2XZRA

Escherichia coli immunoglobulin-binding protein eibd 391-438 fused to gcn4 adaptors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
108
structure length
108
Chain Sequence
KQIEDKIEEILSKIYHIENEIARIKKLIGAIDGRVTRNTQSIEKNSKAIAANTRTLQQHSARLDSQQRQINENHKEMKQIEDKIEEILSKIYHIENEIARIKKLIKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IMMUNOGLOBULIN-BINDING PROTEIN EIBD
publication title The Structure of E. Coli Igg-Binding Protein D Suggests a General Model for Bending and Binding in Trimeric Autotransporter Adhesins.
pubmed doi rcsb
source organism Enterobacteria phage p-eibd
molecule tags Cell adhesion
total genus 54
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2010-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xzrA00
3HE4B 2VRSA 2W6AA 5AVWB 2R3CA 1J2JB 2QM8A 4C7NB 2KP8A 5AVQB 5AW2B 5AW3B 1A02J 4AYCA 3A3YB 5AVTB 1NWQA 3I5CA 3O8ZA 3NMDA 1T2KC 3VN0A 3P8MC 5APWA 5AW9B 3LIEA 4GKGA 5APUA 3OAKA 5AW5B 3V4QA 3VMZA 2Z5IA 1S9KD 1MUUA 1CSBA 3KDPB 3LIDA 1IO4A 2P67A 3L35A 1KQLA 1HJBA 3UIAA 1MFZA 2YNYA 3A2AA 1GU4A 2Q7CA 1H88A 5AVXB 3IR9A 3VTPC 3HE4A 2Z5HA 1FOSF 1CZQA 2P7JA 3KQGA 4JYBA 2ZXEB 3L36A 2IPPA 1SP4A 4GT1A 5AVSB 5AW0B 3TK1A 1X8YA 2JJLA 1A02F 2H7HA 1GK6A 1FAVA 3M0AA 3P32A 5AW8B 2E42A 1GZLA 3MGNA 5APXA 1GK4A 3VYIA 1GU5A 2Q3IA 5APTA 1CI6B 2XV5A 5CMZA 4C7NA 1HWTC 2WWWA 3M9BA 5AVZB 3M0DA 3V4WA 1SLQA 3B8EB 4DZOA 1OWAA 5AW7B 5APSA 2WT7B 2WTYA 1T2KD 2QM7A 1NAFA 2R5DA 3NFQA 1G2CB 5AW4B 3HTKA 5AW6B 5APQA 3M06A 4B86A 4KHXA 3NXSA 5AVRB 3TYYA 1HUCA 1YYCA 1H89A 4AQRD 1H8AA 3HE5B 3A5TA 4I2LC 2YO2A 1DH3A 4M3LA 3TNUB 2YO3A 4XE5B 5AVVB 4HYTB 2C9NY 3MD0A 5AVYB 2WPSA 1GTWA 3A7OA 3T97A 2R5BA 4JYCA 4EOTA 1MV8A 3V5BA 2XZRA 1JUNA 4LC1A 1CI6A 2Q5UA 3M91A 2WPQA 4C46A 3SWFA 5APVA 4I6MC 2C9LY 3VMYA 1GD2E 2WT7A 1HBWA 2N9BA 1FOSE 3VMXA 2WPRA 3P7KA 3M9HA 2ZFCA 2XU6A 5AVUB 2E43A 2P2UA 2R32A 3NTNA 5APYA 4AUWA 1S9KE 5AW1B 3L37A 3HE5A 1JNMA 1OXZA 2W27A 4RESB 3TNUA 2BASA
chains in the Genus database with same CATH superfamily
1SQQE 2L91A 3D70A 1SFCD 1AV1A 1NVOA 3GHGA 2QM8A 1T8ZA 1K73Q 2IFMA 3HD7C 4N78D 5CCHC 5KLVD 2A45I 2OYIA 2FBWC 4IL6X 1SQBG 1SQPE 4OH8B 3Q2YA 3LIDA 3L35A 4GODA 2JR8A 3B71A 3KXDA 1PP9G 3HUSC 1S5LX 1FOSF 1BGYD 4GT1A 1A02F 3H1HJ 4PJ0H 5TISE 1NTZG 2BCCG 3AE5C 5DJTB 5CMZA 1QVGO 4W7ZA 1NGMB 3M0DA 4XA4A 3GMAA 4RKUJ 1ZP0C 2YXQB 1FC2C 5KKZC 2QJKC 3H1LG 1RY3A 4I2LC 1BCCD 4U7JA 4H0LB 3EWKA 4D6TD 4PV1B 3A0BE 1W5CE 4GIFA 4Y99C 3E7KA 3RBZA 3RL0C 4PD4D 5E79H 1VQ7P 1FDMA 1LWUB 4OGQB 3VMXA 1Z56A 2DW3A 2P2UA 2R32A 3H6PA 1KQGB 1SFCC 4UB6H 2LR2A 1UIXA 2J5UA 3CX5I 3I55P 4HB1A 3L71J 1J2JB 3S1KA 3CCQP 2L5GB 1T2KC 1RF1C 2GUSA 5APWA 1YTZI 1LTJC 4NPFX 1KB9E 2B87B 1BE3E 3L74J 3AE7C 2P67A 2I8DA 3GF3A 2JJLA 1NKNA 5KAIE 2ZYAA 2H43A 1GW3A 1SQVG 3KZIE 3GF7A 3O6QB 1VQLP 1SQBJ 2ZVOB 3MUDA 3M9BA 1X0TA 1SLQA 4DZOA 2OGUA 4HKZH 3NFQA 5AW4B 2CK3H 2N9YB 1M56D 2B87A 2M3BA 1GL2C 2GM4A 5L8RJ 2IYOA 4OVNF 2KLUA 2K1AA 3O6QA 4NPEA 1JO5A 1FU1A 4TLFA 3P8CD 1PZQA 3AE1C 2QEXP 1LTTC 1NJIQ 2AXTE 3JCUH 3OA7A 3CX5D 1S9KE 1U7JA 4U3FE 2JEEA 1OX3A 1HGVA 1DEEG 2KSEA 1RQVA 2KP8A 1BCCG 5AW2B 1NTMK 2O01N 2WSEH 4YXDC 1EZVE 2MJZA 3II6A 4GKGA 4JQ0D 1KILD 3KDPB 2YIUC 1MFZA 2M0BA 3F5HA 3RK3D 1T3UA 3M0AA 1RE3C 3H1HE 5APXA 3V4WA 1PGPA 2A45G 3W68A 1M7LA 3ABVC 2K88A 2IYPA 1XTGB 2XNXA 3SFEC 1YJNP 4BWNA 2J58A 1NU1E 1GTWA 1JY2P 1YI2P 4LLHA 4I7ZC 2W83C 3FGAD 2Q5UA 4H44B 3L73E 2KZIA 5KLVJ 2O01H 3L75D 3WU2E 3CD6P 2O1KA 3U1AA 2NRGA 2IBZD 2I1KA 1FZCC 3CCJP 2JP3A 1L0LK 1NTMD 3SFDC 4EYYQ 1HH0A 1RF0C 2V7QH 1BGYJ 1RH5B 1YQ4C 2OQQA 3QH9A 1VQ9P 3CCEP 1URQD 3I5CA 2V4HA 3R2PA 3AEFC 3P8MC 1KILC 5CBNA 3VMZA 2UWJE 1FE6A 3L74E 2KI7B 1CZQA 4JYBA 1RE4C 4D6TJ 1SP4A 5AVSB 3CI9A 2OARA 2OYHB 1X79B 2BEZF 2ITAA 1L0NK 1SQBE 1S2EA 2KIKA 1OW8A 1FDIA 2M5AB 3KPEA 1EXJA 1PP9E 2ZXXA 3V2PA 5APQA 3PRJA 4BRYA 1LT9B 3TYYA 3RBXA 1NTZE 4AQRD 2HODB 1USDA 1HVVA 2OTLP 4EOTA 3CXHI 1OMIA 4HJGH 1AVYA 4YXWH 1KN7A 3H1LE 2KSJA 2M5AA 2KNCA 1J1DB 1R8EA 2PRRA 3Q5RA 5B66E 1LT9A 1MKMA 3MHVA 2HODA 1JNMA 3S4RA 2W27A 2D2CB 3BRVB 3B5ND 4DCKA 3E1RA 1DX7A 2VRSA 2W6AA 4MN4C 1BSNA 3A0HE 4C7NB 1IK9A 1FZEA 1M8OB 4R4MA 3TSIA 2BCCD 2OTJP 1YBKA 3OAKA 