2Y04A

Turkey beta1 adrenergic receptor with stabilising mutations and bound partial agonist salbutamol
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
298
structure length
286
Chain Sequence
AELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for Agonist and Partial Agonist Action on a Beta1-Adrenergic Receptor
pubmed doi rcsb
molecule keywords BETA-1 ADRENERGIC RECEPTOR
molecule tags Receptor
source organism Meleagris gallopavo
total genus 121
structure length 286
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 2y04A00
1TN0A 4AMJA 3C9MA 4G7SB 5TGZA 4G71B 5G28A 3D4SA 3AYNA 3HANA 3RZEA 3OE6A 1UAZA 4LDLA 4WAVA 5G54A 4X1HA 3HASA 5BR5A 3UTYA 3REYA 1C8SA 4HWLA 2QPDB 1P8IA 1F50A 5B6XA 5H2OA 5J7AA 1S8JA 5B35A 4GP5B 3UZAA 1S51A 1X0I1 3QAKA 4A4MA 2KSYA 4LDOA 3PQRA 1BRXA 5DYSA 3MBVA 1GZMA 4J4QA 4XTLA 2ZZLA 1JGJA 1MGYA 4BV0A 3HAQA 4JR8A 2R4SA 2ZIYA 1PXSA 4G72B 3UONA 1BRRA 1EHKB 2YDVA 4DKLA 5JJEA 1M0LA 5H2MA 1H68A 5H2KA 3DDLA 2Z73A 1DZEA 3QDCA 4AMIA 4QRYA 3EH5B 3PBLA 5H2IA 2YCXA 1Q5IA 3S3BB 2G87A 1BM1A 1P8HA 4EIYA 4G70B 2BRDA 3X3CA 5A44A 1HZXA 5JJJA 3QJQB 1F88A 2AT9A 3QBGA 2VT4A 1L0MA 2J4YA 2WJLA 4K5YA 3S3DB 1CWQA 5EN0A 5KKHA 3RFMA 1PXRA 4MQSA 5B0WA 5ITCA 3KJ6A 4MQTA 4PXKA 4X31A 3QJRB 4MD2A 2YCZA 4XTOA 4HYJA 3S3CB 4BUOA 3COCA 1KGBA 2Y02A 3DQBA 2NTUA 3AYMA 3VVKA 3T45A 3S8FB 1IXFA 5B6ZA 4OV0A 5ETZA 4L35A 4NC3A 5H2LA 3UTWA 4BWBA 4N6HA 3ABWA 3VG9A 3CAPA 2HPYA 4EA3A 3A7KA 5H2PA 3PXOA 1LN6A 5AX0A 4DJHA 2Y01A 3EH3B 4KLYA 1GU8A 2JAFA 1KG9A 3QAPA 3UZCA 2JAGA 1VGOA 1U19A 1S53A 3ZEVA 4Y9HA 4XT1A 1BRDA 3AM6A 1UCQA 3QJSB 4DAJA 3VHZA 1PY6A 3OE8A 3OE0A 3OAXA 1FBBA 3PDSA 4FPDA 1C8RA 1S54A 5ITEA 5G53A 1E12A 3NYAA 1JV6A 2YCWA 5A45A 1VJMA 4GYCA 1KG8A 2QPEB 2X72A 1TN5A 3QBLA 3NY8A 1QHJA 5B6WA 3UTXA 5AHYA 4IB4A 1F4ZA 4XT3A 4GP4B 3NSBA 1IW6A 3UTVA 3S8GB 4HYXA 5G36A 3VW7A 3QJVB 4FAAB 5F8UA 3EMLA 3WQJA 4EJ4A 4GPOA 4X32A 5AZDA 4IARA 5G2CA 5H2NA 3ZPQA 1AT9A 3QJUB 2Y00A 1P8UA 2Y03A 2I35A 3V2WA 5G2AA 4WW3A 3VI0A 1M0MA 2KSAA 5LWEA 1JV7A 4N4YB 2L6XA 3HAOA 3NS0A 3QBKA 3HARA 1XIOA 1O0AA 2R4RA 4PXFA 2KS9A 4FBZA 4LDEA 1X0K1 1QM8A 1S52A 4GP8B 1IW9A 2F93A 