2XZEA

Structural basis for amsh-escrt-iii chmp3 interaction
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
141
structure length
141
Chain Sequence
SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Escrt-III Chmp3 Recruitment of Amsh.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein transport
molecule keywords STAM-BINDING PROTEIN
total genus 53
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08969 USP8_dimer USP8 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2xzeA00
4IT4A 2JQHA 5CJ5A 2DL1A 2CRBA 2RPAA 2LRKA 3ZT7A 2JQ9A 4CN4A 2A9UA 5FVLA 3ZSSA 1WFDA 4NIQA 4U33A 4CN6A 2V6YA 2WY2A 4CN1A 1YXRA 3ZSTA 4U3CA 2CPTA 3ZT5A 4U7YA 4ZEYA 5CGMA 2LRLA 2XZEA 2K3WA 2W2UA 4U7IA 1WR0A 4U2YA 4U31A 4A5XA 2JQKA 5FVKA 4WZXA 2V6YB 1WCRA 2WWVA 4U2ZA 4P1NA 3EABA 2V6XA 3K1SA 5LB7B 3ZT6A 2MPKA
chains in the Genus database with same CATH superfamily
2NTXA 2VKHA 5FXZA 2WU5A 2ODUA 2H7OA 3AB3B 2PG8A 2LSKA 3KINB 3KV9A 3C51A 4ZHQE 3OBVE 5LOVE 4CN4A 2W61A 2NOXA 3ZJ2A 4G2AA 3RH3A 5AFUL 1WFDA 4TUYE 4N78D 5C2TA 2Y8DA 5IHYA 4JI7T 2CLYC 2V26A 3GWHA 4EEBA 1ZHCA 3GN5A 3OVUA 3OJAA 4H63H 3ZKRA 2X9HA 3P7IA 4ISSA 4HWFA 4WW0A 2WBLA 4GKKT 4U7YA 3F31A 4JLEA 4ZS2A 4GYRA 4ZI7E 3C50A 1HF8A 1D1CA 3QB5A 3ANWB 1IBLT 2X66A 1AJ3A 2J47A 4MBQA 4ZS3A 3FZHB 2E2AA 3UU4A 1Y64B 5L3EB 1KNRA 2VKJA 5M4YA 3H3MA 2E8IA 5FL0A 2E9XD 3WAJA 4CI1B 4QXCB 4TNVA 3JCFA 2VL8A 4UELA 5AQGB 5AQHB 4AQFC 4DBRA 4ZI2C 1E2AA 2LEHA 5HAXA 4ASKA 4JI3T 2YKSA 2YK0A 3ZMTB 3EDUA 4GYSA 5IYZE 1NAFA 1VCTA 1YKEB 4HN9A 3RHWA 2E9XC 5HEGA 4UR9A 3RYCE 2CA5A 4TN7B 3LG7A 4U72A 4ZI3C 4DR2T 2XM1A 4YXDA 1D0YA 3LK3B 4ZI2D 2XASB 2XHEB 2KWHA 4WNKA 4OHFA 1W0AA 4X1YE 2XAJB 5HXHA 5JTGA 4NPPA 3PUZF 3QOFA 2FJEA 4ILCA 3UUMA 4I4TE 4JI6T 2XQYA 4PAGA 3HL6A 3FZMB 1LKXA 3KBUA 3AE9A 1G73A 4EGWA 3IBPA 3PUYF 2EHOB 2KZ7B 2WCAA 2WP9A 4IGUA 3JC6C 3EHZA 2PBIA 4PK5A 4YFSA 4IREA 4X66T 4YJ2E 4NUUA 3O1IA 2MAWA 2CM0A 5DABA 1FEWA 1MNDA 1VRBA 3HR0A 1IJ5A 2JIWA 2J62A 1Z8UA 2I59A 4O4LE 3RF1A 2NTYA 4AKLA 3Q5XA 3JC6D 3ZEFB 2E9XA 5DJQC 4ZXLA 3ZT7A 4HWHA 3RYIE 4X62T 2YDSA 3A5XA 4X5TA 5H6RB 3CMLA 3RPUA 3GA8A 2LM2A 1HX8A 4TWFA 3N5LA 5FP3A 5BR8T 3UUBA 3DJBA 3IA3A 5KDMC 5AQOB 4U3CA 2YU1A 3ZCIA 4EXTA 3SFEA 2W4XA 1XNQT 4PJNA 3H3AA 4IIJE 4EEDA 3JADA 2ZM6T 2Z6EA 3P4QA 3P4RA 3PU3A 2JQKA 1WR6A 1FIOA 4ISTA 4BA9A 4LF7T 1KNZA 2K9AA 2W66A 4LF6T 3CIRA 3PUAA 4IE0A 4P09A 4P1NA 4JV5T 3P4SA 1T98A 1VOMA 2W63A 3CX8B 2FUPA 3ZLIA 2CXFA 3RIUA 4YY3T 5ABGA 1XMOT 5LA6E 4X65T 4B3ST 3PURA 4X1IE 2K5BB 3AEBA 3OTOT 3K3QC 4DV4T 2YDRA 3HKEE 1YKHB 5ABHA 2XQ4A 4UXNB 3DP7A 3R84B 4WBOA 3I9YA 2HN1A 3AEFA 1OWAA 3P8CD 2M6BA 2WY2A 5L3FB 4UEMA 3WAKA 4UV8B 2XQ5A 1MMAA 1QLBA 3MK7C 2YOEA 2DWKA 4AQFA 4DV0T 1YD8G 5HEUA 3VU7H 5LGUB 2UUCT 2KMFA 1X9BA 2KSRA 5JDHA 1WR0A 2UXNB 2X0HA 3RIAA 4F6RC 1N33T 2Q9QB 4F8HA 4IDZA 5LGTB 3UULA 2ZLYA 2G0UA 4ADZA 2PFVA 5FY0A 