2Y0FA

Structure of gcpe (ispg) from thermus thermophilus hb27
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
403
structure length
403
Chain Sequence
b'MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGVEVPLVGDFHFNGHLLLRKYPKMAEALDKFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPSPKEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAPKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-HYDROXY-3-METHYLBUT-2-EN-1-YL DIPHOSPHATE SYNTHASE
publication title Structure of the E-1-Hydroxy-2-Methyl-But-2-Enyl-4-Diphosphate Synthase (Gcpe) from Thermus Thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 127
structure length 403
sequence length 403
chains with identical sequence B, C, D
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 2y0fA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2y0fA02
4S39A 4O1EA 3VKPA 2YCKX 3B0NA 3OR2B 4S23A 2XSJA 4DJDA 2V4JB 7GEPA 3MM8A 3H21A 3H22A 1TWWA 4DJEC 3VLYA 3TYUA 3MMAB 4D9PA 2H9AA 2YCLA 1EYEA 3MMBA 1AJZA 4HB7A 4GEPA 4S38A 4S3AA 3MCMA 4NHVA 5GEPA 3H2NA 3VKTA 2YCJA 3MM5B 3GEOA 4NL1A 3TYBA 4S3DA 4G9PA 3H24A 4O0QA 4D8AA 3TZNA 3MM9A 1AOPA 1Q7MA 3OR2A 4MWAC 2VEGA 3VM1A 4AOPA 4MWAD 4DB7A 4DJED 2V4JA 1AD4A 4DJFA 2DZAA 4C1NA 1TWSA 3MCNA 2YCIX 4DAIA 2OGYA 1ZJ8A 3MMAA 5AOPA 3TYAA 3H2FA 3MM7B 2Y0FA 3TYZA 4DJDC 1TX0A 4G39A 4DJDD 1Q8AA 3H2AA 1AD1A 3AOPA 2GEPA 3B0JA 4DAFA 3VKSA 4MWAB 2Y5SA 3VKRA 3NOYA 4S3BA 4MWAE 1ZJ9A 3OR1B 4G38A 1Q7ZA 3MMCB 3H2CA 3MM6B 4S3FA 1AJ2A 4S3CA 1F6YA 3H26A 1Q7QA 6GEPA 2Y5JA 1Q8JA 2E7FA 2XSJB 3MM8B 3H2EA 4CCZA 3VLXA 2AOPA 3B0HA 3MM7A 4HTRA 3TR9A 2H9AB 3H2OA 2YCLB 4O1FA 3VM0A 2VEFA 4DJFC 3TYEA 4C1NB 1TX2A 3H2MA 3MMBB 4DJFD 3VLZA 3BOLA 4PZVA 3B0GA 3MM5A 3H23A 2BMBA 4D8ZA 3B0LA 3TZFA 3TYDA 2AKJA 4MWAA 3TYCA 4NIRA 2DZBA 3VKQA 1TWZA 4DJEA 1Q85A 3MCOA 1AJ0A 3OR1A 8GEPA 3MMCA 5JQ9A 3K13A 3V5OA 4NILA 4S3EA 3MM9B 3MM6A 3B0MA 3BOFA 2DQWA 2VP8A
chains in the Genus database with same CATH superfamily
