2Y07H

Crystal structure analysis of the anti-(4-hydroxy-3-nitrophenyl) - acetyl murine germline monoclonal antibody bbe6.12h3 fab fragment in complex with a phage display derived dodecapeptide ppypawhapgni
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
215
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTAYNEKFKSKATLTVDKPSSTAYMALSSLTSADSAVYYCARYDYYGGSYFDYWGQGTTLTVSSGGTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTAVDKAIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Elucidation of the Mechanistic Basis of Degeneracy in the Primary Humoral Response.
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTI-NP MURINE GERMLINE MONOCLONAL ANTIBODY BBE6.12H3, HEAVY
total genus 40
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 2010-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2y07H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2y07H02
3U48A 2XN9A 1LO5B 5IESH 5D72H 1GOHA 4UQ2B 1MJ7H 5KW9L 1XF5A 2A77H 5I1JH 1RHFA 3O2DL 5JDSA 3U0WL 4UNTA 3VE0B 1I8IB 2DQFB 3SGDH 3SCMA 3V0VA 4NO3A 3V0VB 2CKBL 3IU3A 4MHHG 2DQUL 3EOBA 3L95B 4LIQH 2BMKA 5LQBH 4LFHG 1MWAL 2PO6B 3I75A 3CLFH 3QG6A 4JCMA 3ULUC 4IM8A 3UBXG 1ZT4A 1AJ7L 5I30H 1RZ7H 3LVEA 3MZGB 2YD2A 5D7JC 2V5MA 1XR9A 3JWDL 4ZFZA 1I8MB 1YEEH 1QLEL 1MUJA 1Z0MA 4JZOB 4JFFB 5CJQH 4DGYL 5GS2H 5EFIB 5T3ZD 5DYOB 4L8CA 3ULUH 4DW2L 5GSVA 4YHIA 4LMQI 1NCAH 4QNPF 3GKZA 4KK6D 1HQRB 1WTLA 4XX1G 4R4ND 3W5MA 3V6BR 4JLRA 2HLFC 5IHUH 2PTTA 3WFDH 4ZTPH 4LOUD 4U1NB 4ZD3L 2DM2A 4XCYB 3T3ME 1BVLA 1VADB 3GIZL 4R8WH 3DUSB 3BZEA 1NC4B 1D5BB 4NKMB 1MVFA 3VFGL 4OF3A 4C55A 4YFEA 1XMWA 2A74A 4JDZB 3FZUC 1BBDH 5SV4A 3RUGF 1UWXH 3CZFB 4M6ML 3CCHB 2IANB 4R4BB 3BSZL 3DV6A 4DVBB 2BZDA 2E7LC 4X7TB 3U0TA 3CNKA 1ZHKA 1HHHB 4XI5C 5H8DA 5FYJL 3TH2T 3KS0J 4UT6L 3O0RL 3SDAB 5D2NC 4EI5B 4UU9A 3T65A 3NCEB 3O9WB 1MIEH 4MX7A 3N85H 1FAIL 4NC1C 3QHTC 2GAZA 4WWID 3QEHA 3ARFB 4P23D 2LU3A 2V9QA 3ULVH 3GBMH 4HWZB 4ZUWA 3MUGA 3PG2A 4MB4A 5DC0A 3LV3B 4KDTA 2C3HA 2NW3A 4X8XA 2VXTL 3QQ3B 3AB0B 2QLVB 4DKDC 1S7XA 4NQEB 2FIKB 4Y5YB 3HMWL 4F15C 2CDFB 2CXKA 1S5HB 4HXBL 2GSGB 4JPKH 3EDDA 3KPLB 1NMAL 1SYSA 3QNYB 1DEEA 4A2MA 2X9YA 2HTKD 5FUCC 3NN8B 2X4QA 2BSRA 3S97C 4OLXL 4DGIH 5IGXL 2VZTA 3RL2B 5LWYH 4MA7L 4XPHH 1VGEL 5D5MF 3DETD 5CBAA 2DQIL 2YA1A 2HTLD 4PJDA 1T0NA 4QHLA 4IOIB 1XGTB 2CRMA 3KPNA 5E2JA 1SBSL 4GT7A 4Z18A 3ALXA 5JOPE 1NMCC 2FRGP 4X6CE 3DMMD 1CBVH 3LEVH 2W65A 2X1QA 4PG9B 1XCTB 3TBWB 3BO8A 2MHAB 1F3DH 1AGBA 5D70L 5D1XD 3BE1H 5EUOB 2BY1A 4X6DB 3HZVA 4HWBH 4HFUL 2ERJC 4EI6A 3G5ZA 5IM7A 2Y6SC 4WWKB 4LLVA 2ZPKH 3DYOA 1IZJA 5M7QA 1GZQA 3K74B 2A73A 4ZFGH 5H94A 4HUWB 1EBPA 1PSKL 4GG8A 3KYNB 3O6FD 2ADFH 1UM4H 4I4WB 4M93B 5DD1L 3Q5OA 3CUPB 5E08L 3D1MC 3V5DB 4I4WA 1K2DB 4F33B 4PRIB 3UXFA 1V7MH 1VPOL 3BPLB 2IAMC 2M8XA 3CZJA 3M8OH 3F7YA 1J12A 5D1ZB 4IRZL 4OZHA 1LO3L 3IJYA 3BUYB 4NZUH 1LDSA 1VFBB 1T20B 1EBAA 4I1NB 1F3JA 4R9HA 5GHWL 1N4XH 5IVXB 5CSZA 4L8BB 1A6VH 1CLCA 1MAKA 4LAJH 1YY9C 4NQDA 4WI4A 5E95B 4PGDA 1JPGA 5IB2A 5IMKA 3ARDD 3GKWL 3B9KD 1WC7A 5B38G 2RJMA 4QRRB 2A6DB 3KPRE 4JKKA 5F8QC 4FRWA 3QDHA 1K8IA 2J6EH 3T4AA 1HHKA 1T7ZA 2J8UB 1EEZA 5CBAB 4Z7UB 4KTEH 1LGVA 4G8GD 1OP3H 1OY3B 2BSRB 3TJHD 3O6FC 4Z0XB 4G43A 5D7LB 3FJTA 4J7RA 3FOMA 43CAA 2I5YH 1UWEL 5EO0B 3KPLA 4JM2C 3WNMA 2VXSL 2XZAH 3CLEL 5DTFA 2LU4A 5H35B 3BP4A 5KG9A 1ZE3C 3HE7B 4Q9RH 3ZT6A 4OQTH 1HHKB 3ILQD 2KZWA 4J8RA 3CGTA 4LSUH 1IC4L 1AR1D 1WC7B 4DTGL 4D0BB 3V5KB 4I48B 4OIIH 3MV01 5C0CD 2FO1A 5CKAA 3WXVL 1Z6JT 1UM6H 4MB3A 5JORA 1P2CA 1LILA 2K7PA 2EYRA 1KEML 1KTLB 4UOW1 1BFSA 1OQOA 1CN4A 3WHXA 1QFHA 4NFBA 1JNNH 1BZ9B 4FFZL 4RMUA 4PGBA 3VGFA 4HJJH 4UOJA 3VH8A 3G6AA 4PGZA 3QCUH 2JTDA 4IRJB 4PUBH 1RZKH 4DVRH 2DQTH 2H3NA 5HYSB 1VKXB 2DRUA 1YDPB 3UTQA 1I8LA 1G7IB 1CG9A 1LE5A 2MMXA 4JHAH 4M5YL 2MPAL 3WJJC 1P7QA 2E7MA 1RUQL 5CZXC 1FGNH 1H3UA 1K8DA 2DLFL 5GRWA 4BSVA 3L1OL 3N06B 3HHRB 5TH2B 1OCWL 1ZT1B 4LF3B 2W0FB 1H5BA 3VGBA 2QQKH 1A7NL 3E6FB 1UYWL 3TT1H 1U3ZA 3IAGC 5DD5H 1BEYL 5KSVA 3CPLA 4G6MH 5INCA 5D5MA 3HG1D 4OD2B 5I1LA 4AIZA 3P0YL 5CILH 1RZJH 5JXAH 1HQRA 5DMKB 3MLSH 3T4YA 5I8OH 1SVCP 1T04B 4C56B 3WO4C 1F58H 1TQBB 1HH6A 3RWEA 4OUOA 4WFGE 1BVKA 4DK3A 4WFHD 3SCMD 2W65B 4LPUA 4U7SA 5I1IL 5ISZD 4HKBA 1I8MA 2D31B 4A6YA 3HG1B 3S36L 3U30C 1DBKL 5E8EB 5LXGH 1AFVH 5E99H 4KJPD 1ZT4B 3IDMB 1QQDA 4DZ8B 4JO2H 3TV3H 2X4OA 1XF3A 3NTCL 1TPXC 1T7VA 2ICWJ 3VWJC 3PNWB 4JREB 4EN3B 3NN8A 1F4AA 3IU3B 2FB4H 2BDNL 3P9MB 5HYJA 4LAQL 2OSLB 5EU4B 4D0CB 4MNQE 5FGCB 1NKOA 3W39A 2Q8BL 1FL6B 5BW7C 1IEAA 4PB9L 4W6XB 4Z7WF 1LK2B 1ZWIA 1B3JA 2EEBA 2QSVA 3D69B 4OQTL 3V0WH 2DM3A 1J8HD 4R97B 3RA7H 4WO4C 43C9B 2VDRH 2VDOL 4TQEH 4FFWD 4L9LB 3BGAA 2Z4QA 4WHCA 1UZ8B 1RZKC 4MX7B 3OJVC 3P9LB 3OKOA 5HJ3A 3QEGH 2IFGA 5DD0H 1IGYA 3GMPA 1G7QB 5E5MB 4XGZA 1EUTA 3WYRA 1CGVA 3N0PB 4HF5L 3ZTJG 3VW3L 1RZKL 3VFPB 4RFOH 3VGDA 2Q76B 1JTOA 4G6AD 2R23B 3PABA 5GRXG 4RMTA 1QSVA 4CMHB 5HGGS 1E4WL 1JUFB 2Y5EA 5E8DH 4Z7NE 2R2HA 2AERT 1JPFB 3DXAE 3O45B 3SDCB 2CJUH 4IDJH 2G5RA 1JJUA 4P2OC 4RGOH 2DIAA 5GPRA 3UPCA 5FGBA 5MERB 3QZWA 5T5NG 2F19L 1LO2H 1QFWH 1S8DA 