1L0ND 3V4QA 3BCCD 1L4AB 2W6BA 4DOJA 3L75G 3SWYA 1W2BO 1JCCA 1H88A 3AE4C 4H0LD 3IR9A 2Z5HA 2LXCB 3KYQA 3GHGC 1JEKA 4PV1D 1NTMG 4L75A 5TISH 4C7NA 1CI6B 4WBAA 5KLIB 3HD7D 3HTKB 5GTHH 1VQKP 1VF5B 3RK2B 4OGQD 1N73A 3CWBD 5AVRB 1SQVE 1Q86Q 3CXHD 3CLQA 3EQ2A 1NKZB 3Q1MA 2C9NY 2E76B 3A7OA 2Q6QA 1IFIA 3C8VA 3A0BH 3LW5J 2Y9ZA 2WZ7A 1CI6A 3CPWO 3SWFA 4N78E 2C9LY 1FDOA 5KLVE 1FOSE 5CCGA 2ZYGA 3NTNA 1SQXK 3AEAC 3L70D 4Y28J 3BASA 4H13B 3TGUD 3HE4B 2NPSA 1XTCC 1K04A 1AVOA 1P84I 2OYIB 2HPCA 1JTHA 5AVQB 1M90Q 3RL0D 2Y0CA 1GMJA 2KB7P 1L0LG 4U3FJ 3PJSK 1SQQK 1LJ2A 4H0LC 1IO4A 3UIAA 1HF9A 1BCCE 4PV1C 3HE4A 1OW7A 3CC7P 3F89A 4D6TE 4OWFA 3IFMA 5AW8B 1IJDB 5KAIH 2Q3IA 2FFDB 3KZIH 1LWUC 2WSSH 4OGQC 4PD4E 1LP1B 1T2KD 2E75B 1NAFA 1SQPK 3CC2P 2KK7A 2ZVNB 3M06A 3PH0A 1NTMJ 2QJYB 4K3AA 4WY4B 1SQXD 2GA1A 4GOFA 1IFPA 1L0NG 1S4XA 3BCCG 3H1IG 3WUTA 2FFDA 4C46A 4GDOA 1YTZT 1JMMA 5KJ7A 1YITP 1PGJA 1LP1A 2KUBA 3V6IA 2E5TA 2WSFH 3L4FA 1NU1J 2B9BA 2AXTH 1OVVA 2YKOA 1GL2D 3E1IA 1ZR4A 4WY4A 1P84D 2ZJSE 3L73J 1LNQA 2JO1A 2H88C 3CWBG 5CJ0A 1IFMA 1LTBC 3H1KG 3BVHA 1N7SB 3PLNA 4KJMA 1LTIC 2WITA 3A3YB 1SS1A 1VQOP 4L76A 1AQTA 3OJAB 2YNYA 3A2AA 1GU4A 1FZGA 1IK7A 2ZXEB 3L36A 1PFIA 1X8YA 3T97B 1FJPA 1FAVA 1PL5A 1DD4A 3L70G 2Q1KA 2Q3EA 1E79H 3P8CE 1N7SA 4GOEA 5AVZB 2E74B 3TGUG 1KFMA 3MP7B 4HH2A 3AE6C 4ZKUA 3CL3D 5CHXA 1HUCA 3CX5E 3N4XA 4IFFA 3R4YA 1NAYA 2WPSA 3T97A 2Y0EA 1QVFO 1AA0A 2KYVA 1RQUA 3M91A 1PP9J 5B5EE 3MTUE 2IFNA 1JOCA 1NTZJ 2BCCJ 2N9BA 3WU2H 1JY2O 1QX8A 2XU6A 3BCCJ 1KILE 1HJ0A 3I56P 1M1JB 1K05A 3WUVA 2W8ZA 3MZWB 3WUUA 1EC5A 3RK3E 3H1LJ 3PHLA 2YKQA 3ITKA 1ZRTD 1R5LA 4JPZB 1EDJA 3AECC 2FY8A 1NTKK 3GG2A 1SQXG 3CWBJ 1KMIZ 1M1JA 1G1JA 1HJBA 1VQ4P 2Q7CA 3CCUP 2IPPA 4H44C 1SFCA 4WVZA 2IX7C 2Q9IA 3M9QA 3L75E 1D7MA 2QM7A 3JSVC 1Q7YQ 3V2RA 2IBZE 1SQQG 3CMEP 2QE7H 4ZMDA 4RO0A 1NTME 3H25A 3AEGC 2YO2A 1NYHA 2D2CD 3TNUB 3TGUJ 4UB6E 4L74A 3MD0A 1YHQP 5AVYB 2HLOA 1EDIA 1MZ9A 2QJPB 1SQPG 1USEA 1ZOYC 1OFCX 1SQVJ 3P7KA 2QA4P 2ZFCA 1M57D 5B66H 3SSUA 2A06D 1L4AD 2WVRA 3TNUA 4N3YB 2OYHC 1NTKD 2QVAA 2RMZA 2AXCA 5BU8B 3A0HH 5AW3B 3IN6A 1A02J 3O8ZA 3NMDA 3RK2D 1LT9C 2HR3A 1JM0A 1H0TB 3D71A 2N1TB 5APUA 1ZN5A 3VOPA 1AQ5A 3Q3DA 2ZYDA 2POHA 5K5GB 2E76D 1GK6A 1S72P 1L0LE 3VYIA 2FYUK 4I1LA 1J1DC 2HG5D 4BRYB 1H0TA 2FXMA 1AFOA 2R3SA 2N1TA 1WRGA 1BCCJ 2D2CC 3VP9A 2K9JA 1HTLC 1Q81Q 3HE5B 2K37A 2QRXA 3JCUE 3K5BA 4H13D 5AVVB 1X22A 1IFNA 3CCVP 5EFWB 3C1LA 2KNCB 1W2EA 5APVA 1BE3G 1RE3A 2AEJA 2BCCE 1L4AC 2RH0A 1VQMP 3V2NA 1L0NE 5APYA 2AEMA 3BCCE 3L37A 3HE5A 4XFJA 2Y0DA 1L0LD 2OYOA 2R3CA 5KLIC 1BDDA 2WSCJ 1VF5C 2JWDA 3CCLP 3RK2C 3L71D 2FYNB 5CCGC 5BU5A 1KYOH 2YMYA 5AW9B 3CCMP 3LIEA 4TT3H 2FYUD 1JY3N 3CWBE 1KQSO 1YIJP 1CSBA 2J59M 2E76C 5DJUB 5KAFE 3CXHE 1U7MA 3VTPC 1FZCA 3TDKA 2QIWA 3P32A 4NPDA 1VQ8P 2A06G 3RK3B 1NTKG 1N73B 5APSA 2JKVA 3H1ID 4YTPC 1LT1A 3VMAA 1PPJD 3FXDA 1IC2A 3U59A 3NXSA 4H13C 3L70E 1YYCA 2ZAEB 3OW2O 4WB4A 4XE5B 3TGUE 4HYTB 2BEQD 3L72D 2OYIC 2XZRA 2XKMA 1ZV8A 1BDCA 1QLED 1N7SD 1N2DC 4EIJA 1DEBA 1KQFB 1LTAC 3H1KD 2E43A 2NPSB 1OXZA 3D6YA 2O1JA 2YMKA 3M0DC 2FFDC 2HPCB 1JTHB 1YQ3C 2WMMA 5KLVK 3Q5PA 5KJ7C 2XNDH 2E75C 2YKPA 1NWQA 3KHUA 1URQB 2QJYC 4R4LA 1QL2A 1QEXA 1K9MQ 1PGOA 4WY4C 3H1JD 3AE3C 1KQLA 2M8RA 2PGDA 4O9BA 1KYOI 1WMKA 2KS1B 2FYZA 3KQGA 2FXOA 3S9OA 3FX0A 1RHZB 2E42A 1SQXE 1NHLA 2XV5A 1ZW0A 5H2FE 3B4SA 4RJTA 5AW7B 1URQA 1G2CB 1KB9H 3G9RA 1KZUB 5KTBA 2JWAA 1FS0E 3D6ZA 4KHXA 3IF4A 2KOGA 3L71G 3CX5H 1OIPA 2KS1A 4IL6E 1P84E 2QSIA 2FYUG 1N7SC 3BRTB 1S5LE 4IFDK 3L75J 3LW5H 5B5EH 3RL0g 3L74G 1G2CA 3FWNA 1Q2NA 4IOIH 3MUDC 1QL1A 4QMAA 3H32B 1PPJG 1OVRA 4UB8E 5AVWB 3B5NB 1DIPA 1HGZA 2E74C 2CPBA 5GTIE 4AYCA 1YJWP 1L2PA 3L72G 2ZT9B 5GTHE 1J1EB 3G4SP 3ZDMA 1KYOD 1LTGC 1JB0J 1SQQD 2CPSA 3H32A 4C7RA 1K8AQ 3B5NA 2W90A 1GZLA 2LKMA 4W7YA 1T3JA 2P10A 2KXPB 3AEDC 2R5DA 1OW6A 3HD7B 4L73A 3RGUA 5AW6B 3G71P 1M1JC 4B86A 1SQPD 1VDFA 1H8AA 3EFGA 1L0LJ 4WWIA 2YO3A 2OTKE 2XDJA 1KB9I 4H44D 3HUSB 2FKWB 1MV8A 3H1JG 4DT0A 1ZRTE 2H8PD 1N7LA 1Y8AA 2NZ2A 3HD7A 5CCHA 1VL2A 3WMM0 2FYUJ 1LWUA 2N1TD 2WPVB 1ZR2A 1NH4A 1OVUA 1EXIA 5KKZB 2QJKB 1MFTA 2P1JA 1YJ9P 1EQ7A 3HUSA 2IZ0A 1N86A 2IZ1A 1Y47A 2B88A 2WSEJ 1ZXGA 