2XZEA

Structural basis for amsh-escrt-iii chmp3 interaction
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
141
structure length
141
Chain Sequence
b'SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAM-BINDING PROTEIN
publication title Structural Basis for Escrt-III Chmp3 Recruitment of Amsh.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein transport
total genus 53
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08969 USP8_dimer USP8 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2xzeA00
2MPKA 4U3CA 4U31A 4IT4A 2A9UA 3K1SA 2XZEA 4U33A 2JQ9A 4A5XA 2CPTA 2JQKA 2WWVA 2V6YB 2V6XA 5CGMA 1WR0A 4NIQA 4U2YA 2LRLA 4P1NA 4U7YA 4WZXA 3EABA 5LB7B 2LRKA 5FVLA 3ZT6A 2DL1A 3ZT5A 2V6YA 4CN4A 2RPAA 2W2UA 5FVKA 1WFDA 4CN6A 4U7IA 5CJ5A 4ZEYA 2WY2A 2JQHA 2K3WA 3ZSSA 4U2ZA 4CN1A 1WCRA 3ZT7A 1YXRA 2CRBA 3ZSTA
chains in the Genus database with same CATH superfamily
1ZEEA 3PUXF 3O1IA 3AE8A 4O2BE 4X1IE 3RYIE 4U2YA 4CXYA 3CVRA 1LRZA 4U7IA 5BR8T 4U2ZA 4IDZA 2VKOA 1YD8G 3PJAJ 5HXSA 1LKXA 2Y48B 5HWXA 5FP3A 2XZEA 5AQNB 4A97A 1FEWA 3UUBA 5LG3A 4LF6T 4UF0A 3RRWA 3QB5K 3AA1B 2BVMA 4CN6A 4K0KT 4Z91A 5LJNA 3ANWB 2CHNA 5AQGB 2E9XB 3OVUA 4CZZB 2M67A 3CQXC 4MHCA 4JLEA 2K24A 5LB7B 4AKGA 3F57A 1ZV4X 2N1GA 4H9PC 2BG9E 3P4WA 3RIAA 2J4GA 3LBXB 3NKZA 2CMRA 5HEGA 5HYAA 5ABFA 2HH7A 3MJXA 4IT4A 5ADXL 3S4UA 3MXZA 2KLQA 3N9MA 4JUYA 5L2LA 2VQET 4TX5A 1SUMB 3IEEA 3HL6A 5BMVE 5LG4A 3PUAA 2LSYA 4HFBA 1XMQT 3BQLA 3GWHA 2B76A 2IW5B 2R6GF 4I4TE 3GMIA 3M3ZB 3RIUA 4HEAA 4IE4A 3K3OA 2CPTA 3N9PA 1I6ZA 2NW7A 4HWDA 5LMUT 1N36T 5AFUL 5CFBA 4KUMB 2X9XA 5JREA 3AEEA 2JMHA 5IWAT 1UURA 4LFAT 4AQFC 5C8YE 3ZMVB 5JDGA 3RH3A 5LMNT 4HFHA 4TWDA 1MNEA 4OX9T 5JDQA 2DCFA 4C90A 2WZHA 1KFYA 5L3FB 2QRXA 4HFDA 5J1GA 4JEHB 2E5LT 2VL0A 2I0MA 1IJ5A 3HA4A 3AVRA 2L3LA 1X9BA 2NR4A 4EYYR 2W66A 4JBWF 1HF8A 3UTKA 4X64T 3CX7B 3SFEA 1X79A 2M6BA 2V6YB 2XM1A 1IJ6A 4ZI2C 4H9SE 5J2UE 4DV1T 4YXDA 2NTXA 2VASA 3AB3B 4X1YE 3R84B 2UXBT 4PNIA 3RYHE 3X1DA 1T8BA 5EK4A 4XBFB 4ZI2D 3C4XA 1HNWT 5HCJA 1MMGA 3ZMUB 3KBTA 4AIUA 4GOUA 3O9XA 3ZT6A 4QH1A 3O1HA 3P4SA 3OBVE 2ZM0A 4I50E 3EAMA 4JI2T 4CN1A 5JRCA 2A2FX 1N33T 3RHWA 5LHGB 2WCAA 1UX4A 2J47A 4UEMA 5IUXA 2V6XA 1XDPA 2VKHA 5L3DB 2JPFA 2YK0A 3EHZA 3CKDA 2CBIA 2V5CA 2BDEA 5FXVA 5JVDE 3JADA 3AEBA 4AKHA 5LBMA 1OWAA 3PUQA 3RQUA 4H9OC 2WZIA 5EZYE 3N2OA 1XZYA 5FY0A 5AQLB 4I0UA 3PUZF 2IHR1 2WBLA 2OV9A 4TV8E 4X1KE 2BS4A 2LJLA 5DQVA 4L5GA 4F6RC 3VR8A 2CCQA 4O4JE 4P1NA 3JAFA 4UV8B 1QLBA 4Q25A 4NXMT 2JRKA 3P4RA 1WFDA 3CIRA 5FXWA 4EB6E 5KMGP 3RIUC 3EUHA 3K1SA 1V9DA 4HE8A 2WWVA 4YHHT 2HN1A 4OFZA 4NUUA 3J7Yq 2XUEA 1VCSA 3TLVA 1XMOT 1Z8UA 2D0UA 5M4YA 2QVAA 5DQWA 4B3RT 1XWMA 2CWYA 3V5SA 3ONJA 1ZKEA 2W4XA 2YU2A 3A8YC 3W15B 4YTPA 3B57A 3HR0A 3KINB 3LSVA 2LT3A 2XQYA 3QOFA 2XQ9A 2CA5A 4PJLA 1SA0E 3F31A 4LMJA 3Q5WA 4KHPT 3TLUA 3ZLIA 2J62A 2E2AA 4YSZA 