2WUCL 3MCKA 1UYWH 4NN7C 3TT1L 1YC8A 3LIZL 3C6SB 3PQYB 1GVIA 1U0QA 4P23A 1B2WL 3MA9H 3HUJF 2DQHL 4PRBA 1QPXA 3LMJL 2BSSB 3ZKXB 5IHUL 1KPUA 4MJ6B 3VG0L 2LVCA 2Q86B 4XAKD 3UYOD 5I1EH 1FPTL 1ZVSB 4XNZC 3IKKA 2NR6D 4ZUVA 2OL3A 4R8WL 4J2XA 2AJUH 3I50L 4Z7WB 4RX4D 5GGRA 3U46A 1KXVC 4PJXB 1BQHG 1FDLH 1WAAA 5I17A 4P5TD 3MLRL 5E2TH 4ZFZB 5F71A 5BRZA 1TJIL 3LS5L 1Q0YL 2A6IB 5GGSB 4OLXH 2DLTA 4I9WE 1RIHL 1JWMB 1MAJA 1D6EB 3CXHK 4JVWA 3QG6B 2A9MH 5EU5B 3C5ZB 3HE6A 3SDXB 1EPFA 2BVQA 2ZUQC 1ZVSA 3AREB 2Z31B 3PUCA 1KTKE 4U1LA 3WFHA 4MJ6A 3A6OA 2EYTA 3DMMA 4MQXD 2CQVA 3INUL 4L4TA 2BRQA 3G5YB 4LAQH 3MXVH 3TVMB 4M1GH 3C2AH 1NCNA 4KI1A 3C60A 1QFUL 2GK0B 3EKCA 3ZDZF 1J1XL 4RIRA 4MA3B 1FVEA 1Q0XH 5EB9A 2W9LA 4PRAA 3O3EA 2K3TA 3Q1SL 2KKQA 3GHBL 5FGRA 5C9JA 3FT4A 5JR1L 4NQCB 3QFJE 2HN7A 2V2WA 2GUOA 1JUFA 2DQJH 4WEMB 4YHKH 2VB5A 1UZ6E 5I1GH 2IC2A 3BZ4A 3CSYB 5ANMB 5IQ7L 3VFPA 3VDCA 4IJ3C 4YFLI 3P11H 1AY1H 2IBBA 5KSBE 1Y6MR 2VXVL 3P3YA 1A4KB 1ZHLB 4LQFL 3V8OA 5E5MA 1T22B 5F7HA 2NY5L 5FV2A 1FZKB 4RFOL 5J1TC 2QHRH 2E7HA 4ETQB 1PLGL 4F7TB 2P8PB 2H1PH 2R4RL 4F8TA 4DUVA 3O6MH 4DWHA 3CVHA 4G6JH 3ZE1F 2X4TB 2ZSWB 4YAQA 1J8KA 1P4IH 4X4ME 3QXAA 3F7VA 3WFZA 4QOKB 2PXYB 3QJHA 3GJFA 2NY1D 2E8YA 2V5TA 5HTSA 3HS0A 2FCBA 1FNEB 3SDXF 3GIVA 3UO1L 3D2UB 2YUXA 2ICEB 5CIPA 4CBPA 2QQLH 1M6OB 2PTUA 3G04A 4D0CA 2VZ3A 1KSRA 5ERWA 5J11C 4N8CL 1OT1A 4GUPA 5ADPH 1RUPL 4KY1H 1T66D 4NN5C 4PGCB 2DB8A 1UB6A 3ULSA 3RDTB 5CHNA 1K4DB 5D6CA 2Z93B 4GG6F 1FVCB 3SDYL 1N7ML 3IDXL 1HDMA 3DGCR 5DLMH 1A1MB 4HMEA 2P49B 1NLBL 1MI5E 3BQUC 5IROA 2CIIB 3VGGA 4I9WD 3BHBB 3I02A 4UBDD 5EBWA 5E8EA 4U33A 2MQCA 1CDJA 4M8VA 1WCBB 2ZUXA 3HG1A 2BY3A 4JGJA 2FL5A 5C0ND 1KPVA 4F58L 4GMSL 2EDHA 3IU4L 4M93C 4Y1AE 4GAFB 2VDLH 2DKSA 5BVPL 5EORH 2WBWB 1HH6B 1WZKA 4XNZB 5GRJL 5ESVA 1MQKH 1KLUA 2AAVA 4JY6A 1DE4A 1GGYA 5IB3A 3WUWG 3ZKNC 1J1OH 2BJML 1FYHB 3UTZB 2ZUQB 1GGCL 5E0QA 1NGZB 3WXWL 3Q6FA 3AM8C 3GJEA 3S3PA 1BFOA 4XAWL 5KSVB 2B2XH 4OCYL 4BH8B 1QSEE 2YD9A 3E6FA 4CU6A 5BV7C 1I1FB 2XG4A 2Z9TA 3VRLE 4OLWL 1UB5A 3WNOA 3O2WL 4TPRH 1IAKB 1TCRB 4MDIB 1JGLL 4WHTA 2P47B 1YMME 3LKOA 4AG4H 4PJGB 3B5HA 2YPLA 2ZWLT 3TIEA 4A6YH 2J8OA 1JMZA 3D39B 3F8UB 4FQIH 5FKAA 1ZT7B 4L4VD 4K8RD 4OD1H 4M1CD 1DBAL 4L3EB 3IS0X 3OR6A 3I9GL 4M5YH 4L1DA 3B9VA 3VH8B 1I9IH 3VFGH 3DHMA 2I9TB 3U4BL 1VFMA 4S1DD 3BH9A 5D2NA 4I77L 2ZZUT 3DXAA 5CIPH 5C09D 1J88A 5JW5A 3TNMA 5D96B 1MVUB 3X3FH 4F7MB 5A3ID 5C0BE 2DJUA 3QUZC 1CDUA 5DUML 2G2RB 5EZLA 2NY7H 1XF4B 2OS7A 3R4DA 4NCC2 3CFJB 4WHTB 4XVJL 3CD4A 2F74A 5LVEA 4P2RA 4HAFA 5LJYH 4J4PC 5HHME 5HI5C 5HVFB 1WGOA 1P84K 1MCJA 2V5SA 2XIDA 4M7LT 5J3HC 5H35A 2Y72A 5EO9B 4GQ9L 4NKIL 5ISZA 1QP1A 4KMTL 1PYWB 5C0IB 3HFMH 4Q6YA 4KJQC 4DN3L 4PV9B 1FFPA 5HDQH 2P45B 3I85A 1KBGH 5EC1A 4EQ2A 5ADPL 4RAHA 5DJCA 5EOCJ 1CQYA 3UTSD 1N5AA 1RUAH 3RWDA 4E42B 1G6RH 1CR9L 3MRGB 3RHWK 4BFGA 3VXUD 4JM2D 3PIQA 3U7AA 2IG2L 4HUVB 3PHOA 3NFNB 3P73B 2I60H 1AHWA 1S7TB 5MEPA 5J6GA 1IC1A 1PZ5B 5E2VH 1MHHA 4P2QA 3GM0A 5SV3A 4X9IA 5IMKB 2AXFA 1LO0H 1ETZA 3IU4H 4NUGL 4Z8FH 3LS4H 3U9PH 3QEQD 2E6QA 4GKZA 2Y5TA 1IC5L 1NUNB 4KWUA 3WN5A 2VIRA 4DZBB 1I9JL 4PG2C 2FHCA 1R3HB 1NFDB 2IPUG 5HYJE 1BF8A 4UIKL 1UB6B 3FFCA 2IH1A 2A2QT 3QO1B 1OGTB 1HH9A 4Y0GA 3F7YB 3EJYD 1M6OA 3EFDH 1RQ5A 4YBQD 1FZMB 1UWXK 5EH1A 3ZE0E 5I1KH 1ZS8B 2R29H 3REWB 4Z5RA 5DC9B 3SQBA 2DBLL 4MAYC 3BDYH 2C3VB 5CJOL 3F7VB 4OZGA 1R5WA 1IAOB 2NY0D 3W9DA 3VW3H 3FFDA 1WBZA 4FQCH 4JHWL 2Z8RA 1T66C 4BH7B 5FYLH 2ED7A 2YUVA 3CJJA 1DDHA 2LTQB 1PX3A 3C9NA 4HIEB 2SEBA 1SHMA 3K1DA 1YYMH 1UCBH 3QUXC 5IIEB 1JPSH 4OFYD 3EJYC 2H2SD 5AAMA 5IM7B 1MFDL 2AI0L 1AO7E 3H7LA 3HUJA 4LEXL 1I9RH 3FQUB 1U8HA 3DARA 1IRAY 3HPLB 1XT5A 3CSYA 1FGVL 5DD3L 3OXSB 4WU5A 3QWOA 4LDOB 3BO8B 5BCAA 3MV7A 3MLWL 5EUOE 5J7CC 1HQ4B 4CRPA 1CF8H 1P9MA 4TNWF 5EZIL 1QNZH 4YQXL 2YPVL 3GI9H 4Y19A 1I7ZB 5ADOL 3MGAA 3TGXA 2GTZB 1EIBA 1XAUA 4C4KO 1TVBA 4EUPH 5F3BB 6FABL 4LVNC 1NBVH 4PJDB 4XAWH 4ZXBC 3MRPB 4KK9C 3S37H 3GSRA 2R0LL 5DD0L 1GJIA 1KB9K 5IBUB 5E1AA 5DJ6A 4C83B 4IS6A 3BZFB 1C5DA 1DEEB 4XWOC 1ORSA 3IJSA 3F12B 2DLGA 3FT3B 2ZUVA 2Z31A 4K3GA 5F6IC 3RTQC 3LN4B 5D7SH 1BM3H 1YNKL 4HG4K 4G9FD 4ORGB 5D2LA 1JWMA 1F3DJ 1ZTXH 2MNUA 4LHUG 2UWEF 2H9GB 3EOTH 4TTDC 1AD9B 4KQ4H 1EZVY 3MJ8A 1XIWB 5BJTB 1TVHA 2ZUTA 3SE3C 4JPWL 4KHXH 4PBVC 4P2OB 1MIML 2CKNA 1U8LA 4G6KH 1FORL 1BECA 1X4YA 4LVHB 5A3IC 1NDMB 3HC0B 4ZUVB 2A83B 1CLOH 1GHFH 3PP4H 4YK4C 2Q86A 3CXDH 2OTWB 4XNXH 2VR4A 5J57B 3MBEA 1INDH 4X0KA 4JFXB 4N8VB 5EC2B 4LVEA 4ZD3H 4AIXA 3QA3A 3S5LA 2UZYB 5CD3B 1TNMA 1FJ1A 3HNSH 3V5HB 3SKJH 1MCSA 5I1JL 3OKLB 3QG7H 1U8KB 2VLRD 5MERA 5FF6A 5JXED 1WZLA 1X5FA 1U2CA 4U1IB 3QCUL 5TJWK 2IFFL 2E9JA 1OT2A 3MV9D 1AP2A 1IQDB 3GSVA 4JZJC 4WTZA 5IFAL 4MD4B 5GGQL 2O5YL 4PRPD 4R7DA 5HHMD 5KVFL 4JZNA 4MVBD 1D5XA 4OJFL 4WVRA 1AJ7H 4NM8L 4R7NB 4YXHL 1U8OB 4NPYB 4QHUA 4YDJA 3VI4F 1FO0B 4XTRC 1IQWH 3S34L 4G9FB 3U9PL 3W11D 5B38A 2XWBB 1IGJA 1RULH 5DYOA 4GW4A 2FJHA 3SKUD 3D18B 4JY4B 5C3TA 1EVTC 1NBZB 3GRWA 5IK3A 5J0BA 5DK3A 4QRPB 3JXAA 1T83A 5LKNA 2BOCA 3P77B 3HCVA 1G0XA 5DEGA 3GSNH 3IDNA 2DYPB 3VD9A 2NR6C 5INDA 4GKNA 3EFDL 