1R84A 4QIDA 4QI1A 5B6VA 4KNFA 2PEDA 2YCYA 1JFPA 2EI4A 5B6YA 4G7QB 3SN6R 4IAQA 4N4WA 1XMEB 4L6RA 5AHZA 1XJIA 1KMEA 2NTWA 4GRVA 4UHRA 2I21A 3OE9A 1E0PA 5DHHA 3P0GA 5FJGA 4BEYA 5H2HA 4TL3A 2Y04A 5B34A 3V2YA 4BEZA 4UG2A 4XXJA 4G7RB 2WJKA 5H2JA 1H2SA 3QJTB 5BR2A 4FA7B 1R2NA 3UG9A 2LNLA 1FBKA 5JJNA 2RH1A 3X3BA 2ZFEA 5C1MA 1QKPA 2KSBA 3EH4B 5B2NA 5G2DA 5AWZA 3PWHA 1L9HA 2I1XA 3HAPA 4JKVA 1X0SA 1AP9A 5AX1A 3NY9A 4GBRA 1QKOA 1M0KA 2M3GA 3ODUA 1C3WA 1GUEA 3C9LA 3BVDB 1Q5JA 2F95A 4BVNA 2Z55A 1S8LA 4XTNA 3VGAA 3QBIA 5A8EA 4JQ6A 3CODA 4MD1A 3ZPRA 4MBSA 2I20A 2YDOA 5DHGA
chains in the Genus database with same CATH superfamily
1TN0A 4AMJA 3C9MA 4G7SB 5TGZA 4G71B 5G28A 3D4SA 3AYNA 3HANA 3RZEA 3OE6A 1UAZA 4LDLA 4WAVA 5G54A 4X1HA 3HASA 5BR5A 3UTYA 3REYA 1C8SA 4HWLA 2QPDB 1P8IA 1F50A 5B6XA 5H2OA 5J7AA 1S8JA 5B35A 4GP5B 3UZAA 1S51A 1X0I1 3QAKA 4A4MA 2KSYA 4LDOA 3PQRA 1BRXA 5DYSA 3MBVA 1GZMA 4J4QA 4XTLA 2ZZLA 1JGJA 1MGYA 4BV0A 3HAQA 4JR8A 2R4SA 2ZIYA 1PXSA 4G72B 3UONA 1BRRA 1EHKB 2YDVA 4DKLA 5JJEA 1M0LA 5H2MA 1H68A 5H2KA 3DDLA 2Z73A 1DZEA 3QDCA 4AMIA 4QRYA 3EH5B 3PBLA 5H2IA 2YCXA 1Q5IA 3S3BB 2G87A 1BM1A 1P8HA 4EIYA 4G70B 2BRDA 3X3CA 5A44A 1HZXA 5JJJA 3QJQB 1F88A 2AT9A 3QBGA 2VT4A 1L0MA 2J4YA 2WJLA 4K5YA 3S3DB 1CWQA 5EN0A 5KKHA 3RFMA 1PXRA 4MQSA 5B0WA 5ITCA 3KJ6A 4MQTA 4PXKA 4X31A 3QJRB 4MD2A 2YCZA 4XTOA 4HYJA 3S3CB 4BUOA 3COCA 1KGBA 2Y02A 3DQBA 2NTUA 3AYMA 3VVKA 3T45A 3S8FB 1IXFA 5B6ZA 4OV0A 5ETZA 4L35A 4NC3A 5H2LA 3UTWA 4BWBA 4N6HA 3ABWA 3VG9A 3CAPA 2HPYA 4EA3A 3A7KA 5H2PA 3PXOA 1LN6A 5AX0A 4DJHA 2Y01A 3EH3B 4KLYA 1GU8A 2JAFA 1KG9A 3QAPA 3UZCA 2JAGA 1VGOA 1U19A 1S53A 3ZEVA 4Y9HA 4XT1A 1BRDA 3AM6A 1UCQA 3QJSB 4DAJA 3VHZA 1PY6A 3OE8A 3OE0A 3OAXA 1FBBA 3PDSA 4FPDA 1C8RA 1S54A 5ITEA 5G53A 1E12A 3NYAA 1JV6A 2YCWA 5A45A 1VJMA 4GYCA 1KG8A 2QPEB 2X72A 1TN5A 3QBLA 3NY8A 1QHJA 5B6WA 3UTXA 5AHYA 4IB4A 1F4ZA 4XT3A 4GP4B 3NSBA 1IW6A 3UTVA 3S8GB 4HYXA 5G36A 3VW7A 3QJVB 4FAAB 5F8UA 3EMLA 3WQJA 4EJ4A 4GPOA 4X32A 5AZDA 4IARA 5G2CA 5H2NA 3ZPQA 1AT9A 3QJUB 2Y00A 1P8UA 2Y03A 2I35A 3V2WA 5G2AA 4WW3A 3VI0A 1M0MA 2KSAA 5LWEA 1JV7A 4N4YB 2L6XA 3HAOA 3NS0A 3QBKA 3HARA 1XIOA 