4CNSA 3B0YA 4KWOA 3DG6A 3EMZA 4ILSA 1Z89A 2Y63A 5CKSA 3TC3A 2ZZ4A 5J8LA 2J9ZA 4LALA 3BDKA 1EJVC 5FOOA 2DUZA 3IJDA 3R13A 3G1YA 4U28A 1YNQA 1YX1A 3NUKA 1QPOA 2OOGA 4GRSA 3MV11 3M64A 5EPDA 1JI1A 2PLMA 2QF7A 4L9XA 1OT2A 1XBVA 1W3KA 5AHFA 1DTNA 3HV8A 4AD5A 3A4AA 3UWQA 1AD4A 4H9VA 4MIMA 3QHNA 2BHYA 2YLAA 3CAKA 1QO5A 2D3LA 3IWPA 3MSGA 3EWZA 1XRFA 2J7BA 4JN7A 1D7FA 3TIMA 3KVLA 4HQVA 1P6WA 5CZJA 3NGJA 2CC0A 1UZDA 3L0NA 1ML1A 3A3XA 4DWSA 4O52A 3L9CA 1XLJA 2WMKA 1TELA 4O17A 4KWWA 5C9WA 4GXPA 4O18A 3IRDA 1UW9A 1PX8A 3FGCA 2PDIA 1SFLA 2XDFA 1FH8A 1DXEA 2PGEA 3CZKA 3AIRA 3WF3A 2Z1SA 4GVGA 1VCFA 1XFBA 3T0BA 1TPFA 4E6MA 3W1LA 2OGJA 2ACSA 3OR2B 4PCFA 4OBRA 1DIDA 3GFZA 5BWAA 4GGHA 7ENLA 3PZUA 4JTKA 2A6LA 1B9ZA 2E67A 4GVFA 3WBXA 2XWEA 2YXGA 1H7XA 3UWEA 4HA1A 3EWXA 4JY9A 3VD5A 3E3HA 4DEFA 4PRRA 4B5UA 2CU0A 4GO8A 4MGGA 3RMEA 3DHDA 1L6GA 4IXXA 2OEMA 4R27A 2WLYA 3ZIZA 4IIFA 1WUEA 1EH9A 1E73M 3CQIA 1JR1A 1EJTC 2Q01A 1ZZMA 4Q7NA 4DF2A 2PBGA 2XVPA 2VEPA 3NO1A 1VKFA 2J8TA 4M29A 1XH0A 3TXZA 4AF0B 1SR0A 4Z2HA 3NYDA 3KE0A 1JNEA 2ACUA 5FJRA 1BYDA 1KRAC 3NZQA 3QKEA 3VABA 4S3FA 2NV2A 4AHPA 2ZXBA 1O95A 2QYGA 1RR2A 3BAXA 1E4MM 3QQWA 3T0AA 4L1WA 1UKTA 3UYCA 1YE6A 2OQHA 3GNRA 4MHBA 1E6RA 1S5NA 1E15A 4HCDA 5A6MA 5FAGA 3QMRA 4ZA0A 1TPDA 3TYCA 4HPGA 4XWUA 5I06A 4JD4A 4BY3A 5FD0A 3S9IA 5AHLA 4AYGA 3FDGA 4D6DA 3AWOA 2XZ7A 4PMQA 5AC6A 1A5KC 3RYSA 1IWBA 3KZPA 4Y9OA 4UB9A 3QKZA 3KL0A 2VZSA 5H6HA 2WV8A 4MJZA 1Z48A 5AYBA 3WLSA 2O9TA 3OHMB 1KTBA 1X97A 5HDRA 4REQA 3GVVA 2C3ZA 5EMUA 4JOMA 4IFRA 1O1ZA 3C52A 4UTLA 1TJPA 1XQKA 4R7WA 4AZ7A 2EKGA 4O15A 3VKSA 4NRRA 1XUZA 5JUVA 3ZLGA 4HPNA 1CGTA 3PNZA 2FHBA 2OT0A 1YYAA 3EB2A 1GVYA 1LUCB 1BYAA 2A3BA 2QCDB 4TV6A 1X98A 1R2TA 5KETA 5BZAA 3D6NA 2Y6ZA 4AHQA 1IEQA 2VEFA 1W1ZA 1TX2A 1E1CB 3AMKA 2E40A 3ZJ6A 2ATSA 4H9TA 5BCAA 1X6UA 2XN0A 2AOSA 4B4HA 3FKRA 4QCEA 1EIBA 1MDLA 1SZFA 2NV9A 2V5JA 1CXIA 1JCXA 3W01A 3KRSA 4IQEA 1PXGA 1CXFA 3UXLA 3TONA 4EF8A 3S0CA 3B0VC 2IQTA 5CZ0A 2BOGX 3HN3A 3BO9A 5C7VA 1QNOA 5D9OA 4L4LA 4B15A 