3FO2A 1EHLH 1UJ3B 1F11B 5FECA 1IBGL 4U6VL 3QUXA 3WFCL 4Z9KB 4ZS7L 1T5XA 4JKWA 4L29A 3ZT7A 2OSLA 3QWRA 4GRWE 1JYWA 3U4EA 1I8IA 2DQFA 2WLZA 1MCOH 5E8NB 5KVMC 3C6LA 3LHPL 1P7KB 3PNWA 1FNHA 2O61A 3GSNB 1U3HB 1YEGH 3WFBL 5LGJA 2EH8H 5DO2D 1DBJH 3NFSL 1MEXH 4DUWA 1AGFA 3R06B 3MRNA 3JTTA 5F7YC 3DYMA 1WIOA 4ZO6A 4DEPC 1CCZA 1YUHA 4OSUL 2MJWA 5E8PB 1CT8B 2NXZC 3KPPA 2VAAA 4JM2A 2XTJB 5DD6A 3NA9H 3VXUE 4EVNB 1E6OH 3MMEB 4C56A 5EZIH 3KAAA 5GGRY 3PP4L 4JN1L 4BSWA 4YX2H 4HKXB 2XQYG 4I2XE 3UZEA 3ROOB 5CAYB 5DJ0A 5IJKA 1OW0A 3F62A 5F3HA 3S4SA 4XPBH 5C70A 4OB5H 3MV9E 3KNBA 4NN6C 2K9UA 3D87B 1LEGA 4JPKL 1DL7L 1LD9A 4ELME 3MUZ1 1F4YL 4QCIA 5C09A 1ZAGA 1MCNA 2R15A 5CEXB 4XXCC 2YRPA 5T1DH 1LE5B 4WI8A 4JO2L 3HTLX 3WDHA 5C0CB 1MWAA 1LE9A 3FKUS 4XP6H 3NTCH 2C1PB 3TESA 5AZ2L 1E6JH 1T1WB 2AGJL 3WO3B 3GSOA 4LCIL 3HKFA 3VRJA 3BGMB 4LPYA 1OGAD 3ARPA 5GS1B 4MJ5B 5IFHH 4OFPA 3B43A 4HZLA 1OL0A 2FGWH 2J88L 3AY4A 3BXNB 3O4OC 5BVJA 5JOEA 4JM2B 1RURL 2X1OA 1A3RH 4KVCH 3E2HB 3R0NA 2ZCHL 1GPOH 3M45A 4KMTH 1BD2E 1JGLH 4D0BA 4J12A 4KXZH 2J3SA 3HMXH 3ILPA 5SWSE 5SWZE 3B6SB 4KVNH 3NABL 4M61B 4IIQB 4GXVH 1X5AA 5DFWH 1NFDF 4Y2OA 4YK4B 1UM5H 3DX9B 3BPNB 1A0QL 1JN6A 1P7KA 2FJFA 3QH3B 1OM3L 4JM4H 3B9KB 2AS5M 4NN7B 3KYKH 4YHOH 3HI1A 3O11A 3N9GL 1UGNA 4PJCF 1F11A 4J3SA 1NLDL 1JPST 3PQYE 3IF1B 1VA9A 5F1NA 2YC1B 3NCJH 2D7MA 3RRQA 1AE6L 4MNQD 5F89A 4M6AA 5TQ2H 1U8IA 5IK3B 1IGIH 1BBJA 2Q6WA 1MCCA 4KZDL 3RFZC 1CQKA 3ZLQC 3UJJL 2P5WE 2F8VA 1QRNA 3PWPE 4I0KA 4N0UE 1ED3B 4LQ1A 5AZEH 5FDWA 3QIUB 2AK4E 2AV7A 5ITBH 5IVXA 1OOAA 4DCQA 4ZOCA 4OM1L 4XP4L 1T20A 1TPXB 4NBXB 4ONGL 1OAKL 4OV5A 2XXMB 2FWOA 4OLZH 4F2MA 3CX5J 3FO0L 3LPFA 3UJTL 4JZJB 2EDTA 4OFYA 4N1EA 1K2DA 3PDGA 2YPKA 2XZCH 4MCYA 4QRUB 4NOBA 3B8YA 4L5FH 1A7PH 2V7NA 3QQ4A 1RZ8B 1AR1C 1A6UH 2EO1A 1CICC 4PJ5D 1OTUC 3MV7D 1NAMB 5KSAC 1JGUH 2WMPA 3RIFF 3JVGC 4XP5L 3FN0H 4Y19D 2J5LB 2VLRA 1OW0C 4KJWC 3KJ6L 2R9HC 4M48H 3G5ZB 1NGXA 1OAYL 4TTDD 5EUOA 4BZ1L 1HE7A 1E4KA 1NSNH 2ZCKL 3V6ZB 5JW4R 4PG9A 2X10A 5DJZB 2PW2A 3TYFA 5A16B 4KRMB 5FKPB 3V6OC 1N0LA 1G7PA 2A0LD 2Y4SA 5DI8A 3ARYA 4LCYA 4PR5A 3UTPD 3BKCL 3ABZA 4CN6A 1BLNA 2OJZL 4RZCA 4JHWH 4MNGA 3LPGA 1N5YH 4WUKL 2X7LA 3ZHDA 4YHZL 4FQXA 4DKEL 5JHLL 3EO0B 4OAWB 4KPHH 2A77L 3OKYA 4J6RL 2OK0H 4ODSL 4CVWA 4CMHC 1W72A 2CRYA 1C8PA 2FD6L 4QRPD 2DLIA 4QOKE 5I18H 3DSFH 1JP5A 5C8JA 4UTBL 3KLHC 4XPTH 4O5LH 3IVKA 1S5HA 1C5CH 1P5UA 2ZUSA 3QQNA 4QRSA 5TGBB 3KHQA 4G9DA 1S7XB 1NMCB 3J7HA 1JF1B 2YK1L 1INEH 3T09A 4MD0B 4P4KC 5I0ZA 3QDGE 1RJLB 4ODHL 3TN0B 4X4YA 2VXUL 4OLYL 3MODH 3L7FB 2HFGL 2VL4A 1BJ1J 3CMGA 1PDKA 3EO1A 2HFTA 1DZBA 4JPIB 1HHHA 1ZHKB 2ZKHL 4ORZC 1B4RA 5EU6D 4LNRB 3GMNA 3MV9A 3K8KA 4PRPA 5HHQA 3GRWH 2FR4A 3FO0H 3MNZB 5DUPH 3KS0H 1A6ZB 2GCYA 2YD7A 3AB0C 2VDMH 3OAZH 4NKOA 5DRNB 2YD8A 1WEJH 5IB4A 3SE4A 1U8PA 4LLWB 4BFBD 1CFTB 2DQCH 1JFQH 5FGBC 3RUGB 5F7UA 3BPLC 1V3LA 4QRSB 1KELL 3REWA 1GGBL 4TSCL 5CKGA 4NQUA 3A6BH 3IJHB 2IQAB 3TT3H 3RU8L 3O6KH 3WUWA 5C71A 3O3AB 3QNZB 5BMFH 2NY2C 1QEWB 5I8KL 4U1NA 3NCJL 3HZMB 1AIFB 4RAUB 1WSST 4N8VG 1J1OL 1SBSH 3DECA 4HIXL 1JGVH 2D7OA 4FQXB 3SDDC 4P5MA 5GSVB 4NP4H 4Y4KB 1IGFH 2CD0A 1P53A 5K9JH 1MUJB 5ITBL 4UILL 1CD0A 4U1KB 1MPAL 3BKYH 3VXQA 2PW2B 1PZ5A 5B8CC 4NNYB 2WNGA 2DLHA 3ZDZE 5GGTL 3QUMH 1ZGLM 2AV1A 1IKNC 3MLVL 5C0BB 2ITCB 4LKCA 4PJHA 1BMGA 3L95A 3QPXH 1U36A 1KJ2H 4ZFOA 4Y7MA 4APQA 4AEIL 2CMRL 1A6UL 3X3GH 1ZHNB 4F9LA 1KCVH 4XBPA 4OBSA 4C56D 2V7NB 3QQ4B 1DQTA 2MTPA 3X3FL 2W92A 1A2YA 2F15A 2YPKB 4MCYB 1ZV5A 4QRUA 4GH7B 5DEZA 2RFXB 3MYJA 3KPRB 2G2RA 4JQXA 1JZ4A 5DK2A 1VFOA 4XRCA 3AU1B 1KCRL 2J8UE 1FL5B 1LO4L 1QLFA 3QUZB 5T3XL 4LOUC 5JW5B 3MXWH 4J3OC 2JIXA 2X40A 5ESAB 3BEVA 4Y1AA 3ZYOA 1KTRL 5EG6C 4L1HA 2NTFB 3QDMD 5HGBB 4P9HH 1KB5L 1OAXL 1MFCL 1MCHA 4K2UH 1Q0YH 4KHTL 2DL2A 3RZCB 2XTJC 4XPGL 3FT2B 4G6FD 4R4NC 2DF3A 2XACC 1JWSB 4JRXE 4FZ8H 1FRGH 3QYCA 2YPLB 4ODSH 1U92A 4QLRA 2X4RB 3VU2A 3UJIL 3T2OA 4PLJC 4HS6A 4OIAA 5IWLA 3O2DA 3H9HA 2VXSH 3CLEH 4H1LG 2V9TA 1DVFA 2CKBB 3RY5A 1BOGB 1U95B 4FTVA 3QFDB 5E4EC 5M95B 1NAMH 5IEKA 1U58B 1NCAL 4AT6A 2PCPB 4ODVL 2YPVH 4LSSL 4U1HA 2VE6B 3TO4C 2R1XA 2PYFB 4R6UA 4GXVL 4LEOA 3QUKA 4QNPE 1N7MH 3AAZA 3HE7D 5I1GL 5B39A 3GO1H 5DR5H 4U3HA 4E0RB 2D03H 3U7WL 1AXTH 2Z8WC 4UILH 1G6RA 1U8JA 5FUZH 1X4XA 2O26U 4G8FA 1VACB 4H20H 5KS9B 4JFHE 2O5XH 3WS6C 1HXMA 1Q9WA 4RCAA 1NJ9A 2Z93A 4HUXB 1BGXL 2BNRB 4LVOB 4PGCA 4NUJA 4QRRD 2NY6C 3VXRD 2C1PA 4NHCH 3SDDA 2UUDK 5ISZE 5SWSD 5SWZD 3G04B 4ZNCD 3MACH 1MHEA 2EDQA 3CDFA 3D2UA 3A6BL 4PJFA 4X6EA 5EPMB 1WWBX 4NQSB 4FQXD 1EMTH 4URTB 1LP9F 2F58L 4P3DA 2H32A 2Q3ZA 3G6JA 4E5XB 5DJDB 3MOBL 4EJ1C 1OP5H 1INQA 3P0YH 1NANI 2WWKT 5C0NC 3OR7B 4LL9A 3N1GC 4ZS6C 3S4SB 3DUUB 5FCUH 5HSFA 4HJ0D 3KXFD 3ZTNH 3W5NA 3JWNC 4ZO7A 2YA2A 4PJBB 2W9EH 4MD5A 1F2XK 1RMFH 1T3FA 5IR1B 2ILLA 3GDBA 4L5FL 3L3IA 5JOFB 3VA6A 1DANU 1DEDA 3VI3F 4M4RA 1HOCA 1RU9H 2DTML 5DJYA 5GGSY 2EDYA 2GUOB 4NQXB 1DQDL 4FZ8L 2WQRA 4NQCA 4RISL 4O2FA 3MREA 4JY5H 1TETH 2VRAA 5HYSG 1BHGA 3HB3C 3MRNB 3PP3H 4OZIE 1FVEB 4P2OD 4UB0H 1X5XA 3SE4C 3CK0H 4Y16C 1ZA6B 3IXAA 5BV7L 3ESUF 3PF2A 5IMMA 1QRKA 4OCSL 