1O0AA 2R4RA 4PXFA 2KS9A 4FBZA 4LDEA 1X0K1 1QM8A 1S52A 4GP8B 1IW9A 2F93A 1R84A 4QIDA 4QI1A 5B6VA 4KNFA 2PEDA 2YCYA 4DS7E 1JFPA 2EI4A 5B6YA 4G7QB 3SN6R 4IAQA 4N4WA 1XMEB 4L6RA 5AHZA 1XJIA 1KMEA 2NTWA 4GRVA 4UHRA 2I21A 3OE9A 1E0PA 5DHHA 3P0GA 5FJGA 4BEYA 5H2HA 4TL3A 2Y04A 5B34A 3V2YA 4BEZA 4UG2A 4XXJA 4G7RB 2WJKA 5H2JA 1H2SA 3QJTB 5BR2A 4FA7B 1R2NA 3UG9A 2LNLA 1FBKA 5JJNA 2RH1A 3X3BA 2ZFEA 5C1MA 1QKPA 2KSBA 3EH4B 5B2NA 5G2DA 5AWZA 3PWHA 1L9HA 2I1XA 3HAPA 4JKVA 1X0SA 1AP9A 5AX1A 3NY9A 4GBRA 1QKOA 1M0KA 2M3GA 3ODUA 1C3WA 1GUEA 3C9LA 3BVDB 1Q5JA 2F95A 4BVNA 2Z55A 1S8LA 4XTNA 3VGAA 3QBIA 5A8EA 4JQ6A 3CODA 4MD1A 3ZPRA 4MBSA 2I20A 2YDOA 5DHGA
chains in the Genus database with same CATH topology
1TN0A 4AMJA 3C9MA 4G7SB 5TGZA 4G71B 5G28A 3D4SA 3AYNA 3HANA 3RZEA 3OE6A 1UAZA 4LDLA 4WAVA 5G54A 4X1HA 3HASA 5BR5A 3UTYA 3REYA 1C8SA 4HWLA 2QPDB 1P8IA 1F50A 5B6XA 5H2OA 5J7AA 1S8JA 5B35A 4GP5B 3UZAA 1S51A 1X0I1 3QAKA 4A4MA 2KSYA 4LDOA 3PQRA 1BRXA 5DYSA 3MBVA 1GZMA 4J4QA 4XTLA 2ZZLA 1JGJA 1MGYA 4BV0A 3HAQA 4JR8A 2R4SA 2ZIYA 1PXSA 4G72B 3UONA 1BRRA 1EHKB 2YDVA 4DKLA 5JJEA 1M0LA 5H2MA 1H68A 5H2KA 3DDLA 2Z73A 1DZEA 3QDCA 4AMIA 4QRYA 3EH5B 3PBLA 5H2IA 2YCXA 1Q5IA 3S3BB 2G87A 1BM1A 1P8HA 4EIYA 4G70B 2BRDA 3X3CA 5A44A 1HZXA 5JJJA 3QJQB 1F88A 2AT9A 3QBGA 2VT4A 1L0MA 2J4YA 2WJLA 4K5YA 3S3DB 1CWQA 5EN0A 5KKHA 3RFMA 1PXRA 4MQSA 5B0WA 5ITCA 3KJ6A 4MQTA 4PXKA 4X31A 3QJRB 4MD2A 2YCZA 4XTOA 4HYJA 3S3CB 4BUOA 3COCA 1KGBA 2Y02A 3DQBA 2NTUA 3AYMA 3VVKA 3T45A 3S8FB 1IXFA 5B6ZA 4OV0A 5ETZA 4L35A 4NC3A 5H2LA 3UTWA 4BWBA 4N6HA 3ABWA 3VG9A 3CAPA 2HPYA 4EA3A 3A7KA 5H2PA 3PXOA 1LN6A 5AX0A 4DJHA 2Y01A 3EH3B 4KLYA 1GU8A 2JAFA 1KG9A 3QAPA 3UZCA 2JAGA 1VGOA 1U19A 1S53A 3ZEVA 4Y9HA 4XT1A 1BRDA 3AM6A 1UCQA 3QJSB 4DAJA 3VHZA 1PY6A 3OE8A 3OE0A 3OAXA 1FBBA 3PDSA 4FPDA 1C8RA 1S54A 5ITEA 5G53A 1E12A 3NYAA 1JV6A 2YCWA 5A45A 1VJMA 4GYCA 1KG8A 2QPEB 2X72A 1TN5A 3QBLA 3NY8A 1QHJA 5B6WA 3UTXA 5AHYA 4IB4A 1F4ZA 4XT3A 4GP4B 3NSBA 1IW6A 3UTVA 3S8GB 4HYXA 5G36A 3VW7A 3QJVB 4FAAB 5F8UA 3EMLA 3WQJA 4EJ4A 4GPOA 4X32A 5AZDA 4IARA 5G2CA 5H2NA 3ZPQA 1AT9A 3QJUB 2Y00A 1P8UA 2Y03A 2I35A 3V2WA 5G2AA 