1ZLPA 2R1KA 2AMGA 2O7SA 1FX6A 3INPA 1G67A 4AD2A 4W8LA 3RR4A 1BQGA 4H9MA 2OR2A 2ZX9A 2VWSA 2Y24A 3NSNA 2HE5A 3T8QA 4TXEA 2B7PA 1S5TA 4FLOA 3RNDA 4N9BA 3TAKA 2G0WA 3D3AA 4O11A 3NEHA 3U9IA 3SUVA 3F5KA 1UWUA 1R8LA 2CZDA 4K36A 1KRBC 2FKPA 1NP0A 4RZ5A 3UJFA 4ERGA 1V6WA 4FSAA 2QXWA 5AC4A 4GNJA 1XISA 4DXVA 3OR1B 5MF5A 5CPLA 1WZMA 2BFGA 3C2FA 2PLCA 3LRMA 5HNNA 2PFHA 4MM1A 3QV7A 2E5DA 4K2SA 4CCZA 4BCEA 3VU2A 2GGIA 4GBUA 3QGAC 5I03A 4N9EA 1B3OA 1I1XA 2EAWA 4ZQPA 1IZJA 3T2QA 4E4PA 3H23A 3VE9A 1F74A 4YNGA 3W6MA 4Z0JA 3CNYA 4BK9A 4E5TA 3KOFA 4Y90A 4XBJA 4LY8A 1UPPA 4QQUA 3VD3A 2OKTA 3SUUA 3EWWA 4PMNA 2GJNA 1XJBA 1DORA 2Y2WA 2AAMA 3TCEA 4D6FA 3L4UA 2IQ0A 3HBLA 1VEMA 4GIAA 5E1QA 1P48A 4HPJA 4X0VA 3LMYA 3MSDA 4MDOA 4NP7A 2E0PA 3VMNA 5CPMA 3OW1A 1VEOA 1X1OA 1XP3A 4UCGA 4UMBA 5CJNA 4DYKA 3GDTA 3GC5A 3IIXA 3W7KA 3CIWA 2Y85A 4HPHA 1G0CA 2FYMA 2X1RA 1US3A 2PAJA 1K9TA 5TNVA 3GR7A 1Y5WA 1UOZA 4DWDA 4Q32A 4E3TA 3CMJA 2WM1A 3AMDA 5FF0A 3C2EA 4GY1A 4ZO6A 4P8XA 2WKJA 4HZMA 4M7SA 3UG8A 1D7KA 3PB0A 1J0JA 1Y0EA 4JEQA 1N8IA 2J9XA 1JPKA 3WIJA 1Q7QA 3B9NA 3OA5A 4L64A 3VKKA 4PA8A 1CTNA 1RVKA 4LRTA 4IFKA 4AZBA 4XAPA 1NWTA 1E9LA 4QE4A 1B9BA 1TWIA 3AYTA 4IXHA 3AISA 3PK7A 3UJEA 4QG6A 2DSVA 3AZTA 5F2MA 3AIQA 2IPGA 5I23A 1GW9A 3N17A 4EVZA 5FCZA 2NXIA 4S2CA 1UH4A 2IMRA 2PUZA 3OLDA 4XD3A 1Z69A 1EJWC 4LEFA 3GVWA 1QMLA 1NOWA 4C6PA 1M5WA 3GXNA 4QHRA 1ZBCA 1GNXA 4EWJA 5KEZA 1G7UA 3E38A 4XISA 2WAGA 4LYQA 3L23A 4QIUA 1XYCA 3GHUA 1Q3NA 3AO0A 3URQA 4XIAA 1VBRA 4G7FA 2BY3A 1U5HA 3COTA 3VFLA 1JPHA 2GK1B 2C13A 4XUYA 1JYVA 2OLHA 1QNRA 1E1EA 3GZAA 1W54A 1WCGA 4AIOA 1XC4A 3RPMA 1H0IA 3U2ZA 5IFTA 1H1YA 4RZ4A 3NOYA 3GVRA 5F2LA 4XD6A 1J6PA 1DJQA 3UD6A 1J2WA 1A53A 3PPHA 1E71M 1NSJA 3FXGA 2V68A 4H00A 4GNVA 3W2MA 2FZMA 1UR4A 2NV1A 2WSKA 2H8ZA 3KBJA 4TX6A 1X8CA 2FMOA 5JXQA 3B0LA 4XO7A 1TVLA 1HXJA 5I07A 2VDGA 3JR2A 3U48A 5AVHA 4RW3A 3NPVA 3FJ4A 2BOFX 1LBMA 1VJSA 6CGTA 3EWCA 1EJSC 1NFGA 4JCMA 1S1RA 1IR1A 1UUOA 3LGEA 4CN4A 2G4FA 4X9YA 1TWWA 3I3BA 2J7HA 