2J4GA 1ZKEA 2XAFB 2FJBA 3AA6B 4ILAA 3C98B 4PK4A 2LSGA 2CXDA 2D5UA 2WDRA 2LSJA 2IW5B 3ZYMA 3GMIA 3ZT6A 2GK9A 3UTKA 2LLYA 1BR2A 5HXRA 2DCFA 3A8YC 2DL1A 2E5VA 2YINA 3AE7A 4H9RC 2Y48B 5AQUB 4CI3B 5A1LA 3CX6B 4H9OC 4Q25A 3FXEB 5FVLA 3TLUA 3NKZA 4YTPA 1G8XA 2WQYA 3OYXA 3BQKA 4Z91A 2RA1A 5F5WA 3OKQA 3SFDA 3HA4A 3ONJA 3PUVF 4AIUA 1N34T 3L09A 3NVOA 2V7JA 3FB2A 4PNIA 5AQVB 5HYAA 2XY8B 3LBXB 2RP4A 1W09A 4JEUB 3MZKB 2AE9A 4HGAA 1HX1B 2MOZA 3E08A 3AEDA 2XZEA 3TLVA 2P9BA 5L4EA 3UFGA 3GN5B 2M67A 4KHPT 3CWZB 2C5KT 5JDQA 5HEOA 3NRXA 4MFRA 2X68A 5LJMA 1XMQT 2WWVA 5L3GB 4QX8B 5JRCA 3NZPA 4A97A 2DHRA 2D2SA 5J0ZA 1HFAA 1SA0E 2JRKA 2N9DA 1OEDB 4HFEA 2WDQA 2E5LT 3AXJB 2UXCT 1HR0T 2X9WA 4AKGA 5L2LA 1SE7A 2KINB 1OEDA 2KNDA 3TLTA 1MMGA 4ZOLE 3RKOA 4DV1T 1L0VA 3Q5WA 3AVSA 2B76A 2LKGA 2VKOA 4HFBA 5JRCB 4DUZT 4LF4T 5FKYA 3PUWF 5LBQB 3RC3A 4PJMA 5J2TE 2NP9A 2XJ7A 4J2CA 3HI2A 4TWDA 1BR1A 2CXLA 1M62A 3PUQA 4BJNA 5L3CB 1S94A 3N2KE 5AQKB 1IZNB 3WI3A 3C4ZA 5LJNA 1I6ZA 4AKHA 1MNEA 1W0BA 5CA0E 5HXSA 4UVCB 1HNXT 4HWCA 4HFIA 3CKDA 4A5XA 5LHHB 1LVFA 3B5MA 4KHZF 5FXWA 1UGOA 2V6YB 1UUSA 3P50A 4B3TT 2X0YA 4HFVA 3UU6A 5CB4E 3CQGB 3V5UA 4YHJA 4BJMA 5TAOA 5AQIB 3VHLA 2CE7A 4QHOA 3FXDB 1MIVA 2LSYA 4EB6E 4DUYT 1KF6A 1SHZC 1UX5A 4FI5A 2LRKA 4MALA 1CUNA 3V5SA 1HNZT 2XQ3A 2XAGB 3ZSSA 1Z0PA 4DV5T 5DQVA 5H6QB 3RC8A 1O3XA 2W0GA 3AE1A 4UV9B 4M1PA 3RGLA 4OK0A 3BQIA 2H89A 3AA0B 2BKPA 3CX7B 2C5JA 3OPCA 2D0TA 4L9IA 4QH1A 1UURA 3IHRA 2CWYA 5ABFB 2Q9QA 2N1GA 3EI0A 2A72A 1U4QA 3VR8A 3UFEA 2UXXB 2K3WA 3LJCA 5EK3A 3SRZA 4C90A 5HXEA 4U2YA 1YW0A 4P0AA 4AKRB 2KT9A 3QC9A 4U2ZA 1NWMX 2DI4A 2DWGA 2DLRA 3EABA 2VVSA 3C4WA 5J1GA 4B3RT 4WBNE 2X0LB 3E22E 3S4UA 5LXTE 5AQSB 1UX4A 4OFZA 4FJOA 2CLYB 5HCJA 3UQ4A 3AE6A 5ADXL 4LFAT 2H3RA 4YSYA 4IDQA 4DBQA 5FXVA 2WAUA 3AVRA 3TLWA 3PDYA 3N9QA 3I0QA 5AQRB 2HPJA 5HEHA 2XSBA 3FZFB 4CN6A 3PJAA 3L8RA 2HPLA 2PTFA 3QUJA 4HE8A 3AXJA 2X9XA 3HKCE 1Y01A 4G63A 2ES0A 4L5GA 4UF0A 1S35A 2XAHB 1J5ET 3JAEA 4DR7T 3MKDA 4U7IA 3PU8A 2LSIA 1D1AA 2XQAA 2LHRA 5FY1A 4A98A 4AISA 3RYHE 2UUBT 2FJAA 3O1JA 1JNZA 3EAMA 4KBMB 5L3DB 3K1SA 2BS3A 5JDLA 2XPKA 4YLHA 2KXPB 2K48A 4PJJA 5AQTB 5HEJA 1I94T 5JR9B 4XBFB 5FNVE 4HWIB 1MMNA 1YQ3A 2QYWA 2ZMAA 3ONLC 4HFDA 4JUYA 4DIDB 2RPAA 2IMLA 3N9LA 3Q9DA 4JI5T 4ERRA 2WB5A 2VQET 3AE2A 1X79A 5AQPB 2LE8A 3I1AA 2KLQA 2D0UA 4AXPA 3LBXA 4ILUA 3CQCB 4GIWA 4HKAA 2V7MA 5EK4A 4KI0F 3NWIA 5JR9A 1ZP0A 2X67A 4TWHA 2NW7A 5L4HA 4BAYB 2BS2A 5ETWA 3TKLB 2A3DA 3AE8A 1LRZA 3AAEB 3C4XA 2EHOA 2LRLA 4DV3T 3LK2B 2LM9A 2LOPA 2XQ6A 3MXZA 2HN2A 4XAXB 5AQQB 3SWHA 5LP6E 1N32T 2B1EA 1HCIA 3UU3A 4UF0B 5ABEA 5KX5E 5LG4A 3PUXF 4EAHA 3VRBA 1FMVA 2ZM0A 1U5PA 2QGSA 3MACA 4O2BE 4Z90A 4A56A 4DVDA 4JYAT 5BMVE 3AE4A 3L3PA 4IDOA 3RIUC 3VRAA 2E9XB 1LVKA 4DMWA 5GONE 2BG9C 2JJ9A 4OX9T 2VB6A 2WWUA 4HEAA 5LBMA 4EIWA 2WM9A 4IL4A 2IC6A 2IC9A 2R6GF 2CHOA 3ONXA 3RYFE 