2XZRA

Escherichia coli immunoglobulin-binding protein eibd 391-438 fused to gcn4 adaptors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
108
structure length
108
Chain Sequence
KQIEDKIEEILSKIYHIENEIARIKKLIGAIDGRVTRNTQSIEKNSKAIAANTRTLQQHSARLDSQQRQINENHKEMKQIEDKIEEILSKIYHIENEIARIKKLIKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of E. Coli Igg-Binding Protein D Suggests a General Model for Bending and Binding in Trimeric Autotransporter Adhesins.
pubmed doi rcsb
molecule keywords IMMUNOGLOBULIN-BINDING PROTEIN EIBD
molecule tags Cell adhesion
source organism Enterobacteria phage p-eibd
total genus 54
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2010-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xzrA00
3UIAA 2R5DA 2WPQA 4I2LC 3P7KA 1J2JB 4AUWA 2R5BA 1H88A 3V4WA 1X8YA 3KDPB 5AW4B 4KHXA 5AW6B 1KQLA 1SLQA 3HE5B 3HE5A 3NFQA 1IO4A 4DZOA 1S9KD 5AW3B 3OAKA 3LIEA 2WT7A 2XZRA 5APYA 1CI6B 1GTWA 3LIDA 3O8ZA 5AVSB 3V5BA 4C7NB 1HBWA 5CMZA 2P2UA 5AVUB 3NXSA 3P32A 2Q5UA 5AW9B 1CSBA 3A3YB 4AYCA 1H8AA 3TYYA 2XU6A 1A02J 2Z5HA 3NTNA 1GU4A 2C9LY 3HTKA 3L37A 3M0AA 3MGNA 5APWA 4I6MC 3P8MC 5AVRB 3VTPC 3L35A 3VMXA 1S9KE 3M06A 4RESB 3SWFA 1DH3A 5APUA 1NAFA 4HYTB 5APVA 2N9BA 2W27A 3TK1A 3M9BA 1MUUA 4JYCA 1SP4A 2QM8A 1CI6A 3MD0A 5APTA 5AW7B 5AW1B 2YNYA 2BASA 2C9NY 4C7NA 2Z5IA 1HJBA 1GK4A 2WPRA 2ZFCA 3B8EB 2E42A 3L36A 5AVXB 4EOTA 2H7HA 3T97A 3A7OA 3VMZA 1CZQA 1FAVA 3A2AA 3I5CA 4LC1A 1OWAA 1A02F 1GZLA 5AVQB 5AW8B 3HE4A 3HE4B 1JUNA 2YO2A 2E43A 2QM7A 5AVZB 1MFZA 2VRSA 1GD2E 3M9HA 1FOSF 5APSA 2R32A 1HUCA 5AVVB 2JJLA 2WWWA 2P67A 2IPPA 3M91A 2Q7CA 1T2KC 2W6AA 5AW2B 4JYBA 1GU5A 3NMDA 5APQA 1G2CB 4XE5B 1HWTC 3V4QA 4AQRD 1NWQA 4B86A 5AVYB 3IR9A 4GT1A 5AVWB 3VMYA 1FOSE 2YO3A 3VN0A 1H89A 5AW0B 1YYCA 2Q3IA 1T2KD 4GKGA 1MV8A 5AW5B 2KP8A 2WT7B 5APXA 2WPSA 2WTYA 3A5TA 4M3LA 1OXZA 3TNUA 3TNUB 1GK6A 2XV5A 4C46A 1JNMA 2P7JA 5AVTB 3VYIA 2ZXEB 2R3CA 3M0DA 3KQGA
chains in the Genus database with same CATH superfamily
2R5DA 1L4AC 1ZMEC 1K73Q 5BU8B 5B66E 1ZR2A 2E75C 5GTIH 3CCRP 4BXLA 2HPCB 2FXPA 3L75J 1VL2A 4H0LD 1SQQK 1PP9G 3PRJA 1PPJG 2D2CD 2XDJA 3GG2A 3LW5H 3CI9A 1JY3N 3A0HE 3QWOC 3TYYA 4RO0A 4OGQD 2LR2A 1YI2P 2QJYC 2KS1B 3P8MC 1OVRA 1S1CX 3KZIE 1OZHA 1NTMK 3GMAA 5GTHE 2GM4A 2ZAEB 3H1KE 2WPRA 3T97A 1KFMA 2O01J 3OJAB 1RE4C 1OWAA 2IZ0A 1VQLP 5AVQB 5AW8B 1EZVI 4EDFA 1DEBA 3E7KA 5CJ4A 3L75D 1QEXA 2FXMA 3MUDA 2ZVNB 5KAIH 3H32A 1YIJP 4JF7A 5KKZC 1SQBE 5KTBA 1KN7A 3P8CE 1N8RQ 5DJTB 2ZT9C 1SQPD 2KK7A 2R3CA 3TGUG 4U3FJ 3G9RA 1L0LJ 1RF1C 3B5NC 2NRGA 1JY3P 3CXHD 5AW3B 1S72P 2FYNC 3H1LE 3B71A 1IFJA 1RF0A 1OMIA 2FKWB 3O8ZA 4C7NB 2IFNA 2PAJA 2QJKC 2YXQB 4HJGH 2GA1A 1H8AA 4CPGA 2OYIB 3VTPC 2IFMA 3L70E 3TSIA 3SWFA 1S2EA 3FXDA 1W2EA 5APVA 3TK1A 2Q9IA 1CI6A 4PD4H 3V6IA 1YTZI 3OA7A 4U3FD 2WSFH 1RY3A 4LC1A 4L74A 1L0LD 1OIPA 1A02F 1BSNA 1S4XA 1KB9D 1SFCA 5CBNA 1QL1A 2QM7A 4W80A 5KAFE 3D71A 2QG4A 3L75G 1OW6A 3AE6C 5APQA 1TU3F 3V4QA 2E76D 2YMKA 1H89A 5AW0B 1NO4A 3PHLA 2WT7B 1NTZE 1LT9B 3MTUE 3II6A 1ZLLA 2ZXXA 5AVTB 3TDKA 1J2JB 1U57A 1P84I 1RH5B 1IC2A 2FYUJ 1N73B 2IZ1A 1AVYA 3LIEA 3CMAP 3SFEC 3L74J 3A3YB 2OTJP 2O1JA 3H1KD 2IDBA 2Y0EA 3VMXA 1IFNA 1IK9A 2HR3A 2I8DA 5CCGA 4N3YB 4RKUJ 5CCHA 4YPCA 1N86A 1PGJA 4N78E 3VOPA 4H44D 1L4AA 3H1IJ 2YNYA 1EDLA 2PFXA 2KXPB 3RL0g 1KYOE 2P1JA 3BCCJ 3JC22 4HH2A 2FYUD 3L73E 4U3FG 1PIXA 2WSEH 1VQ8P 1Z56A 1M7LA 2XKMA 2FYZA 2HODA 1N7SB 1KILB 1HUCA 5KLIC 3P8CD 3G3ZA 1MKMA 3Q5PA 2A45H 1NU1J 4B86A 3Q1MA 1PPJE 1Q81Q 1YJNP 1M56D 3RL0C 3FWNA 3H1ID 1H0TB 2B87B 2B88A 1USDA 1YBKA 4PV1B 3D6ZA 1HGVA 1UIXA 3BCCD 4H13C 3L70D 1RQUA 2E74C 4Z1MH 3A0BE 3AE1C 1EZVE 1FZGA 2QIWA 3F5HA 3IF4A 3KXDA 4L76A 1SQVJ 1YJWP 1Q2NA 1CW5A 4ZKUA 3HTKB 1FC2C 2N1TD 1NU1D 4PD4I 1OX3A 1OW7A 4BWNA 1DH3A 2OYOA 2K88A 1RF1A 1LJ2A 1J1DC 2XNDH 3CCUP 3RK3B 2Z5IA 1VF5B 3A7OA 4MN4C 1FAVA 1QVFO 1S5LX 4DCKA 2K9JA 1AFOA 1NJIQ 1PL5A 3MUDC 4UB6E 3AE8C 3M0DC 1YTZT 2FYUG 3EQ2A 1FZCB 2POHA 3AEFC 2E43A 4BRYB 4WY4B 1NVOA 4OWFA 2ZJSE 5TJHA 3RGUA 3M9HA 1NTZD 2WWWA 4JYBA 1FU1A 3CMEP 2ZVOB 1S5LE 3MHVA 1SQVD 1LWUB 2KZIA 2AXCA 4AQRD 2D2CC 3L74G 3WUTA 1YYCA 1JEKA 1ZOYC 1T2KD 1IFMA 2HFED 4M3LA 