4WW3A 3VI0A 1M0MA 2KSAA 5LWEA 1JV7A 4N4YB 2L6XA 3HAOA 3NS0A 3QBKA 3HARA 1XIOA 1O0AA 2R4RA 4PXFA 2KS9A 4FBZA 4LDEA 1X0K1 1QM8A 1S52A 4GP8B 1IW9A 2F93A 1R84A 4QIDA 4QI1A 5B6VA 4KNFA 2PEDA 2YCYA 4DS7E 1JFPA 2EI4A 5B6YA 4G7QB 3SN6R 4IAQA 4N4WA 1XMEB 4L6RA 5AHZA 1XJIA 1KMEA 2NTWA 4GRVA 4UHRA 2I21A 3OE9A 1E0PA 5DHHA 3P0GA 5FJGA 4BEYA 5H2HA 4TL3A 2Y04A 5B34A 3V2YA 4BEZA 4UG2A 4XXJA 4G7RB 2WJKA 5H2JA 1H2SA 3QJTB 5BR2A 4FA7B 1R2NA 3UG9A 2LNLA 1FBKA 5JJNA 2RH1A 3X3BA 2ZFEA 5C1MA 1QKPA 2KSBA 3EH4B 5B2NA 5G2DA 5AWZA 3PWHA 1L9HA 2I1XA 3HAPA 4JKVA 1X0SA 1AP9A 5AX1A 3NY9A 4GBRA 1QKOA 1M0KA 2M3GA 3ODUA 1C3WA 1GUEA 3C9LA 3BVDB 1Q5JA 2F95A 4BVNA 2Z55A 1S8LA 4XTNA 3VGAA 3QBIA 5A8EA 4JQ6A 3CODA 4MD1A 3ZPRA 4MBSA 2I20A 2YDOA 5DHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN0 A;  4AMJ A;  3C9M A;  4G7S B;  5TGZ A;  4G71 B;  5G28 A;  3D4S A;  3AYN A;  3HAN A;  3RZE A;  3OE6 A;  1UAZ A;  4LDL A;  4WAV A;  5G54 A;  4X1H A;  3HAS A;  5BR5 A;  3UTY A;  3REY A;  1C8S A;  4HWL A;  2QPD B;  1P8I A;  1F50 A;  5B6X A;  5H2O A;  5J7A A;  1S8J A;  5B35 A;  4GP5 B;  3UZA A;  1S51 A;  1X0I 1;  3QAK A;  4A4M A;  2KSY A;  4LDO A;  3PQR A;  1BRX A;  5DYS A;  3MBV A;  1GZM A;  4J4Q A;  4XTL A;  2ZZL A;  1JGJ A;  1MGY A;  4BV0 A;  3HAQ A;  4JR8 A;  2R4S A;  2ZIY A;  1PXS A;  4G72 B;  3UON A;  1BRR A;  1EHK B;  2YDV A;  4DKL A;  5JJE A;  1M0L A;  5H2M A;  1H68 A;  5H2K A;  3DDL A;  2Z73 A;  1DZE A;  3QDC A;  4AMI A;  4QRY A;  3EH5 B;  3PBL A;  5H2I A;  2YCX A;  1Q5I A;  3S3B B;  2G87 A;  1BM1 A;  1P8H A;  4EIY A;  4G70 B;  2BRD A;  3X3C A;  5A44 A;  1HZX A;  5JJJ A;  3QJQ B;  1F88 A;  2AT9 A;  3QBG A;  2VT4 A;  1L0M A;  2J4Y A;  2WJL A;  4K5Y A;  3S3D B;  1CWQ A;  5EN0 A;  5KKH A;  3RFM A;  1PXR A;  4MQS A;  5B0W A;  5ITC A;  3KJ6 A;  4MQT A;  4PXK A;  4X31 A;  3QJR B;  4MD2 A;  2YCZ A;  4XTO A;  4HYJ A;  3S3C B;  4BUO A;  3COC A;  1KGB A;  2Y02 A;  3DQB A;  2NTU A;  3AYM A;  3VVK A;  3T45 A;  3S8F B;  1IXF A;  5B6Z A;  4OV0 A;  5ETZ A;  4L35 A;  4NC3 A;  5H2L A;  3UTW A;  4BWB A;  4N6H A;  3ABW A;  3VG9 A;  3CAP A;  2HPY A;  4EA3 A;  3A7K A;  5H2P A;  3PXO A;  