5HWYA 5LMNT 1GQEA 1UCUA 2IDOB 1KNPA 4UVAB 2OLTA 2VK9A 2XUEA 4H9QC 2OV9A 2EHOC 2H7VC 2V5CA 2YDQA 4NUVA 4QH4A 3ZN1B 4ZEYA 4DR6T 2W00A 4C91A 4TV9E 1B7TA 2CHNA 4LFBT 3G06A 3CPZA 5EZYE 1WRDA 5LYJE 1D1BA 3QB5K 3A7MA 2QVAA 4KX6A 3L39A 4V1Av 3ETUA 2I6HA 3D0TA 2EHOD 1H7CA 2YEVC 2XQ7A 3N2GE 3QK6A 3R6NA 3N2OA 1IAPA 2SPCA 3F57A 3PV0F 4H63V 1QSDA 3HKBE 4IE6A 2NW9A 5F3JA 2MPKA 3AAIA 4Z8XA 5LNKA 1HTJF 3NZQA 3T8OA 1KK7A 1HG2A 2CRBA 3LFMA 3HKDE 3P4PA 4DR5T 1UK5A 4HFCA 3MA9A 3AECA 2BBJA 1NENA 4PJLA 1BR0A 2NR4A 3BQLA 3KVAA 2BG9A 4ZZCA 3PUSA 3ZYLA 5LHGB 1JNRA 2MTQA 1HNWT 1VCSA 2V1DB 4PW8A 3B57A 4PFOA 3F2EA 4QXBB 3FBZA 5FMNA 3ZMUB 2XQ9A 2XM2A 4O8SA 2Y6XA 5FYMA 4GK0E 4HWDA 4X64T 4LF9T 2BVMA 2I0MA 2AXDS 4ILBA 1ZEEA 2M6IA 3ZCJA 1IBMT 2W2UA 3UU5A 3C64A 1IJ6A 3K3NA 4CZZB 4LMKA 2N2NA 4X1KE 5JVDE 5ABFA 4LFCT 4I43B 3N9MA 2WDVA 4JI4T 2BG9B 1ZV4X 1J1JA 1WYBA 2KWIB 4ANJA 3BK9A 5L47A 3ZJ1A 5LB7B 4LF5T 5LCYA 1XDPA 2ZM8A 2V5DA 3Q5DA 1MMDA 1OXZA 2FJDA 2XSAA 4GOUA 2HH7A 5IWAT 4IE5A 2DNXA 2W62A 4OYKA 4EYYR 5CA1E 1XDOA 3TLSA 3UU8A 2BDEA 3H37A 2MBGA 3AE3A 3RKGA 3ZMZB 5HCMA 1WYCA 4U33A 3J9X1 4UVBB 3U78A 3NRYA 4IE7A 4MLKA 5HXCA 3ZSTA 2WZHA 2Q9QC 1W9RA 2XTLA 4QWNB 4YJ3E 3ABVA 4O4IE 3SS1A 4DNDA 3LDQB 5AQLB 3ZPOA 5JDMA 3PJAJ 4TV8E 3RIFA 2LOSA 2Q9QD 2WSSV 1MIYA 2LHNA 3E0ZA 4K0UA 3RX6A 3LK42 4IDPA 4O4JE 2VASA 3MJXA 3FHNA 3UUXB 3ZC0A 3O4XE 2IIUA 1BR4A 1V9DA 3KV4A 2NW8A 4EYUA 2ACXA 4P0BA 2WU2A 2VVNA 1M7KA 3SOLA 4EZ4A 4AQYT 5CJ5A 3T1HT 5EK2A 4OYJA 3ZN0B 1T72A 3DTOA 4O2AE 3CQXC 1SUMB 4QX7B 3KVBA 4KMCA 4DR4T 3FBLA 3AA7B 4H9NC 3AEEA 4AI6A 2JMHA 4CN1A 1YXRA 1US7B 5E0OA 3Q5EA 2V8SV 4O4HE 3W15B 5JH7E 4NXMT 2CPTA 4COFA 1QUUA 5CGMA 2IAKA 3IF8B 2BKNA 4I50E 4H9PC 4TZ4C 4LMLA 3U3IA 3ZMVB 1T7SA 2V7KA 3KV6A 3K8PC 2BZBA 2QRXA 4IL9A 2L9QA 2WS3A 3CVRA 4U74A 2CWOA 2IUBA 2V7IA 3CK6A 3I0OA 1WCRA 3B13A 2XQ8A 3M65A 3QNUA 4HTEA 4JEHB 5JDNA 4EV6A 2JMKA 1XWMA 3FZLB 3X1DA 4IE4A 5FY7A 2WMNA 3AA1B 3IEEA 4NXNT 2JPFA 3ESLA 3N9PA 1E7PA 2VWAA 4KUMB 3ZC1A 3KBTA 2BKOA 3EVYA 5AQFB 4B6XA 4EZHA 5L3BB 4CXYA 2W67A 5JDFA 1WLXA 5C8YE 1KFYA 4YT0A 1HS7A 4ZI3D 4QXHB 4I0UA 5HWXA 5LMUT 3O1HA 5AQMB 2YN6A 1T8BA 5C3JA 5LG3A 3AAAB 3ZT5A 3EUHA 3O9XA 4PFPA 4GKJT 1FMWA 1XZYA 4JBWF 3UT5E 3RQUA 2CCQA 3ZMSB 4DV6T 3VKHA 2CMRA 4U31A 1IBKT 2LJLA 2F4VT 2OA5A 4LMJA 2PJQA 3RRCA 1N36T 4L0RA 2HHHT 2V6XA 3VKGA 1YQ4A 4EOZB 4YSXA 1D0ZA 2UU9T 4K0KT 2VURA 5AQNB 1XNRT 4IT4A 4YTMA 3ZYKA 3N9OA 3PE0A 5JDGA 4X20E 3ANWA 5FL1A 2A9UA 4JI1T 5LGNB 4E7SA 5KMGP 4NIQA 3PUGA 4TNWA 4DV7T 3J7Yq 2V6YA 4GK5E 4YHHT 1FJGT 4CXWA 3UUNA 2VQFT 2BVLA 2H88A 2NWBA 2XAQB 2ZM2A 3NBXX 4PK6A 5FXXA 3AEAA 2QA7A 1DU2A 4XZCA 2L3LA 5LHIB 1ZOYA 4ZZBA 1NEKA 3ETVA 3KFWX 4CI2B 1CHUA 2D9DA 2ACZA 2BG9E 2C5IT 2MYSA 4TX5A 3RQWA 3OYZA 5J2UE 1OEDC 3KDSE 5JR9C 1R8IA 4DV2T 2YU2A 3K3OA 5IUXA 4IDNA 4CQIA 4UIGA 2UUAT 3M3ZB 3UQ7A 1EZ3A 3P4WA 2C0SA 2ODVA 3PTRB 1D0XA 