1S A;  3ZT6 A;  3ZST A;  5CJ5 A;  2XZE A;  2V6Y B;  2V6Y A;  4U7I A;  4U2Y A;  2DL1 A;  5FVL A;  4NIQ A;  4U2Z A;  2RPA A;  5LB7 B;  4P1N A;  4CN4 A;  4U3C A;  2WY2 A;  4CN1 A;  2MPK A;  2K3W A;  2A9U A;  2JQH A;  2LRK A;  2CPT A;  2WWV A;  4U33 A;  5FVK A;  2CRB A;  4ZEY A;  4U31 A;  2W2U A;  3EAB A;  2LRL A;  4A5X A;  4U7Y A;  1WFD A;  1WR0 A;  2JQK A;  2JQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...