1LN6 A;  5AX0 A;  4DJH A;  2Y01 A;  3EH3 B;  4KLY A;  1GU8 A;  2JAF A;  1KG9 A;  3QAP A;  3UZC A;  2JAG A;  1VGO A;  1U19 A;  1S53 A;  3ZEV A;  4Y9H A;  4XT1 A;  1BRD A;  3AM6 A;  1UCQ A;  3QJS B;  4DAJ A;  3VHZ A;  1PY6 A;  3OE8 A;  3OE0 A;  3OAX A;  1FBB A;  3PDS A;  4FPD A;  1C8R A;  1S54 A;  5ITE A;  5G53 A;  1E12 A;  3NYA A;  1JV6 A;  2YCW A;  5A45 A;  1VJM A;  4GYC A;  1KG8 A;  2QPE B;  2X72 A;  1TN5 A;  3QBL A;  3NY8 A;  1QHJ A;  5B6W A;  3UTX A;  5AHY A;  4IB4 A;  1F4Z A;  4XT3 A;  4GP4 B;  3NSB A;  1IW6 A;  3UTV A;  3S8G B;  4HYX A;  5G36 A;  3VW7 A;  3QJV B;  4FAA B;  5F8U A;  3EML A;  3WQJ A;  4EJ4 A;  4GPO A;  4X32 A;  5AZD A;  4IAR A;  5G2C A;  5H2N A;  3ZPQ A;  1AT9 A;  3QJU B;  2Y00 A;  1P8U A;  2Y03 A;  2I35 A;  3V2W A;  5G2A A;  4WW3 A;  3VI0 A;  1M0M A;  2KSA A;  5LWE A;  1JV7 A;  4N4Y B;  2L6X A;  3HAO A;  3NS0 A;  3QBK A;  3HAR A;  1XIO A;  1O0A A;  2R4R A;  4PXF A;  2KS9 A;  4FBZ A;  4LDE A;  1X0K 1;  1QM8 A;  1S52 A;  4GP8 B;  1IW9 A;  2F93 A;  1R84 A;  4QID A;  4QI1 A;  5B6V A;  4KNF A;  2PED A;  2YCY A;  1JFP A;  2EI4 A;  5B6Y A;  4G7Q B;  3SN6 R;  4IAQ A;  4N4W A;  1XME B;  4L6R A;  5AHZ A;  1XJI A;  1KME A;  2NTW A;  4GRV A;  4UHR A;  2I21 A;  3OE9 A;  1E0P A;  5DHH A;  3P0G A;  5FJG A;  4BEY A;  5H2H A;  4TL3 A;  2Y04 A;  5B34 A;  3V2Y A;  4BEZ A;  4UG2 A;  4XXJ A;  4G7R B;  2WJK A;  5H2J A;  1H2S A;  3QJT B;  5BR2 A;  4FA7 B;  1R2N A;  3UG9 A;  2LNL A;  1FBK A;  5JJN A;  2RH1 A;  3X3B A;  2ZFE A;  5C1M A;  1QKP A;  2KSB A;  3EH4 B;  5B2N A;  5G2D A;  5AWZ A;  3PWH A;  1L9H A;  2I1X A;  3HAP A;  4JKV A;  1X0S A;  1AP9 A;  5AX1 A;  3NY9 A;  4GBR A;  1QKO A;  1M0K A;  2M3G A;  3ODU A;  1C3W A;  1GUE A;  3C9L A;  3BVD B;  1Q5J A;  2F95 A;  4BVN A;  2Z55 A;  1S8L A;  4XTN A;  3VGA A;  3QBI A;  5A8E A;  4JQ6 A;  3COD A;  4MD1 A;  3ZPR A;  4MBS A;  2I20 A;  2YDO A;  5DHG A; 
#chains in the Genus database with same CATH topology