5AVTB 4Y99B 1L0NJ 3H1IJ 3RL0B 2RKLA 2PP6A 2Z5IA 1IFDA 1S3JA 1BSHA 1PGQA 4EDFA 1SFCB 5KLVG 3L72J 2QJPC 4PJ0E 2B89A 1GK4A 3QWOC 1JY2N 2RN0A 1WT6A 3H1KJ 3AE9C 3FXEA 1X9VA 1BGYG 1RF1B 2PAJA 1KB9D 1BE3D 2A06E 1EZVI 1LTJB 1DH3A 1NTKE 1KD1Q 2IBZI 3BATA 1Q90D 3VP8A 2E5YA 2O01J 3CC4P 5E79E 4EI2A 2R44A 2N1TC 2H89C 3L70J 4ASWA 5CJ4A 1RF1A 4DJGA 4D6TG 3Q5SA 3H1JJ 4AUWA 1N8RQ 1LTJA 2V7QJ 5M1BA 1CW5A 1Y9BA 2HFED 1DD3A 1GL2B 1KFNA 3GW6A 3C9IA 2GUVA 3USSA 1IZNB 2M3EA 3AEEC 1TU3F 1NU1K 1NO4A 3TF5A 1S9KD 4ZNCA 1LGHB 4U3FD 2Z4EA 5KAFH 3CXHH 2G8YA 2H7HA 1GL2A 3TK1A 2Y9YA 2C0WA 3MGNA 2P58A 1R5SA 1VF5D 5APTA 1KV4A 3AE2C 2WQYC 5CCGD 2WTYA 1EZVD 2MKVA 5BVZA 2K9JB 3PTZA 2W6JH 2NPSD 1JCDA 1SQXJ 2O3JA 2IDBA 4M3LA 5CBOA 3N7NA 1U57A 3IAOA 2YXRB 2YIUB 2FXPA 2R5BA 3H1HD 1JUNA 1M1KQ 2C0XA 2FYNC 2WPQA 4CPGA 4N6JA 3PP5A 3L71E 1GD2E 1Q82Q 2WPRA 5AVUB 2FYUE 5AW1B 2PFXA 1SQBK 3EFFK 4RESB 1SQQJ 1NU1D 2KLVA 2LXBA 3RK3C 3CCSP 3AEBC 1VQPP 1KC8Q 1N73C 3L73D 4I7ZB 1NTZK 5TJHA 1UIIA 5C39A 3H1IE 3VN0A 3MIWA 1PPJE 1SQPJ 1FZCB 1FBMA 1S1CX 1E5WA 1AJYA 1VPCA 2HYNA 2P7JA 3W67A 1NOHA 1EDKA 3L72E 2K9YA 2G3AA 1SVFA 1JY3O 5KJ7D 2E75D 2OYHA 2WWWA 4LGDE 1OWAA 5H2FH 2WT7B 3GLMA 1EDLA 3H1KE 2NPSC 3FWLA 4WY4D 1KILB 3L74D 4Z1MH 3A5TA 1FZBA 1T6AA 4IL6H 1P84H 1RF0A 1JMBA 3V5BA 1ZMEC 1GW4A 2SPZA 4LC1A 4BXLA 4PD4H 1S5LH 1SQBD 1VQ6P 4U3FG 1PIXA 3VMYA 1URQC 3G3ZA 2WT7A 2ZT9D 1PP9D 1VQ5P 3AE8C 3U1CA 3M9HA 4K35A 1KILA 3CMAP 1NTZD 3H1JE 1QGKB 3SWKA 4JF7A 1G1IA 1EZVG 2A45H 4A7PA 2I1JA 1RE4A 1FJKA 4UB8H 2IBZG 2KZJA 1GDTA 1SQVK 3H1LD 2WSCH 5GTIH 4ASVA 5CCHD 3G6EP 3H1HG 1IFJA 2AEFA 1VQNP 1BE3J 5AW5B 1OZHA 1MUUA 4W80A 2K3RA 5AVXB 3CCRP 1L4AA 4JBZA 5AW0B 2E74D 1GU5A 1FZFA 3V2QA 1HWTC 1KORA 1NU1G 3HRNA 2QG4A 3B8EB 1JY3P 2JDIH 1ZLLA 1LTSC 3HTKA 3L73G 1H89A 1FZAA 4YPCA 3B5NC 3JC22 4JYCA 3GHGB 4KT0J 1BGYE 1KTMA 2ZT9C 4I6MC 1J1EC 2WSFJ 1HBWA 4ZKPA 4IFMA 1PV3A 1KYOE 4PD4I 1NTKJ 1SQVD 2BASA
chains in the Genus database with same CATH topology
1SFCD 1DX7A 2VRSA 1EQ7A 3HUSA 2W6AA 1N86A 3GHGA 5BU8B 2QM8A 1T8ZA 4C7NB 1IK9A 2IFMA 3HD7C 4N78D 1FZEA 5AW3B 2A45I 5CCHC 1A02J 5AVTB 4Y99B 2OYIA 3O8ZA 3TSIA 3NMDA 3RK2D 1LT9C 3RL0B 2N1TB 2PP6A 5APUA 3OAKA 1ZN5A 3V4QA 3VOPA 2Z5IA 1IFDA 1L4AB 4OH8B 3LIDA 3L35A 1AQ5A 2W6BA 4DOJA 3SWYA 1H88A 1JCCA 3HUSC 3IR9A 2POHA 2Z5HA 1FOSF 1SFCB 3KYQA 3GHGC 4GT1A 1A02F 1GK6A 1GK4A 3VYIA 2FYUK 4I1LA 1J1DC 1CI6B 5CMZA 4C7NA 4W7ZA 4WBAA 1JY2N 3HD7D 3M0DA 2HG5D 4XA4A 3HTKB 1WT6A 3RK2B 2FXMA 1AFOA 2N1TA 1N73A 1WRGA 1X9VA 1RF1B 2PAJA 5AVRB 3VP9A 1HTLC 1RY3A 3HE5B 1LTJB 4I2LC 1DH3A 3CLQA 3EQ2A 1NKZB 5AVVB 2C9NY 3A7OA 3BATA 1IFNA 1IFIA 4GIFA 2WZ7A 1CI6A 4Y99C 3VP8A 1W2EA 3SWFA 5APVA 4N78E 2C9LY 3RL0C 1FDMA 1LWUB 2N1TC 1RE3A 1FOSE 3VMXA 1Z56A 5CCGA 5CJ4A 1L4AC 2P2UA 2R32A 3H6PA 3NTNA 1SQXK 1RF1A 3V2NA 5APYA 4AUWA 3L37A 3BASA 3HE5A 1LTJA 1SFCC 1CW5A 3HE4B 2NPSA 2HFED 1XTCC 1GL2B 1KFNA 2R3CA 1J2JB 2OYIB 2HPCA 1JTHA 3C9IA 2GUVA 5AVQB 3RK2C 3RL0D 5CCGC 2L5GB 1T2KC 5BU5A 1NU1K 1RF1C 2YMYA 1NO4A 2GUSA 2KB7P 5APWA 5AW9B 3LIEA 1YTZI 1JY3N 1LTJC 1S9KD 1SQQK 1CSBA 2J59M 1IO4A 1LGHB 2P67A 3UIAA 2Z4EA 3VTPC 3HE4A 1FZCA 2H7HA 1GL2A 2JJLA 1NKNA 3TK1A 3P32A 3IFMA 5AW8B 2H43A 1IJDB 1GW3A 2C0WA 3MGNA 2Q3IA 2FFDB 3RK3B 5APTA 1LWUC 3MUDA 3M9BA 1SLQA 1N73B 4DZOA 5CCGD 1T2KD 5APSA 2WTYA 1NAFA 3NFQA 1SQPK 5AW4B 5BVZA 3M06A 1IC2A 3U59A 3NXSA 1YYCA 2M3BA 2NPSD 1JCDA 4M3LA 1GL2C 4WB4A 3N7NA 4WY4B 4XE5B 4HYTB 2GM4A 2OYIC 2R5BA 2XZRA 1JO5A 1JUNA 1FU1A 2FFDA 2C0XA 2XKMA 3P8CD 1ZV8A 2WPQA 4N6JA 1YTZT 4C46A 1JMMA 3PP5A 1N7SD 5KJ7A 1N2DC 1GD2E 4EIJA 1DEBA 1LTTC 1LTAC 2WPRA 2WSFH 3L4FA 5AVUB 2E43A 3OA7A 1S9KE 5AW1B 2NPSB 1SQBK 2YKOA 1OXZA 4RESB 1GL2D 3E1IA 1ZR4A 4WY4A 2O1JA 3M0DC 2JEEA 2KLVA 2FFDC 3RK3C 5CJ0A 2HPCB 1JTHB 1HGVA 1IFMA 1LTBC 5KLVK 5KJ7C 1N73C 2KP8A 3BVHA 1N7SB 5AW2B 1NTMK 1LTIC 1NTZK 2WITA 2YKPA 2WSEH 3A3YB 1NWQA 2MJZA 1URQB 3VN0A 3II6A 3MIWA 1QL2A 4GKGA 1KILD 3KDPB 4WY4C 1FZCB 3OJAB 1FBMA 1KQLA 1E5WA 1VPCA 2M8RA 1MFZA 2YNYA 3A2AA 4O9BA 1GU4A 2HYNA 1FZGA 2FYZA 2P7JA 3KQGA 2ZXEB 3L36A 1NOHA 1T3UA 3RK3D 1PFIA 1X8YA 1FJPA 1FAVA 3M0AA 1RE3C 2E42A 1SVFA 1JY3O 1NHLA 5KJ7D 5APXA 2XV5A 3P8CE 2OYHA 1N7SA 2WWWA 