1OXZA 4C46A 1U7JA 3FX0A 1D7MA 3PJSK 3H1IG 3JCUH 1QLED 3AE7C 3AE5C 4EIJA 1H88A 1HF9A 3ABVC 1URQB 5L8RJ 3HRNA 3BCCG 4DZOA 4H0LB 4IL6H 3MZWB 4IFFA 1BE3G 4I1LA 5B5EE 4OGQB 4AYCA 3K5BA 1L0NJ 4I6MC 1ZRTD 4PV1D 1KYOD 2WMMA 1Y9BA 1OFCX 3SFDC 1VPCA 2BCCJ 2OARA 1MUUA 2OTLP 1J1EB 5AW7B 5C39A 5E79H 1K9MQ 3AE4C 5GTIE 2LXCB 5H2FH 1SQXE 2LXBA 1FZBA 1BCCJ 3HUSB 2K9YA 2KI7B 2A45G 1GL2A 4GOEA 2NPSC 2R3SA 2JEEA 2K37A 3CD6P 2OYHB 1G1IA 1BDDA 3RK3D 1Q82Q 2BEQD 1L0ND 3HD7C 2WTYA 2CPSA 3L71G 2BCCD 5KLVJ 3PLNA 2IBZD 1LT1A 2FXOA 2V4HA 1JO5A 2RN0A 3U59A 3TF5A 4R4MA 1KQLA 1FDIA 1JTHA 1JY2N 5KAIE 3LIDA 3V5BA 1N7LA 3P32A 5CCHC 2AXTH 1IK7A 1AJYA 3BATA 3HTKA 3WUUA 1URQD 3ITKA 1R5SA 2N9BA 1IFDA 2M3BA 3USSA 5KLVD 1SQQJ 2YKQA 1WT6A 1E5WA 1K04A 1ZN5A 1VQ7P 2O01H 3CXHH 2YKOA 2PRRA 3C1LA 2KUBA 2XNXA 1SQPJ 1NTMJ 2R32A 3O6QA 1M1JB 1VQMP 2KNCB 3L72E 1SQXK 2E76B 3CX5D 1NWQA 3RK2C 3W67A 2YO3A 2Q3IA 1EDKA 1L0NG 3H1JJ 4PD4E 1JY2P 1X0TA 1M57D 1ZW0A 2BCCG 1X9VA 3M0DA 1SQQD 3AECC 5EFWB 2IBZG 1YQ3C 1KB9H 3Q5RA 4EI2A 1NTKG 2C0WA 3QH9A 1BCCG 2R44A 2OYIC 4D6TE 2QA4P 1NTMD 2KLVA 3D6YA 1W5CE 3M0AA 4R4LA 1LTTC 2W6JH 3L35A 1KQGB 4H44B 4WVZA 4UB8H 1P84D 1BGYE 2W27A 3M9BA 3H1JD 1SP4A 3R2PA 1VQNP 2LKMA 2IX7C 5AVXB 3G6EP 5KLVG 5KJ7D 3A2AA 4JPZB 3CWBE 2H8PD 3HE4B 1JUNA 1SVFA 3CCLP 1FDMA 2M5AB 2W6AA 3WMM0 2YMYA 4OH8B 2Q3EA 4XE5B 1BE3E 2WSSH 1HWTC 1IFIA 2AEFA 1MFTA 2ZYAA 4JBZA 2WPSA 3B5NB 2QE7H 1WRGA 4Y99B 3TNUB 1N73C 2L5GB 3GHGB 4W7YA 3H1KJ 3P7KA 1SQQG 2GUSA 2NPSA 1VQKP 3HE5B 5CHXA 2YIUB 3SWKA 1KC8Q 3H1HE 1L4AD 1YHQP 2M0BA 2E75D 1YITP 3HD7A 3EFGA 1SQPG 1NTMG 2E5YA 5CBOA 2N1TB 3GLMA 1HH0A 4YXDC 4TLFA 1SQBJ 1RHZB 2AEMA 1BSHA 1NAFA 2HPCA 1LTAC 3CXHI 3H1JG 1M1KQ 1HJBA 1GL2C 1KD1Q 2A06E 1Q86Q 2KYVA 1N7SC 1KILC 2KS1A 1FBMA 3L72D 1R5LA 1FS0E 2V7QJ 2OQQA 1KILE 2KB7P 1MFZA 2VRSA 1FOSF 3OW2O 1LTSC 2Q7CA 3H1LJ 3KHUA 2KNCA 3AEAC 2FFDB 1G2CB 1EDIA 2ZYGA 1T3JA 5AVYB 4GT1A 3PTZA 1L0LG 1SQBD 3L70J 3CCQP 4PV1C 1PGPA 1ZV8A 2ITAA 4I2LC 1NHLA 1VQOP 4WB4A 1FZEA 3JSVC 1PP9E 1IJDB 3CL3D 2ZT9D 1SLQA 3N7NA 1JMMA 5APYA 2J5UA 3B5ND 3KYQA 2HG5D 2C0XA 3EWKA 2Y9YA 5AVUB 3H1LD 1JY2O 2YKPA 1S9KE 1HTLC 4IL6X 1VF5C 1JB0J 1AA0A 3JCUE 1ZXGA 1UIIA 4NPFX 1NTZJ 2C9NY 4C7NA 2H7HA 1FZCC 2QJPB 4WY4C 3I5CA 4QMAA 2OYIA 2O3JA 1L2PA 4IL6E 3H1KG 3AEEC 1AV1A 4GODA 3HE4A 3CCMP 1LWUC 2WITA 1LTJB 1W2BO 1LTIC 1NTKE 2CPBA 2P10A 3E1RA 4ZMDA 3S4RA 4W7ZA 1S3JA 1EDJA 1KYOH 2Y0DA 2NZ2A 2GUVA 3Q2YA 2M8RA 3TGUE 5E79E 4O9BA 2B9BA 1SQBG 4NPDA 3TNUA 1URQC 2P7JA 3VYIA 2ZXEB 3UIAA 4H0LC 4AUWA 1HGZA 4KHXA 1VQPP 1DD4A 3HE5A 3L73J 3OAKA 4OGQC 2WT7A 1LT9A 1PZQA 1LP1B 5CJ0A 3GF3A 2P2UA 3T97B 5TISH 1VQ4P 1GU4A 3H1LG 1J1EC 3L37A 1AQ5A 1N73A 2KSJA 1XTCC 1PP9J 4I7ZB 2ZYDA 2SPZA 4PJ0H 4NPEA 2QM8A 3MD0A 5APTA 3V2NA 3L70G 3V2RA 3F89A 3HUSC 4N78D 1RE3A 3H32B 4YTPC 3WUVA 3FXEA 2OYHC 1M8OB 2HLOA 3L75E 4Y28J 1EXJA 1NU1G 3L73D 2Z4EA 2AXTE 3VP8A 4A7PA 2JJLA 1HVVA 1L0NK 2JKVA 2PP6A 4ZNCA 3VMAA 4OVNF 3KPEA 5AW5B 1PP9D 1DD3A 4XFJA 3U1CA 1PPJD 2A45I 2FY8A 1N7SA 1KILA 1OW8A 4HKZH 2K1AA 3L4FA 1NTKK 3CXHE 3PP5A 1NTZG 1YJ9P 2RH0A 3R4YA 3RL0D 5AW6B 1SQVG 1S9KD 5KJ7C 1LGHB 1R8EA 1CI6B 2Q6QA 3Q5SA 1H0TA 2B87A 2WSCJ 5AW9B 3CC2P 4H13D 1EZVD 1LTGC 1VDFA 3CX5H 1JOCA 2E74D 1FDOA 1VQ9P 1SFCB 3FWLA 5KLVK 3C9IA 3H6PA 2JDIH 5AW1B 4U3FE 1T6AA 2W90A 1L0LE 1USEA 1Q90D 3Q3DA 1CZQA 1KB9E 1X22A 1JCCA 5K5GB 1M1JC 1QL2A 2E76C 3TGUD 3L73G 5APSA 1GW3A 1OVVA 4UB8E 5M1BA 4WWIA 1FZCA 1P84H 4BRYA 4WY4A 2L91A 1PFIA 1XTGB 1SS1A 1DX7A 2R5BA 3S1KA 3SSUA 3V4WA 1LWUA 3KDPB 1SQXJ 5AW4B 4ASWA 3NFQA 1IO4A 1GMJA 1SQPK 3MP7B 1L4AB 2XZRA 1LP1A 3B4SA 3H25A 2E75B 2KOGA 1HBWA 3LW5J 3NXSA 2JWDA 1CSBA 4H44C 1LTBC 2Z5HA 3I56P 2BEZF 5APWA 1URQA 1EZVG 2O01N 3AE3C 2QSIA 3AE2C 1KFNA 2IBZI 3ZDMA 3V2QA 4HYTB 2HODB 4JYCA 2QJYB 3WU2H 3B8EB 2FYUE 1KQSO 1HJ0A 1IZNB 4DJGA 1RQVA 1SQXD 2KZJA 5B66H 3SWYA 2J58A 3CPWO 1SFCD 2W83C 3RK2B 2H43A 4LGDE 2WZ7A 3L74E 1L0LK 2PGDA 4Y99C 3AEBC 1U7MA 3A0HH 3IR9A 1NKNA 2NPSD 1K8AQ 3HUSA 3M9QA 3H1IE 1ZR4A 1NGMB 3GHGC 5KKZB 3KZIH 1AVOA 2XV5A 3S9OA 5GTHH 4IOIH 3BCCE 2OYHA 2YIUC 3HD7D 2IYPA 1LT9C 2ZT9B 1T8ZA 1X8YA 3CCSP 1BDCA 3IFMA 4DOJA 1NYHA 2Y9ZA 1RF1B 2N1TC 3CX5I 1E79H 1EC5A 5AVSB 2Q1KA 