4UVBB 4DV4T 2BG9A 3UU4A 4I43B 3I1AA 3AXJA 3MACA 2XQ7A 1WR6A 1NWMX 3QB5A 4TNVA 5HEJA 3N5LA 1CHUA 4P0AA 2UXNB 2H3RA 4YTNA 3TLWA 3OYZA 2X68A 5HXCA 2W67A 2WMNA 4TWFA 1OXZA 4U72A 3RYFE 2P9BA 1EZ3A 2FJBA 4HWIB 4GIWA 3RPUA 3MA9A 2UUBT 3C4WA 5E0OA 2XM2A 5HXHA 5IYZE 1D1AA 4ZOLE 1WCRA 3ZKRA 4LF7T 4WBOA 3ZCIA 4ILAA 2YOEA 2V5DA 5HEOA 3GN5A 2IIUA 2PFVA 2XJ7A 5CB4E 1SE7A 3F2EA 3ZT7A 3EDVA 2I6HA 3FHNA 2NW8A 1HTJF 2I59A 3ZCJA 2XASB 4UXNB 1J5WA 2ZMAA 4YFSA 2VB6A 3CX8B 5FXXA 3KDSE 4NPPA 1HFAA 4BAYB 2JQQA 1J1JA 3FBZA 2Q9QA 3ZN1B 2Z6EA 4QH5A 4ZI3D 1SHZC 4PJMA 4ISTA 4GYRA 4H63V 4YLHA 1OEDB 3PUSA 2C5IT 3UULA 4PAGA 3VRAA 5LP6E 1YXRA 3ZMSB 5HWYA 4PW8A 4YT0A 2A72A 4ADZA 4A5XA 2DI4A 3C51A 2LKGA 5CGMA 4YSXA 3PE0A 4ZXLA 5AQTB 2XQ5A 2HN2A 2W63A 2IUBA 2BKPA 3FXEB 5C2TA 4UIGA 4LF5T 1MNDA 4FJOA 4H9RC 5FL1A 2VKDA 4DR2T 4DR3T 4K0UA 3P4PA 4COFA 3UFEA 3LDQB 2OLTA 2MOZA 4CXXA 4DR6T 4JI3T 3ZMZB 1N34T 4DBQA 1HNXT 5LJMA 3T1HT 2WY2A 4QH4A 4AQYT 2CM0A 1FJGT 2EHOA 2LM2A 2CE7A 3B13A 5AQJB 3RF1A 2JJ9A 2X0HA 4HN9A 4B3TT 5JR9A 2VL8A 3LG7A 1KNPA 4V1Av 2ZM2A 4A56A 5CA1E 4OYKA 4EOZB 4ZEYA 2JQHA 2BG9C 4LMLA 1HG2A 2V7KA 1W09A 2CLYC 5AQKB 4YTMA 4U33A 4HKAA 2IMLA 3L39A 2CHOA 3E22E 4EIWA 2N2NA 4WBNE 4I55E 2HPLA 2W0GA 5KX5E 2WDRA 1T72A 3AA6B 2DHRA 4IIJE 3AE7A 2JQKA 5ABHA 3Q5DA 4NIQA 4E7SA 2L9QA 4TUYE 4H9QC 4ZS3A 5LXTE 3Q5XA 4HFVA 2KMFA 2IDOB 4DV5T 4UELA 3SOLA 5F3JA 2CXFA 4AISA 2IC9A 1KEYA 4QXHB 1E2AA 3N2GE 4ILUA 5AQFB 2ACZA 5JDFA 3PUWF 5C3JA 2XQ8A 2JQ9A 2CXDA 4DUZT 2ES0A 2MAWA 2B1EA 5CA0E 2UXCT 2NOXA 3PU3A 5KDMC 3BQKA 4AXPA 2GK9A 3JCFA 2Q9QC 4ZZCA 4AI6A 5A1LA 1W9RA 1HR0T 2XQ4A 4F8HA 2ZM8A 3IBPA 3EDUA 3AAAB 4ILCA 1XNRT 2LSGA 3HKCE 2Q9QD 2LSJA 2ACXA 4FI5A 2KWIB 3ZC1A 3DP7A 2AXDS 2JIWA 5AQSB 3NZQA 4G63A 4JEUB 2C5JA 1Y01A 3J9X1 4ZHQE 4HTEA 2LHRA 4WZXA 3EABA 3D0TA 1ZHCA 1MMDA 1WRDA 3I9WA 3KV4A 4PJNA 3PDYA 1H7CA 3FB2A 4OHFA 3VKGA 3UU3A 3P7IA 3K3QC 5JDMA 2KXPB 4B3ST 3KFWX 3PUGA 1FMWA 5LBQB 1IBKT 2LKHA 5AQRB 1T7SA 4U31A 2VWAA 2WS3A 5H6QB 2EHOC 3CQCB 4A98A 5J2TE 1MMNA 3AECA 3ZJ2A 5KXJA 3PUYF 4QX8B 5JR9C 3U78A 4PK4A 2VVSA 3OTOT 2EHOD 3CPZA 4DV7T 3CK6A 2C5KT 1S94A 1L0VA 2MPKA 2X0YA 4PK5A 4CQIA 2BBHA 4DNDA 3ZPOA 3LK3B 4ZS2A 3K3NA 2WQYA 5HXEA 3CWZB 3G06A 3RKOA 1YKEB 4ILBA 2RPAA 1I94T 3ZYLA 2K3WA 3UUXB 4AKIA 1KNZA 4HFCA 2FBWA 5L3EB 5FMNA 2UXXB 2V1DB 3AVSA 3N9NA 2XQ6A 3JAEA 2D2SA 4HWHA 4P09A 3BK9A 1R8IA 2LSIA 4P0BA 4TV9E 3RC3A 3KV6A 2PTFA 4C91A 3ANWA 4OYJA 2E9XA 3RLFF 4DO0A 3KVAA 3PTRB 2YEVC 1D0XA 2HPJA 4UF0B 1BR0A 3LBXA 1LVKA 4CI1B 4KBMB 1JNZA 1D1BA 4KMCA 3WAJA 4HGAA 3FZLB 5JDLA 2V7IA 5JDNA 1CUNA 1KF6A 4ZZBA 5F8PA 4B3MT 4X20E 1S35A 1D0ZA 4DV6T 5JDHA 2LOPA 2YKSA 4GK5E 2M6IA 1WYBA 4X65T 5FY1A 2X9WA 1T98A 4XAXB 1UGOA 1D1CA 4UVCB 1GQEA 4PJJA 3KV9A 4EXTA 3GA8A 1DU2A 2SPCA 4NUVA 3ZN0B 4JI7T 2FJDA 5AQMB 2MTQA 5FVKA 3LK2B 2QGSA 5FKYA 4KP3C 2QYWA 4DR5T 5AQQB 3I0OA 3QC9A 2W61A 