5AVZB 1KFMA 3V4WA 4LGDE 1OWAA 5AW7B 2WT7B 2A45G 1URQA 1G2CB 4HH2A 1M7LA 1KZUB 2NPSC 4ZKUA 5KTBA 3CL3D 4KHXA 5CHXA 4WY4D 1KILB 1HUCA 1XTGB 2KOGA 2XNXA 3N4XA 3A5TA 4IFFA 2J58A 1FZBA 2WPSA 1GTWA 3T97A 1RF0A 1JY2P 4LLHA 1N7SC 3V5BA 3BRTB 1GW4A 4LC1A 4IFDK 2KYVA 2Q5UA 3M91A 3LW5H 3MTUE 3VMYA 1URQC 2O01H 3G3ZA 2IFNA 1JOCA 2WT7A 2O1KA 3U1AA 1G2CA 2N9BA 2I1KA 1JY2O 3U1CA 3M9HA 1FZCC 2XU6A 1KILA 1L0LK 1HH0A 1M1JB 4JF7A 1G1IA 1RF0C 1QL1A 2A45H 3H32B 5AVWB 3B5NB 2YKQA 2I1JA 1RE4A 1FJKA 1HGZA 2CPBA 1GDTA 1SQVK 2WSCH 1URQD 4AYCA 3I5CA 3R2PA 1NTKK 5CCHD 3P8MC 1J1EB 1IFJA 1KILC 5AW5B 3VMZA 1MUUA 1M1JA 1G1JA 1HJBA 4W80A 2Q7CA 1LTGC 5AVXB 1L4AA 1CZQA 4JYBA 1RE4C 2CPSA 3H32A 2IPPA 1SP4A 5AW0B 5AVSB 4C7RA 3CI9A 2OARA 3B5NA 2OYHB 1GZLA 1X79B 1SFCA 2IX7C 1GU5A 1FZFA 3V2QA 1L0NK 1HWTC 2LKMA 2Q9IA 4W7YA 3HRNA 1T3JA 3M9QA 3KPEA 3B8EB 1JY3P 2QM7A 2R5DA 3HD7B 1ZLLA 3V2PA 3V2RA 1LTSC 3HTKA 5AW6B 5APQA 1M1JC 4B86A 1LT9B 3TYYA 1H89A 1VDFA 4AQRD 1H8AA 1FZAA 3EFGA 2HODB 2YO2A 3TNUB 3B5NC 2YO3A 4N3YB 3MD0A 2XDJA 5AVYB 1HVVA 3HUSB 4JYCA 4EOTA 2FKWB 1MV8A 2HLOA 1MZ9A 3GHGB 2H8PD 4I6MC 1N7LA 2KSJA 1J1DB 1J1EC 3HD7A 5CCHA 1HBWA 4ZKPA 4IFMA 3WMM0 3P7KA 1LWUA 2N1TD 2ZFCA 1LT9A 1ZR2A 1NH4A 1L4AD 2HODA 1JNMA 2W27A 3TNUA 2BASA 2P1JA 3BRVB 3B5ND 2OYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HE4 B;  2VRS A;  2W6A A;  5AVW B;  2R3C A;  1J2J B;  2QM8 A;  4C7N B;  2KP8 A;  5AVQ B;  5AW2 B;  5AW3 B;  1A02 J;  4AYC A;  3A3Y B;  5AVT B;  1NWQ A;  3I5C A;  3O8Z A;  3NMD A;  1T2K C;  3VN0 A;  3P8M C;  5APW A;  5AW9 B;  3LIE A;  4GKG A;  5APU A;  3OAK A;  5AW5 B;  3V4Q A;  3VMZ A;  2Z5I A;  1S9K D;  1MUU A;  1CSB A;  3KDP B;  3LID A;  1IO4 A;  2P67 A;  3L35 A;  1KQL A;  1HJB A;  3UIA A;  1MFZ A;  2YNY A;  3A2A A;  1GU4 A;  2Q7C A;  1H88 A;  5AVX B;  3IR9 A;  3VTP C;  3HE4 A;  2Z5H A;  1FOS F;  1CZQ A;  2P7J A;  3KQG A;  4JYB A;  2ZXE B;  3L36 A;  2IPP A;  1SP4 A;  4GT1 A;  5AVS B;  5AW0 B;  3TK1 A;  1X8Y A;  2JJL A;  1A02 F;  2H7H A;  1GK6 A;  1FAV A;  3M0A A;  3P32 A;  5AW8 B;  2E42 A;  1GZL A;  3MGN A;  5APX A;  1GK4 A;  3VYI A;  1GU5 A;  2Q3I A;  5APT A;  1CI6 B;  2XV5 A;  5CMZ A;  4C7N A;  1HWT C;  2WWW A;  3M9B A;  5AVZ B;  3M0D A;  3V4W A;  1SLQ A;  3B8E B;  4DZO A;  1OWA A;  5AW7 B;  5APS A;  2WT7 B;  2WTY A;  1T2K D;  2QM7 A;  1NAF A;  2R5D A;  3NFQ A;  1G2C B;  5AW4 B;  3HTK A;  5AW6 B;  5APQ A;  3M06 A;  4B86 A;  4KHX A;  3NXS A;  5AVR B;  3TYY A;  1HUC A;  1YYC A;  1H89 A;  4AQR D;  1H8A A;  3HE5 B;  3A5T A;  4I2L C;  2YO2 A;  1DH3 A;  4M3L A;  3TNU B;  2YO3 A;  4XE5 B;  5AVV B;  4HYT B;  2C9N Y;  3MD0 A;  5AVY B;  2WPS A;  1GTW A;  3A7O A;  3T97 A;  2R5B A;  4JYC A;  4EOT A;  1MV8 A;  3V5B A;  2XZR A;  1JUN A;  4LC1 A;  1CI6 A;  2Q5U A;  3M91 A;  2WPQ A;  4C46 A;  3SWF A;  5APV A;  4I6M C;  2C9L Y;  3VMY A;  1GD2 E;  2WT7 A;  1HBW A;  2N9B A;  1FOS E;  3VMX A;  2WPR A;  3P7K A;  3M9H A;  2ZFC A;  2XU6 A;  5AVU B;  2E43 A;  2P2U A;  2R32 A;  3NTN A;  5APY A;  4AUW A;  1S9K E;  5AW1 B;  3L37 A;  3HE5 A;  1JNM A;  1OXZ A;  2W27 A;  4RES B;  3TNU A;  2BAS A; 
#chains in the Genus database with same CATH topology
 1SQQ E;  2L91 A;  3D70 A;  1SFC D;  1AV1 A;  1NVO A;  3GHG A;  2QM8 A;  1T8Z A;  1K73 Q;  2IFM A;  3HD7 C;  4N78 D;  5CCH C;  5KLV D;  2A45 I;  2OYI A;  2FBW C;  4IL6 X;  1SQB G;  1SQP E;  4OH8 B;  3Q2Y A;  3LID A;  3L35 A;  4GOD A;  2JR8 A;  3B71 A;  3KXD A;  1PP9 G;  3HUS C;  1S5L X;  1FOS F;  1BGY D;  4GT1 A;  1A02 F;  3H1H J;  4PJ0 H;  5TIS E;  1NTZ G;  2BCC G;  3AE5 C;  5DJT B;  5CMZ A;  1QVG O;  4W7Z A;  1NGM B;  3M0D A;  4XA4 A;  3GMA A;  4RKU J;  1ZP0 C;  2YXQ B;  1FC2 C;  5KKZ C;  2QJK C;  3H1L G;  1RY3 A;  4I2L C;  1BCC D;  4U7J A;  4H0L B;  3EWK A;  4D6T D;  4PV1 B;  3A0B E;  1W5C E;  4GIF A;  4Y99 C;  3E7K A;  3RBZ A;  3RL0 C;  4PD4 D;  5E79 H;  1VQ7 P;  1FDM A;  1LWU B;  4OGQ B;  3VMX A;  1Z56 A;  2DW3 A;  2P2U A;  2R32 A;  3H6P A;  1KQG B;  1SFC C;  4UB6 H;  2LR2 A;  1UIX A;  2J5U A;  3CX5 I;  3I55 P;  4HB1 A;  3L71 J;  1J2J B;  3S1K A;  3CCQ P;  2L5G B;  1T2K C;  1RF1 C;  2GUS A;  5APW A;  1YTZ I;  1LTJ C;  4NPF X;  1KB9 E;  