3AEDC 2Q5UA 3GF7A 1NU1E 1GW4A 2FYNB 2P58A 2K9JB 3L72J 5AVRB 2JR8A 1NKZB 2QJKB 1RE3C 5CCGD 5CCHD 2M3EA 1IFPA 1Q7YQ 1MZ9A 2ZFCA 2E42A 3L36A 4L73A 5KJ7A 4IFMA 2WSFJ 3VMZA 4K35A 2WVRA 3CCJP 2V7QH 1SQXG 2K3RA 2FFDC 2JO1A 1EXIA 5AVVB 3RBXA 1SQVE 1T2KC 4WBAA 2DW3A 2OTKE 2FYUK 4D6TJ 1SQBK 3L71E 1FJPA 5AVWB 1NOHA 1ZP0C 2N9YB 1DEEG 1BGYJ 1JNMA 3RK2D 2JWAA 4PD4D 3U1AA 1M1JA 1Y47A 2WPQA 1JM0A 4ASVA 2IYOA 2E5TA 2J59M 4L75A 3VP9A 3CC7P 4N6JA 3CWBJ 3G71P 1KV4A 1K05A 3MIWA 1GTWA 1FJKA 2RMZA 1N2DC 1KB9I 1ZRTE 5KAFH 3N4XA 4DT0A 4D6TD 3W68A 3MGNA 2I1JA 1BE3J 1GL2B 4U7JA 2RKLA 2QJPC 1FZAA 1VQ5P 3BASA 2YXRB 2HYNA 1BGYD 4XA4A 1WMKA 2G3AA 4C7RA 1NU1K 3L74D 4KT0J 3CCEP 1LTJC 1KZUB 2WSEJ 3RK3C 2KIKA 2MKVA 1EQ7A 3CWBD 1RE4A 5TISE 3RK3E 1QGKB 3H1HJ 4TT3H 5AW2B 1GU5A 1L0NE 1PV3A 4YXWH 2QRXA 1KORA 4GDOA 5KLIB 4PJ0E 1JTHB 2BCCE 1BE3D 1NAYA 1NTZK 2KP8A 3L72G 1G1JA 2Y0CA 2IBZE 1GK6A 2H89C 2I1KA 3E1IA 1SQVK 2M5AA 1PGQA 4ZKPA 3KQGA 1BCCE 3RL0B 1VQ6P 4K3AA 4HB1A 3EFFK 3L71J 3FGAD 1Y8AA 1JY3O 3B5NA 1QX8A 5H2FE 4H13B 3H1HD 4I7ZC 2OGUA 3GHGA 1T3UA 2E74B 4JQ0D 1KQFB 1LNQA 4D6TG 2QEXP 1FZFA 2B89A 5BU5A 5APUA 2FBWC 5KLVE 1NH4A 2JP3A 1X79B 3O6QB 4EOTA 5BVZA 1BGYG 2N1TA 1J1DB 2A06D 3V2PA 4LLHA 3L71D 2WPVB 4GOFA 1GL2D 3AE9C 2QVAA 3CWBG 2IPPA 1N7SD 3A0BH 1KILD 3CX5E 3NMDA 1RF0C 3I55P 3BRTB 1FOSE 1PGOA 3VN0A 2CK3H 4GKGA 2O1KA 5APXA 1JCDA 1SQQE 2D2CB 2UWJE 1FE6A 3CCVP 2FFDA 1G2CA 2W8ZA 4GIFA 4EYYQ 2KSEA 1SQPE 1NTME 4UB6H 2KLUA 3C8VA 2W6BA 5CMZA 3G4SP 1SFCC 3CLQA 2WSCH 2MJZA 1NTKJ 2XU6A 3D70A 3H1HG 3NTNA 1A02J 2C9LY 1P84E 1S5LH 3M06A 3H1JE 4RESB 1QVGO 1OVUA 3TGUJ 3BRVB 3AEGC 2BASA 1AQTA 1GK4A 1JMBA 4KJMA 1VF5D 3IN6A 3RBZA 1GDTA 2AEJA 1GZLA 2YO2A 5AVZB 2A06G 3GW6A 1KTMA 1GD2E 4WY4D 2G8YA 2P67A 3M91A 5DJUB 2H88C 1YQ4C 5B5EH 1NTKD 2NPSB 3PH0A 3IAOA 3VMYA 1BCCD 1DIPA 1MV8A 1M90Q 3BVHA 3WU2E 3A5TA 2WQYC 1KMIZ 1LTJA 1KYOI 5CCGC 3HD7B 4RJTA 4IFDK 3CC4P
chains in the Genus database with same CATH topology
3HD7D 2R5DA 4I2LC 1NHLA 4EIJA 1L4AC 4WB4A 1H88A 1LT9C 5BU8B 1URQB 1FZEA 1T8ZA 1X8YA 1ZR2A 1IJDB 3HRNA 3CL3D 1SLQA 3IFMA 3N7NA 4DOJA 4DZOA 1RF1B 1JMMA 4IFFA 5APYA 2HPCB 2N1TC 1SQQK 4I1LA 3B5ND 3KYQA 5AVSB 2HG5D 2C0XA 2XDJA 5AVUB 3LW5H 2Q5UA 3CI9A 1JY3N 1GW4A 1JY2O 4AYCA 3TYYA 2YKPA 1S9KE 4I6MC 3P8MC 5AVRB 1NKZB 1HTLC 1RE3C 1VPCA 5CCGD 1NTMK 5CCHD 2OARA 1MUUA 1J1EB 5AW7B 2GM4A 2C9NY 1MZ9A 4C7NA 2WPRA 2ZFCA 2E42A 3L36A 2H7HA 5KJ7A 1FZCC 3T97A 1KFMA 4IFMA 4WY4C 3VMZA 3OJAB 1FZBA 3I5CA 2OYIA 1RE4C 1OWAA 3HUSB 5AVQB 5AW8B 2A45G 1GL2A 3HE4A 2FFDC 1DEBA 5CJ4A 1LWUC 2WITA 1LTJB 2NPSC 2FXMA 5AVVB 1LTIC 2JEEA 1T2KC 4WBAA 3MUDA 2CPBA 2OYHB 1G1IA 2FYUK 4W7ZA 3H32A 3RK3D 1SQBK 4JF7A 5KTBA 1FJPA 2GUVA 5AVWB 2M8RA 3HD7C 1NOHA 3P8CE 4O9BA 2WTYA 2CPSA 3TNUA 1URQC 1JNMA 2P7JA 3RK2D 3U1AA 3VYIA 2ZXEB 2R3CA 1M1JA 3UIAA 2WPQA 1JO5A 4AUWA 1RF1C 3B5NC 2J59M 3U59A 1JY3P 3VP9A 1HGZA 4KHXA 1KQLA 3HE5A 1JTHA 1JY2N 5AW3B 3OAKA 4N6JA 2WT7A 1LT9A 3MIWA 1GTWA 1IFJA 1RF0A 2FKWB 3LIDA 5CJ0A 1FJKA 3O8ZA 3V5BA 4C7NB 2IFNA 2PAJA 1N2DC 2P2UA 1N7LA 3P32A 5CCHC 3N4XA 1H8AA 1GU4A 3BATA 3HTKA 1J1EC 3L37A 2OYIB 3MGNA 1AQ5A 1N73A 2I1JA 2IFMA 2KSJA 3VTPC 1XTCC 3TSIA 1GL2B 1URQD 3SWFA 1W2EA 5APVA 2N9BA 1FZAA 3TK1A 1IFDA 2M3BA 3BASA 2Q9IA 2QM8A 1CI6A 3MD0A 5APTA 3V2NA 2HYNA 3V2RA 3HUSC 4N78D 1RE3A 4XA4A 3H32B 2YKQA 4C7RA 1NU1K 1WT6A 1E5WA 1YTZI 3OA7A 1ZN5A 2WSFH 2O01H 1RY3A 4LC1A 2YKOA 1LTJC 1A02F 1KZUB 2OYHC 1SFCA 2HLOA 3RK3C 1QL1A 2QM7A 2XNXA 1EQ7A 2Z4EA 4W80A 1RE4A 2R32A 3VP8A 2JJLA 5AW2B 1M1JB 1HVVA 1L0NK 1GU5A 5APQA 1SQXK 2PP6A 3V4QA 1NWQA 3RK2C 3KPEA 1JTHB 2YO3A 1H89A 5AW0B 1NO4A 2Q3IA 1NTZK 5AW5B 2KP8A 2WT7B 1G1JA 1LT9B 3MTUE 3U1CA 2A45I 1JY2P 1GK6A 3II6A 1N7SA 1KILA 1ZLLA 2I1KA 3E1IA 1SQVK 5AVTB 3L4FA 1NTKK 1X9VA 3M0DA 3KQGA 4ZKPA 3PP5A 1J2JB 3RL0B 1IC2A 1N73B 3RL0D 5AW6B 2C0WA 5KJ7C 1S9KD 1LGHB 1JY3O 3LIEA 3B5NA 1CI6B 2OYIC 2KLVA 5AW9B 3A3YB 3GHGA 1T3UA 2O1JA 1LTGC 1VDFA 1JOCA 3M0AA 3VMXA 1LTTC 3L35A 1IFNA 1IK9A 1FZFA 1SFCB 5CCGA 4N3YB 5CCHA 3C9IA 3H6PA 5BU5A 1N86A 5APUA 5KLVK 1NH4A 4N78E 3VOPA 2W27A 1L4AA 3M9BA 1SP4A 3R2PA 5AW1B 1X79B 2YNYA 2LKMA 2IX7C 5AVXB 4EOTA 5BVZA 1CZQA 2P1JA 5KJ7D 3A2AA 4HH2A 