 1TN0 A;  4AMJ A;  3C9M A;  4G7S B;  5TGZ A;  4G71 B;  5G28 A;  3D4S A;  3AYN A;  3HAN A;  3RZE A;  3OE6 A;  1UAZ A;  4LDL A;  4WAV A;  5G54 A;  4X1H A;  3HAS A;  5BR5 A;  3UTY A;  3REY A;  1C8S A;  4HWL A;  2QPD B;  1P8I A;  1F50 A;  5B6X A;  5H2O A;  5J7A A;  1S8J A;  5B35 A;  4GP5 B;  3UZA A;  1S51 A;  1X0I 1;  3QAK A;  4A4M A;  2KSY A;  4LDO A;  3PQR A;  1BRX A;  5DYS A;  3MBV A;  1GZM A;  4J4Q A;  4XTL A;  2ZZL A;  1JGJ A;  1MGY A;  4BV0 A;  3HAQ A;  4JR8 A;  2R4S A;  2ZIY A;  1PXS A;  4G72 B;  3UON A;  1BRR A;  1EHK B;  2YDV A;  4DKL A;  5JJE A;  1M0L A;  5H2M A;  1H68 A;  5H2K A;  3DDL A;  2Z73 A;  1DZE A;  3QDC A;  4AMI A;  4QRY A;  3EH5 B;  3PBL A;  5H2I A;  2YCX A;  1Q5I A;  3S3B B;  2G87 A;  1BM1 A;  1P8H A;  4EIY A;  4G70 B;  2BRD A;  3X3C A;  5A44 A;  1HZX A;  5JJJ A;  3QJQ B;  1F88 A;  2AT9 A;  3QBG A;  2VT4 A;  1L0M A;  2J4Y A;  2WJL A;  4K5Y A;  3S3D B;  1CWQ A;  5EN0 A;  5KKH A;  3RFM A;  1PXR A;  4MQS A;  5B0W A;  5ITC A;  3KJ6 A;  4MQT A;  4PXK A;  4X31 A;  3QJR B;  4MD2 A;  2YCZ A;  4XTO A;  4HYJ A;  3S3C B;  4BUO A;  3COC A;  1KGB A;  2Y02 A;  3DQB A;  2NTU A;  3AYM A;  3VVK A;  3T45 A;  3S8F B;  1IXF A;  5B6Z A;  4OV0 A;  5ETZ A;  4L35 A;  4NC3 A;  5H2L A;  3UTW A;  4BWB A;  4N6H A;  3ABW A;  3VG9 A;  3CAP A;  2HPY A;  4EA3 A;  3A7K A;  5H2P A;  3PXO A;  1LN6 A;  5AX0 A;  4DJH A;  2Y01 A;  3EH3 B;  4KLY A;  1GU8 A;  2JAF A;  1KG9 A;  3QAP A;  3UZC A;  2JAG A;  1VGO A;  1U19 A;  1S53 A;  3ZEV A;  4Y9H A;  4XT1 A;  1BRD A;  3AM6 A;  1UCQ A;  3QJS B;  4DAJ A;  3VHZ A;  1PY6 A;  3OE8 A;  3OE0 A;  3OAX A;  1FBB A;  3PDS A;  4FPD A;  1C8R A;  1S54 A;  5ITE A;  5G53 A;  1E12 A;  3NYA A;  1JV6 A;  2YCW A;  5A45 A;  1VJM A;  4GYC A;  1KG8 A;  2QPE B;  2X72 A;  1TN5 A;  3QBL A;  3NY8 A;  1QHJ A;  5B6W A;  3UTX A;  5AHY A;  4IB4 A;  1F4Z A;  4XT3 A;  4GP4 B;  3NSB A;  1IW6 A;  3UTV A;  3S8G B;  4HYX A;  5G36 A;  3VW7 A;  3QJV B;  4FAA B;  5F8U A;  3EML A;  3WQJ A;  4EJ4 A;  4GPO A;  4X32 A;  5AZD A;  4IAR A;  5G2C A;  5H2N A;  3ZPQ A;  1AT9 A;  3QJU B;  2Y00 A;  1P8U A;  2Y03 A;  2I35 A;  3V2W A;  5G2A A;  4WW3 A;  3VI0 A;  1M0M A;  2KSA A;  5LWE A;  1JV7 A;  4N4Y B;  2L6X A;  3HAO A;  3NS0 A;  3QBK A;  3HAR A;  1XIO A;  1O0A A;  2R4R A;  4PXF A;  2KS9 A;  4FBZ A;  4LDE A;  1X0K 1;  1QM8 A;  