3T1YT 2YINA 5LHIB 2ZLYA 3NRXA 4EZ4A 2W00A 4KHZF 2UUAT 1IBMT 2CBJA 5L4EA 4ISSA 4GYSA 4DIDB 4O8SA 5HCMA 3L09A 1U4QA 4H63H 4CI3B 2LSKA 3OYXA 3V5UA 5TAOA 3RYCE 5EK2A 4YY3T 5FVLA 5AQHB 3RRCA 3ETVA 2KSRA 4TN7B 4IDNA 2E8IA 2V6YA 1OEDE 3AEAA 3Q5EA 4J2CA 4DMVA 3ZSTA 1JNRA 4LF9T 1IZNB 2VK9A 2X51A 4N78D 1YQ4A 4CI2B 3OKQA 5HEUA 2LLYA 4DBRA 4ZI3C 3O1JA 2XAHB 2FUPA 2UU9T 2DWKA 1VRBA 1D0YA 4QWNB 4BJMA 5DJQC 2WAUA 4LFCT 4O4HE 3A5XA 2XQAA 2FJEA 2LOSA 3ESLA 4IDQA 3LFMA 3KVBA 3AEDA 4HWFA 1BR4A 2A9UA 2IC6A 1YW0A 4IE5A 4IE0A 5L3BB 5LHHB 1HG5A 5JRCB 2E9XC 3IA3A 2X66A 2JMKA 2RP4A 4EZHA 1N32T 2BKNA 3PJAA 3O4XE 3ZC0A 5ETWA 3RKGA 2LM9A 3SRZA 2E9XD 2LEHA 3AEGA 1IAPA 2OA5A 1W0AA 4LF8T 1WLXA 3AAIA 3MK7C 3SS1A 4IHJE 2RA1A 4ZI7E 3QK6A 3FZKB 5JH7E 2G0UA 1IBLT 4ANJA 1FMVA 1US7B 3NRYA 1BR1A 5HXRA 1UX5A 5LGTB 3DJBA 3WAKA 5AQOB 5L3CB 2XSBA 2KINB 2BS2A 4WNKA 1U5PA 1J5ET 2ZM6T 3HKDE 4QX7B 2VQFT 3ZYMA 3H37A 4IDOA 2W62A 5JTGA 3FBLA 3RQWA 1XNQT 2XAFB 5EK3A 2V7MA 4YHJA 4GKJT 4JI4T 1NAFA 2V7LA 2XAJB 3IHRA 2VVNA 2LRLA 2WP9A 2ODVA 3HI2A 1UK5A 2KWHA 2XTLA 3UQ4A 3R6NA 4QHOA 1QSDA 3VKHA 2C0SA 1B7TA 5JQGE 4NXNT 5F5WA 2D0TA 2X0LB 3VU7H 4O2AE 4BJNA 1AJ3A 4HWCA 3RIFA 4EYUA 2V8SV 3ZYKA 2F4VT 1VOMA 3P50A 4DV0T 3L8RA 4TZ4C 4U3CA 3U3IA 4YSYA 3Q9DA 3I0QA 4JYAT 2DNXA 4B6XA 2WU2A 2BG9B 4LMKA 2NTYA 2CLYB 2H89A 5ABGA 3AXJB 3AA7B 4DMWA 3ZMTB 2X9YA 3E08A 2CRBA 5H6RB 3VRBA 3TKLB 2YDQA 2LHNA 1YKHB 2PBIA 2BZBA 3LK42 4U74A 5DABA 4JI0T 5LYJE 1WYCA 3CMLA 2H7VC 4PK6A 4YJ3E 3OPCA 3HKEE 3IF8B 4ERRA 2DWGA 2CEAA 4X5TA 3N9LA 3N9QA 5CJ5A 4X62T 3PU8A 5FXZA 5LA6E 2ODUA 3AE9A 1HX1B 3AE1A 3GN5B 2D9DA 4DR1T 2BS3A 3P8CD 3PURA 2LE8A 4AKRB 2WM9A 3MZKB 4EEBA 1OEDA 2N9DA 4AQGA 4IDPA 4HFEA 4QXBB 2WU5A 3AE6A 3ABVA 3AE4A 2XAQB 1KNRA 2BBJA 1G8XA 3FZHB 3ONLC 3C4ZA 2HHHT 2Q9QB 4WW0A 2WMOA 3NWIA 1ZP0A 4DV2T 2K9AA 2KZ7B 2NP9A 2UXDT 2YN6A 5FYMA 4JI1T 3NVOA 2XY8B 1Z0PA 3BQIA 1HNZT 4G2AA 2KT9A 5FNVE 2K48A 2Y6XA 4IL4A 2IAKA 3SFDA 4BA9A 1G73A 2CWOA 5LGUB 3C64A 2WSSV 3UU8A 2FJAA 3DTOA 3VR9A 5L3GB 3HKBE 3L3PA 3UFGA 4Z8XA 2K5BB 2YDSA 2E5VA 1QUUA 2PJQA 1E1HB 5LGNB 4QXCB 3FZFB 5IHYA 2LRKA 2EHOB 3EI0A 2WWUA 3WI3A 2VURA 3EVYA 1KK7A 4MBQA 2XSAA 1NEKA 4EGWA 3B5MA 3C50A 2V7JA 3CX6B 3N9OA 5JR9B 5LOVE 1FIOA 3UU5A 3AE5A 1MIVA 1YQ3A 4GKKT 2L8KA 4H9NC 3K8PC 1XDOA 3KV5A 3UT5E 2WDQA 5HEHA 5L47A 2BKOA 2Y8DA 4DUYT 4DR7T 4ASKA 3ZJ1A 3QNUA 3NBXX 3AE3A 4PFPA 4IREA 1UCUA 3JC6C 3RC8A 3ZT5A 5ABFB 1Y64B 2XQ3A 3FZMB 3H3AA 5AQPB 4O4LE 3ZSSA 4EV6A 2H7OA 3SWHA 3JC6D 1ZOYA 1WR0A 3A7MA 3PUVF 2WB5A 5LCYA 3UUNA 1VCTA 4UVAB 3NZPA 2WDVA 4L0RA 2MYSA 4CN4A 3CQGB 2DLRA 3M65A 2D5UA 1O3XA 5FL0A 2J1DG 3I9YA 4YJ2E 1HCIA 3T8OA 1MMAA 1HX8A 4JI6T 1HS7A 1UUSA 3RX6A 5ABEA 2MBGA 3QUJA 1MIYA 3AA0B 4IGUA 2X67A 2DL1A 4PFOA 2A3DA 3FXDB 4KX6A 5GONE 1NENA 1OEDC 4JI8T 5AQIB 3RGLA 3P4QA 3KBUA 4X66T 3E0ZA 4E7ZA 5J0ZA 4KI0F 3AEFA 5AQVB 2BVLA 4U7YA 2X9HA 