2N1TA 1J1DB 3V2PA 2H8PD 2WSEH 1JCCA 4LLHA 3HE4B 1JUNA 1M1JC 1Z56A 1M7LA 1GL2D 1QL2A 2XKMA 2FYZA 2HODA 1SVFA 1N7SB 1KILB 5APSA 1HUCA 3P8CD 1FDMA 2IPPA 3G3ZA 1N7SD 1KILD 2W6AA 3WMM0 2YMYA 1GW3A 3NMDA 4OH8B 2A45H 4XE5B 1RF0C 1HWTC 1IFIA 4B86A 3BRTB 1FOSE 3VN0A 4GKGA 2O1KA 5APXA 1FZCA 2WPSA 3B5NB 4WY4A 1WRGA 1JCDA 3RL0C 1PFIA 4Y99B 3TNUB 1N73C 1XTGB 2L5GB 3GHGB 1DX7A 4W7YA 3P7KA 2R5BA 2FFDA 1G2CA 4GIFA 3V4WA 1HGVA 1LWUA 2GUSA 2NPSA 3KDPB 5AW4B 3HE5B 3NFQA 1IO4A 5CHXA 1SQPK 1L4AB 2XZRA 1L4AD 2KOGA 2W6BA 1HBWA 5CMZA 1FZGA 1SFCC 3CLQA 3HD7A 3NXSA 3EFGA 1CSBA 2WSCH 1CW5A 2MJZA 2XU6A 1LTBC 1A02J 2Z5HA 2N1TB 3NTNA 4ZKUA 2C9LY 3HTKB 5APWA 1URQA 1HH0A 2N1TD 3M06A 4RESB 1KFNA 1DH3A 3V2QA 1NAFA 4HYTB 2HODB 4JYCA 1RF1A 2HPCA 1LTAC 1J1DC 3BRVB 2BASA 3RK3B 1HJBA 2Z5IA 1GK4A 1GL2C 3B8EB 3A7OA 1GDTA 1FAVA 2KYVA 1N7SC 1KILC 1FBMA 1AFOA 1GZLA 3M0DC 1YTZT 3EQ2A 2YO2A 2POHA 1FZCB 5AVZB 2E43A 3SWYA 4WY4B 2J58A 1SFCD 2KB7P 1MFZA 2VRSA 3RK2B 2H43A 3M9HA 4WY4D 1GD2E 1FOSF 4LGDE 2WZ7A 2WWWA 1LTSC 2P67A 3M91A 2Q7CA 1L0LK 4JYBA 1FU1A 2FFDB 1G2CB 1LWUB 2NPSB 4Y99C 4AQRD 1T3JA 5AVYB 3IR9A 4GT1A 1NKNA 2NPSD 3VMYA 3HUSA 3M9QA 1YYCA 1ZR4A 1T2KD 1MV8A 3GHGC 3BVHA 1IFMA 2HFED 3A5TA 4M3LA 1OXZA 2XV5A 4C46A 1ZV8A 1LTJA 5CCGC 3HD7B 4IFDK 2OYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIA A;  2R5D A;  2WPQ A;  4I2L C;  3P7K A;  1J2J B;  4AUW A;  2R5B A;  1H88 A;  3V4W A;  1X8Y A;  3KDP B;  5AW4 B;  4KHX A;  5AW6 B;  1KQL A;  1SLQ A;  3HE5 B;  3HE5 A;  3NFQ A;  1IO4 A;  4DZO A;  1S9K D;  5AW3 B;  3OAK A;  3LIE A;  2WT7 A;  2XZR A;  5APY A;  1CI6 B;  1GTW A;  3LID A;  3O8Z A;  5AVS B;  3V5B A;  4C7N B;  1HBW A;  5CMZ A;  2P2U A;  5AVU B;  3NXS A;  3P32 A;  2Q5U A;  5AW9 B;  1CSB A;  3A3Y B;  4AYC A;  1H8A A;  3TYY A;  2XU6 A;  1A02 J;  2Z5H A;  3NTN A;  1GU4 A;  2C9L Y;  3HTK A;  3L37 A;  3M0A A;  3MGN A;  5APW A;  4I6M C;  3P8M C;  5AVR B;  3VTP C;  3L35 A;  3VMX A;  1S9K E;  3M06 A;  4RES B;  3SWF A;  1DH3 A;  5APU A;  1NAF A;  4HYT B;  5APV A;  2N9B A;  2W27 A;  3TK1 A;  3M9B A;  1MUU A;  4JYC A;  1SP4 A;  2QM8 A;  1CI6 A;  3MD0 A;  5APT A;  5AW7 B;  5AW1 B;  2YNY A;  2BAS A;  2C9N Y;  4C7N A;  2Z5I A;  1HJB A;  1GK4 A;  2WPR A;  2ZFC A;  3B8E B;  2E42 A;  3L36 A;  5AVX B;  4EOT A;  2H7H A;  3T97 A;  3A7O A;  3VMZ A;  1CZQ A;  1FAV A;  3A2A A;  3I5C A;  4LC1 A;  1OWA A;  1A02 F;  1GZL A;  5AVQ B;  5AW8 B;  3HE4 A;  3HE4 B;  1JUN A;  2YO2 A;  2E43 A;  2QM7 A;  5AVZ B;  1MFZ A;  2VRS A;  1GD2 E;  3M9H A;  1FOS F;  5APS A;  2R32 A;  1HUC A;  5AVV B;  2JJL A;  2WWW A;  2P67 A;  2IPP A;  3M91 A;  2Q7C A;  1T2K C;  2W6A A;  5AW2 B;  4JYB A;  1GU5 A;  3NMD A;  5APQ A;  1G2C B;  4XE5 B;  1HWT C;  3V4Q A;  4AQR D;  1NWQ A;  4B86 A;  5AVY B;  3IR9 A;  4GT1 A;  5AVW B;  3VMY A;  1FOS E;  2YO3 A;  3VN0 A;  1H89 A;  5AW0 B;  1YYC A;  2Q3I A;  1T2K D;  4GKG A;  1MV8 A;  5AW5 B;  2KP8 A;  2WT7 B;  5APX A;  2WPS A;  2WTY A;  3A5T A;  4M3L A;  1OXZ A;  3TNU A;  3TNU B;  1GK6 A;  2XV5 A;  4C46 A;  1JNM A;  2P7J A;  5AVT B;  3VYI A;  2ZXE B;  2R3C A;  3M0D A;  3KQG A; 
#chains in the Genus database with same CATH topology
 2R5D A;  1L4A C;  1ZME C;  1K73 Q;  5BU8 B;  5B66 E;  1ZR2 A;  2E75 C;  5GTI H;  3CCR P;  4BXL A;  2HPC B;  2FXP A;  3L75 J;  1VL2 A;  4H0L D;  1SQQ K;  1PP9 G;  3PRJ A;  1PPJ G;  2D2C D;  2XDJ A;  3GG2 A;  3LW5 H;  3CI9 A;  1JY3 N;  3A0H E;  3QWO C;  3TYY A;  4RO0 A;  4OGQ D;  2LR2 A;  1YI2 P;  2QJY C;  2KS1 B;  3P8M C;  1OVR A;  1S1C X;  3KZI E;  1OZH A;  1NTM K;  3GMA A;  5GTH E;  2GM4 A;  2ZAE B;  3H1K E;  2WPR A;  3T97 A;  1KFM A;  2O01 J;  3OJA B;  1RE4 C;  1OWA A;  2IZ0 A;  1VQL P;  5AVQ B;  5AW8 B;  1EZV I;  4EDF A;  1DEB A;  3E7K A;  5CJ4 A;  3L75 D;  1QEX A;  2FXM A;  3MUD A;  2ZVN B;  5KAI H;  3H32 A;  1YIJ P;  4JF7 A;  5KKZ C;  1SQB E;  5KTB A;  1KN7 A;  3P8C E;  1N8R Q;  5DJT B;  2ZT9 C;  1SQP D;  2KK7 A;  2R3C A;  3TGU G;  4U3F J;  3G9R A;  1L0L J;  1RF1 C;  3B5N C;  2NRG A;  1JY3 P;  3CXH D;  5AW3 B;  1S72 P;  2FYN C;  3H1L E;  3B71 A;  1IFJ A;  1RF0 A;  1OMI A;  2FKW B;  3O8Z A;  4C7N B;  2IFN A;  2PAJ A;  2QJK C;  2YXQ B;  4HJG