1S52 A;  4GP8 B;  1IW9 A;  2F93 A;  1R84 A;  4QID A;  4QI1 A;  5B6V A;  4KNF A;  2PED A;  2YCY A;  4DS7 E;  1JFP A;  2EI4 A;  5B6Y A;  4G7Q B;  3SN6 R;  4IAQ A;  4N4W A;  1XME B;  4L6R A;  5AHZ A;  1XJI A;  1KME A;  2NTW A;  4GRV A;  4UHR A;  2I21 A;  3OE9 A;  1E0P A;  5DHH A;  3P0G A;  5FJG A;  4BEY A;  5H2H A;  4TL3 A;  2Y04 A;  5B34 A;  3V2Y A;  4BEZ A;  4UG2 A;  4XXJ A;  4G7R B;  2WJK A;  5H2J A;  1H2S A;  3QJT B;  5BR2 A;  4FA7 B;  1R2N A;  3UG9 A;  2LNL A;  1FBK A;  5JJN A;  2RH1 A;  3X3B A;  2ZFE A;  5C1M A;  1QKP A;  2KSB A;  3EH4 B;  5B2N A;  5G2D A;  5AWZ A;  3PWH A;  1L9H A;  2I1X A;  3HAP A;  4JKV A;  1X0S A;  1AP9 A;  5AX1 A;  3NY9 A;  4GBR A;  1QKO A;  1M0K A;  2M3G A;  3ODU A;  1C3W A;  1GUE A;  3C9L A;  3BVD B;  1Q5J A;  2F95 A;  4BVN A;  2Z55 A;  1S8L A;  4XTN A;  3VGA A;  3QBI A;  5A8E A;  4JQ6 A;  3COD A;  4MD1 A;  3ZPR A;  4MBS A;  2I20 A;  2YDO A;  5DHG A; 
#chains in the Genus database with same CATH homology
 1TN0 A;  4AMJ A;  3C9M A;  4G7S B;  5TGZ A;  4G71 B;  5G28 A;  3D4S A;  3AYN A;  3HAN A;  3RZE A;  3OE6 A;  1UAZ A;  4LDL A;  4WAV A;  5G54 A;  4X1H A;  3HAS A;  5BR5 A;  3UTY A;  3REY A;  1C8S A;  4HWL A;  2QPD B;  1P8I A;  1F50 A;  5B6X A;  5H2O A;  5J7A A;  1S8J A;  5B35 A;  4GP5 B;  3UZA A;  1S51 A;  1X0I 1;  3QAK A;  4A4M A;  2KSY A;  4LDO A;  3PQR A;  1BRX A;  5DYS A;  3MBV A;  1GZM A;  4J4Q A;  4XTL A;  2ZZL A;  1JGJ A;  1MGY A;  4BV0 A;  3HAQ A;  4JR8 A;  2R4S A;  2ZIY A;  1PXS A;  4G72 B;  3UON A;  1BRR A;  1EHK B;  2YDV A;  4DKL A;  5JJE A;  1M0L A;  5H2M A;  1H68 A;  5H2K A;  3DDL A;  2Z73 A;  1DZE A;  3QDC A;  4AMI A;  4QRY A;  3EH5 B;  3PBL A;  5H2I A;  2YCX A;  1Q5I A;  3S3B B;  2G87 A;  1BM1 A;  1P8H A;  4EIY A;  4G70 B;  2BRD A;  3X3C A;  5A44 A;  1HZX A;  5JJJ A;  3QJQ B;  1F88 A;  2AT9 A;  3QBG A;  2VT4 A;  1L0M A;  2J4Y A;  2WJL A;  4K5Y A;  3S3D B;  1CWQ A;  5EN0 A;  5KKH A;  3RFM A;  1PXR A;  4MQS A;  5B0W A;  5ITC A;  3KJ6 A;  4MQT A;  4PXK A;  4X31 A;  3QJR B;  4MD2 A;  2YCZ A;  4XTO A;  4HYJ A;  3S3C B;  4BUO A;  3COC A;  1KGB A;  2Y02 A;  3DQB A;  2NTU A;  3AYM A;  3VVK A;  3T45 