2UUCT 2PG8A 2V26A 4DVDA 2W2UA 4JV5T 4LF4T 3UU6A 2AE9A 2CXLA 2XPKA 3TLSA 3LJCA 4OK0A 4TNWA 3AE2A 1W0BA 2XHEB 4M1PA 3ONXA 5FY7A 2KNDA 3H3MA 1E7PA 2NW9A 3ETUA 3TLTA 3ZEFB 4L9IA 4IE6A 3C98B 3PV0F 3N2KE 4AQFA 3VHLA 4UR9A 4Z90A 3UUMA 4JI5T 3MKDA 1BR2A 5L4HA 4O4IE 4IL9A 3OJAA 4DV3T 2QA7A 5HAXA 2YDRA 4TWHA 3RI5A 2YU1A 4EEDA 2H88A 4MFRA 2NWBA 4QKNA 4CXWA 1M7KA 3UQ7A 3Q2MA 4UV9B 1LVFA 4GK0E 4MLKA 4MALA 2VKJA 1M62A 2XAGB 4HFIA 4EAHA 3AAEB 4XZCA 4AKLA 5AQUB 1MIWA 5LNKA 4LFBT 4IE7A 4WYVA 4DR4T
chains in the Genus database with same CATH topology
2MPKA 4U3CA 4U31A 4IT4A 2A9UA 3K1SA 2XZEA 4U33A 2JQ9A 4A5XA 2CPTA 2JQKA 2WWVA 2V6YB 2V6XA 5CGMA 1WR0A 4NIQA 4U2YA 2LRLA 4P1NA 4U7YA 4WZXA 3EABA 5LB7B 2LRKA 5FVLA 3ZT6A 2DL1A 3ZT5A 2V6YA 4CN4A 2RPAA 2W2UA 5FVKA 1WFDA 4CN6A 4U7IA 5CJ5A 4ZEYA 2WY2A 2JQHA 2K3WA 3ZSSA 4U2ZA 4CN1A 1WCRA 3ZT7A 1YXRA 2CRBA 3ZSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPK A;  4U3C A;  4U31 A;  4IT4 A;  2A9U A;  3K1S A;  2XZE A;  4U33 A;  2JQ9 A;  4A5X A;  2CPT A;  2JQK A;  2WWV A;  2V6Y B;  2V6X A;  5CGM A;  1WR0 A;  4NIQ A;  4U2Y A;  2LRL A;  4P1N A;  4U7Y A;  4WZX A;  3EAB A;  5LB7 B;  2LRK A;  5FVL A;  3ZT6 A;  2DL1 A;  3ZT5 A;  2V6Y A;  4CN4 A;  2RPA A;  2W2U A;  5FVK A;  1WFD A;  4CN6 A;  4U7I A;  5CJ5 A;  4ZEY A;  2WY2 A;  2JQH A;  2K3W A;  3ZSS A;  4U2Z A;  4CN1 A;  1WCR A;  3ZT7 A;  1YXR A;  2CRB A;  3ZST A; 
#chains in the Genus database with same CATH topology
 1ZEE A;  3PUX F;  3O1I A;  3AE8 A;  4O2B E;  4X1I E;  3RYI E;  4U2Y A;  4CXY A;  3CVR A;  1LRZ A;  4U7I A;  5BR8 T;  4U2Z A;  4IDZ A;  2VKO A;  1YD8 G;  3PJA J;  5HXS A;  1LKX A;  2Y48 B;  5HWX A;  5FP3 A;  2XZE A;  5AQN B;  4A97 A;  1FEW A;  3UUB A;  5LG3 A;  4LF6 T;  4UF0 A;  3RRW A;  3QB5 K;  3AA1 B;  2BVM A;  4CN6 A;  4K0K T;  4Z91 A;  5LJN A;  3ANW B;  2CHN A;  5AQG B;  2E9X B;  3OVU A;  4CZZ B;  2M67 A;  3CQX C;  4MHC A;  4JLE A;  2K24 A;  5LB7 B;  4AKG A;  3F57 A;  1ZV4 X;  2N1G A;  4H9P C;  2BG9 E;  3P4W A;  3RIA A;  2J4G A;  3LBX B;  3NKZ A;  2CMR A;  5HEG A;  5HYA A;  5ABF A;  2HH7 A;  3MJX A;  4IT4 A;  5ADX L;  3S4U A;  3MXZ A;  2KLQ A;  3N9M A;  4JUY A;  5L2L A;  2VQE T;  4TX5 A;  1SUM B;  3IEE A;  3HL6 A;  5BMV E;  5LG4 A;  3PUA A;  2LSY A;  4HFB A;  1XMQ T;  3BQL A;  3GWH A;  2B76 A;  2IW5 B;  2R6G F;  4I4T E;  3GMI A;  3M3Z B;  3RIU A;  4HEA A;  4IE4 A;  3K3O A;  2CPT A;  3N9P A;  1I6Z A;  2NW7 A;  4HWD A;  5LMU T;  1N36 T;  5AFU L;  5CFB A;  4KUM B;  2X9X A;  5JRE A;  3AEE A;  2JMH A;  5IWA T;  1UUR A;  4LFA T;  4AQF C;  5C8Y E;  3ZMV B;  5JDG A;  3RH3 A;  5LMN T;  4HFH A;  4TWD A;  1MNE A;  4OX9 T;  5JDQ A;  2DCF A;  4C90 A;  2WZH A;  1KFY A;  5L3F B;  2QRX A;  4HFD A;  5J1G A;  4JEH B;  2E5L T;  2VL0 A;  2I0M A;  1IJ5 A;  3HA4 A;  3AVR A;  2L3L A;  1X9B A;  2NR4 A;  4EYY R;  2W66 A;  4JBW F;  1HF8 A;  