2B87 B;  1BE3 E;  3L74 J;  3AE7 C;  2P67 A;  2I8D A;  3GF3 A;  2JJL A;  1NKN A;  5KAI E;  2ZYA A;  2H43 A;  1GW3 A;  1SQV G;  3KZI E;  3GF7 A;  3O6Q B;  1VQL P;  1SQB J;  2ZVO B;  3MUD A;  3M9B A;  1X0T A;  1SLQ A;  4DZO A;  2OGU A;  4HKZ H;  3NFQ A;  5AW4 B;  2CK3 H;  2N9Y B;  1M56 D;  2B87 A;  2M3B A;  1GL2 C;  2GM4 A;  5L8R J;  2IYO A;  4OVN F;  2KLU A;  2K1A A;  3O6Q A;  4NPE A;  1JO5 A;  1FU1 A;  4TLF A;  3P8C D;  1PZQ A;  3AE1 C;  2QEX P;  1LTT C;  1NJI Q;  2AXT E;  3JCU H;  3OA7 A;  3CX5 D;  1S9K E;  1U7J A;  4U3F E;  2JEE A;  1OX3 A;  1HGV A;  1DEE G;  2KSE A;  1RQV A;  2KP8 A;  1BCC G;  5AW2 B;  1NTM K;  2O01 N;  2WSE H;  4YXD C;  1EZV E;  2MJZ A;  3II6 A;  4GKG A;  4JQ0 D;  1KIL D;  3KDP B;  2YIU C;  1MFZ A;  2M0B A;  3F5H A;  3RK3 D;  1T3U A;  3M0A A;  1RE3 C;  3H1H E;  5APX A;  3V4W A;  1PGP A;  2A45 G;  3W68 A;  1M7L A;  3ABV C;  2K88 A;  2IYP A;  1XTG B;  2XNX A;  3SFE C;  1YJN P;  4BWN A;  2J58 A;  1NU1 E;  1GTW A;  1JY2 P;  1YI2 P;  4LLH A;  4I7Z C;  2W83 C;  3FGA D;  2Q5U A;  4H44 B;  3L73 E;  2KZI A;  5KLV J;  2O01 H;  3L75 D;  3WU2 E;  3CD6 P;  2O1K A;  3U1A A;  2NRG A;  2IBZ D;  2I1K A;  1FZC C;  3CCJ P;  2JP3 A;  1L0L K;  1NTM D;  3SFD C;  4EYY Q;  1HH0 A;  1RF0 C;  2V7Q H;  1BGY J;  1RH5 B;  1YQ4 C;  2OQQ A;  3QH9 A;  1VQ9 P;  3CCE P;  1URQ D;  3I5C A;  2V4H A;  3R2P A;  3AEF C;  3P8M C;  1KIL C;  5CBN A;  3VMZ A;  2UWJ E;  1FE6 A;  3L74 E;  2KI7 B;  1CZQ A;  4JYB A;  1RE4 C;  4D6T J;  1SP4 A;  5AVS B;  3CI9 A;  2OAR A;  2OYH B;  1X79 B;  2BEZ F;  2ITA A;  1L0N K;  1SQB E;  1S2E A;  2KIK A;  1OW8 A;  1FDI A;  2M5A B;  3KPE A;  1EXJ A;  1PP9 E;  2ZXX A;  3V2P A;  5APQ A;  3PRJ A;  4BRY A;  1LT9 B;  3TYY A;  3RBX A;  1NTZ E;  4AQR D;  2HOD B;  1USD A;  1HVV A;  2OTL P;  4EOT A;  3CXH I;  1OMI A;  4HJG H;  1AVY A;  4YXW H;  1KN7 A;  3H1L E;  2KSJ A;  2M5A A;  2KNC A;  1J1D B;  1R8E A;  2PRR A;  3Q5R A;  5B66 E;  1LT9 A;  1MKM A;  3MHV A;  2HOD A;  1JNM A;  3S4R A;  2W27 A;  2D2C B;  3BRV B;  3B5N D;  4DCK A;  3E1R A;  1DX7 A;  2VRS A;  2W6A A;  4MN4 C;  1BSN A;  3A0H E;  4C7N B;  1IK9 A;  1FZE A;  1M8O B;  4R4M A;  3TSI A;  2BCC D;  2OTJ P;  1YBK A;  3OAK A;  1L0N D;  3V4Q A;  3BCC D;  1L4A B;  2W6B A;  4DOJ A;  3L75 G;  3SWY A;  1W2B O;  1JCC A;  1H88 A;  3AE4 C;  4H0L D;  3IR9 A;  2Z5H A;  2LXC B;  3KYQ A;  3GHG C;  1JEK A;  4PV1 D;  1NTM G;  4L75 A;  5TIS H;  4C7N A;  1CI6 B;  4WBA A;  5KLI B;  3HD7 D;  3HTK B;  5GTH H;  1VQK P;  1VF5 B;  3RK2 B;  4OGQ D;  1N73 A;  3CWB D;  5AVR B;  1SQV E;  1Q86 Q;  3CXH D;  3CLQ A;  3EQ2 A;  1NKZ B;  3Q1M A;  2C9N Y;  2E76 B;  3A7O A;  2Q6Q A;  1IFI A;  3C8V A;  3A0B H;  3LW5 J;  2Y9Z A;  2WZ7 A;  1CI6 A;  3CPW O;  3SWF A;  4N78 E;  2C9L Y;  1FDO A;  5KLV E;  1FOS E;  5CCG A;  2ZYG A;  3NTN A;  1SQX K;  3AEA C;  3L70 D;  4Y28 J;  3BAS A;  4H13 B;  3TGU D;  3HE4 B;  2NPS A;  1XTC C;  1K04 A;  1AVO A;  1P84 I;  2OYI B;  2HPC A;  1JTH A;  5AVQ B;  1M90 Q;  3RL0 D;  2Y0C A;  1GMJ A;  2KB7 P;  1L0L G;  4U3F J;  3PJS K;  1SQQ K;  1LJ2 A;  4H0L C;  1IO4 A;  3UIA A;  1HF9 A;  1BCC E;  4PV1 C;  3HE4 A;  1OW7 A;  3CC7 P;  3F89 A;  4D6T E;  4OWF A;  3IFM A;  5AW8 B;  1IJD B;  5KAI H;  2Q3I A;  2FFD B;  3KZI H;  1LWU C;  2WSS H;  4OGQ C;  4PD4 E;  1LP1 B;  1T2K D;  2E75 B;  1NAF A;  1SQP K;  3CC2 P;  2KK7 A;  2ZVN B;  3M06 A;  3PH0 A;  1NTM J;  2QJY B;  4K3A A;  4WY4 B;  1SQX D;  2GA1 A;  4GOF A;  1IFP A;  1L0N G;  1S4X A;  3BCC G;  3H1I G;  3WUT A;  2FFD A;  4C46 A;  4GDO A;  1YTZ T;  1JMM A;  5KJ7 A;  1YIT P;  1PGJ A;  1LP1 A;  2KUB A;  3V6I A;  2E5T A;  2WSF H;  3L4F A;  1NU1 J;  2B9B A;  2AXT H;  1OVV A;  2YKO A;  1GL2 D;  3E1I A;  1ZR4 A;  4WY4 A;  1P84 D;  2ZJS E;  3L73 J;  1LNQ A;  2JO1 A;  2H88 C;  3CWB G;  5CJ0 A;  1IFM A;  1LTB C;  3H1K G;  3BVH A;  1N7S B;  3PLN A;  4KJM A;  1LTI C;  2WIT A;  3A3Y B;  1SS1 A;  1VQO P;  4L76 A;  1AQT A;  3OJA B;  2YNY A;  3A2A A;  1GU4 A;  1FZG A;  1IK7 A;  2ZXE B;  3L36 A;  1PFI A;  1X8Y A;  3T97 B;  1FJP A;  1FAV A;  1PL5 A;  1DD4 A;  3L70 G;  2Q1K A;  2Q3E A;  1E79 H;  3P8C E;  1N7S A;  4GOE A;  5AVZ B;  2E74 B;  3TGU G;  