A;  3S8F B;  1IXF A;  5B6Z A;  4OV0 A;  5ETZ A;  4L35 A;  4NC3 A;  5H2L A;  3UTW A;  4BWB A;  4N6H A;  3ABW A;  3VG9 A;  3CAP A;  2HPY A;  4EA3 A;  3A7K A;  5H2P A;  3PXO A;  1LN6 A;  5AX0 A;  4DJH A;  2Y01 A;  3EH3 B;  4KLY A;  1GU8 A;  2JAF A;  1KG9 A;  3QAP A;  3UZC A;  2JAG A;  1VGO A;  1U19 A;  1S53 A;  3ZEV A;  4Y9H A;  4XT1 A;  1BRD A;  3AM6 A;  1UCQ A;  3QJS B;  4DAJ A;  3VHZ A;  1PY6 A;  3OE8 A;  3OE0 A;  3OAX A;  1FBB A;  3PDS A;  4FPD A;  1C8R A;  1S54 A;  5ITE A;  5G53 A;  1E12 A;  3NYA A;  1JV6 A;  2YCW A;  5A45 A;  1VJM A;  4GYC A;  1KG8 A;  2QPE B;  2X72 A;  1TN5 A;  3QBL A;  3NY8 A;  1QHJ A;  5B6W A;  3UTX A;  5AHY A;  4IB4 A;  1F4Z A;  4XT3 A;  4GP4 B;  3NSB A;  1IW6 A;  3UTV A;  3S8G B;  4HYX A;  5G36 A;  3VW7 A;  3QJV B;  4FAA B;  5F8U A;  3EML A;  3WQJ A;  4EJ4 A;  4GPO A;  4X32 A;  5AZD A;  4IAR A;  5G2C A;  5H2N A;  3ZPQ A;  1AT9 A;  3QJU B;  2Y00 A;  1P8U A;  2Y03 A;  2I35 A;  3V2W A;  5G2A A;  4WW3 A;  3VI0 A;  1M0M A;  2KSA A;  5LWE A;  1JV7 A;  4N4Y B;  2L6X A;  3HAO A;  3NS0 A;  3QBK A;  3HAR A;  1XIO A;  1O0A A;  2R4R A;  4PXF A;  2KS9 A;  4FBZ A;  4LDE A;  1X0K 1;  1QM8 A;  1S52 A;  4GP8 B;  1IW9 A;  2F93 A;  1R84 A;  4QID A;  4QI1 A;  5B6V A;  4KNF A;  2PED A;  2YCY A;  4DS7 E;  1JFP A;  2EI4 A;  5B6Y A;  4G7Q B;  3SN6 R;  4IAQ A;  4N4W A;  1XME B;  4L6R A;  5AHZ A;  1XJI A;  1KME A;  2NTW A;  4GRV A;  4UHR A;  2I21 A;  3OE9 A;  1E0P A;  5DHH A;  3P0G A;  5FJG A;  4BEY A;  5H2H A;  4TL3 A;  2Y04 A;  5B34 A;  3V2Y A;  4BEZ A;  4UG2 A;  4XXJ A;  4G7R B;  2WJK A;  5H2J A;  1H2S A;  3QJT B;  5BR2 A;  4FA7 B;  1R2N A;  3UG9 A;  2LNL A;  1FBK A;  5JJN A;  2RH1 A;  3X3B A;  2ZFE A;  5C1M A;  1QKP A;  2KSB A;  3EH4 B;  5B2N A;  5G2D A;  5AWZ A;  3PWH A;  1L9H A;  2I1X A;  3HAP A;  4JKV A;  1X0S A;  1AP9 A;  5AX1 A;  3NY9 A;  4GBR A;  1QKO A;  1M0K A;  2M3G A;  3ODU A;  1C3W A;  1GUE A;  3C9L A;  3BVD B;  1Q5J A;  2F95 A;  4BVN A;  2Z55 A;  1S8L A;  4XTN A;  3VGA A;  3QBI A;  5A8E A;  4JQ6 A;  3COD A;  4MD1 A;  3ZPR A;  4MBS A;  2I20 A;  2YDO A;  5DHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...