2LKHA 2JQHA 4YSZA 4HFHA 4B3MT 2BBHA 2J1DG 3AEGA 3JAFA 2JQ9A 4JI2T 5KXJA 1KEYA 5DQWA 3RRWA 4DR1T 3RLFF 1OEDE 4DO0A 1E1HB 4DR3T 3EDVA 3RI5A 2UXBT 2V7LA 2UXDT 4YTNA 2WZIA 4DMVA 5JQGE 3I9WA 5JREA 3T1YT 2A2FX 4JI0T 2BS4A 4LF8T 4AKIA 3AE5A 4QKNA 2CBIA 3N9NA 4WYVA 2IHR1 3LSVA 4I55E 4QH5A 2CEAA 2WMOA 2X9YA 5CFBA 3Q2MA 5FVKA 4AQGA 2K24A 4WZXA 3VR9A 4JI8T 2VL0A 4H9SE 2L8KA 4MHCA 4KP3C 5AQJB 2VKDA 2LT3A 1HG5A 1MIWA 1J5WA 2CBJA 3KV5A 2JQQA 2FBWA 4E7ZA 5F8PA 3FZKB 2X51A 4CXXA 4IHJE
chains in the Genus database with same CATH topology
4IT4A 2JQHA 5CJ5A 2DL1A 2CRBA 2RPAA 2LRKA 3ZT7A 2JQ9A 4CN4A 2A9UA 5FVLA 3ZSSA 1WFDA 4NIQA 4U33A 4CN6A 2V6YA 2WY2A 4CN1A 1YXRA 3ZSTA 4U3CA 2CPTA 3ZT5A 4U7YA 4ZEYA 5CGMA 2LRLA 2XZEA 2K3WA 2W2UA 4U7IA 1WR0A 4U2YA 4U31A 4A5XA 2JQKA 5FVKA 4WZXA 2V6YB 1WCRA 2WWVA 4U2ZA 4P1NA 3EABA 2V6XA 3K1SA 5LB7B 3ZT6A 2MPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT4 A;  2JQH A;  5CJ5 A;  2DL1 A;  2CRB A;  2RPA A;  2LRK A;  3ZT7 A;  2JQ9 A;  4CN4 A;  2A9U A;  5FVL A;  3ZSS A;  1WFD A;  4NIQ A;  4U33 A;  4CN6 A;  2V6Y A;  2WY2 A;  4CN1 A;  1YXR A;  3ZST A;  4U3C A;  2CPT A;  3ZT5 A;  4U7Y A;  4ZEY A;  5CGM A;  2LRL A;  2XZE A;  2K3W A;  2W2U A;  4U7I A;  1WR0 A;  4U2Y A;  4U31 A;  4A5X A;  2JQK A;  5FVK A;  4WZX A;  2V6Y B;  1WCR A;  2WWV A;  4U2Z A;  4P1N A;  3EAB A;  2V6X A;  3K1S A;  5LB7 B;  3ZT6 A;  2MPK A; 
#chains in the Genus database with same CATH topology
 2NTX A;  2VKH A;  5FXZ A;  2WU5 A;  2ODU A;  2H7O A;  3AB3 B;  2PG8 A;  2LSK A;  3KIN B;  3KV9 A;  3C51 A;  4ZHQ E;  3OBV E;  5LOV E;  4CN4 A;  2W61 A;  2NOX A;  3ZJ2 A;  4G2A A;  3RH3 A;  5AFU L;  1WFD A;  4TUY E;  4N78 D;  5C2T A;  2Y8D A;  5IHY A;  4JI7 T;  2CLY C;  2V26 A;  3GWH A;  4EEB A;  1ZHC A;  3GN5 A;  3OVU A;  3OJA A;  4H63 H;  3ZKR A;  2X9H A;  3P7I A;  4ISS A;  4HWF A;  4WW0 A;  2WBL A;  4GKK T;  4U7Y A;  3F31 A;  4JLE A;  4ZS2 A;  4GYR A;  4ZI7 E;  3C50 A;  1HF8 A;  1D1C A;  3QB5 A;  3ANW B;  1IBL T;  2X66 A;  1AJ3 A;  2J47 A;  4MBQ A;  4ZS3 A;  3FZH B;  2E2A A;  3UU4 A;  1Y64 B;  5L3E B;  1KNR A;  2VKJ A;  5M4Y A;  3H3M A;  2E8I A;  5FL0 A;  2E9X D;  3WAJ A;  4CI1 B;  4QXC B;  4TNV A;  3JCF A;  2VL8 A;  4UEL A;  5AQG B;  5AQH B;  4AQF C;  4DBR A;  4ZI2 C;  1E2A A;  2LEH A;  5HAX A;  4ASK A;  4JI3 T;  2YKS A;  2YK0 A;  3ZMT B;  3EDU A;  4GYS A;  5IYZ E;  1NAF A;  1VCT A;  1YKE B;  4HN9 A;  3RHW A;  2E9X C;  5HEG A;  4UR9 A;  3RYC E;  2CA5 A;  4TN7 B;  3LG7 A;  4U72 A;  4ZI3 C;  4DR2 T;  2XM1 A;  4YXD A;  1D0Y A;  3LK3 B;  4ZI2 D;  2XAS B;  2XHE B;  2KWH A;  4WNK A;  4OHF A;  1W0A A;  4X1Y E;  2XAJ B;  5HXH A;  5JTG A;  4NPP A;  3PUZ F;  3QOF A;  2FJE A;  4ILC A;  3UUM A;  4I4T E;  4JI6 T;  2XQY A;  4PAG A;  3HL6 A;  3FZM B;  1LKX A;  3KBU A;  3AE9 A;  1G73 A;  4EGW A;  3IBP A;  3PUY F;  2EHO B;  2KZ7 B;  2WCA A;  