3UTK A;  4X64 T;  3CX7 B;  3SFE A;  1X79 A;  2M6B A;  2V6Y B;  2XM1 A;  1IJ6 A;  4ZI2 C;  4H9S E;  5J2U E;  4DV1 T;  4YXD A;  2NTX A;  2VAS A;  3AB3 B;  4X1Y E;  3R84 B;  2UXB T;  4PNI A;  3RYH E;  3X1D A;  1T8B A;  5EK4 A;  4XBF B;  4ZI2 D;  3C4X A;  1HNW T;  5HCJ A;  1MMG A;  3ZMU B;  3KBT A;  4AIU A;  4GOU A;  3O9X A;  3ZT6 A;  4QH1 A;  3O1H A;  3P4S A;  3OBV E;  2ZM0 A;  4I50 E;  3EAM A;  4JI2 T;  4CN1 A;  5JRC A;  2A2F X;  1N33 T;  3RHW A;  5LHG B;  2WCA A;  1UX4 A;  2J47 A;  4UEM A;  5IUX A;  2V6X A;  1XDP A;  2VKH A;  5L3D B;  2JPF A;  2YK0 A;  3EHZ A;  3CKD A;  2CBI A;  2V5C A;  2BDE A;  5FXV A;  5JVD E;  3JAD A;  3AEB A;  4AKH A;  5LBM A;  1OWA A;  3PUQ A;  3RQU A;  4H9O C;  2WZI A;  5EZY E;  3N2O A;  1XZY A;  5FY0 A;  5AQL B;  4I0U A;  3PUZ F;  2IHR 1;  2WBL A;  2OV9 A;  4TV8 E;  4X1K E;  2BS4 A;  2LJL A;  5DQV A;  4L5G A;  4F6R C;  3VR8 A;  2CCQ A;  4O4J E;  4P1N A;  3JAF A;  4UV8 B;  1QLB A;  4Q25 A;  4NXM T;  2JRK A;  3P4R A;  1WFD A;  3CIR A;  5FXW A;  4EB6 E;  5KMG P;  3RIU C;  3EUH A;  3K1S A;  1V9D A;  4HE8 A;  2WWV A;  4YHH T;  2HN1 A;  4OFZ A;  4NUU A;  3J7Y q;  2XUE A;  1VCS A;  3TLV A;  1XMO T;  1Z8U A;  2D0U A;  5M4Y A;  2QVA A;  5DQW A;  4B3R T;  1XWM A;  2CWY A;  3V5S A;  3ONJ A;  1ZKE A;  2W4X A;  2YU2 A;  3A8Y C;  3W15 B;  4YTP A;  3B57 A;  3HR0 A;  3KIN B;  3LSV A;  2LT3 A;  2XQY A;  3QOF A;  2XQ9 A;  2CA5 A;  4PJL A;  1SA0 E;  3F31 A;  4LMJ A;  3Q5W A;  4KHP T;  3TLU A;  3ZLI A;  2J62 A;  2E2A A;  4YSZ A;  4UVB B;  4DV4 T;  2BG9 A;  3UU4 A;  4I43 B;  3I1A A;  3AXJ A;  3MAC A;  2XQ7 A;  1WR6 A;  1NWM X;  3QB5 A;  4TNV A;  5HEJ A;  3N5L A;  1CHU A;  4P0A A;  2UXN B;  2H3R A;  4YTN A;  3TLW A;  3OYZ A;  2X68 A;  5HXC A;  2W67 A;  2WMN A;  4TWF A;  1OXZ A;  4U72 A;  3RYF E;  2P9B A;  1EZ3 A;  2FJB A;  4HWI B;  4GIW A;  3RPU A;  3MA9 A;  2UUB T;  3C4W A;  5E0O A;  2XM2 A;  5HXH A;  5IYZ E;  1D1A A;  4ZOL E;  1WCR A;  3ZKR A;  4LF7 T;  4WBO A;  3ZCI A;  4ILA A;  2YOE A;  2V5D A;  5HEO A;  3GN5 A;  2IIU A;  2PFV A;  2XJ7 A;  5CB4 E;  1SE7 A;  3F2E A;  3ZT7 A;  3EDV A;  2I6H A;  3FHN A;  2NW8 A;  1HTJ F;  2I59 A;  3ZCJ A;  2XAS B;  4UXN B;  1J5W A;  2ZMA A;  4YFS A;  2VB6 A;  3CX8 B;  5FXX A;  3KDS E;  4NPP A;  1HFA A;  4BAY B;  2JQQ A;  1J1J A;  3FBZ A;  2Q9Q A;  3ZN1 B;  2Z6E A;  4QH5 A;  4ZI3 D;  1SHZ C;  4PJM A;  4IST A;  4GYR A;  4H63 V;  4YLH A;  1OED B;  3PUS A;  2C5I T;  3UUL A;  4PAG A;  3VRA A;  5LP6 E;  1YXR A;  3ZMS B;  5HWY A;  4PW8 A;  4YT0 A;  2A72 A;  4ADZ A;  4A5X A;  2DI4 A;  3C51 A;  2LKG A;  5CGM A;  4YSX A;  3PE0 A;  4ZXL A;  5AQT B;  2XQ5 A;  2HN2 A;  2W63 A;  2IUB A;  2BKP A;  3FXE B;  5C2T A;  4UIG A;  4LF5 T;  1MND A;  4FJO A;  4H9R C;  5FL1 A;  2VKD A;  4DR2 T;  4DR3 T;  4K0U A;  3P4P A;  4COF A;  3UFE A;  3LDQ B;  2OLT A;  2MOZ A;  4CXX A;  4DR6 T;  4JI3 