4PRHE 3FN3A 3WL9A 3DYPA 2LAGB 3MBXL 4YNYB 4P99A 3QUXB 4GO6B 2QSTA 5IMOA 2W60A 4WY7L 4HUXA 3VDBA 3UDWA 4I8DA 5B3NA 5FM4A 3HNSL 4RBPK 1FAKT 3BP6A 3PE9A 1AC0A 1QSFB 1MCWM 2G5BB 2Y07H 2D0HA 4QRPA 4WTZG 4Y19E 3NCCB 5L2KD 1GGUA 4G9FE 3NZHH 3RL1A 1T1XB 1KJVB 1I4FB 2XWBA 3WN5C 4DEPB 1QUNA 2NY1B 2DQIH 1PW3A 5DC4B 1I9JH 4K3DL 3C8DA 3U1SH 2ZOLB 1NL0L 1S7VB 3KJ6H 3QDME 4WTWA 3QUMB 4JPVL 4U1HB 3CVHL 5CP7A 4U1MB 1D5XB 1N64L 4RGNB 4IHOA 3U0PA 3E0GA 3LQMA 1BQSA 1JE6A 4U7KA 2AEPL 1T6WA 1SVZA 1NGYB 2G60L 3WIIH 1N0XH 3PWJB 1IJ9A 3WIHH 5F7LB 5D2NE 4LCUA 2F53A 1N2RA 3C2SA 4JFDA 3ULVD 5EA0H 4UV7H 4QHMA 4PRDB 1IGCL 1CR9H 4P5TC 4R96A 3WNPA 4KFZC 3W82A 5DVKA 5FCUL 1A7OH 3T0EE 1UM4L 4JO1H 1BWMA 4LVHC 3WNNA 4XP9L 4AM0A 1QO3B 2F53E 4Y5XB 5BO1H 4YO0B 1U8LB 4FFWC 2EDDA 1NC4D 1EJOH 3PWPA 4TRPL 3SEPA 2CR6A 1VDGA 1QBML 2VJXA 5DMIL 2XTJE 1FGVH 5DD3H 1IM9D 2PF6A 4MA8H 4NRXB 2B8OT 4RISH 1Q9OB 3LPWA 4QXUH 4GRLB 3VG9C 3ROLB 3S98A 1E4XH 1CLZH 2E7LA 2LQRA 4U0QB 2EECA 3K0WA 2KL6A 2FX8L 4M6NH 5BS0E 3EYFA 2EE2A 2NY4C 1FFOA 4O9HL 4WGVB 3IXTB 5CZXD 2QADB 4TTGA 2XA8L 3GSQA 3VFSB 3QFJD 2Q7YA 1K5NB 2BVEA 3IETA 2VWEC 3FONA 4HK0B 3SJVD 3R8QA 1QYGL 4JJ5A 2HH0H 3ISWA 1MFEL 4YHML 2X4OB 2HFFA 4ALAH 3CC5B 1DVFD 1EJ6A 2HVKB 4F57L 4HDIA 4O4YH 4FTVD 5IJVA 5DHVA 2ATKB 4HKZB 4PJCE 4Y4HD 3CIQA 3CDCA 4WI5A 3PGDA 1TNNA 5LQBL 1L4IA 3H3PH 3C5SA 1MFAL 3AVEA 1BEYH 4HLZH 4JO4L 2J4WH 3ME0A 1BIIA 2JCCF 3NZ8B 3NFPB 1TETL 3HN3A 4G7YH 4OD3L 1JNHB 3HI6L 5D5MB 4PREA 3BX7C 4Z7QF 1FZJA 4D8PA 1GC1L 4HIEA 1QEWA 4QHNB 5EULV 5EIIA 5LBSL 4BH7A 4F7CB 4AENA 3JZ7A 1ZGLP 1KJ3H 1AGDB 2G60H 2BNUA 4P48A 4Y1AD 3VFOB 3IJHA 1N8ZA 5LGHL 3BI9X 3T3PE 1R5WB 4AL8H 1OGAB 4HJJL 4ZQKB 5HHNB 4QY8A 4QY8B 3GHEH 1X5KA 5IKCA 3HMXL 3VXRA 4OCWH 4ONGH 1CL7H 4PRNA 3UTQB 3ARWA 3BT2L 1OSZB 5CGYD 3WE6A 2O5YH 2VLJE 5KVFH 3DV4B 1NC2D 3FFCB 2B0SH 1IGMH 4FZEL 1XH3A 4OI9A 5JMOC 3NFPA 2NYYC 4J23A 5ALCL 1FP5A 3V7MA 5E4EB 2FEDD 1Y18B 2WIIA 1WFNA 1P2CB 3WMSA 4LU5H 3F7PC 3G6JF 4S1QH 1ETZB 5FDYA 3TN0A 2IWGA 2AK4B 4QYOB 3LH2H 1UH2A 2ATKA 1ZLSH 4M7LL 5AYUL 2VQ1B 2ZUUA 3BPOB 3O4LE 4NDMA 4NZJA 4PJ8B 4M5ZL 4PJGE 5MI0B 2CK0H 3C09B 3L3DA 4YXKH 1FQ9C 3EZ8A 3MCLL 3V7AE 3B2VH 4NNPH 1WLHA 5KVEH 3BP4B 3ARGB 3Q6GL 5JPNA 3WIHL 2OZ4A 3GO1L 4H26B 5MEND 3X11A 1CDHA 4JJ5B 4JG1L 5GSRB 5HHOA 4YR6A 2X4NB 2X6MA 1FFPB 4KKAD 4H1LB 3BPCA 3WEXA 3LRHA 4JKMA 4EN3C 2LU7A 3W81A 5DEFB 1HZHH 3C6LC 1I3GH 4OCNC 3U83A 2R0WL 3B9KC 2C4FT 3JUYA 5DRZA 1ZGLA 4YHZH 3T4AB 1BBDL 4Z77A 1CXIA 4PJIB 5IVXF 4LCWB 4V2BA 3KYOB 5SWSA 5SWZA 2NYYD 3DROB 3BAEH 4F7MA 1EDQA 3GUTB 4KTYA 3GM8A 3LEXA 5HHMB 1KB5A 1HHJB 4XP1H 2RR3A 1KJ2B 5C0AB 3QI9A 5BVPH 4L8BA 1BQHB 1CE6A 2CDEB 1XF1A 4L8SA 4Y2DD 2I9TA 2X1WL 1MCPH 5ITFB 3W0WE 4X4MA 4BZ2L 2HYMA 4MB5A 5C0FA 4XHQA 4TQEL 3ZTJH 1TZIA 5T5FL 3VXSB 1NDGB 5E6ZA 1HI6A 1JF5A 4OB5L 1ZA3B 3FOLA 3WV0A 4MMZC 5GGVH 4HFWA 4Y89A 5DVMA 4HFUH 3WKMH 4BQBA 3P2TA 2OJEB 3SGKA 3P0GB 2N7BA 4K8RL 4LCUB 4OZFA 3UCRA 5F7NC 1H15A 1RU9L 2DTMH 3TBTB 1DTUA 4K07A 3RVVD 4Y5XC 3HR5A 2APBA 5DURD 4RGNC 1I7RB 1GZQB 5DQDL 5EU3A 5CZVL 4LARL 1HINL 4GW1B 2HFEA 4JY6B 4HIJB 5C08E 4Y8DC 4ZNEA 5I1HH 5ESQB 3T0EC 2X70A 5AUMB 2CLRA 1DQJA 1YMMD 4OKVA 3HAEB 3DO7B 5FDWB 4HWUA 3PJSB 3BIKA 3RNQA 1CIUA 4MAUH 5KVGL 5E2UH 2HLFD 4B5EA 4DGYH 3BWUC 4HH9A 4XNQB 3ZKSD 1BZ7B 2BCKB 4KK6C 3DBXB 3T1FA 2JB6B 1PEWA 4ZXBB 5E00B 3BHBA 3I02B 1F4WL 5EBWB 1CXEA 5GS0D 5HYIA 2QADC 4S1DC 4QHLB 1IC4H 1FC2D 4PJ7B 2OQJA 4Y2DB 1N4XL 2EDBA 1MY7A 1UXSB 1VHPA 3BPOC 4PJEA 4UTAH 3TA3D 3D0VB 3MLPA 3EDKA 1PKQE 1SMOA 5DJAA 4NSKB 2XKSA 3NIGF 5KS9F 1NCDH 2OTUA 4IRSC 4MXQC 3OZ9H 5ERWB 4L9DA 3WL9B 1X5HA 2ESVE 4FFYL 1KNOB 4KDVA 1AO7B 3KYKL 4YHOL 4YHLL 3CFBB 1Y6KR 5I8EB 2WP3O 1TJHH 3STLB 4RFNB 4TOYL 3DX9A 2FJGA 5FOBB 3FB5A 2G75B 3QFJA 4K3EL 1J0HA 1IAMA 2ZSWA 4JHBA 1NMBH 4YAQB 3ULUE 3T8XA 4OGXH 1MAMH 4JQXC 5D9SA 3QPXL 3EHBD 5ALCH 3HRPA 1QHOA 5JHDA 1UVQA 4BYHA 2OP4H 4UQ3B 3MV7E 1KTDA 4JFEE 1E0OB 4LHUB 3O9WA 1J0JA 2ZNXA 3HC4L 4Z95L 5BS0D 4JFEA 5CLTA 4NO5A 5F9JA 2ZG3A 3SKNA 4RWYH 3UP1A 4D9LL 1A4KA 1HWGB 3P30H 5GS1A 3U7YL 5ANMA 1L0QA 2ARJQ 2OX5A 3MRMB 2HP4A 4DVBA 4Y4HA 1TJGH 2Y25A 2HN7B 2V2WB 5C1MB 3VFRB 3VD4A 2C26A 1A21A 1ADQH 2GTWB 4JFDE 1INQB 1B0RA 3D5OF 3GSUA 1PD6A 5I75C 4Z6AT 1HZHL 3BVNB 3EYSH 3ETBF 2F5BH 2PXYC 3VH8G 3DURA 1QHPA 4M02A 5FYKE 2PNDA 2VH5H 1JWUB 2P5EB 3DMMB 5IBTL 3VXPA 4NM4L 4JPVH 4BSWB 4M7KH 1D5MB 5TFSL 3V0AC 5TE4H 2C3GA 4OKDA 3NBNA 2F9BT 2R2CA 1X5JA 4P9MH 4NQEE 1LDPL 5IVOA 1WBXA 5D7JD 4M1DH 1OAQL 1F8TH 2P5WA 5F9OL 4PJIF 2F54A 2R0ZL 1MCPL 1A7QL 4HWBL 1RV6X 2I9LA 1EFXD 1HIMH 2EZ0C 3LKNA 1QYGH 3BDBA 5C7XL 5GGRB 4M62L 5IB1B 3JTTB 3ARGD 3DGGB 1QBLL 3B2UC 3G5VB 3BZDA 3NCYS 1HYRC 4NRZA 4KK8D 1LEKA 5ICYB 1DQLL 1FSKB 2YPLE 1V7NL 1S78D 4S0TD 1I1CA 3NACL 3T08A 3G9VA 2PYFA 5JMRA 5GGUB 4OZGE 4OQTA 2VO5A 2JCCA 5TF1L 4NJAL 3QNXA 1J5OL 2ADIB 1U9KA 5JDSB 1AR2A 1Q9KA 2IFFH 1QBMH 3REVA 1KEGH 1SY6L 1S9WA 3JV6A 3QZWB 5FECB 4RQQB 1DSFH 1HEZA 3FCTA 3MRKB 4CW1A 3ARGC 4JAMA 2P24B 5HHOD 4P4KA 1OLLA 2FB4L 2RIKA 2H6PB 3VMNA 3QSKB 4H25B 1MCFA 4IMLA 5J6HB 3U36B 2R69L 3MODL 5EUKA 4JE4B 4HJGA 3OF6A 5KSBA 35C8L 