H;  2GA1 A;  1H8A A;  4CPG A;  2OYI B;  3VTP C;  2IFM A;  3L70 E;  3TSI A;  3SWF A;  1S2E A;  3FXD A;  1W2E A;  5APV A;  3TK1 A;  2Q9I A;  1CI6 A;  4PD4 H;  3V6I A;  1YTZ I;  3OA7 A;  4U3F D;  2WSF H;  1RY3 A;  4LC1 A;  4L74 A;  1L0L D;  1OIP A;  1A02 F;  1BSN A;  1S4X A;  1KB9 D;  1SFC A;  5CBN A;  1QL1 A;  2QM7 A;  4W80 A;  5KAF E;  3D71 A;  2QG4 A;  3L75 G;  1OW6 A;  3AE6 C;  5APQ A;  1TU3 F;  3V4Q A;  2E76 D;  2YMK A;  1H89 A;  5AW0 B;  1NO4 A;  3PHL A;  2WT7 B;  1NTZ E;  1LT9 B;  3MTU E;  3II6 A;  1ZLL A;  2ZXX A;  5AVT B;  3TDK A;  1J2J B;  1U57 A;  1P84 I;  1RH5 B;  1IC2 A;  2FYU J;  1N73 B;  2IZ1 A;  1AVY A;  3LIE A;  3CMA P;  3SFE C;  3L74 J;  3A3Y B;  2OTJ P;  2O1J A;  3H1K D;  2IDB A;  2Y0E A;  3VMX A;  1IFN A;  1IK9 A;  2HR3 A;  2I8D A;  5CCG A;  4N3Y B;  4RKU J;  5CCH A;  4YPC A;  1N86 A;  1PGJ A;  4N78 E;  3VOP A;  4H44 D;  1L4A A;  3H1I J;  2YNY A;  1EDL A;  2PFX A;  2KXP B;  3RL0 g;  1KYO E;  2P1J A;  3BCC J;  3JC2 2;  4HH2 A;  2FYU D;  3L73 E;  4U3F G;  1PIX A;  2WSE H;  1VQ8 P;  1Z56 A;  1M7L A;  2XKM A;  2FYZ A;  2HOD A;  1N7S B;  1KIL B;  1HUC A;  5KLI C;  3P8C D;  3G3Z A;  1MKM A;  3Q5P A;  2A45 H;  1NU1 J;  4B86 A;  3Q1M A;  1PPJ E;  1Q81 Q;  1YJN P;  1M56 D;  3RL0 C;  3FWN A;  3H1I D;  1H0T B;  2B87 B;  2B88 A;  1USD A;  1YBK A;  4PV1 B;  3D6Z A;  1HGV A;  1UIX A;  3BCC D;  4H13 C;  3L70 D;  1RQU A;  2E74 C;  4Z1M H;  3A0B E;  3AE1 C;  1EZV E;  1FZG A;  2QIW A;  3F5H A;  3IF4 A;  3KXD A;  4L76 A;  1SQV J;  1YJW P;  1Q2N A;  1CW5 A;  4ZKU A;  3HTK B;  1FC2 C;  2N1T D;  1NU1 D;  4PD4 I;  1OX3 A;  1OW7 A;  4BWN A;  1DH3 A;  2OYO A;  2K88 A;  1RF1 A;  1LJ2 A;  1J1D C;  2XND H;  3CCU P;  3RK3 B;  2Z5I A;  1VF5 B;  3A7O A;  4MN4 C;  1FAV A;  1QVF O;  1S5L X;  4DCK A;  2K9J A;  1AFO A;  1NJI Q;  1PL5 A;  3MUD C;  4UB6 E;  3AE8 C;  3M0D C;  1YTZ T;  2FYU G;  3EQ2 A;  1FZC B;  2POH A;  3AEF C;  2E43 A;  4BRY B;  4WY4 B;  1NVO A;  4OWF A;  2ZJS E;  5TJH A;  3RGU A;  3M9H A;  1NTZ D;  2WWW A;  4JYB A;  1FU1 A;  3CME P;  2ZVO B;  1S5L E;  3MHV A;  1SQV D;  1LWU B;  2KZI A;  2AXC A;  4AQR D;  2D2C C;  3L74 G;  3WUT A;  1YYC A;  1JEK A;  1ZOY C;  1T2K D;  1IFM A;  2HFE D;  4M3L A;  1OXZ A;  4C46 A;  1U7J A;  3FX0 A;  1D7M A;  3PJS K;  3H1I G;  3JCU H;  1QLE D;  3AE7 C;  3AE5 C;  4EIJ A;  1H88 A;  1HF9 A;  3ABV C;  1URQ B;  5L8R J;  3HRN A;  3BCC G;  4DZO A;  4H0L B;  4IL6 H;  3MZW B;  4IFF A;  1BE3 G;  4I1L A;  5B5E E;  4OGQ B;  4AYC A;  3K5B A;  1L0N J;  4I6M C;  1ZRT D;  4PV1 D;  1KYO D;  2WMM A;  1Y9B A;  1OFC X;  3SFD C;  1VPC A;  2BCC J;  2OAR A;  1MUU A;  2OTL P;  1J1E B;  5AW7 B;  5C39 A;  5E79 H;  1K9M Q;  3AE4 C;  5GTI E;  2LXC B;  5H2F H;  1SQX E;  2LXB A;  1FZB A;  1BCC J;  3HUS B;  2K9Y A;  2KI7 B;  2A45 G;  1GL2 A;  4GOE A;  2NPS C;  2R3S A;  2JEE A;  2K37 A;  3CD6 P;  2OYH B;  1G1I A;  1BDD A;  3RK3 D;  1Q82 Q;  2BEQ D;  1L0N D;  3HD7 C;  2WTY A;  2CPS A;  3L71 G;  2BCC D;  5KLV J;  3PLN A;  2IBZ D;  1LT1 A;  2FXO A;  2V4H A;  1JO5 A;  2RN0 A;  3U59 A;  3TF5 A;  4R4M A;  1KQL A;  1FDI A;  1JTH A;  1JY2 N;  5KAI E;  3LID A;  3V5B A;  1N7L A;  3P32 A;  5CCH C;  2AXT H;  1IK7 A;  1AJY A;  3BAT A;  3HTK A;  3WUU A;  1URQ D;  3ITK A;  1R5S A;  2N9B A;  1IFD A;  2M3B A;  3USS A;  5KLV D;  1SQQ J;  2YKQ A;  1WT6 A;  1E5W A;  1K04 A;  1ZN5 A;  1VQ7 P;  2O01 H;  3CXH H;  2YKO A;  2PRR A;  3C1L A;  2KUB A;  2XNX A;  1SQP J;  1NTM J;  2R32 A;  3O6Q A;  1M1J B;  1VQM P;  2KNC B;  3L72 E;  1SQX K;  2E76 B;  3CX5 D;  1NWQ A;  3RK2 C;  3W67 A;  2YO3 A;  2Q3I A;  1EDK A;  1L0N G;  3H1J J;  4PD4 E;  1JY2 P;  1X0T A;  1M57 D;  1ZW0 A;  2BCC G;  1X9V A;  3M0D A;  1SQQ D;  3AEC C;  5EFW B;  2IBZ G;  1YQ3 C;  1KB9 H;  3Q5R A;  4EI2 A;  1NTK G;  2C0W A;  3QH9 A;  1BCC G;  2R44 A;  2OYI C;  4D6T E;  2QA4 P;  1NTM D;  2KLV A;  3D6Y A;  1W5C E;  3M0A A;  4R4L A;  1LTT C;  2W6J H;  3L35 A;  1KQG B;  4H44 B;  4WVZ A;  4UB8 H;  1P84 D;  1BGY E;  2W27 A;  3M9B A;  3H1J D;  1SP4 A;  3R2P A;  1VQN P;  2LKM A;  2IX7 C;  5AVX B;  3G6E P;  5KLV G;  5KJ7 D;  3A2A A;  4JPZ B;  3CWB E;  2H8P D;  3HE4 B;  1JUN A;  1SVF A;  3CCL