2WP9 A;  4IGU A;  3JC6 C;  3EHZ A;  2PBI A;  4PK5 A;  4YFS A;  4IRE A;  4X66 T;  4YJ2 E;  4NUU A;  3O1I A;  2MAW A;  2CM0 A;  5DAB A;  1FEW A;  1MND A;  1VRB A;  3HR0 A;  1IJ5 A;  2JIW A;  2J62 A;  1Z8U A;  2I59 A;  4O4L E;  3RF1 A;  2NTY A;  4AKL A;  3Q5X A;  3JC6 D;  3ZEF B;  2E9X A;  5DJQ C;  4ZXL A;  3ZT7 A;  4HWH A;  3RYI E;  4X62 T;  2YDS A;  3A5X A;  4X5T A;  5H6R B;  3CML A;  3RPU A;  3GA8 A;  2LM2 A;  1HX8 A;  4TWF A;  3N5L A;  5FP3 A;  5BR8 T;  3UUB A;  3DJB A;  3IA3 A;  5KDM C;  5AQO B;  4U3C A;  2YU1 A;  3ZCI A;  4EXT A;  3SFE A;  2W4X A;  1XNQ T;  4PJN A;  3H3A A;  4IIJ E;  4EED A;  3JAD A;  2ZM6 T;  2Z6E A;  3P4Q A;  3P4R A;  3PU3 A;  2JQK A;  1WR6 A;  1FIO A;  4IST A;  4BA9 A;  4LF7 T;  1KNZ A;  2K9A A;  2W66 A;  4LF6 T;  3CIR A;  3PUA A;  4IE0 A;  4P09 A;  4P1N A;  4JV5 T;  3P4S A;  1T98 A;  1VOM A;  2W63 A;  3CX8 B;  2FUP A;  3ZLI A;  2CXF A;  3RIU A;  4YY3 T;  5ABG A;  1XMO T;  5LA6 E;  4X65 T;  4B3S T;  3PUR A;  4X1I E;  2K5B B;  3AEB A;  3OTO T;  3K3Q C;  4DV4 T;  2YDR A;  3HKE E;  1YKH B;  5ABH A;  2XQ4 A;  4UXN B;  3DP7 A;  3R84 B;  4WBO A;  3I9Y A;  2HN1 A;  3AEF A;  1OWA A;  3P8C D;  2M6B A;  2WY2 A;  5L3F B;  4UEM A;  3WAK A;  4UV8 B;  2XQ5 A;  1MMA A;  1QLB A;  3MK7 C;  2YOE A;  2DWK A;  4AQF A;  4DV0 T;  1YD8 G;  5HEU A;  3VU7 H;  5LGU B;  2UUC T;  2KMF A;  1X9B A;  2KSR A;  5JDH A;  1WR0 A;  2UXN B;  2X0H A;  3RIA A;  4F6R C;  1N33 T;  2Q9Q B;  4F8H A;  4IDZ A;  5LGT B;  3UUL A;  2ZLY A;  2G0U A;  4ADZ A;  2PFV A;  5FY0 A;  2J4G A;  1ZKE A;  2XAF B;  2FJB A;  3AA6 B;  4ILA A;  3C98 B;  4PK4 A;  2LSG A;  2CXD A;  2D5U A;  2WDR A;  2LSJ A;  2IW5 B;  3ZYM A;  3GMI A;  3ZT6 A;  2GK9 A;  3UTK A;  2LLY A;  1BR2 A;  5HXR A;  2DCF A;  3A8Y C;  2DL1 A;  2E5V A;  2YIN A;  3AE7 A;  4H9R C;  2Y48 B;  5AQU B;  4CI3 B;  5A1L A;  3CX6 B;  4H9O C;  4Q25 A;  3FXE B;  5FVL A;  3TLU A;  3NKZ A;  4YTP A;  1G8X A;  2WQY A;  3OYX A;  3BQK A;  4Z91 A;  2RA1 A;  5F5W A;  3OKQ A;  3SFD A;  3HA4 A;  3ONJ A;  3PUV F;  4AIU A;  1N34 T;  3L09 A;  3NVO A;  2V7J A;  3FB2 A;  4PNI A;  5AQV B;  5HYA A;  2XY8 B;  3LBX B;  2RP4 A;  1W09 A;  4JEU B;  3MZK B;  2AE9 A;  4HGA A;  1HX1 B;  2MOZ A;  3E08 A;  3AED A;  2XZE A;  3TLV A;  2P9B A;  5L4E A;  3UFG A;  3GN5 B;  2M67 A;  4KHP T;  3CWZ B;  2C5K T;  5JDQ A;  5HEO A;  3NRX A;  4MFR A;  2X68 A;  5LJM A;  1XMQ T;  2WWV A;  5L3G B;  4QX8 B;  5JRC A;  3NZP A;  4A97 A;  2DHR A;  2D2S A;  5J0Z A;  1HFA A;  1SA0 E;  2JRK A;  2N9D A;  1OED B;  4HFE A;  2WDQ A;  2E5L T;  3AXJ B;  2UXC T;  1HR0 T;  2X9W A;  4AKG A;  5L2L A;  1SE7 A;  2KIN B;  1OED A;  2KND A;  3TLT A;  1MMG A;  4ZOL E;  3RKO A;  4DV1 T;  1L0V A;  3Q5W A;  3AVS A;  2B76 A;  2LKG A;  2VKO A;  4HFB A;  5JRC B;  4DUZ T;  4LF4 T;  5FKY A;  3PUW F;  5LBQ B;  3RC3 A;  4PJM A;  5J2T E;  2NP9 A;  2XJ7 A;  4J2C