T;  3ZMZ B;  1N34 T;  4DBQ A;  1HNX T;  5LJM A;  3T1H T;  2WY2 A;  4QH4 A;  4AQY T;  2CM0 A;  1FJG T;  2EHO A;  2LM2 A;  2CE7 A;  3B13 A;  5AQJ B;  3RF1 A;  2JJ9 A;  2X0H A;  4HN9 A;  4B3T T;  5JR9 A;  2VL8 A;  3LG7 A;  1KNP A;  4V1A v;  2ZM2 A;  4A56 A;  5CA1 E;  4OYK A;  4EOZ B;  4ZEY A;  2JQH A;  2BG9 C;  4LML A;  1HG2 A;  2V7K A;  1W09 A;  2CLY C;  5AQK B;  4YTM A;  4U33 A;  4HKA A;  2IML A;  3L39 A;  2CHO A;  3E22 E;  4EIW A;  2N2N A;  4WBN E;  4I55 E;  2HPL A;  2W0G A;  5KX5 E;  2WDR A;  1T72 A;  3AA6 B;  2DHR A;  4IIJ E;  3AE7 A;  2JQK A;  5ABH A;  3Q5D A;  4NIQ A;  4E7S A;  2L9Q A;  4TUY E;  4H9Q C;  4ZS3 A;  5LXT E;  3Q5X A;  4HFV A;  2KMF A;  2IDO B;  4DV5 T;  4UEL A;  3SOL A;  5F3J A;  2CXF A;  4AIS A;  2IC9 A;  1KEY A;  4QXH B;  1E2A A;  3N2G E;  4ILU A;  5AQF B;  2ACZ A;  5JDF A;  3PUW F;  5C3J A;  2XQ8 A;  2JQ9 A;  2CXD A;  4DUZ T;  2ES0 A;  2MAW A;  2B1E A;  5CA0 E;  2UXC T;  2NOX A;  3PU3 A;  5KDM C;  3BQK A;  4AXP A;  2GK9 A;  3JCF A;  2Q9Q C;  4ZZC A;  4AI6 A;  5A1L A;  1W9R A;  1HR0 T;  2XQ4 A;  4F8H A;  2ZM8 A;  3IBP A;  3EDU A;  3AAA B;  4ILC A;  1XNR T;  2LSG A;  3HKC E;  2Q9Q D;  2LSJ A;  2ACX A;  4FI5 A;  2KWI B;  3ZC1 A;  3DP7 A;  2AXD S;  2JIW A;  5AQS B;  3NZQ A;  4G63 A;  4JEU B;  2C5J A;  1Y01 A;  3J9X 1;  4ZHQ E;  4HTE A;  2LHR A;  4WZX A;  3EAB A;  3D0T A;  1ZHC A;  1MMD A;  1WRD A;  3I9W A;  3KV4 A;  4PJN A;  3PDY A;  1H7C A;  3FB2 A;  4OHF A;  3VKG A;  3UU3 A;  3P7I A;  3K3Q C;  5JDM A;  2KXP B;  4B3S T;  3KFW X;  3PUG A;  1FMW A;  5LBQ B;  1IBK T;  2LKH A;  5AQR B;  1T7S A;  4U31 A;  2VWA A;  2WS3 A;  5H6Q B;  2EHO C;  3CQC B;  4A98 A;  5J2T E;  1MMN A;  3AEC A;  3ZJ2 A;  5KXJ A;  3PUY F;  4QX8 B;  5JR9 C;  3U78 A;  4PK4 A;  2VVS A;  3OTO T;  2EHO D;  3CPZ A;  4DV7 T;  3CK6 A;  2C5K T;  1S94 A;  1L0V A;  2MPK A;  2X0Y A;  4PK5 A;  4CQI A;  2BBH A;  4DND A;  3ZPO A;  3LK3 B;  4ZS2 A;  3K3N A;  2WQY A;  5HXE A;  3CWZ B;  3G06 A;  3RKO A;  1YKE B;  4ILB A;  2RPA A;  1I94 T;  3ZYL A;  2K3W A;  3UUX B;  4AKI A;  1KNZ A;  4HFC A;  2FBW A;  5L3E B;  5FMN A;  2UXX B;  2V1D B;  3AVS A;  3N9N A;  2XQ6 A;  3JAE A;  2D2S A;  4HWH A;  4P09 A;  3BK9 A;  1R8I A;  2LSI A;  4P0B A;  4TV9 E;  3RC3 A;  3KV6 A;  2PTF A;  4C91 A;  3ANW A;  4OYJ A;  2E9X A;  3RLF F;  4DO0 A;  3KVA A;  3PTR B;  2YEV C;  1D0X A;  2HPJ A;  4UF0 B;  1BR0 A;  3LBX A;  1LVK A;  4CI1 B;  4KBM B;  1JNZ A;  1D1B A;  4KMC A;  3WAJ A;  4HGA A;  3FZL B;  5JDL A;  2V7I A;  5JDN A;  1CUN A;  1KF6 A;  4ZZB A;  5F8P A;  4B3M T;  4X20 E;  1S35 A;  1D0Z A;  4DV6 T;  5JDH A;  2LOP A;  2YKS A;  4GK5 E;  2M6I A;  1WYB A;  4X65 T;  5FY1 A;  2X9W A;  1T98 A;  4XAX B;  1UGO A;  1D1C A;  4UVC B;  1GQE A;  4PJJ A;  3KV9 A;  4EXT A;  3GA8 A;  1DU2 A;  2SPC A;  4NUV A;  3ZN0 B;  4JI7 T;  2FJD A;  5AQM B;  2MTQ A;  5FVK A;  3LK2 B;  