P;  1FDM A;  2M5A B;  2W6A A;  3WMM 0;  2YMY A;  4OH8 B;  2Q3E A;  4XE5 B;  1BE3 E;  2WSS H;  1HWT C;  1IFI A;  2AEF A;  1MFT A;  2ZYA A;  4JBZ A;  2WPS A;  3B5N B;  2QE7 H;  1WRG A;  4Y99 B;  3TNU B;  1N73 C;  2L5G B;  3GHG B;  4W7Y A;  3H1K J;  3P7K A;  1SQQ G;  2GUS A;  2NPS A;  1VQK P;  3HE5 B;  5CHX A;  2YIU B;  3SWK A;  1KC8 Q;  3H1H E;  1L4A D;  1YHQ P;  2M0B A;  2E75 D;  1YIT P;  3HD7 A;  3EFG A;  1SQP G;  1NTM G;  2E5Y A;  5CBO A;  2N1T B;  3GLM A;  1HH0 A;  4YXD C;  4TLF A;  1SQB J;  1RHZ B;  2AEM A;  1BSH A;  1NAF A;  2HPC A;  1LTA C;  3CXH I;  3H1J G;  1M1K Q;  1HJB A;  1GL2 C;  1KD1 Q;  2A06 E;  1Q86 Q;  2KYV A;  1N7S C;  1KIL C;  2KS1 A;  1FBM A;  3L72 D;  1R5L A;  1FS0 E;  2V7Q J;  2OQQ A;  1KIL E;  2KB7 P;  1MFZ A;  2VRS A;  1FOS F;  3OW2 O;  1LTS C;  2Q7C A;  3H1L J;  3KHU A;  2KNC A;  3AEA C;  2FFD B;  1G2C B;  1EDI A;  2ZYG A;  1T3J A;  5AVY B;  4GT1 A;  3PTZ A;  1L0L G;  1SQB D;  3L70 J;  3CCQ P;  4PV1 C;  1PGP A;  1ZV8 A;  2ITA A;  4I2L C;  1NHL A;  1VQO P;  4WB4 A;  1FZE A;  3JSV C;  1PP9 E;  1IJD B;  3CL3 D;  2ZT9 D;  1SLQ A;  3N7N A;  1JMM A;  5APY A;  2J5U A;  3B5N D;  3KYQ A;  2HG5 D;  2C0X A;  3EWK A;  2Y9Y A;  5AVU B;  3H1L D;  1JY2 O;  2YKP A;  1S9K E;  1HTL C;  4IL6 X;  1VF5 C;  1JB0 J;  1AA0 A;  3JCU E;  1ZXG A;  1UII A;  4NPF X;  1NTZ J;  2C9N Y;  4C7N A;  2H7H A;  1FZC C;  2QJP B;  4WY4 C;  3I5C A;  4QMA A;  2OYI A;  2O3J A;  1L2P A;  4IL6 E;  3H1K G;  3AEE C;  1AV1 A;  4GOD A;  3HE4 A;  3CCM P;  1LWU C;  2WIT A;  1LTJ B;  1W2B O;  1LTI C;  1NTK E;  2CPB A;  2P10 A;  3E1R A;  4ZMD A;  3S4R A;  4W7Z A;  1S3J A;  1EDJ A;  1KYO H;  2Y0D A;  2NZ2 A;  2GUV A;  3Q2Y A;  2M8R A;  3TGU E;  5E79 E;  4O9B A;  2B9B A;  1SQB G;  4NPD A;  3TNU A;  1URQ C;  2P7J A;  3VYI A;  2ZXE B;  3UIA A;  4H0L C;  4AUW A;  1HGZ A;  4KHX A;  1VQP P;  1DD4 A;  3HE5 A;  3L73 J;  3OAK A;  4OGQ C;  2WT7 A;  1LT9 A;  1PZQ A;  1LP1 B;  5CJ0 A;  3GF3 A;  2P2U A;  3T97 B;  5TIS H;  1VQ4 P;  1GU4 A;  3H1L G;  1J1E C;  3L37 A;  1AQ5 A;  1N73 A;  2KSJ A;  1XTC C;  1PP9 J;  4I7Z B;  2ZYD A;  2SPZ A;  4PJ0 H;  4NPE A;  2QM8 A;  3MD0 A;  5APT A;  3V2N A;  3L70 G;  3V2R A;  3F89 A;  3HUS C;  4N78 D;  1RE3 A;  3H32 B;  4YTP C;  3WUV A;  3FXE A;  2OYH C;  1M8O B;  2HLO A;  3L75 E;  4Y28 J;  1EXJ A;  1NU1 G;  3L73 D;  2Z4E A;  2AXT E;  3VP8 A;  4A7P A;  2JJL A;  1HVV A;  1L0N K;  2JKV A;  2PP6 A;  4ZNC A;  3VMA A;  4OVN F;  3KPE A;  5AW5 B;  1PP9 D;  1DD3 A;  4XFJ A;  3U1C A;  1PPJ D;  2A45 I;  2FY8 A;  1N7S A;  1KIL A;  1OW8 A;  4HKZ H;  2K1A A;  3L4F A;  1NTK K;  3CXH E;  3PP5 A;  1NTZ G;  1YJ9 P;  2RH0 A;  3R4Y A;  3RL0 D;  5AW6 B;  1SQV G;  1S9K D;  5KJ7 C;  1LGH B;  1R8E A;  1CI6 B;  2Q6Q A;  3Q5S A;  1H0T A;  2B87 A;  2WSC J;  5AW9 B;  3CC2 P;  4H13 D;  1EZV D;  1LTG C;  1VDF A;  3CX5 H;  1JOC A;  2E74 D;  1FDO A;  1VQ9 P;  1SFC B;  3FWL A;  5KLV K;  3C9I A;  3H6P A;  2JDI H;  5AW1 B;  4U3F E;  1T6A A;  2W90 A;  1L0L E;  1USE A;  1Q90 D;  3Q3D A;  1CZQ A;  1KB9 E;  1X22 A;  1JCC A;  5K5G B;  1M1J C;  1QL2 A;  2E76 C;  3TGU D;  3L73 G;  5APS A;  1GW3 A;  1OVV A;  4UB8 E;  5M1B A;  4WWI A;  1FZC A;  1P84 H;  4BRY A;  4WY4 A;  2L91 A;  1PFI A;  1XTG B;  1SS1 A;  1DX7 A;  2R5B A;  3S1K A;  3SSU A;  3V4W A;  1LWU A;  3KDP B;  1SQX J;  5AW4 B;  4ASW A;  3NFQ A;  1IO4 A;  1GMJ A;  1SQP K;  3MP7 B;  1L4A B;  2XZR A;  1LP1 A;  3B4S A;  3H25 A;  2E75 B;  2KOG A;  1HBW A;  3LW5 J;  3NXS A;  2JWD A;  1CSB A;  4H44 C;  1LTB C;  2Z5H A;  3I56 P;  2BEZ F;  5APW A;  1URQ A;  1EZV G;  2O01 N;  3AE3 C;  2QSI A;  3AE2 C;  1KFN A;  2IBZ I;  3ZDM A;  3V2Q A;  4HYT B;  2HOD B;  4JYC A;  2QJY B;  3WU2 H;  3B8E B;  2FYU E;  1KQS O;  1HJ0 A;  1IZN B;  4DJG A;  1RQV A;  1SQX D;  2KZJ A;  5B66 H;  3SWY A;  2J58 A;  3CPW O;  1SFC D;  2W83 C;  3RK2 B;  2H43 A;  4LGD E;  2WZ7 A;  3L74 E;  1L0L K;  2PGD A;  4Y99 C;  3AEB C;  1U7M A;  3A0H H;  3IR9 A;  1NKN A;  2NPS D;  1K8A Q;  3HUS A;  3M9Q A;  3H1I E;  1ZR4 A;  1NGM B;  3GHG C;  5KKZ B;  3KZI H;  1AVO A;  2XV5 A;  3S9O A;  5GTH H;  4IOI H;  3BCC E;  2OYH A;  2YIU C;  3HD7 D;  2IYP A;  1LT9 C;  2ZT9 