1KFM A;  3MP7 B;  4HH2 A;  3AE6 C;  4ZKU A;  3CL3 D;  5CHX A;  1HUC A;  3CX5 E;  3N4X A;  4IFF A;  3R4Y A;  1NAY A;  2WPS A;  3T97 A;  2Y0E A;  1QVF O;  1AA0 A;  2KYV A;  1RQU A;  3M91 A;  1PP9 J;  5B5E E;  3MTU E;  2IFN A;  1JOC A;  1NTZ J;  2BCC J;  2N9B A;  3WU2 H;  1JY2 O;  1QX8 A;  2XU6 A;  3BCC J;  1KIL E;  1HJ0 A;  3I56 P;  1M1J B;  1K05 A;  3WUV A;  2W8Z A;  3MZW B;  3WUU A;  1EC5 A;  3RK3 E;  3H1L J;  3PHL A;  2YKQ A;  3ITK A;  1ZRT D;  1R5L A;  4JPZ B;  1EDJ A;  3AEC C;  2FY8 A;  1NTK K;  3GG2 A;  1SQX G;  3CWB J;  1KMI Z;  1M1J A;  1G1J A;  1HJB A;  1VQ4 P;  2Q7C A;  3CCU P;  2IPP A;  4H44 C;  1SFC A;  4WVZ A;  2IX7 C;  2Q9I A;  3M9Q A;  3L75 E;  1D7M A;  2QM7 A;  3JSV C;  1Q7Y Q;  3V2R A;  2IBZ E;  1SQQ G;  3CME P;  2QE7 H;  4ZMD A;  4RO0 A;  1NTM E;  3H25 A;  3AEG C;  2YO2 A;  1NYH A;  2D2C D;  3TNU B;  3TGU J;  4UB6 E;  4L74 A;  3MD0 A;  1YHQ P;  5AVY B;  2HLO A;  1EDI A;  1MZ9 A;  2QJP B;  1SQP G;  1USE A;  1ZOY C;  1OFC X;  1SQV J;  3P7K A;  2QA4 P;  2ZFC A;  1M57 D;  5B66 H;  3SSU A;  2A06 D;  1L4A D;  2WVR A;  3TNU A;  4N3Y B;  2OYH C;  1NTK D;  2QVA A;  2RMZ A;  2AXC A;  5BU8 B;  3A0H H;  5AW3 B;  3IN6 A;  1A02 J;  3O8Z A;  3NMD A;  3RK2 D;  1LT9 C;  2HR3 A;  1JM0 A;  1H0T B;  3D71 A;  2N1T B;  5APU A;  1ZN5 A;  3VOP A;  1AQ5 A;  3Q3D A;  2ZYD A;  2POH A;  5K5G B;  2E76 D;  1GK6 A;  1S72 P;  1L0L E;  3VYI A;  2FYU K;  4I1L A;  1J1D C;  2HG5 D;  4BRY B;  1H0T A;  2FXM A;  1AFO A;  2R3S A;  2N1T A;  1WRG A;  1BCC J;  2D2C C;  3VP9 A;  2K9J A;  1HTL C;  1Q81 Q;  3HE5 B;  2K37 A;  2QRX A;  3JCU E;  3K5B A;  4H13 D;  5AVV B;  1X22 A;  1IFN A;  3CCV P;  5EFW B;  3C1L A;  2KNC B;  1W2E A;  5APV A;  1BE3 G;  1RE3 A;  2AEJ A;  2BCC E;  1L4A C;  2RH0 A;  1VQM P;  3V2N A;  1L0N E;  5APY A;  2AEM A;  3BCC E;  3L37 A;  3HE5 A;  4XFJ A;  2Y0D A;  1L0L D;  2OYO A;  2R3C A;  5KLI C;  1BDD A;  2WSC J;  1VF5 C;  2JWD A;  3CCL P;  3RK2 C;  3L71 D;  2FYN B;  5CCG C;  5BU5 A;  1KYO H;  2YMY A;  5AW9 B;  3CCM P;  3LIE A;  4TT3 H;  2FYU D;  1JY3 N;  3CWB E;  1KQS O;  1YIJ P;  1CSB A;  2J59 M;  2E76 C;  5DJU B;  5KAF E;  3CXH E;  1U7M A;  3VTP C;  1FZC A;  3TDK A;  2QIW A;  3P32 A;  4NPD A;  1VQ8 P;  2A06 G;  3RK3 B;  1NTK G;  1N73 B;  5APS A;  2JKV A;  3H1I D;  4YTP C;  1LT1 A;  3VMA A;  1PPJ D;  3FXD A;  1IC2 A;  3U59 A;  3NXS A;  4H13 C;  3L70 E;  1YYC A;  2ZAE B;  3OW2 O;  4WB4 A;  4XE5 B;  3TGU E;  4HYT B;  2BEQ D;  3L72 D;  2OYI C;  2XZR A;  2XKM A;  1ZV8 A;  1BDC A;  1QLE D;  1N7S D;  1N2D C;  4EIJ A;  1DEB A;  1KQF B;  1LTA C;  3H1K D;  2E43 A;  2NPS B;  1OXZ A;  3D6Y A;  2O1J A;  2YMK A;  3M0D C;  2FFD C;  2HPC B;  1JTH B;  1YQ3 C;  2WMM A;  5KLV K;  3Q5P A;  5KJ7 C;  2XND H;  2E75 C;  2YKP A;  1NWQ A;  3KHU A;  1URQ B;  2QJY C;  4R4L A;  1QL2 A;  1QEX A;  1K9M Q;  1PGO A;  4WY4 C;  3H1J D;  3AE3 C;  1KQL A;  2M8R A;  2PGD A;  4O9B A;  1KYO I;  1WMK A;  2KS1 B;  2FYZ A;  3KQG A;  2FXO A;  3S9O A;  3FX0 A;  1RHZ B;  2E42 A;  1SQX E;  1NHL A;  2XV5 A;  1ZW0 A;  5H2F E;  3B4S A;  4RJT A;  5AW7 B;  1URQ A;  1G2C B;  1KB9 H;  3G9R A;  1KZU B;  5KTB A;  2JWA A;  1FS0 E;  3D6Z A;  4KHX A;  3IF4 A;  2KOG A;  3L71 G;  3CX5 H;  1OIP A;  2KS1 A;  4IL6 E;  1P84 E;  2QSI A;  2FYU G;  1N7S C;  3BRT B;  1S5L E;  4IFD K;  3L75 J;  3LW5 H;  5B5E H;  3RL0 g;  3L74 G;  1G2C A;  3FWN A;  1Q2N A;  4IOI H;  3MUD C;  1QL1 A;  4QMA A;  3H32 B;  1PPJ G;  1OVR A;  4UB8 E;  5AVW B;  3B5N B;  1DIP A;  1HGZ A;  2E74 C;  2CPB A;  5GTI E;  4AYC A;  1YJW P;  1L2P A;  3L72 G;  2ZT9 B;  5GTH E;  1J1E B;  3G4S P;  3ZDM A;  1KYO D;  1LTG C;  1JB0 J;  1SQQ D;  2CPS A;  3H32 A;  4C7R A;  1K8A Q;  3B5N A;  2W90 A;  1GZL A;  2LKM A;  4W7Y A;  1T3J A;  2P10 A;  2KXP B;  3AED C;  2R5D A;  1OW6 A;  3HD7 B;  4L73 A;  3RGU A;  5AW6 B;  3G71 P;  1M1J C;  4B86 A;  1SQP D;  1VDF A;  1H8A A;  3EFG A;  1L0L J;  4WWI A;  2YO3 A;  2OTK E;  2XDJ A;  1KB9 I;  4H44 D;  3HUS B;  2FKW B;  1MV8 A;  3H1J G;  4DT0 A;  1ZRT E;  2H8P D;  1N7L A;  1Y8A A;  2NZ2 A;  3HD7 A;  5CCH A;  1VL2 A;  3WMM 0;  2FYU J;  1LWU A;  2N1T D;  2WPV B;  1ZR2 A;  1NH4 A;  1OVU A;  1EXI A;  