A;  3HI2 A;  4TWD A;  1BR1 A;  2CXL A;  1M62 A;  3PUQ A;  4BJN A;  5L3C B;  1S94 A;  3N2K E;  5AQK B;  1IZN B;  3WI3 A;  3C4Z A;  5LJN A;  1I6Z A;  4AKH A;  1MNE A;  1W0B A;  5CA0 E;  5HXS A;  4UVC B;  1HNX T;  4HWC A;  4HFI A;  3CKD A;  4A5X A;  5LHH B;  1LVF A;  3B5M A;  4KHZ F;  5FXW A;  1UGO A;  2V6Y B;  1UUS A;  3P50 A;  4B3T T;  2X0Y A;  4HFV A;  3UU6 A;  5CB4 E;  3CQG B;  3V5U A;  4YHJ A;  4BJM A;  5TAO A;  5AQI B;  3VHL A;  2CE7 A;  4QHO A;  3FXD B;  1MIV A;  2LSY A;  4EB6 E;  4DUY T;  1KF6 A;  1SHZ C;  1UX5 A;  4FI5 A;  2LRK A;  4MAL A;  1CUN A;  3V5S A;  1HNZ T;  2XQ3 A;  2XAG B;  3ZSS A;  1Z0P A;  4DV5 T;  5DQV A;  5H6Q B;  3RC8 A;  1O3X A;  2W0G A;  3AE1 A;  4UV9 B;  4M1P A;  3RGL A;  4OK0 A;  3BQI A;  2H89 A;  3AA0 B;  2BKP A;  3CX7 B;  2C5J A;  3OPC A;  2D0T A;  4L9I A;  4QH1 A;  1UUR A;  3IHR A;  2CWY A;  5ABF B;  2Q9Q A;  2N1G A;  3EI0 A;  2A72 A;  1U4Q A;  3VR8 A;  3UFE A;  2UXX B;  2K3W A;  3LJC A;  5EK3 A;  3SRZ A;  4C90 A;  5HXE A;  4U2Y A;  1YW0 A;  4P0A A;  4AKR B;  2KT9 A;  3QC9 A;  4U2Z A;  1NWM X;  2DI4 A;  2DWG A;  2DLR A;  3EAB A;  2VVS A;  3C4W A;  5J1G A;  4B3R T;  4WBN E;  2X0L B;  3E22 E;  3S4U A;  5LXT E;  5AQS B;  1UX4 A;  4OFZ A;  4FJO A;  2CLY B;  5HCJ A;  3UQ4 A;  3AE6 A;  5ADX L;  4LFA T;  2H3R A;  4YSY A;  4IDQ A;  4DBQ A;  5FXV A;  2WAU A;  3AVR A;  3TLW A;  3PDY A;  3N9Q A;  3I0Q A;  5AQR B;  2HPJ A;  5HEH A;  2XSB A;  3FZF B;  4CN6 A;  3PJA A;  3L8R A;  2HPL A;  2PTF A;  3QUJ A;  4HE8 A;  3AXJ A;  2X9X A;  3HKC E;  1Y01 A;  4G63 A;  2ES0 A;  4L5G A;  4UF0 A;  1S35 A;  2XAH B;  1J5E T;  3JAE A;  4DR7 T;  3MKD A;  4U7I A;  3PU8 A;  2LSI A;  1D1A A;  2XQA A;  2LHR A;  5FY1 A;  4A98 A;  4AIS A;  3RYH E;  2UUB T;  2FJA A;  3O1J A;  1JNZ A;  3EAM A;  4KBM B;  5L3D B;  3K1S A;  2BS3 A;  5JDL A;  2XPK A;  4YLH A;  2KXP B;  2K48 A;  4PJJ A;  5AQT B;  5HEJ A;  1I94 T;  5JR9 B;  4XBF B;  5FNV E;  4HWI B;  1MMN A;  1YQ3 A;  2QYW A;  2ZMA A;  3ONL C;  4HFD A;  4JUY A;  4DID B;  2RPA A;  2IML A;  3N9L A;  3Q9D A;  4JI5 T;  4ERR A;  2WB5 A;  2VQE T;  3AE2 A;  1X79 A;  5AQP B;  2LE8 A;  3I1A A;  2KLQ A;  2D0U A;  4AXP A;  3LBX A;  4ILU A;  3CQC B;  4GIW A;  4HKA A;  2V7M A;  5EK4 A;  4KI0 F;  3NWI A;  5JR9 A;  1ZP0 A;  2X67 A;  4TWH A;  2NW7 A;  5L4H A;  4BAY B;  2BS2 A;  5ETW A;  3TKL B;  2A3D A;  3AE8 A;  1LRZ A;  3AAE B;  3C4X A;  2EHO A;  2LRL A;  4DV3 T;  3LK2 B;  2LM9 A;  2LOP A;  2XQ6 A;  3MXZ A;  2HN2 A;  4XAX B;  5AQQ B;  3SWH A;  5LP6 E;  1N32 T;  2B1E A;  1HCI A;  3UU3 A;  4UF0 B;  5ABE A;  5KX5 E;  5LG4 A;  3PUX F;  4EAH A;  3VRB A;  1FMV A;  2ZM0 A;  1U5P A;  2QGS A;  3MAC A;  4O2B E;  4Z90 A;  4A56 A;  4DVD A;  4JYA T;  5BMV E;  3AE4 A;  3L3P A;  4IDO A;  3RIU C;  3VRA A;  2E9X B;  1LVK A;  4DMW A;  5GON E;  2BG9 C;  2JJ9 A;  4OX9 T;  2VB6 A;  2WWU A;  4HEA