4LSRL 4WI3A 5T3XD 4J1UB 4GRWB 4NPYA 4QHUB 4YDJB 3U79A 1E27B 1CICA 3BKML 5HJ3B 1QZ1A 1YZZA 2J6EL 2XWTA 4N1CA 3HZKB 2Z4QB 1O7VA 4OIBA 2CLVB 4WU7A 1UQSA 2YUZA 2FIRT 4WNQA 1MJ8H 3TO4B 5B4MC 1R5VB 2BNRE 4P4KB 2LTQC 4A2LA 4XH2B 4KGJA 3EZJB 3JWOH 1WEJL 3W0WA 4J4PA 1Y0LB 2CIKA 1B88A 3OAYK 4RQQA 4PLNC 4L4VB 4N0UA 4YZFE 1JZ7A 1BAFL 3MOAH 3TN0D 4GXUM 1EH9A 5EU4A 3QA3B 5GS3A 1QBAA 4IRZH 1S5IH 4JFXA 1NMBL 2HG5B 5L0QC 3E1F1 1X5IA 4X6DF 3D3VB 2OTWA 3ELAT 2H8PB 3RVUC 3MLUH 4YDKH 1D5IL 4LKCB 3MGOA 4KXZI 5JQ6H 1KGCD 1S9VA 3G5VA 1UXWB 4JVUA 4ODTH 4HIIA 1XCQA 5GRVK 1KN2H 1NFIB 5C2BL 4PP2A 3BKJL 5GS0L 5I76B 4W70A 1TVHB 5TE7H 3OPZH 2D31A 3BISA 4WENB 1U42A 4U6TA 5F9WB 2KZ1B 5JZ7D 2IPKA 4YPJA 1I8KB 3KPSB 4XPFL 5ABDE 4OZHE 1CFBA 1I1AC 3BT2H 3KHOA 3BRDA 1SJHB 5JPMB 1MNUH 4GS7C 3U6RB 3OX8A 5C0DA 3RBSA 3GBNL 4U3CA 4JRYA 4FQHA 2NNAB 5E94A 3IFPB 5IHZB 2W1NA 1UCBL 4Q74A 2XXCB 1LP9A 3B5TA 1CU4H 2OMBA 1DLFL 3PL6A 4P46B 5FFLA 1C5DB 3MLRH 4HBQA 5TDPA 1X4ZA 1LO0L 3U82B 5TF1H 4IS6B 1EA9C 1OSPL 1OCWH 3H9SD 4PJ9B 3U4AA 3UYPA 3VCLA 3Q2CA 4ZSOA 3A6CL 4QWWC 5IV2B 1ZLSL 2BRRH 4YDIL 1B0RB 1AKJB 4PRHB 4X9FA 5CSBA 3S4SG 2AXGA 5DRNA 1U2HA 2WUCH 5LCVH 1I7ZA 2WUBL 3INUH 1OD9A 3QHFH 3MRIA 2XY1A 3GK8H 5ID1B 2H3NB 3OSKA 3OXSA 4WU5B 2VSDA 3VFUA 1KLGB 3L6FA 4FP8H 1YY8B 3FQUA 5F6HI 3CVIL 3QIWB 4OFVA 1R0AH 4GMTH 4FFZH 3CFCH 1YQ2A 2H26B 3B9DA 3M1BA 3VJ6A 3RIAF 3UTTD 5EDXA 3OJMB 3TO2A 3JV0A 4MNGE 3FMGH 1VCAA 4JFED 5DJ2B 1WBZB 4NO2A 5DMGC 1JI2A 4S1SL 1I1YB 4X99A 3QQ9C 2VABB 5L2JB 3ARRA 1GGIH 1XFPA 2EXWC 2FJGB 2O5ZH 5AG9A 4HUUB 1BOYA 1S7WB 1K6QH 1IFHH 2HKHH 3SO3C 3ALPA 5EORL 5HHPB 4KRPC 1QVOA 1P6FA 3T2NH 1FV1B 4H88H 4OI8A 3MXVL 43CAB 2IH1B 1B9ZA 4JKPH 3X13A 4JHZA 2VDRL 1AQDA 2CK2A 2L4OA 1DBBH 5T5FH 1YEHL 4DK6A 4X7DC 4BKLB 5EBMA 1DQQB 3UPAA 1JYVA 1K8IB 2FO4A 2HT3C 1YQVH 5IG7B 3N1FC 2A6DA 2ZCHH 2HRLA 3O3BA 5DUBB 3OPZL 4XMKH 4OF0A 1DBML 1J05B 3ARED 1U41A 4KY1L 4X80L 3H3BC 3S3SA 2NY0C 4I3SH 1TJHL 4YBHA 1W0WA 1NBYB 4X5WB 2ED9A 5CSZB 4XX1E 1Z0NA 2CRIA 1DQJB 3QHZL 3IGAB 5CUSL 3MRGA 5ESQA 2ITDB 5D1XC 1R3KA 4RRPG 4UV4L 3AS3A 3C5ZC 2X4SA 3VXMD 3IFLL 5I15L 4P5TB 1MRDH 4ZXBD 5FYKD 1S7SA 2XWJB 4HG4J 5LG1A 1A5FL 4LRIA 1PYWA 2HT2D 5FM5O 2EC9T 3ARBC 4HX1B 1RULL 1WZ1H 1LO2L 3O6ML 1WWWX 2DKMA 5HI3C 1SBBA 2NQCA 4KRPD 3D3VD 5EU7E 3ZMRA 3RVXC 2NXYB 1H3PH 1HI6B 1F13A 2BVTA 3VXSA 3GMOB 4NFDA 1OWRM 3ZKXC 3I6LE 1EGJH 3ULVL 3C8KA 3ULVE 4EDXB 3DXAB 1WBYB 1GIGL 2VXTH 1CLYL 1RUKH 3EYVA 3ORJA 5I2IA 5H37H 4YHYC 3GBML 3OL2A 4N0FA 1MHCA 4P4KD 5J1AA 4JJHA 1OAZL 4LLYB 4GOSA 2V17L 4MJIA 4W6YB 3JV5A 1KB5B 2IGFH 3O6LH 5C0EA 1EEUA 4P2RE 3GUTA 3HNTL 1WISA 5DS8A 1IAII 5CD5C 2DDQL 3G6DH 3FMGL 2XRAL 3TZVD 2B0SL 3OF6D 4N90D 1R24A 5DD1H 1F02I 5LWYL 5AD0A 1CFQA 5E08H 1CGSL 3QDGB 5JQHC 1HYSD 5I74C 2F54D 1WWAX 1JGUL 3QUZD 2XPGB 1BFOB 1EFXA 1FYTA 4LCWD 1E4XI 4TNVF 1EAPA 1VEOA 1JN6B 3GSNL 2IQ9L 4MSWA 3MRLB 3MCLH 5JPMA 2DM7A 4I18C 4ERSH 4IIQC 1G0YR 1ADQL 4CDHA 4LBEB 3MNVB 5D70H 4M1CC 1RMFL 4DN4L 2CR3A 3QEHB 2FL5B 2UVEA 1KBGL 1B0GB 3E2HC 2BP3A 2HJFA 4KJWD 4OD1L 4JFFE 2EH8L 3MRHB 1G9NL 2H45A 1UXWA 4KTEL 5J89A 4ZFOL 2NY3B 1ZLVH 4G42A 5IEHA 1U6AL 3MGOB 2OL3H 1IKNA 3V52L 5D6CB 3U2SB 1K4CB 3BGMA 4XCFL 3BW9A 3FAXA 2MFNA 5L6YH 5T1LD 5I71C 3PWLA 4X7TA 2WINB 2AI0H 1SEQH 4Y4FC 4UDTA 1HSAB 3NIFE 5EIQA 3K1KC 3RY6A 3DRQA 4NJ9H 2AJVL 4JRYD 4QXTA 2CIKB 2PN5A 2YRZA 2NZ9D 3TN0C 4D3CH 4KI5E 5DO2C 5EA0L 4AENB 3HRZB 2R56L 5CWSA 4YIQB 5GZNC 3PV6A 3OAUH 1BVLB 1VADA 2IANE 2P8PA 5IQ9B 2XWTB 5F3HB 1M71A 1Q72H 3RJDA 1FZKA 5C2UB 3RDTC 3S3JA 3W0WD 4YHPA 2N56A 3CH1A 4LQFH 5GRYA 4ZS6D 2KQMA 4QTIL 5HDLA 1CFNB 1DUZA 4U6XA 2DOCA 3U36A 2D7QA 5DMIH 1P9MC 3K8LA 5CCKL 1RI8A 5EOQH 5I16B 5BOZG 2NX5E 4ONHB 1ZTXL 4WFHE 2VISA 4HDIB 4KAQL 4Q9RL 2FBOJ 4XI5D 3UTTA 1AGFB 2WW8A 4GRMB 1Q94B 3ARUA 5HGHA 4OM0L 3GJFK 1KCVL 1U3HA 1YEKL 4KTDH 3OAZK 1EFQA 1JZ8A 3EGSB 1FLRL 5CEZD 3GMQA 3DHJA 4FA8A 4CN4A 2OR7A 1DLHB 3LY6A 1GHFL 1K5NA 1XZ0A 1ZXQA 1AD0B 1WFOA 2IMNA 5GRZA 5HGHB 3FQTB 3GI8H 3X17A 4Y4KD 2IQ9H 1UA6H 3NIDF 2BVYA 1EGJL 1XGQA 4NC0B 4WFED 3GMRA 3JBG7 5GGVL 3AS2A 5I16A 1FL3B 1I3RB 4X6CB 1SYVB 3SE3A 1NBZA 3C5JA 3KPMB 1L7TL 4G8GB 1QSEB 4F7PB 2AQ2A 3LD8B 1IGJB 1BX2B 3BD3A 1EO8H 2E6JA 4Y5XA 3CH1B 4X6DE 4N9GB 3OV6A 2EXYC 4I18B 4ZUUA 4F3FA 1JWUA 2P5EA 5LCVL 1MI5A 1KCSH 4PRBB 3FN9A 3EW3B 5CEZH 2EDFA 3D39E 4XNUL 3VFTA 1MRCL 4PJHF 4NKDB 4H5SA 3P4OB 1PKQB 4JFHD 4FQ2H 5C3LD 1A1NB 2E5EA 3ULUD 4X9GA 4U1IA 4ELMA 4OM1H 4PY8J 4BQ9A 4KI5F 1LHZA 3VXTB 3B8SA 1TQBC 3IT8D 4LPTA 1YJDL 3MJGX 1L0YA 4WJ5A 1JPFA 1LVEA 2EYSA 4H5SB 1T21A 2V2TB 2EXYD 3WFEH 3QIBB 5J12B 2I07B 3PABB 4I5BA 1IBGH 2Q8AL 4X4ZA 3AGVA 2OK0L 4FXGA 2ZOLA 2I26N 1NMAH 1K4CA 5K59F 4WDIA 2EIDA 2A83A 4I13B 1IEBB 3ARQA 4W6WB 2NX5D 2YD6A 4HF5H 2ICWI 4JFEB 1BF2A 3A6CH 5E9DB 3ULVF 1KTDB 3VXSD 3V6OA 2ADGB 1T5WA 1B0GA 1UVQB 3IS1X 3MJ8B 4HD9A 4X6CA 3GNML 3VWKD 3TBVB 4Y4KC 5AYUH 4K3HA 1RJYB 3RX7A 32C2A 4H0HB 3TM6A 3QUYC 4MS8C 5JDJA 3MV11 4LFHD 3RPIB 5J13C 4N0RA 1RVFL 3OB0H 3FQWB 3STLA 5IMOB 1R3LA 4M1DL 3W39B 4JO3H 2BVPB 1ZKAA 4HW6A 1J8HA 3WKNA 1AO7A 3HUJE 3IJSB 5C86A 2FLBT 4K3JL 4DN3H 3TZVA 3V0WL 