2QGS A;  5FKY A;  4KP3 C;  2QYW A;  4DR5 T;  5AQQ B;  3I0O A;  3QC9 A;  2W61 A;  3T1Y T;  2YIN A;  5LHI B;  2ZLY A;  3NRX A;  4EZ4 A;  2W00 A;  4KHZ F;  2UUA T;  1IBM T;  2CBJ A;  5L4E A;  4ISS A;  4GYS A;  4DID B;  4O8S A;  5HCM A;  3L09 A;  1U4Q A;  4H63 H;  4CI3 B;  2LSK A;  3OYX A;  3V5U A;  5TAO A;  3RYC E;  5EK2 A;  4YY3 T;  5FVL A;  5AQH B;  3RRC A;  3ETV A;  2KSR A;  4TN7 B;  4IDN A;  2E8I A;  2V6Y A;  1OED E;  3AEA A;  3Q5E A;  4J2C A;  4DMV A;  3ZST A;  1JNR A;  4LF9 T;  1IZN B;  2VK9 A;  2X51 A;  4N78 D;  1YQ4 A;  4CI2 B;  3OKQ A;  5HEU A;  2LLY A;  4DBR A;  4ZI3 C;  3O1J A;  2XAH B;  2FUP A;  2UU9 T;  2DWK A;  1VRB A;  1D0Y A;  4QWN B;  4BJM A;  5DJQ C;  2WAU A;  4LFC T;  4O4H E;  3A5X A;  2XQA A;  2FJE A;  2LOS A;  3ESL A;  4IDQ A;  3LFM A;  3KVB A;  3AED A;  4HWF A;  1BR4 A;  2A9U A;  2IC6 A;  1YW0 A;  4IE5 A;  4IE0 A;  5L3B B;  5LHH B;  1HG5 A;  5JRC B;  2E9X C;  3IA3 A;  2X66 A;  2JMK A;  2RP4 A;  4EZH A;  1N32 T;  2BKN A;  3PJA A;  3O4X E;  3ZC0 A;  5ETW A;  3RKG A;  2LM9 A;  3SRZ A;  2E9X D;  2LEH A;  3AEG A;  1IAP A;  2OA5 A;  1W0A A;  4LF8 T;  1WLX A;  3AAI A;  3MK7 C;  3SS1 A;  4IHJ E;  2RA1 A;  4ZI7 E;  3QK6 A;  3FZK B;  5JH7 E;  2G0U A;  1IBL T;  4ANJ A;  1FMV A;  1US7 B;  3NRY A;  1BR1 A;  5HXR A;  1UX5 A;  5LGT B;  3DJB A;  3WAK A;  5AQO B;  5L3C B;  2XSB A;  2KIN B;  2BS2 A;  4WNK A;  1U5P A;  1J5E T;  2ZM6 T;  3HKD E;  4QX7 B;  2VQF T;  3ZYM A;  3H37 A;  4IDO A;  2W62 A;  5JTG A;  3FBL A;  3RQW A;  1XNQ T;  2XAF B;  5EK3 A;  2V7M A;  4YHJ A;  4GKJ T;  4JI4 T;  1NAF A;  2V7L A;  2XAJ B;  3IHR A;  2VVN A;  2LRL A;  2WP9 A;  2ODV A;  3HI2 A;  1UK5 A;  2KWH A;  2XTL A;  3UQ4 A;  3R6N A;  4QHO A;  1QSD A;  3VKH A;  2C0S A;  1B7T A;  5JQG E;  4NXN T;  5F5W A;  2D0T A;  2X0L B;  3VU7 H;  4O2A E;  4BJN A;  1AJ3 A;  4HWC A;  3RIF A;  4EYU A;  2V8S V;  3ZYK A;  2F4V T;  1VOM A;  3P50 A;  4DV0 T;  3L8R A;  4TZ4 C;  4U3C A;  3U3I A;  4YSY A;  3Q9D A;  3I0Q A;  4JYA T;  2DNX A;  4B6X A;  2WU2 A;  2BG9 B;  4LMK A;  2NTY A;  2CLY B;  2H89 A;  5ABG A;  3AXJ B;  3AA7 B;  4DMW A;  3ZMT B;  2X9Y A;  3E08 A;  2CRB A;  5H6R B;  3VRB A;  3TKL B;  2YDQ A;  2LHN A;  1YKH B;  2PBI A;  2BZB A;  3LK4 2;  4U74 A;  5DAB A;  4JI0 T;  5LYJ E;  1WYC A;  3CML A;  2H7V C;  4PK6 A;  4YJ3 E;  3OPC A;  3HKE E;  3IF8 B;  4ERR A;  2DWG A;  2CEA A;  4X5T A;  3N9L A;  3N9Q A;  5CJ5 A;  4X62 T;  3PU8 A;  5FXZ A;  5LA6 E;  2ODU A;  3AE9 A;  1HX1 B;  3AE1 A;  3GN5 B;  2D9D A;  4DR1 T;  2BS3 A;  3P8C D;  3PUR A;  2LE8 A;  4AKR B;  2WM9 A;  3MZK B;  4EEB A;  1OED A;  2N9D A;  4AQG A;  4IDP A;  4HFE A;  4QXB B;  2WU5 A;  3AE6 A;  3ABV A;  3AE4 A;  2XAQ B;  1KNR A;  2BBJ A;  1G8X A;  3FZH B;  3ONL C;  3C4Z A;  2HHH T;  2Q9Q B;  4WW0 A;  2WMO A;  3NWI A;  1ZP0 A;  4DV2 T;  2K9A A;  2KZ7 B;  2NP9 A;  2UXD T;  2YN6 A;  5FYM