A;  5LBM A;  4EIW A;  2WM9 A;  4IL4 A;  2IC6 A;  2IC9 A;  2R6G F;  2CHO A;  3ONX A;  3RYF E;  5HWY A;  5LMN T;  1GQE A;  1UCU A;  2IDO B;  1KNP A;  4UVA B;  2OLT A;  2VK9 A;  2XUE A;  4H9Q C;  2OV9 A;  2EHO C;  2H7V C;  2V5C A;  2YDQ A;  4NUV A;  4QH4 A;  3ZN1 B;  4ZEY A;  4DR6 T;  2W00 A;  4C91 A;  4TV9 E;  1B7T A;  2CHN A;  4LFB T;  3G06 A;  3CPZ A;  5EZY E;  1WRD A;  5LYJ E;  1D1B A;  3QB5 K;  3A7M A;  2QVA A;  4KX6 A;  3L39 A;  4V1A v;  3ETU A;  2I6H A;  3D0T A;  2EHO D;  1H7C A;  2YEV C;  2XQ7 A;  3N2G E;  3QK6 A;  3R6N A;  3N2O A;  1IAP A;  2SPC A;  3F57 A;  3PV0 F;  4H63 V;  1QSD A;  3HKB E;  4IE6 A;  2NW9 A;  5F3J A;  2MPK A;  3AAI A;  4Z8X A;  5LNK A;  1HTJ F;  3NZQ A;  3T8O A;  1KK7 A;  1HG2 A;  2CRB A;  3LFM A;  3HKD E;  3P4P A;  4DR5 T;  1UK5 A;  4HFC A;  3MA9 A;  3AEC A;  2BBJ A;  1NEN A;  4PJL A;  1BR0 A;  2NR4 A;  3BQL A;  3KVA A;  2BG9 A;  4ZZC A;  3PUS A;  3ZYL A;  5LHG B;  1JNR A;  2MTQ A;  1HNW T;  1VCS A;  2V1D B;  4PW8 A;  3B57 A;  4PFO A;  3F2E A;  4QXB B;  3FBZ A;  5FMN A;  3ZMU B;  2XQ9 A;  2XM2 A;  4O8S A;  2Y6X A;  5FYM A;  4GK0 E;  4HWD A;  4X64 T;  4LF9 T;  2BVM A;  2I0M A;  2AXD S;  4ILB A;  1ZEE A;  2M6I A;  3ZCJ A;  1IBM T;  2W2U A;  3UU5 A;  3C64 A;  1IJ6 A;  3K3N A;  4CZZ B;  4LMK A;  2N2N A;  4X1K E;  5JVD E;  5ABF A;  4LFC T;  4I43 B;  3N9M A;  2WDV A;  4JI4 T;  2BG9 B;  1ZV4 X;  1J1J A;  1WYB A;  2KWI B;  4ANJ A;  3BK9 A;  5L47 A;  3ZJ1 A;  5LB7 B;  4LF5 T;  5LCY A;  1XDP A;  2ZM8 A;  2V5D A;  3Q5D A;  1MMD A;  1OXZ A;  2FJD A;  2XSA A;  4GOU A;  2HH7 A;  5IWA T;  4IE5 A;  2DNX A;  2W62 A;  4OYK A;  4EYY R;  5CA1 E;  1XDO A;  3TLS A;  3UU8 A;  2BDE A;  3H37 A;  2MBG A;  3AE3 A;  3RKG A;  3ZMZ B;  5HCM A;  1WYC A;  4U33 A;  3J9X 1;  4UVB B;  3U78 A;  3NRY A;  4IE7 A;  4MLK A;  5HXC A;  3ZST A;  2WZH A;  2Q9Q C;  1W9R A;  2XTL A;  4QWN B;  4YJ3 E;  3ABV A;  4O4I E;  3SS1 A;  4DND A;  3LDQ B;  5AQL B;  3ZPO A;  5JDM A;  3PJA J;  4TV8 E;  3RIF A;  2LOS A;  2Q9Q D;  2WSS V;  1MIY A;  2LHN A;  3E0Z A;  4K0U A;  3RX6 A;  3LK4 2;  4IDP A;  4O4J E;  2VAS A;  3MJX A;  3FHN A;  3UUX B;  3ZC0 A;  3O4X E;  2IIU A;  1BR4 A;  1V9D A;  3KV4 A;  2NW8 A;  4EYU A;  2ACX A;  4P0B A;  2WU2 A;  2VVN A;  1M7K A;  3SOL A;  4EZ4 A;  4AQY T;  5CJ5 A;  3T1H T;  5EK2 A;  4OYJ A;  3ZN0 B;  1T72 A;  3DTO A;  4O2A E;  3CQX C;  1SUM B;  4QX7 B;  3KVB A;  4KMC A;  4DR4 T;  3FBL A;  3AA7 B;  4H9N C;  3AEE A;  4AI6 A;  2JMH A;  4CN1 A;  1YXR A;  1US7 B;  5E0O A;  3Q5E A;  2V8S V;  4O4H E;  3W15 B;  5JH7 E;  4NXM T;  2CPT A;  4COF A;  1QUU A;  5CGM A;  2IAK A;  3IF8 B;  2BKN A;  4I50 E;  4H9P C;  4TZ4 C;  4LML A;  3U3I A;  3ZMV B;  1T7S A;  2V7K A;  3KV6 A;  3K8P C;  2BZB A;  2QRX A;  4IL9 A;  2L9Q A;  2WS3 A;  3CVR A;  4U74 A;  2CWO A;  2IUB A;  2V7I A;  3CK6 A;  3I0O A;  1WCR A;  3B13 A;  2XQ8 