1T1YB 1EXUB 4MCZA 4KJPC 3D0VA 3UYRL 3KGRA 1Q94A 4P4RB 4DKEH 5JHLH 2BOBA 4AH2A 4KPHL 1ND0B 3UTSB 4ETYA 1KN4L 4R90H 4O2FB 1KFAL 4A6YB 3O8XB 4OZIB 4QXGH 2CO6B 1ES0A 5C0EB 1CTOA 1VPOH 2VWEE 4TUOA 2IAND 3AXLA 3MO1B 1MEXL 1FNGB 4NZTL 1CDIA 3RWEB 3L3IB 4ZO9A 5KSAA 1WITA 2X70B 5AUMA 3T4YB 5D1QA 1BJ8A 5HGAA 3P4MA 4ESKA 1KENL 4ENED 4JREC 3NGBB 4U6YB 3S37X 2JJTC 3EHBC 4NZRL 4HMDA 4M7JH 1GZPA 5IROC 4KVCL 3MPCA 8FABB 5TH2A 2F58H 1QSFE 3OTTA 1CXHA 4OZGB 3SN6N 4QTHA 2H32B 5B22A 3ARBB 3PHQA 5T1LA 2JJUA 3ZHKA 1ITBB 1ZS8A 4PJFB 4HX1A 5EPMA 2EO9A 1FZMA 1R5IA 3U0WH 1S7SB 2XWJA 3GIZH 1MH5A 1DQLH 5E70A 2WM0A 5HYSA 1MJ7L 4P5TA 1CGXA 5C0FB 3RGVD 5D7IF 4HWEH 5AG8A 1FSKC 5JIKA 2I5YL 3D85B 2ZSVA 3DVGA 3IGAA 4RGMB 1CDGA 4PJDE 4P59H 3MLYH 3QI9B 2B5IB 3WHXB 2FX9H 5MEOA 5BQ7A 3MLWH 3HPJA 4JFOA 5JHDE 3EDFA 3GI9L 3JWDC 4QGTA 4OCRH 5I30L 1QR1A 4LGPB 1I7TA 2Z92B 1WFTA 3OKEB 3MLZH 4J3TA 2G9HA 4JG0H 5BZWA 3RX5A 4YDLC 1FZOB 4PIRF 5DRZB 1ZGLB 4M6OL 5DJ8B 3HC3H 4QKXB 5K9JL 2HT3D 3UAJC 4LP4A 2VE6A 3VXNA 5DJCB 5TQ0H 3WEXB 1ZSDB 2XZQH 3WFDL 5C07E 1QVOB 4OLVH 1DVFC 2DL9A 3KPOA 2P8MB 4Z0XA 1EHXA 1U95A 1X5ZA 4XNMA 4L4VE 2W0LA 4LVNB 2L7UA 1FE8H 5D7JB 1T1ZA 2AP2A 3QULA 2G9HB 5EWIH 5BXFB 3FO9A 4NM8H 1QA9B 3L5IA 5BS0B 4UNUA 1J10A 4WV1B 2EC8A 3NMEA 4PJ5E 2JB5L 2HA1A 1EJOL 3WSQH 3ILQC 5EOTA 2MCG1 3M1BB 4QRQA 3VJ6B 3CFDA 3K2UL 1JBJA 2F5AL 3KPTA 1BIHA 1F3JB 2PYEB 3BFOA 3BWAA 1FG2A 5FB8A 2ICWA 3OR6B 1A3RL 4TUJA 3H0TA 4OZHB 5F1IA 3BIAX 4W4OC 4UT7H 5L0QB 2GITB 5C09E 1KPRB 2YEZB 2FLRT 1TZGH 2W59A 4PRHA 3RZCD 4IRJD 4JFZH 3V5DA 4CVZB 5LXGL 4KUCD 4XBPB 2EDNA 1MI5D 3DWTA 2BNUB 3EAKA 4FQIL 3NGBC 4OJFH 2BXZA 2HMIC 2YKLL 3GMLA 4QRPE 4XCFH 2FEDC 2E7CA 4B0MM 1G7HA 1X6LA 3ZE2F 1KCLA 3AREC 4V1DB 2XN9D 1FFRA 3T2PA 5DHVH 4KRPB 3ARFC 3I6GA 3VMPA 1UH4A 4CVUA 1AE6H 3TBSA 4NZTH 5T1MB 4J3VA 5DHVB 4PJXE 4XWGH 2PW1B 1J05A 1OGAE 1CBVL 3O3BB 1W72L 3LMJH 2E7BA 5HDBF 4ZAKA 1A14H 1A1OA 1T0NB 1FAIH 4O9HH 1IM3A 1FBIL 4M6OH 4BKLA 3K2MC 3RDTA 1UACH 1YQVL 3HFML 3TCXA 1T1YA 2QKIA 2JJSA 3BGFB 3OG6B 2EKJA 4AMKH 4L4VA 3WFBH 1D6VL 4JRWA 3KLSA 3FQWA 4NQEA 1NEUA 4GAGL 1KULA 4QOKA 3RBGA 4J6RH 4PV8A 4ZFFB 5IB4B 1AO7D 3BMVA 2Q3AA 3MUGB 3UPRB 3BQUB 4FOMA 5DQJB 1U8QA 5M94B 4NQCE 1A6ZA 2GCYB 1IGTA 2R9HD 4NUGH 4LLMA 4PRPB 2FR4B 3Q0HA 4JQVA 4WEBL 3TCLA 5E9DA 4DQOH 3MV9B 3DI3B 4KRLB 2BC4B 2AVGA 4F9LC 4JO4H 3NCBB 1Q38A 1ZHLA 3R0MA 3QCTL 4QWWD 4M7LH 4HT1L 4CMMB 5KSBB 4OD3H 3IDUA 1G84A 2Z31C 4GG6A 3MRFA 2AEQL 3ULVC 1IT9H 4HGKC 2I27N 2F8XC 1A7RH 4WFFD 3WD5H 2DI7A 5HDQL 2IANA 3GKWH 2EE6A 1S7RA 3EYUL 1VGKA 4M9OA 1JF1A 4PJIE 1JGDA 3GHEL 3DX7A 3SE8L 4OCWL 3VXUA 4L3CB 4RFEB 1UADC 4M9PA 1D5BA 4NKMA 4LRNL 4PJ9A 4M6MH 3VCLB 3TVMC 3QNXB 3SKMB 2UY6A 3F65A 3O4OB 4P2QD 2AGJH 5TDPB 3IDIB 4UV4H 1EERB 3STZA 5I15H 3OWEA 4CU7A 1KCSL 3QEQA 3EO0A 2OYPA 3QIBC 4XMLL 2LV4A 3TPUB 2V6HA 1D5ZB 3MNWB 3OX8B 4IEFB 1D6EA 2E9IA 1I4FA 4L8CB 3SY0B 4F7PA 1CZ8L 1QSEA 1A22B 1HHGB 3IB4A 4ONFL 4JFQA 1L6ZA 3C5JB 1EHAA 4KK8C 4MA1C 3B2UD 3FFCD 3RGVA 3E3QC 3RGVB 3CFKB 4N0CC 1AXSA 4JFQB 4P46D 2YMXH 3ZDYE 3U46B 1I85A 4XPFH 2V5YA 2VZ1A 3NAAL 3MLSL 3S88H 4KZEL 1XCQB 4HIIB 4YBLC 3SDYH 5DRWA 1FIEA 1MNUL 1Q8MA 1WICA 2CGRL 4KKLD 3UEZA 3QUYB 1D5MA 4WEUD 1ZVYA 2OCFD 2D7PA 5C0JA 3VXPB 1XZ0B 4PJ8D 1RZFH 3IDIA 1MPAH 3BKYL 3SCMB 2ARWA 3MRDB 5ELIA 1J8HE 1FO0H 4KJYB 5F1SA 4YFDB 3BVNA 1ZA6A 2R0KL 4UQ2A 1RZ8A 3PP3K 1P1ZA 4WV1C 3IDGA 1JTPA 3VA2C 5GJSL 5DQDH 3GNMH 3L3GA 4HLZG 5GRJH 4PFEA 2ZG1A 4G6JL 2MPAH 1E4XL 2JJWA 3RU8H 4DUXA 4HQQL 2JELL 1PGRB 4M6NL 2R2HB 2JF1A 5I8CA 4UT6H 4XCCL 4U6HA 3HZKA 2NPLX 4PJ8C 3MRMA 1HOCB 3H7BB 1V3KA 4L3EE 4G5ZL 1CFNA 5AZEL 4O58L 1E27A 5HD8C 4YQXH 5SX5K 3DSNA 2EEAA 3MA7B 3MRCB 1RUPH 2MCPH 3O3UN 5KOMC 4MD5B 4YHPB 3MJ9H 1QRNB 5JXAL 3LKQB 5D7IA 3B83A 4FQ1H 3SGDI 3TCLB 1KCRH 2NCMA 3MRJB 5T3XH 1W8OA 2CPCA 4IMLB 1A7OL 3PV6B 4G3YH 1WIUA 4XMPH 5F1NB 2BVOA 1S9YB 2G75A 4HJ0C 4TN9A 3RTQB 1YNLH 2XKNA 3MX0A 2PYED 1WZMA 5DWUL 4YHLH 1AFVL 5F7FA 5FGSA 1KT2B 4M43L 5CP3H 4FNLL 3VMOA 2CUHA 4PJEF 4BM7A 3ZE2E 3SDDB 1LNUA 3CDYA 5DT1H 4AK1A 4IMKC 4R0LC 2XQBH 4Q6IB 2FJFB 3QH3A 1INEL 3EOTL 3RY4A 4AY0A 5L6YL 4KHXL 1FIGH 1WT5C 1OAYH 1NJ9B 4JG0L 2FEEL 1BJ1H 1Z3GH 1N6QL 4M61A 2X89D 4TVPD 2QHLA 2UWEB 2W07A 2HJFB 5GGVY 1OARL 1H9VA 2V9RA 5GZOD 1V05A 5F88B 5I1AA 3LDBC 3BIKB 3RNQB 3OAUL 1H0DA 2WQ8A 3NIDE 3L5WB 4PBXA 4XXDA 2AJUL 4FQXC 3SKJL 2DQGL 4K9EC 4R4FH 5DMKA 1MRFL 3OMZA 5CEYA 4GW1A 2PCPA 4PTUB 3KG5A 1LNUB 3VGAC 3X14A 1GGIL 1EFXB 3NOIA 1U58A 3BYYA 4PLJD 5JNYB 2ERJB 2ZCLH 4BUHA 2JK5A 2XNAB 1PY4A 4Z7VF 5TPWL 2ENSA 5K9KA 4HS6B 3RIAK 1UZ6F 3H2WA 4NQVB 5FYKH 2F5AH 2NW2B 3RWHA 4ZMAT 4BSVB 5AD0B 2DBJA 5ENWB 3D85D 3PGFL 2BVOB 1ZA3A 3FOLB 1P7QB 1R24B 4KMLB 2DTSA 2ESVD 3BDXA 4X7SL 2MKLC 4RDQF 3EUUA 2NZ9C 4XCCH 4M4PA 1D9KC 2HJLA 1D9KA 1DCLA 1JHTA 4OZ4A 5FYJU 1P7QD 4PRHD 4MJIB 3RZCA 1HHIB 4HPYL 5FIEA 2QSQA 3Q1SH 2CLZA 2X09A 2CDEA 3O6FB 4IRSB 4G8GE 4MDJB 5EZOH 4PJEE 2HRPH 1QLFB 3O2DH 1XF2B 2X4UB 4UQ3A 3LN5B 3DROA 4I48A 3V5KA 1YUHB 4RGND 2NXYC 3LAFA 1QA9A 3V2AR 1N59A 3T8XB 1G9EA 1A2YB 1S9XB 4XVUD 3QULB 4NC1E 1GGBH 4JN2A 4MNHA 4XHJC 3BJLA 1B6UA 2VZUA 