B;  1T8Z A;  1X8Y A;  3CCS P;  1BDC A;  3IFM A;  4DOJ A;  1NYH A;  2Y9Z A;  1RF1 B;  2N1T C;  3CX5 I;  1E79 H;  1EC5 A;  5AVS B;  2Q1K A;  3AED C;  2Q5U A;  3GF7 A;  1NU1 E;  1GW4 A;  2FYN B;  2P58 A;  2K9J B;  3L72 J;  5AVR B;  2JR8 A;  1NKZ B;  2QJK B;  1RE3 C;  5CCG D;  5CCH D;  2M3E A;  1IFP A;  1Q7Y Q;  1MZ9 A;  2ZFC A;  2E42 A;  3L36 A;  4L73 A;  5KJ7 A;  4IFM A;  2WSF J;  3VMZ A;  4K35 A;  2WVR A;  3CCJ P;  2V7Q H;  1SQX G;  2K3R A;  2FFD C;  2JO1 A;  1EXI A;  5AVV B;  3RBX A;  1SQV E;  1T2K C;  4WBA A;  2DW3 A;  2OTK E;  2FYU K;  4D6T J;  1SQB K;  3L71 E;  1FJP A;  5AVW B;  1NOH A;  1ZP0 C;  2N9Y B;  1DEE G;  1BGY J;  1JNM A;  3RK2 D;  2JWA A;  4PD4 D;  3U1A A;  1M1J A;  1Y47 A;  2WPQ A;  1JM0 A;  4ASV A;  2IYO A;  2E5T A;  2J59 M;  4L75 A;  3VP9 A;  3CC7 P;  4N6J A;  3CWB J;  3G71 P;  1KV4 A;  1K05 A;  3MIW A;  1GTW A;  1FJK A;  2RMZ A;  1N2D C;  1KB9 I;  1ZRT E;  5KAF H;  3N4X A;  4DT0 A;  4D6T D;  3W68 A;  3MGN A;  2I1J A;  1BE3 J;  1GL2 B;  4U7J A;  2RKL A;  2QJP C;  1FZA A;  1VQ5 P;  3BAS A;  2YXR B;  2HYN A;  1BGY D;  4XA4 A;  1WMK A;  2G3A A;  4C7R A;  1NU1 K;  3L74 D;  4KT0 J;  3CCE P;  1LTJ C;  1KZU B;  2WSE J;  3RK3 C;  2KIK A;  2MKV A;  1EQ7 A;  3CWB D;  1RE4 A;  5TIS E;  3RK3 E;  1QGK B;  3H1H J;  4TT3 H;  5AW2 B;  1GU5 A;  1L0N E;  1PV3 A;  4YXW H;  2QRX A;  1KOR A;  4GDO A;  5KLI B;  4PJ0 E;  1JTH B;  2BCC E;  1BE3 D;  1NAY A;  1NTZ K;  2KP8 A;  3L72 G;  1G1J A;  2Y0C A;  2IBZ E;  1GK6 A;  2H89 C;  2I1K A;  3E1I A;  1SQV K;  2M5A A;  1PGQ A;  4ZKP A;  3KQG A;  1BCC E;  3RL0 B;  1VQ6 P;  4K3A A;  4HB1 A;  3EFF K;  3L71 J;  3FGA D;  1Y8A A;  1JY3 O;  3B5N A;  1QX8 A;  5H2F E;  4H13 B;  3H1H D;  4I7Z C;  2OGU A;  3GHG A;  1T3U A;  2E74 B;  4JQ0 D;  1KQF B;  1LNQ A;  4D6T G;  2QEX P;  1FZF A;  2B89 A;  5BU5 A;  5APU A;  2FBW C;  5KLV E;  1NH4 A;  2JP3 A;  1X79 B;  3O6Q B;  4EOT A;  5BVZ A;  1BGY G;  2N1T A;  1J1D B;  2A06 D;  3V2P A;  4LLH A;  3L71 D;  2WPV B;  4GOF A;  1GL2 D;  3AE9 C;  2QVA A;  3CWB G;  2IPP A;  1N7S D;  3A0B H;  1KIL D;  3CX5 E;  3NMD A;  1RF0 C;  3I55 P;  3BRT B;  1FOS E;  1PGO A;  3VN0 A;  2CK3 H;  4GKG A;  2O1K A;  5APX A;  1JCD A;  1SQQ E;  2D2C B;  2UWJ E;  1FE6 A;  3CCV P;  2FFD A;  1G2C A;  2W8Z A;  4GIF A;  4EYY Q;  2KSE A;  1SQP E;  1NTM E;  4UB6 H;  2KLU A;  3C8V A;  2W6B A;  5CMZ A;  3G4S P;  1SFC C;  3CLQ A;  2WSC H;  2MJZ A;  1NTK J;  2XU6 A;  3D70 A;  3H1H G;  3NTN A;  1A02 J;  2C9L Y;  1P84 E;  1S5L H;  3M06 A;  3H1J E;  4RES B;  1QVG O;  1OVU A;  3TGU J;  3BRV B;  3AEG C;  2BAS A;  1AQT A;  1GK4 A;  1JMB A;  4KJM A;  1VF5 D;  3IN6 A;  3RBZ A;  1GDT A;  2AEJ A;  1GZL A;  2YO2 A;  5AVZ B;  2A06 G;  3GW6 A;  1KTM A;  1GD2 E;  4WY4 D;  2G8Y A;  2P67 A;  3M91 A;  5DJU B;  2H88 C;  1YQ4 C;  5B5E H;  1NTK D;  2NPS B;  3PH0 A;  3IAO A;  3VMY A;  1BCC D;  1DIP A;  1MV8 A;  1M90 Q;  3BVH A;  3WU2 E;  3A5T A;  2WQY C;  1KMI Z;  1LTJ A;  1KYO I;  5CCG C;  3HD7 B;  4RJT A;  4IFD K;  3CC4 P; 
#chains in the Genus database with same CATH homology
 3HD7 D;  2R5D A;  4I2L C;  1NHL A;  4EIJ A;  1L4A C;  4WB4 A;  1H88 A;  1LT9 C;  5BU8 B;  1URQ B;  1FZE A;  1T8Z A;  1X8Y A;  1ZR2 A;  1IJD B;  3HRN A;  3CL3 D;  1SLQ A;  3IFM A;  3N7N A;  4DOJ A;  4DZO A;  1RF1 B;  1JMM A;  4IFF A;  5APY A;  2HPC B;  2N1T C;  1SQQ K;  4I1L A;  3B5N D;  3KYQ A;  5AVS B;  2HG5 D;  2C0X A;  2XDJ A;  5AVU B;  3LW5 H;  2Q5U A;  3CI9 A;  1JY3 N;  1GW4 A;  1JY2 O;  4AYC A;  3TYY A;  2YKP A;  1S9K E;  4I6M C;  3P8M C;  5AVR B;  1NKZ B;  1HTL C;  1RE3 C;  1VPC A;  5CCG D;  1NTM K;  5CCH D;  2OAR A;  1MUU A;  1J1E B;  5AW7 B;  2GM4 A;  2C9N Y;  1MZ9 A;  4C7N A;  2WPR A;  2ZFC A;  2E42 A;  3L36 A;  2H7H A;  5KJ7 A;  1FZC C;  3T97 A;  1KFM A;  4IFM A;  4WY4 C;  3VMZ A;  3OJA B;  1FZB A;  3I5C A;  2OYI A;  1RE4 C;  1OWA A;  3HUS B;  5AVQ B;  5AW8 B;  2A45 G;  1GL2 A;  3HE4 A;  2FFD C;  1DEB A;  5CJ4 A;  1LWU C;  2WIT A;  1LTJ B;  2NPS C;  2FXM A;  5AVV B;  1LTI C;  2JEE A;  1T2K C;  4WBA A;  3MUD A;  2CPB A;  2OYH B;  1G1I A;  2FYU K;  4W7Z A;  3H32 A;  3RK3 D;  1SQB K;  4JF7 A;  5KTB A;  1FJP A;  2GUV A;  5AVW