A;  3M65 A;  3QNU A;  4HTE A;  4JEH B;  5JDN A;  4EV6 A;  2JMK A;  1XWM A;  3FZL B;  3X1D A;  4IE4 A;  5FY7 A;  2WMN A;  3AA1 B;  3IEE A;  4NXN T;  2JPF A;  3ESL A;  3N9P A;  1E7P A;  2VWA A;  4KUM B;  3ZC1 A;  3KBT A;  2BKO A;  3EVY A;  5AQF B;  4B6X A;  4EZH A;  5L3B B;  4CXY A;  2W67 A;  5JDF A;  1WLX A;  5C8Y E;  1KFY A;  4YT0 A;  1HS7 A;  4ZI3 D;  4QXH B;  4I0U A;  5HWX A;  5LMU T;  3O1H A;  5AQM B;  2YN6 A;  1T8B A;  5C3J A;  5LG3 A;  3AAA B;  3ZT5 A;  3EUH A;  3O9X A;  4PFP A;  4GKJ T;  1FMW A;  1XZY A;  4JBW F;  3UT5 E;  3RQU A;  2CCQ A;  3ZMS B;  4DV6 T;  3VKH A;  2CMR A;  4U31 A;  1IBK T;  2LJL A;  2F4V T;  2OA5 A;  4LMJ A;  2PJQ A;  3RRC A;  1N36 T;  4L0R A;  2HHH T;  2V6X A;  3VKG A;  1YQ4 A;  4EOZ B;  4YSX A;  1D0Z A;  2UU9 T;  4K0K T;  2VUR A;  5AQN B;  1XNR T;  4IT4 A;  4YTM A;  3ZYK A;  3N9O A;  3PE0 A;  5JDG A;  4X20 E;  3ANW A;  5FL1 A;  2A9U A;  4JI1 T;  5LGN B;  4E7S A;  5KMG P;  4NIQ A;  3PUG A;  4TNW A;  4DV7 T;  3J7Y q;  2V6Y A;  4GK5 E;  4YHH T;  1FJG T;  4CXW A;  3UUN A;  2VQF T;  2BVL A;  2H88 A;  2NWB A;  2XAQ B;  2ZM2 A;  3NBX X;  4PK6 A;  5FXX A;  3AEA A;  2QA7 A;  1DU2 A;  4XZC A;  2L3L A;  5LHI B;  1ZOY A;  4ZZB A;  1NEK A;  3ETV A;  3KFW X;  4CI2 B;  1CHU A;  2D9D A;  2ACZ A;  2BG9 E;  2C5I T;  2MYS A;  4TX5 A;  3RQW A;  3OYZ A;  5J2U E;  1OED C;  3KDS E;  5JR9 C;  1R8I A;  4DV2 T;  2YU2 A;  3K3O A;  5IUX A;  4IDN A;  4CQI A;  4UIG A;  2UUA T;  3M3Z B;  3UQ7 A;  1EZ3 A;  3P4W A;  2C0S A;  2ODV A;  3PTR B;  1D0X A;  2LKH A;  2JQH A;  4YSZ A;  4HFH A;  4B3M T;  2BBH A;  2J1D G;  3AEG A;  3JAF A;  2JQ9 A;  4JI2 T;  5KXJ A;  1KEY A;  5DQW A;  3RRW A;  4DR1 T;  3RLF F;  1OED E;  4DO0 A;  1E1H B;  4DR3 T;  3EDV A;  3RI5 A;  2UXB T;  2V7L A;  2UXD T;  4YTN A;  2WZI A;  4DMV A;  5JQG E;  3I9W A;  5JRE A;  3T1Y T;  2A2F X;  4JI0 T;  2BS4 A;  4LF8 T;  4AKI A;  3AE5 A;  4QKN A;  2CBI A;  3N9N A;  4WYV A;  2IHR 1;  3LSV A;  4I55 E;  4QH5 A;  2CEA A;  2WMO A;  2X9Y A;  5CFB A;  3Q2M A;  5FVK A;  4AQG A;  2K24 A;  4WZX A;  3VR9 A;  4JI8 T;  2VL0 A;  4H9S E;  2L8K A;  4MHC A;  4KP3 C;  5AQJ B;  2VKD A;  2LT3 A;  1HG5 A;  1MIW A;  1J5W A;  2CBJ A;  3KV5 A;  2JQQ A;  2FBW A;  4E7Z A;  5F8P A;  3FZK B;  2X51 A;  4CXX A;  4IHJ E; 
#chains in the Genus database with same CATH homology
 4IT4 A;  2JQH A;  5CJ5 A;  2DL1 A;  2CRB A;  2RPA A;  2LRK A;  3ZT7 A;  2JQ9 A;  4CN4 A;  2A9U A;  5FVL A;  3ZSS A;  1WFD A;  4NIQ A;  4U33 A;  4CN6 A;  2V6Y A;  2WY2 A;  4CN1 A;  1YXR A;  3ZST A;  4U3C A;  2CPT A;  3ZT5 A;  4U7Y A;  4ZEY A;  5CGM A;  2LRL A;  2XZE A;  2K3W A;  2W2U A;  4U7I A;  1WR0 A;  4U2Y A;  4U31 A;  4A5X A;  2JQK A;  5FVK A;  4WZX A;  2V6Y B;  1WCR A;  2WWV A;  4U2Z A;  4P1N A;  3EAB A;  2V6X A;  3K1S A;  5LB7 B;  3ZT6 A;  2MPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...