3N1PC 5I8EA 4LKXA 5ILTL 1SY6H 1U8NB 2JKXA 3MRDA 3NIFF 2P8MA 2YN3A 4H1LA 12E8L 1YJDC 1MF2H 3O41B 4LMQE 2BY2A 4JY5L 2VDPL 3CX5K 3NA4A 3X11B 1WAAF 4G80B 4HQQH 4NYLA 1R3KB 4JEGB 4MMXC 4XB7A 5DJAB 4YXKL 5F21B 1CE1H 1FC1A 4PJBF 4XBEH 5CEZL 4K94L 4NNPL 4GKNB 2C5DC 2D9CA 1H3VA 1MRCH 4PJ9D 3U30B 3S9DB 3UTPE 3T0DA 4YBLB 3SBWA 1D3CA 3VXQB 1U3HC 3DBXA 5I1IH 5KN5A 2FJHB 4JDTH 3HPJB 1M7XA 3HMXA 3S8WA 2ED8A 3C5ZD 2GJZB 4NQED 5HXMA 3MRBB 3TA3B 1F90H 1L0XA 1A9EB 9CGTA 3H9ZA 1QSED 2BSTA 2Q8AH 2O93L 3V52H 4ZUTA 3X13B 3M07A 4CVXB 3O3AA 1MWAH 3QAZB 5D1ZA 4XP9H 4JZNB 1CGSH 1AGCA 3NZHL 4IRJC 3TBTA 2J6EA 2YOCA 3S35H 1ZK9A 4FNLH 3TWCH 5E2UL 1A7NH 1CFVH 4X9HA 4OZFB 1ZMYA 5TPWH 2HMID 3K4DA 3WLBB 1OGAA 3QCTH 4ZQKA 5HHNA 1H3WM 3RP1A 1GZPB 1U8MA 3QO0A 3KJ4B 4OT1L 3S5LB 3MNZA 1G7JB 1PX4A 1TFHA 4U6YA 1LEIA 5F6IB 5I71B 4PPTA 1JNHA 4WWKA 4DVRL 3Q48A 3EIFA 2H26A 3MR9A 5LAXB 3MFFA 3O4LD 1MFCH 4D9RD 2AQ1A 2EXWD 4X6DA 1PBYA 5FUZL 1AGEA 1UM5L 3K81A 3C8HA 4HK3N 3MO1A 1HHJA 4HKZA 4X9BA 2KQNA 2WSKA 1CXLA 4TNVK 3O8XA 4OZIA 1NLBH 2VXVH 3BH8A 4F57H 3L1OH 4WHYH 2AXGB 2WWMD 2ID5A 2LAAA 1JRHH 5HDBE 2QQKL 3KLHD 1F97A 5BOPA 4RX4A 4MLIA 5F96L 4GBXD 3KLDA 3W2DL 5J11B 4XBGA 1OP5K 4KQ3L 4NT6B 2YZ1A 2AJVH 2Q7NA 4HXAL 4MNQA 4IBLT 3BZFA 2RBLA 3QDJB 1CGTA 3PL6B 4P46A 2C3XA 1R6VA 5GSRA 2AEPH 1JK8A 1R3LB 4JRYB 4K94H 2FECI 3MRPA 3OKMA 4G8IB 4LLQB 4MNGB 3QJFA 3L3DB 3ZTNL 4PGEA 3LDBB 5ACZB 1HCFX 3BRGC 2D03L 4KKBD 4NDMB 4PJ8A 2IPKB 1R0AL 4L4TD 4ZYKB 3CAFA 2XKUA 3TBVA 5FUOL 5A16A 3ARFA 1PG7W 4H0GA 3HAEG 1H3GA 4BFEA 2VLJD 1AGEB 1FHGA 3OKNA 2P48B 4P23C 2ICES 3QXVA 5E1HB 2VKXA 1TZHB 3LZFH 5C07D 4PB0L 5J12C 3BOVA 3NIGE 1PG7H 4MJ2A 3MYZA 1FLTX 2SEBB 5IVZA 3LKPA 4OSUH 4KROD 1N3NA 1VENA 3DV4A 3DX8B 4DKFH 4EUPB 5HHVL 5ID0A 5EU6E 2X5PA 4PRDA 3S35L 3CCHA 2YUWA 4BUGA 4WJ5B 1J1XH 2RCSL 3H42L 2GJ6E 2A6JA 3UC0L 4FABL 4UOW0 3VXTA 4UT9H 5C07B 2GJ6A 2UYLB 2A9NL 3D0LB 4L8SC 4U05A 4OCRL 4ELMB 5BW7A 2YK1H 4U1SA 5CP3A 4NN6B 1R5VA 1A02N 3KR3L 3CDGA 2J7LA 3WFEL 3QO1A 2FWOB 4AG4L 4F3FB 4FQJL 1FNLA 4OV6F 3NCFB 4X8JB 4P9HC 1E28A 3DMMC 3LQAH 1NGWB 1E4WH 4UNVA 1KJVA 1T1XA 5EZJA 3FRUB 2FATH 2QQNL 4HV8A 1BQLL 4JFFA 3LEYL 5E2VL 4WV1A 1D9KD 1NUFA 1UEMA 4K7PY 3WS6A 2NY4B 1E6JL 1MHHB 5E5UB 2QR0A 5HI5D 1EUUA 3FO9B 1BREA 1J7VR 5BXFA 3OHXA 1A64A 2P24A 4JAMB 5HI4C 4D9QE 4RMQA 2IH3A 2J12B 4GRLC 5AWNL 1JCKA 4M1GL 4W81A 2XTLA 3H8NA 1OP9A 5A2IH 1B2WH 3MA9L 1F8TL 2X89A 3QDAA 5CJQL 1CFVL 1N5AB 5GGTA 1KIQA 1RPQA 3L5XL 4H8WC 3HI1B 1OARH 4YHNA 5JW3L 2AJ3A 1T2QL 2ICCA 5MP6H 3MJ9L 5EO9A 3BPNC 3GMQB 2HKFH 3OB8A 4LSUL 4RMRA 2PETA 1OF2B 4AL8L 4P2RB 1FFOB 1DP0A 4G8EB 5KVEL 3UTTB 1WF5A 3OKEA 3QT2A 4R4FL 4DAGH 3B6SA 1JI1A 1HSBA 1YN7B 3C09C 4ISVB 4JANA 4JFZL 1Q9OA 4R90L 2CKBH 3I3DA 5DURB 5DJXB 2XV6B 4RGNE 4WUUA 3TNMB 4MWFA 3MLXL 5IWLC 4MDJA 5FXCH 4P57A 2BHYA 1ACZA 2P5WB 3BQUD 2FBJH 1KLFA 4KKCC 3D85A 3DVGB 4GAJH 4LSPL 2W9DH 4O02H 3BIBX 1QLEH 3JWOC 4PJBA 5D71L 2OZ4H 4JR9L 3TT3L 1XGRB 1YEDB 2D7TH 2HAZA 4OZGF 1KELH 7FABL 3ZKND 3JTSB 4YIQA 4O2CB 1S78C 4YC2C 2PUQT 3A67L 3GSUB 5F7WC 4ELKB 4MVBC 2ENYA 2F53B 3QWQB 1CD1B 3KXFE 2EZ0D 3D9AL 5D1ZD 4DJMA 5EZOL 3MUY1 1NGYA 1MHEB 4HS3B 1T0MB 1NGZA 5CZKA 1YEDA 3UJTH 1MRFH 4HKXA 3TC9A 5FO8A 1GC1C 1U3YA 4PTUA 3S36H 4ZOEA 2IPTH 2P44B 4EUPG 3WHE1 2D0GA 1MCRA 2DQTL 4PLKC 3SO3B 4P2RD 1KFAH 1AQKL 4OF5A 5IEHB 2EDKA 1Q9WB 4FMKA 4G42B 2JJVA 3AXLB 4PRPE 1QR4A 2VAAB 2V7HB 5IGXH 3BSZH 4MWFB 4GFTB 1V3JA 2B20A 1KPVB 4KQ4L 1YN7A 4ISVA 4JANB 2HLAA 3EFFA 4CGTA 5D7LD 1MAML 1QSFA 2HWZH 4E0RA 1I1AA 2BOBB 3FB5B 5FOBA 4CN1A 2OP4L 4OLEA 1OF2A 4GW5B 2Y7QB 4F37K 3C6LB 4I2XA 5T3ZH 1XGYL 4YNYA 1EXUA 4MCZB 1INDL 1ZLUH 3Q5TA 4E41E 1CD9B 2BVPA 4D3CL 1KIQB 3S37L 3MRQB 4PJCB 3VFWA 3HS0B 2ATPB 3BP5A 1F2QA 1HKLH 1UXSA 5DEGB 4GMSH 2X4RA 3V95A 2VLRE 1QTYT 4FZEH 2QR0B 3FTGA 1BD2D 1R3IH 5E00A 2C1OB 2CDGB 4YGVA 5DHXB 3CU7A 4PY7B 2ADGA 4HV8B 5DA0B 5DS8B 3V6FA 5IFAH 3FT2A 2FX9L 4RDQG 2VQUA 2YXFA 3TF7C 3FN0L 4WDIB 4CUCA 1E28B 2PXYD 1YEFL 2CLRB 1JNLL 5FK9A 2M2DA 3HZYB 1C16A 3BZ4B 4XMLH 5GS0C 3BP7B 3GK8L 3BE1L 4OT1H 1FL5A 1I7RA 2VLJA 4ODUB 1K85A 2DQHH 4OF6A 4XNXL 2MSPA 5GISL 1FYTE 2XZQL 3LSOA 1ULVA 5C07A 3AS0A 1A8JH 3K3QA 3A67H 2P1YA 3P30L 5F93C 4PD4J 2AJXL 2R2EA 3P4OA 3WDIA 4RNRB 2AK1L 4X6EB 2ADFL 3B3IA 3L5JA 3O8XD 3STBA 4IMKA 5JW4Q 3LKPB 5IVZB 2VDML 2LABA 4ZS7H 5EOCH 2GSIB 4XVTL 3TA3C 2GJ6D 4LSTH 5ITFA 2EDOA 4F37F 4AEFA 1VEPA 3LS5H 2YD5A 5E8DL 1NBYA 4X5WA 3TO4D 1XR8B 5SWQA 2A6IA 3KPMA 3D25B 4OGXL 1AXSB 1GXEA 4WUUB 3UROR 1I3RA 5I74B 3TVMD 4R26L 2KPNA 2DWDA 4EIGB 1QG3A 4Q9CA 1HHGA 1QRNE 3RQ3A 4PGEB 3SDCC 3T77A 5B39B 2B1HL 4G8IA 1KCKA 1H8SA 4TSAH 1V5JA 4AEEA 2YXMA 4K94C 3V8CA 1OTTD 3QEQB 1YEKH 4KTDL 1AD0A 4JFFD 1JK8B 5E6IA 4OUUA 3SGEI 4NIKB 1RUAL 5CMAB 2R0ZH 4B41A 3BPCB 3RAJH 1EAJA 3QB7C 4PTTB 4QT5B 2W91A 1ODAA 4RA3A 5CJXA 5D6DA 3GSRB 1FVDB 4KVNL 3WFCH 4HUUA 4NWUH 4XWOD 1JVKA 3IKCB 5KANI 1JPTL 2EE9A 1AY1L 2VMFA 2WAHA 1VGKB 1T6VN 4ONHA 1W0VB 2UZXB 5HYFA 1TTGA 5TDNB 3V6OE 1UFUA 4XP6L 3T0BA 1A7BA 2DQDL 4Z7VE 4U6XB 4LCIH 3HUJB 4U1JB 2EH7H 3S36X 2H1PL 4N68A 3EO1B 3MCG1 2XYCA 1G7QA 1Z9LA 2VZOA 3B4NA 1XH3B 