B;  2M8R A;  3HD7 C;  1NOH A;  3P8C E;  4O9B A;  2WTY A;  2CPS A;  3TNU A;  1URQ C;  1JNM A;  2P7J A;  3RK2 D;  3U1A A;  3VYI A;  2ZXE B;  2R3C A;  1M1J A;  3UIA A;  2WPQ A;  1JO5 A;  4AUW A;  1RF1 C;  3B5N C;  2J59 M;  3U59 A;  1JY3 P;  3VP9 A;  1HGZ A;  4KHX A;  1KQL A;  3HE5 A;  1JTH A;  1JY2 N;  5AW3 B;  3OAK A;  4N6J A;  2WT7 A;  1LT9 A;  3MIW A;  1GTW A;  1IFJ A;  1RF0 A;  2FKW B;  3LID A;  5CJ0 A;  1FJK A;  3O8Z A;  3V5B A;  4C7N B;  2IFN A;  2PAJ A;  1N2D C;  2P2U A;  1N7L A;  3P32 A;  5CCH C;  3N4X A;  1H8A A;  1GU4 A;  3BAT A;  3HTK A;  1J1E C;  3L37 A;  2OYI B;  3MGN A;  1AQ5 A;  1N73 A;  2I1J A;  2IFM A;  2KSJ A;  3VTP C;  1XTC C;  3TSI A;  1GL2 B;  1URQ D;  3SWF A;  1W2E A;  5APV A;  2N9B A;  1FZA A;  3TK1 A;  1IFD A;  2M3B A;  3BAS A;  2Q9I A;  2QM8 A;  1CI6 A;  3MD0 A;  5APT A;  3V2N A;  2HYN A;  3V2R A;  3HUS C;  4N78 D;  1RE3 A;  4XA4 A;  3H32 B;  2YKQ A;  4C7R A;  1NU1 K;  1WT6 A;  1E5W A;  1YTZ I;  3OA7 A;  1ZN5 A;  2WSF H;  2O01 H;  1RY3 A;  4LC1 A;  2YKO A;  1LTJ C;  1A02 F;  1KZU B;  2OYH C;  1SFC A;  2HLO A;  3RK3 C;  1QL1 A;  2QM7 A;  2XNX A;  1EQ7 A;  2Z4E A;  4W80 A;  1RE4 A;  2R32 A;  3VP8 A;  2JJL A;  5AW2 B;  1M1J B;  1HVV A;  1L0N K;  1GU5 A;  5APQ A;  1SQX K;  2PP6 A;  3V4Q A;  1NWQ A;  3RK2 C;  3KPE A;  1JTH B;  2YO3 A;  1H89 A;  5AW0 B;  1NO4 A;  2Q3I A;  1NTZ K;  5AW5 B;  2KP8 A;  2WT7 B;  1G1J A;  1LT9 B;  3MTU E;  3U1C A;  2A45 I;  1JY2 P;  1GK6 A;  3II6 A;  1N7S A;  1KIL A;  1ZLL A;  2I1K A;  3E1I A;  1SQV K;  5AVT B;  3L4F A;  1NTK K;  1X9V A;  3M0D A;  3KQG A;  4ZKP A;  3PP5 A;  1J2J B;  3RL0 B;  1IC2 A;  1N73 B;  3RL0 D;  5AW6 B;  2C0W A;  5KJ7 C;  1S9K D;  1LGH B;  1JY3 O;  3LIE A;  3B5N A;  1CI6 B;  2OYI C;  2KLV A;  5AW9 B;  3A3Y B;  3GHG A;  1T3U A;  2O1J A;  1LTG C;  1VDF A;  1JOC A;  3M0A A;  3VMX A;  1LTT C;  3L35 A;  1IFN A;  1IK9 A;  1FZF A;  1SFC B;  5CCG A;  4N3Y B;  5CCH A;  3C9I A;  3H6P A;  5BU5 A;  1N86 A;  5APU A;  5KLV K;  1NH4 A;  4N78 E;  3VOP A;  2W27 A;  1L4A A;  3M9B A;  1SP4 A;  3R2P A;  5AW1 B;  1X79 B;  2YNY A;  2LKM A;  2IX7 C;  5AVX B;  4EOT A;  5BVZ A;  1CZQ A;  2P1J A;  5KJ7 D;  3A2A A;  4HH2 A;  2N1T A;  1J1D B;  3V2P A;  2H8P D;  2WSE H;  1JCC A;  4LLH A;  3HE4 B;  1JUN A;  1M1J C;  1Z56 A;  1M7L A;  1GL2 D;  1QL2 A;  2XKM A;  2FYZ A;  2HOD A;  1SVF A;  1N7S B;  1KIL B;  5APS A;  1HUC A;  3P8C D;  1FDM A;  2IPP A;  3G3Z A;  1N7S D;  1KIL D;  2W6A A;  3WMM 0;  2YMY A;  1GW3 A;  3NMD A;  4OH8 B;  2A45 H;  4XE5 B;  1RF0 C;  1HWT C;  1IFI A;  4B86 A;  3BRT B;  1FOS E;  3VN0 A;  4GKG A;  2O1K A;  5APX A;  1FZC A;  2WPS A;  3B5N B;  4WY4 A;  1WRG A;  1JCD A;  3RL0 C;  1PFI A;  4Y99 B;  3TNU B;  1N73 C;  1XTG B;  2L5G B;  3GHG B;  1DX7 A;  4W7Y A;  3P7K A;  2R5B A;  2FFD A;  1G2C A;  4GIF A;  3V4W A;  1HGV A;  1LWU A;  2GUS A;  2NPS A;  3KDP B;  5AW4 B;  3HE5 B;  3NFQ A;  1IO4 A;  5CHX A;  1SQP K;  1L4A B;  2XZR A;  1L4A D;  2KOG A;  2W6B A;  1HBW A;  5CMZ A;  1FZG A;  1SFC C;  3CLQ A;  3HD7 A;  3NXS A;  3EFG A;  1CSB A;  2WSC H;  1CW5 A;  2MJZ A;  2XU6 A;  1LTB C;  1A02 J;  2Z5H A;  2N1T B;  3NTN A;  4ZKU A;  2C9L Y;  3HTK B;  5APW A;  1URQ A;  1HH0 A;  2N1T D;  3M06 A;  4RES B;  1KFN A;  1DH3 A;  3V2Q A;  1NAF A;  4HYT B;  2HOD B;  4JYC A;  1RF1 A;  2HPC A;  1LTA C;  1J1D C;  3BRV B;  2BAS A;  3RK3 B;  1HJB A;  2Z5I A;  1GK4 A;  1GL2 C;  3B8E B;  3A7O A;  1GDT A;  1FAV A;  2KYV A;  1N7S C;  1KIL C;  1FBM A;  1AFO A;  1GZL A;  3M0D C;  1YTZ T;  3EQ2 A;  2YO2 A;  2POH A;  1FZC B;  5AVZ B;  2E43 A;  3SWY A;  4WY4 B;  2J58 A;  1SFC D;  2KB7 P;  1MFZ A;  2VRS A;  3RK2 B;  2H43 A;  3M9H A;  4WY4 D;  1GD2 E;  1FOS F;  4LGD E;  2WZ7 A;  2WWW A;  1LTS C;  2P67 A;  3M91 A;  2Q7C A;  1L0L K;  4JYB A;  1FU1 A;  2FFD B;  1G2C B;  1LWU B;  2NPS B;  4Y99 C;  4AQR D;  1T3J A;  5AVY B;  3IR9 A;  4GT1 A;  1NKN A;  2NPS D;  3VMY A;  3HUS A;  3M9Q A;  1YYC A;  1ZR4 A;  1T2K D;  1MV8 A;  3GHG C;  3BVH A;  1IFM A;  2HFE D;  3A5T A;  4M3L A;  1OXZ A;  2XV5 A;  4C46 A;  1ZV8 A;  1LTJ A;  5CCG C;  3HD7 B;  4IFD K;  2OYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...