5KKZ B;  2QJK B;  1MFT A;  2P1J A;  1YJ9 P;  1EQ7 A;  3HUS A;  2IZ0 A;  1N86 A;  2IZ1 A;  1Y47 A;  2B88 A;  2WSE J;  1ZXG A;  5AVT B;  4Y99 B;  1L0N J;  3H1I J;  3RL0 B;  2RKL A;  2PP6 A;  2Z5I A;  1IFD A;  1S3J A;  1BSH A;  1PGQ A;  4EDF A;  1SFC B;  5KLV G;  3L72 J;  2QJP C;  4PJ0 E;  2B89 A;  1GK4 A;  3QWO C;  1JY2 N;  2RN0 A;  1WT6 A;  3H1K J;  3AE9 C;  3FXE A;  1X9V A;  1BGY G;  1RF1 B;  2PAJ A;  1KB9 D;  1BE3 D;  2A06 E;  1EZV I;  1LTJ B;  1DH3 A;  1NTK E;  1KD1 Q;  2IBZ I;  3BAT A;  1Q90 D;  3VP8 A;  2E5Y A;  2O01 J;  3CC4 P;  5E79 E;  4EI2 A;  2R44 A;  2N1T C;  2H89 C;  3L70 J;  4ASW A;  5CJ4 A;  1RF1 A;  4DJG A;  4D6T G;  3Q5S A;  3H1J J;  4AUW A;  1N8R Q;  1LTJ A;  2V7Q J;  5M1B A;  1CW5 A;  1Y9B A;  2HFE D;  1DD3 A;  1GL2 B;  1KFN A;  3GW6 A;  3C9I A;  2GUV A;  3USS A;  1IZN B;  2M3E A;  3AEE C;  1TU3 F;  1NU1 K;  1NO4 A;  3TF5 A;  1S9K D;  4ZNC A;  1LGH B;  4U3F D;  2Z4E A;  5KAF H;  3CXH H;  2G8Y A;  2H7H A;  1GL2 A;  3TK1 A;  2Y9Y A;  2C0W A;  3MGN A;  2P58 A;  1R5S A;  1VF5 D;  5APT A;  1KV4 A;  3AE2 C;  2WQY C;  5CCG D;  2WTY A;  1EZV D;  2MKV A;  5BVZ A;  2K9J B;  3PTZ A;  2W6J H;  2NPS D;  1JCD A;  1SQX J;  2O3J A;  2IDB A;  4M3L A;  5CBO A;  3N7N A;  1U57 A;  3IAO A;  2YXR B;  2YIU B;  2FXP A;  2R5B A;  3H1H D;  1JUN A;  1M1K Q;  2C0X A;  2FYN C;  2WPQ A;  4CPG A;  4N6J A;  3PP5 A;  3L71 E;  1GD2 E;  1Q82 Q;  2WPR A;  5AVU B;  2FYU E;  5AW1 B;  2PFX A;  1SQB K;  3EFF K;  4RES B;  1SQQ J;  1NU1 D;  2KLV A;  2LXB A;  3RK3 C;  3CCS P;  3AEB C;  1VQP P;  1KC8 Q;  1N73 C;  3L73 D;  4I7Z B;  1NTZ K;  5TJH A;  1UII A;  5C39 A;  3H1I E;  3VN0 A;  3MIW A;  1PPJ E;  1SQP J;  1FZC B;  1FBM A;  1S1C X;  1E5W A;  1AJY A;  1VPC A;  2HYN A;  2P7J A;  3W67 A;  1NOH A;  1EDK A;  3L72 E;  2K9Y A;  2G3A A;  1SVF A;  1JY3 O;  5KJ7 D;  2E75 D;  2OYH A;  2WWW A;  4LGD E;  1OWA A;  5H2F H;  2WT7 B;  3GLM A;  1EDL A;  3H1K E;  2NPS C;  3FWL A;  4WY4 D;  1KIL B;  3L74 D;  4Z1M H;  3A5T A;  1FZB A;  1T6A A;  4IL6 H;  1P84 H;  1RF0 A;  1JMB A;  3V5B A;  1ZME C;  1GW4 A;  2SPZ A;  4LC1 A;  4BXL A;  4PD4 H;  1S5L H;  1SQB D;  1VQ6 P;  4U3F G;  1PIX A;  3VMY A;  1URQ C;  3G3Z A;  2WT7 A;  2ZT9 D;  1PP9 D;  1VQ5 P;  3AE8 C;  3U1C A;  3M9H A;  4K35 A;  1KIL A;  3CMA P;  1NTZ D;  3H1J E;  1QGK B;  3SWK A;  4JF7 A;  1G1I A;  1EZV G;  2A45 H;  4A7P A;  2I1J A;  1RE4 A;  1FJK A;  4UB8 H;  2IBZ G;  2KZJ A;  1GDT A;  1SQV K;  3H1L D;  2WSC H;  5GTI H;  4ASV A;  5CCH D;  3G6E P;  3H1H G;  1IFJ A;  2AEF A;  1VQN P;  1BE3 J;  5AW5 B;  1OZH A;  1MUU A;  4W80 A;  2K3R A;  5AVX B;  3CCR P;  1L4A A;  4JBZ A;  5AW0 B;  2E74 D;  1GU5 A;  1FZF A;  3V2Q A;  1HWT C;  1KOR A;  1NU1 G;  3HRN A;  2QG4 A;  3B8E B;  1JY3 P;  2JDI H;  1ZLL A;  1LTS C;  3HTK A;  3L73 G;  1H89 A;  1FZA A;  4YPC A;  3B5N C;  3JC2 2;  4JYC A;  3GHG B;  4KT0 J;  1BGY E;  1KTM A;  2ZT9 C;  4I6M C;  1J1E C;  2WSF J;  1HBW A;  4ZKP A;  4IFM A;  1PV3 A;  1KYO E;  4PD4 I;  1NTK J;  1SQV D;  2BAS A; 
#chains in the Genus database with same CATH homology
 1SFC D;  1DX7 A;  2VRS A;  1EQ7 A;  3HUS A;  2W6A A;  1N86 A;  3GHG A;  5BU8 B;  2QM8 A;  1T8Z A;  4C7N B;  1IK9 A;  2IFM A;  3HD7 C;  4N78 D;  1FZE A;  5AW3 B;  2A45 I;  5CCH C;  1A02 J;  5AVT B;  4Y99 B;  2OYI A;  3O8Z A;  3TSI A;  3NMD A;  3RK2 D;  1LT9 C;  3RL0 B;  2N1T B;  2PP6 A;  5APU A;  3OAK A;  1ZN5 A;  3V4Q A;  3VOP A;  2Z5I A;  1IFD A;  1L4A B;  4OH8 B;  3LID A;  3L35 A;  1AQ5 A;  2W6B A;  4DOJ A;  3SWY A;  1H88 A;  1JCC A;  3HUS C;  3IR9 A;  2POH A;  2Z5H A;  1FOS F;  1SFC B;  3KYQ A;  3GHG C;  4GT1 A;  1A02 F;  1GK6 A;  1GK4 A;  3VYI A;  2FYU K;  4I1L A;  1J1D C;  1CI6 B;  5CMZ A;  4C7N A;  4W7Z A;  4WBA A;  1JY2 N;  3HD7 D;  3M0D A;  2HG5 D;  4XA4 A;  3HTK B;  1WT6 A;  3RK2 B;  2FXM A;  1AFO A;  2N1T A;  1N73 A;  1WRG A;  1X9V A;  1RF1 B;  2PAJ A;  5AVR B;  3VP9 A;  1HTL C;  1RY3 A;  3HE5 B;  1LTJ B;  4I2L C;  1DH3 A;  3CLQ A;  3EQ2 A;  1NKZ B;  5AVV B;  2C9N Y;  3A7O A;  3BAT A;  1IFN A;  1IFI A;  4GIF A;  2WZ7 A;  1CI6 A;  4Y99 C;  3VP8 A;  1W2E A;  3SWF A;  5APV A;  4N78 E;  2C9L Y;  3RL0 C;  1FDM A;  1LWU B;  2N1T