3UBXI 1T7WA 2X9XA 1KLGA 1I3VA 3L6FB 3BN9D 4IJ3B 5DZLA 3C9NB 5DF0A 5I8OL 4LLMB 4KDTC 3ULUL 4W68A 1X7QA 3WE6B 4Q6IC 3FFDB 4KRNA 3WIIL 3BQUA 4M00A 3UPRA 4K9EH 3UTSE 1JHKH 5GIRA 5IW6A 2CRZA 2IJ0C 1EEYB 2GI7A 3HLAA 3WIFB 4Z7OF 4Q9QL 5GGTH 1V7NH 3QP3A 4JKLA 3D39D 3HNTH 1AGCB 1IC7L 2P42B 3WLWD 4F7CA 3MZTA 3WO4B 2XRAH 4RGMC 2Y07L 2BSTB 2APWA 4OAWA 4DZBA 2VIRB 4PJ7E 3ZHLA 1TZHA 3MRBA 1ZLVK 5C0DB 4DKFL 2VC2H 4LVOC 4DZ8A 2AV1B 2NY5C 3QUXD 4R0LB 4NO0B 3EOAA 2VDLL 3B9EA 5FHAH 1OQXA 2PTVA 3ARTA 4R26H 2DS4A 4B53A 2UZIH 5MP6L 1YEEL 3C6LD 3ZDYF 2D9QB 5CILL 3MNVA 4ZUSA 1JZ5A 1A3LH 1F45A 4TVPE 5EIVA 4NO0A 1IGIL 3QJFB 1TENA 4HUVA 3T3PF 5JUEL 1NGXB 2F53D 4HCRA 3EYUH 5D7IE 5KJRH 1Q72L 5J9PA 1JZ3A 4OLWH 3CVIH 1JHLL 5CINH 5ISZB 5D4QA 3G08A 1JZ2A 4XBGB 4M3KB 2FBJL 4KGLA 3F7RA 2IAMD 1I9IL 3WLWC 2IF7A 4TUKL 4HULB 4XH2A 5KVDH 3ROLA 4YLQT 3LN5A 1TLKA 2FDBP 1IQWL 4MA8L 5TE6H 3H0TB 3HC4H 5HHQB 1QFWL 3IDYB 4NGHL 3NH7L 1CLZL 3G6AB 4BK5A 2JCCE 4PJBE 4EDWH 5MHSE 3O9WC 4PGBB 2NMSA 4J1UA 3TLRA 2A6KA 3LQZA 4U1JA 1NCBH 3CSPA 5DSCA 2IEPA 2Y9RT 3F6LA 2EYRB 3T0VA 3L5HA 1DBBL 3TJEH 4U4BA 1J9CT 2OLDA 1A6VL 4H25A 2JLLA 3PWVB 4MQ7A 4LHJB 1YPZE 1FFNA 1ZHBB 4FQLH 2HH0L 4KUCF 2GY7B 5BZDB 1CGUA 3BN3B 1I9EA 2OJZH 5KG9B 3JV6B 1S9WB 2OXHA 4OGAD 3I9GH 2ORBL 5HHXH 2HTLC 4PS4H 1P69B 4R3SA 4PTTA 2VXQL 2VR9A 4NHUA 4Y5YC 1FNFA 4FMFA 1K9TA 1ZSDA 2X4SB 5CEYB 3OGCA 4H8WL 5DZOA 4ZUTB 5KZCB 4RGOL 1EGJA 5DJ8A 1VGEH 2NLJA 1LEKB 5ICYA 3L5WA 4XVUC 4LCCB 1NFKA 1W0WB 4TSCH 1NEZG 3DGGA 4U1GB 3T0AA 2VLMD 4RZCB 5I1AB 3MTRA 2WUBH 4XVJH 1WCBA 4H88L 5FKPA 1ZANH 4RA0C 1MCBA 2F54B 1S3KL 1XR8A 4ODXA 5EBMB 4F15B 2IALB 5D8JL 4Q2ZB 4UBDC 3P9WB 1CFSA 3LKRA 4LGSB 4YGAB 3WUZA 5HPMA 1T89C 1XGPA 5FA4B 1CLYH 1DBJL 1RUKL 3NFSH 3O41A 3UBXA 5J8OA 3RNKA 3AMLA 3GIVB 1QRND 1NC2A 2EDRA 4LKXB 1IGML 3MROA 4XPAH 2QL1A 5T1LB 1V8HA 2PXYA 5FYKL 4L4TE 4K3DH 4LEXH 3U1SL 2X4TA 1YMHA 4V1DD 3N1MC 8FABA 4NO2B 1C1EH 2GTWA 1RZIA 4NRYA 3CVHH 5IHLB 3KYNA 4GG8B 4OCXL 4F7TA 1E6OL 5CFHA 2A73B 3MRJA 4LPWA 2EDXA 4DKAA 4S1RL 1EO5A 1QD0A 1T22A 4Y5VC 5FK9B 2NY0B 2CLZB 2Y36L 2E3VA 1T03L 5C0RH 2J8HA 5IESL 1W72H 5JIHA 3CFIC 4HIXH 5I1KL 1F4XL 3ZYJA 2HJLB 3DUUA 4XMKL 4QHKJ 2DBLH 1BBJB 2Q6WB 4ERSL 1QFOA 1EVUA 3J8F7 4YGVB 3UTOA 4HBCL 2N1KA 3FT4B 1BFVL 3D3VE 1ND0A 3L3GB 4E5XA 2NW2A 3IDGB 5IT2L 1P1ZB 4MA3A 2Y06H 1Z9MA 4DGIL 3NPZB 3O11B 3KPQB 2K7QA 3TVMA 3KYAA 1BM3L 1YNKH 3RNKB 3I2CH 4BK4A 3C08L 4L29B 4U1LB 4WW2A 3WFHB 4J3XA 3IFPA 4HZAA 2BNRA 2DI8A 3FO2B 4TSAL 2IALA 3QI9D 1U91A 1MLBA 1C5BH 1GAFH 4U2ZA 4WEBH 2OQJB 4Y2DA 4WHYG 2XA8H 5L7XH 4RMWA 3KJ4C 1RJYA 3EFFB 4NJ9L 5F88A 2JB6A 7CGTA 1NBVL 4P2QE 4NQDE 5I76A 2UWEA 3HB3D 3SY0A 4Q0XL 4P46C 1GIGH 1F4HA 5DLML 3GBNH 2P7TB 3G9AB 2H8PA 3STZB 1OAXH 4Q6IA 3QUML 3U0TB 3OGCB 5J06A 1ZOXA 2I07A 1T1WA 1TVDA 4NHUB 3JUZA 3I84A 1T0MA 4K71B 4R4BA 4FTVB 2ZNWA 2EYSB 1H15B 1DVFB 25C8L 4PS4L 2YRLA 4YWGL 3DX7B 1T4KA 4BJLA 3GFUA 3IYLW 5CZVH 3ZT5A 4ELKA 3T2NL 4Q97A 5ALBH 4DGVH 4NZUL 1TTUA 2WK2A 4NKDA 5CBEA 4YC2B 3MV8D 3ARVA 1FORH 4G6KL 2R23A 4BZ1H 2A1WL 2YR3A 2PTTB 3MRFB 2HFGH 4AJ0A 1CICB 2D4FA 5TQ0L 2ZJSL 2NXZD 3MA7A 1ZANL 4S2SA 4ZFGL 1V3MA 4HJGB 4GRLD 2VL5A 3MJ6A 5I75B 2OR9H 1M7IA 4RMVA 5J6HA 3ARSA 4ZOBA 1F90L 5I8CB 1OLZA 4UINH 3IAQA 3O4LB 4CW1B 5J1SC 4Z77B 5I18L 5T1KB 1RK1A 1IL1A 1M7DA 3O2VH 5D2LF 1RFDL 2BHZA 3M17A 5A2FA 4HCRH 3CSBA 3SBWC 3SKOB 3UJIH 2OI9B 3WNKA 4JFYB 1LO3H 1Z9SA 2X4NA 1QPPA 5C0GA 4NO0D 4TVPH 2DN7A 2J5LC 3QUYA 1LO5A 1AI1L 2GHWB 1IM3B 2ZP0T 3FB8A 5INDB 3IDMA 4B50A 3RI5F 2EIBA 4ZUSB 5BRZE 1R3JA 4X98B 2BOCB 5CSGA 4HH8A 4LCWE 4HKBB 1W8NA 1PEZA 5HYJD 2MCPL 1SJEB 3QIBD 1PSKH 4JN1H 2VDKH 4B7IA 1RIVH 4POZC 2B39A 3NAAH 3GB7B 3T0XA 5A40E 3GI8L 5EZJB 1N6UA 1WBXB 2E27L 2WBKA 4KKBC 2IAMA 1D5ZA 1PKOA 3MNWA 1NPUA 4YHKL 5CD5D 4TUKH 1G7HB 1WIPA 2IPTL 4L3AA 4AIZB 4JHAL 3ARDB 1Q9LB 1UEYA 3HZMA 1M71B 5DGRA 4S11A 2DLFH 3QNZA 3VXSE 1OSZA 3WUWB 1AP2B 2X1PA 3NVQA 5T1DL 4UDUB 5C6TH 5JLZA 3CSGA 4FXKA 4RFEA 4L3CA 4JGUA 4YWGH 3AROA 3VXRB 1MHPH 1NKRA 3D0LA 1U8PB 4LLWA 3TEUA 2C7UB 1DQML 1N8ZB 3VFRA 5CJBA 1AGDA 2P5WD 5BV7H 4WW2F 4EUPA 4UDTB 5B21A 5DVLA 3HE6C 4XCNB 5T33L 5HI3D 4GG6B 3N50A 4LPCA 5C08B 3T04D 4CMMA 1PFCA 1HYSC 3NZ8A 3RVWC 2YS4A 1QBLH 4OI7A 1J0YA 3PXHA 1TQCC 5EOTB 2V17H 3ALWA 2OTPA 3OKNB 3MRHA 1KC5H 5JIIA 3H9YA 3PGDB 3L7FA 4LLUB 2VAJA 2QV2A 3TV3L 5HVWA 1HKLL 1RJLA 3LEYH 1F4YH 5MHSD 2Q20A 4PJAF 5J6GB 1W0VA 2YZ8A 3DNKA 2B7DT 1NCCL 1T1ZB 1O0VA 4UI2A 1PY9A 3RI5K 1P4BL 4ORGA 4P3CH 3V4PH 5JW4N 4WRLA 4K55A 4XNYL 1OPGH 1OAUL 5FYJE 2R4RH 4XNMB 3DTXA 25C8H 5ADOH 3FT3A 2APTA 1PG7X 4MJIE 1FYTB 1GL4B 4DOHE 3WDJA 2ESVB 3PGFH 5CJXC 5CMAA 4HWNA 1W72B 5BRZD 4NT6A 2XZZA 1JF6A 3BESR 4TVPL 1IARB 1KENH 2FGZA 1DN0B 1H8OA 4YUEH 4PJEB 1T80A 4TULH 3THMH 3D48R 3H9SB 3UZQA 4ODTL 2F74B 3WD5L 2B2XL 4OCYH 1A1OB 4ONOA 2AW2A 1G7MA 3SDDD 1G7PB 3BH8B 5IMLA 4JFOB 4NRXA 3TYFB 2BSED 3RVWD 4LSDA 4AEHH 1OAKH 2BNRD 3D25A 5FHBL 3I6GB 4Y4FB 4N0FB 5IP4A 4OKVB 1F6FB 1PQZB 15C8L 1ZVHA 1NH6A 3MFFB 2GJJA 4V1DA 5L8JB 4AEIH 5I1DB 2NY5H 2R1YB 4IDJL 1IZKA 4LSTL 4TRPH 3SQOL 3GMLB 4OCXH 4PB9H 4G6ML 5E5RB 2BFVL 3B3IB 3MJ7A