A;  4JI1 T;  3NVO A;  2XY8 B;  1Z0P A;  3BQI A;  1HNZ T;  4G2A A;  2KT9 A;  5FNV E;  2K48 A;  2Y6X A;  4IL4 A;  2IAK A;  3SFD A;  4BA9 A;  1G73 A;  2CWO A;  5LGU B;  3C64 A;  2WSS V;  3UU8 A;  2FJA A;  3DTO A;  3VR9 A;  5L3G B;  3HKB E;  3L3P A;  3UFG A;  4Z8X A;  2K5B B;  2YDS A;  2E5V A;  1QUU A;  2PJQ A;  1E1H B;  5LGN B;  4QXC B;  3FZF B;  5IHY A;  2LRK A;  2EHO B;  3EI0 A;  2WWU A;  3WI3 A;  2VUR A;  3EVY A;  1KK7 A;  4MBQ A;  2XSA A;  1NEK A;  4EGW A;  3B5M A;  3C50 A;  2V7J A;  3CX6 B;  3N9O A;  5JR9 B;  5LOV E;  1FIO A;  3UU5 A;  3AE5 A;  1MIV A;  1YQ3 A;  4GKK T;  2L8K A;  4H9N C;  3K8P C;  1XDO A;  3KV5 A;  3UT5 E;  2WDQ A;  5HEH A;  5L47 A;  2BKO A;  2Y8D A;  4DUY T;  4DR7 T;  4ASK A;  3ZJ1 A;  3QNU A;  3NBX X;  3AE3 A;  4PFP A;  4IRE A;  1UCU A;  3JC6 C;  3RC8 A;  3ZT5 A;  5ABF B;  1Y64 B;  2XQ3 A;  3FZM B;  3H3A A;  5AQP B;  4O4L E;  3ZSS A;  4EV6 A;  2H7O A;  3SWH A;  3JC6 D;  1ZOY A;  1WR0 A;  3A7M A;  3PUV F;  2WB5 A;  5LCY A;  3UUN A;  1VCT A;  4UVA B;  3NZP A;  2WDV A;  4L0R A;  2MYS A;  4CN4 A;  3CQG B;  2DLR A;  3M65 A;  2D5U A;  1O3X A;  5FL0 A;  2J1D G;  3I9Y A;  4YJ2 E;  1HCI A;  3T8O A;  1MMA A;  1HX8 A;  4JI6 T;  1HS7 A;  1UUS A;  3RX6 A;  5ABE A;  2MBG A;  3QUJ A;  1MIY A;  3AA0 B;  4IGU A;  2X67 A;  2DL1 A;  4PFO A;  2A3D A;  3FXD B;  4KX6 A;  5GON E;  1NEN A;  1OED C;  4JI8 T;  5AQI B;  3RGL A;  3P4Q A;  3KBU A;  4X66 T;  3E0Z A;  4E7Z A;  5J0Z A;  4KI0 F;  3AEF A;  5AQV B;  2BVL A;  4U7Y A;  2X9H A;  2UUC T;  2PG8 A;  2V26 A;  4DVD A;  2W2U A;  4JV5 T;  4LF4 T;  3UU6 A;  2AE9 A;  2CXL A;  2XPK A;  3TLS A;  3LJC A;  4OK0 A;  4TNW A;  3AE2 A;  1W0B A;  2XHE B;  4M1P A;  3ONX A;  5FY7 A;  2KND A;  3H3M A;  1E7P A;  2NW9 A;  3ETU A;  3TLT A;  3ZEF B;  4L9I A;  4IE6 A;  3C98 B;  3PV0 F;  3N2K E;  4AQF A;  3VHL A;  4UR9 A;  4Z90 A;  3UUM A;  4JI5 T;  3MKD A;  1BR2 A;  5L4H A;  4O4I E;  4IL9 A;  3OJA A;  4DV3 T;  2QA7 A;  5HAX A;  2YDR A;  4TWH A;  3RI5 A;  2YU1 A;  4EED A;  2H88 A;  4MFR A;  2NWB A;  4QKN A;  4CXW A;  1M7K A;  3UQ7 A;  3Q2M A;  4UV9 B;  1LVF A;  4GK0 E;  4MLK A;  4MAL A;  2VKJ A;  1M62 A;  2XAG B;  4HFI A;  4EAH A;  3AAE B;  4XZC A;  4AKL A;  5AQU B;  1MIW A;  5LNK A;  4LFB T;  4IE7 A;  4WYV A;  4DR4 T; 
#chains in the Genus database with same CATH homology
 2MPK A;  4U3C A;  4U31 A;  4IT4 A;  2A9U A;  3K1S A;  2XZE A;  4U33 A;  2JQ9 A;  4A5X A;  2CPT A;  2JQK A;  2WWV A;  2V6Y B;  2V6X A;  5CGM A;  1WR0 A;  4NIQ A;  4U2Y A;  2LRL A;  4P1N A;  4U7Y A;  4WZX A;  3EAB A;  5LB7 B;  2LRK A;  5FVL A;  3ZT6 A;  2DL1 A;  3ZT5 A;  2V6Y A;  4CN4 A;  2RPA A;  2W2U A;  5FVK A;  1WFD A;  4CN6 A;  4U7I A;  5CJ5 A;  4ZEY A;  2WY2 A;  2JQH A;  2K3W A;  3ZSS A;  4U2Z A;  4CN1 A;  1WCR A;  3ZT7 A;  1YXR A;  2CRB A;  3ZST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...