C;  1RE3 A;  1FOS E;  3VMX A;  1Z56 A;  5CCG A;  5CJ4 A;  1L4A C;  2P2U A;  2R32 A;  3H6P A;  3NTN A;  1SQX K;  1RF1 A;  3V2N A;  5APY A;  4AUW A;  3L37 A;  3BAS A;  3HE5 A;  1LTJ A;  1SFC C;  1CW5 A;  3HE4 B;  2NPS A;  2HFE D;  1XTC C;  1GL2 B;  1KFN A;  2R3C A;  1J2J B;  2OYI B;  2HPC A;  1JTH A;  3C9I A;  2GUV A;  5AVQ B;  3RK2 C;  3RL0 D;  5CCG C;  2L5G B;  1T2K C;  5BU5 A;  1NU1 K;  1RF1 C;  2YMY A;  1NO4 A;  2GUS A;  2KB7 P;  5APW A;  5AW9 B;  3LIE A;  1YTZ I;  1JY3 N;  1LTJ C;  1S9K D;  1SQQ K;  1CSB A;  2J59 M;  1IO4 A;  1LGH B;  2P67 A;  3UIA A;  2Z4E A;  3VTP C;  3HE4 A;  1FZC A;  2H7H A;  1GL2 A;  2JJL A;  1NKN A;  3TK1 A;  3P32 A;  3IFM A;  5AW8 B;  2H43 A;  1IJD B;  1GW3 A;  2C0W A;  3MGN A;  2Q3I A;  2FFD B;  3RK3 B;  5APT A;  1LWU C;  3MUD A;  3M9B A;  1SLQ A;  1N73 B;  4DZO A;  5CCG D;  1T2K D;  5APS A;  2WTY A;  1NAF A;  3NFQ A;  1SQP K;  5AW4 B;  5BVZ A;  3M06 A;  1IC2 A;  3U59 A;  3NXS A;  1YYC A;  2M3B A;  2NPS D;  1JCD A;  4M3L A;  1GL2 C;  4WB4 A;  3N7N A;  4WY4 B;  4XE5 B;  4HYT B;  2GM4 A;  2OYI C;  2R5B A;  2XZR A;  1JO5 A;  1JUN A;  1FU1 A;  2FFD A;  2C0X A;  2XKM A;  3P8C D;  1ZV8 A;  2WPQ A;  4N6J A;  1YTZ T;  4C46 A;  1JMM A;  3PP5 A;  1N7S D;  5KJ7 A;  1N2D C;  1GD2 E;  4EIJ A;  1DEB A;  1LTT C;  1LTA C;  2WPR A;  2WSF H;  3L4F A;  5AVU B;  2E43 A;  3OA7 A;  1S9K E;  5AW1 B;  2NPS B;  1SQB K;  2YKO A;  1OXZ A;  4RES B;  1GL2 D;  3E1I A;  1ZR4 A;  4WY4 A;  2O1J A;  3M0D C;  2JEE A;  2KLV A;  2FFD C;  3RK3 C;  5CJ0 A;  2HPC B;  1JTH B;  1HGV A;  1IFM A;  1LTB C;  5KLV K;  5KJ7 C;  1N73 C;  2KP8 A;  3BVH A;  1N7S B;  5AW2 B;  1NTM K;  1LTI C;  1NTZ K;  2WIT A;  2YKP A;  2WSE H;  3A3Y B;  1NWQ A;  2MJZ A;  1URQ B;  3VN0 A;  3II6 A;  3MIW A;  1QL2 A;  4GKG A;  1KIL D;  3KDP B;  4WY4 C;  1FZC B;  3OJA B;  1FBM A;  1KQL A;  1E5W A;  1VPC A;  2M8R A;  1MFZ A;  2YNY A;  3A2A A;  4O9B A;  1GU4 A;  2HYN A;  1FZG A;  2FYZ A;  2P7J A;  3KQG A;  2ZXE B;  3L36 A;  1NOH A;  1T3U A;  3RK3 D;  1PFI A;  1X8Y A;  1FJP A;  1FAV A;  3M0A A;  1RE3 C;  2E42 A;  1SVF A;  1JY3 O;  1NHL A;  5KJ7 D;  5APX A;  2XV5 A;  3P8C E;  2OYH A;  1N7S A;  2WWW A;  5AVZ B;  1KFM A;  3V4W A;  4LGD E;  1OWA A;  5AW7 B;  2WT7 B;  2A45 G;  1URQ A;  1G2C B;  4HH2 A;  1M7L A;  1KZU B;  2NPS C;  4ZKU A;  5KTB A;  3CL3 D;  4KHX A;  5CHX A;  4WY4 D;  1KIL B;  1HUC A;  1XTG B;  2KOG A;  2XNX A;  3N4X A;  3A5T A;  4IFF A;  2J58 A;  1FZB A;  2WPS A;  1GTW A;  3T97 A;  1RF0 A;  1JY2 P;  4LLH A;  1N7S C;  3V5B A;  3BRT B;  1GW4 A;  4LC1 A;  4IFD K;  2KYV A;  2Q5U A;  3M91 A;  3LW5 H;  3MTU E;  3VMY A;  1URQ C;  2O01 H;  3G3Z A;  2IFN A;  1JOC A;  2WT7 A;  2O1K A;  3U1A A;  1G2C A;  2N9B A;  2I1K A;  1JY2 O;  3U1C A;  3M9H A;  1FZC C;  2XU6 A;  1KIL A;  1L0L K;  1HH0 A;  1M1J B;  4JF7 A;  1G1I A;  1RF0 C;  1QL1 A;  2A45 H;  3H32 B;  5AVW B;  3B5N B;  2YKQ A;  2I1J A;  1RE4 A;  1FJK A;  1HGZ A;  2CPB A;  1GDT A;  1SQV K;  2WSC H;  1URQ D;  4AYC A;  3I5C A;  3R2P A;  1NTK K;  5CCH D;  3P8M C;  1J1E B;  1IFJ A;  1KIL C;  5AW5 B;  3VMZ A;  1MUU A;  1M1J A;  1G1J A;  1HJB A;  4W80 A;  2Q7C A;  1LTG C;  5AVX B;  1L4A A;  1CZQ A;  4JYB A;  1RE4 C;  2CPS A;  3H32 A;  2IPP A;  1SP4 A;  5AW0 B;  5AVS B;  4C7R A;  3CI9 A;  2OAR A;  3B5N A;  2OYH B;  1GZL A;  1X79 B;  1SFC A;  2IX7 C;  1GU5 A;  1FZF A;  3V2Q A;  1L0N K;  1HWT C;  2LKM A;  2Q9I A;  4W7Y A;  3HRN A;  1T3J A;  3M9Q A;  3KPE A;  3B8E B;  1JY3 P;  2QM7 A;  2R5D A;  3HD7 B;  1ZLL A;  3V2P A;  3V2R A;  1LTS C;  3HTK A;  5AW6 B;  5APQ A;  1M1J C;  4B86 A;  1LT9 B;  3TYY A;  1H89 A;  1VDF A;  4AQR D;  1H8A A;  1FZA A;  3EFG A;  2HOD B;  2YO2 A;  3TNU B;  3B5N C;  2YO3 A;  4N3Y B;  3MD0 A;  2XDJ A;  5AVY B;  1HVV A;  3HUS B;  4JYC A;  4EOT A;  2FKW B;  1MV8 A;  2HLO A;  1MZ9 A;  3GHG B;  2H8P D;  4I6M C;  1N7L A;  2KSJ A;  1J1D B;  1J1E C;  3HD7 A;  5CCH A;  1HBW A;  4ZKP A;  4IFM A;  3WMM 0;  3P7K A;  1LWU A;  2N1T D;  2ZFC A;  1LT9 A;  1ZR2 A;  1NH4 A;  1L4A D;  2HOD A;  1JNM A;  2W27 A;  3TNU A;  2BAS A;  2P1J A;  3BRV B;  3B5N D;  2OYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...