4L4OA 1QU4A 3LB0A 1V0KA 3GDLA 4O0ZA 1EZ2A 1TMLA 4QNEA 2HBVA 1XKYA 3DN5A 2O4QA 3GQYA 5GPRA 5DRIA 1KBLA 3EEZA 3R2GA 3LPFA 3SIZA 2QUMA 4O0QA 3TQVA 4AUBA 1NF7A 5C6MA 1E9YB 2HWGA 4ORMA 4BR1A 2RDTA 3B8SA 4B91A 2DY3A 4P61A 3IIVA 2ZZ3A 3T1GA 4A3QA 1R7AA 3RHGA 3TYAA 2ZIDA 1X6NA 4GKTA 1X39A 3SCOA 4ECLA 3UR5A 4TVCA 3S46A 4V1XA 2FGZA 2IKGA 1JYXA 3TC6A 4C1KA 1QATA 3VGBA 2DDXA 4ICNA 3W7GA 3VD9A 1M7XA 4HHLA 4CNUA 1M04A 4P8VA 3W02A 2D1ZA 1WDQA 4BFAA 1CGWA 4MNLA 5A2BA 2Z1XA 3VINA 5CAKA 2H90A 2ZFAA 4WSKA 4MADA 2V9DA 2NQHA 3GXTA 2IQDA 1GTEA 3SECA 4DJFD 5EYWA 4O12A 1VD6A 3G1VA 3TMLA 3E0WA 7A3HA 5C0QA 3W1TA 1OG6A 3STFA 3ZR5A 2H3DA 4LAKA 3V5FA 3MPGA 4LUTA 2TPSA 3CIVA 3ME3A 3TN6A 1R46A 2QJJA 3S1GA 1LRQA 1M3UA 3TW6A 3H22A 2VC5A 3O0FA 4UTFA 1FUYA 2NT1A 2BV9A 1R3SA 4NHVA 1JPDX 3EGJA 3C4UA 2FZDA 2BZNA 1HJVA 4B5TA 4PCTA 5DCEA 4AZ6A 2D2HA 3UJ2A 2JF6A 4P8WA 4W8BA 1HN1A 1UCWA 3MUAA 1AMYA 3M07A 1O60A 2CYGA 1B57A 3U2OA 1JJKA 4TOQA 3W7QA 2Y0FA 3B8WA 1NDVA 1NDWA 4FB7A 1UBSA 2PODA 3CUHA 4DO7A 4DAFA 1BYCA 2PU0A 4IX2A 5FESA 3N13A 3NA8A 5BMWA 2Z7GA 4OV9A 2WHKA 1X38A 1LL7A 3A47A 1O7AA 4HGXA 4TTGA 2OWWA 3NQ6A 3V0TA 3EOSA 3QFWA 1LM1A 1FHVA 1B1YA 1XKJA 3EB4A 3HG3A 2VUYA 1IGSA 3W84A 1YNPA 1D8WA 4WHBA 4F2TA 4NNCA 2I1OA 4C5YA 2NQJA 1XCXA 1EGMA 1OFRA 3EBVA 1CECA 3IUIA 4DNMA 1ISYA 3AXKA 2FQIA 4YYFA 5FJJA 1Q5MA 1ZBWA 3WLRA 1XG4A 1E9ZB 1A3XA 2J62A 2Z1BA 2V5LA 3Q37A 3UEQA 2WANA 3AIEA 1OM0A 1W56A 3SGZA 1E0UA 5D03A 4B3KA 1NWRA 3GNPA 4YWIA 1US2A 1LP6A 2WWDA 4YLWA 3VKAA 3U0HA 1PV8A 2VD9A 4AG0A 4PMJA 4GLEA 1RQBA 4TMCA 1W0MA 4H8HA 3SSJA 4LCSA 4AZHA 4KGJA 3M16A 2E28A 4XIMA 3T40A 4F0MA 4PYSA 3QXBA 3B8IA 3T08A 1J6OA 1VGAA 1TPH1 3PZVA 4GH3A 2YA2A 5A8OA 3N34A 3G77A 1TTIA 3I7SA 4GFIA 4NI3A 4D6IA 1MNZA 1GVIA 2ZZ7A 5IXEA 1NAL1 1EPVA 3LM7A 2E9MA 3CPGA 3CZEA 4D6HA 1KFLA 5HMDA 3BLEA 2X7WA 4CNNA 2VZVA 3UPBA 3VX0A 2QPXA 4UQAA 1L6FA 3UP8A 4GIEA 3RILA 4DJEA 1NY1A 2CLLA 3LGDA 3W7PA 4JTJA 3NPWA 3BQ5A 5FI8A 2GUBA 4KFNA 1GEQA 3UBPC 1W1VA 1PYFA 1WB0A 1C93A 5AY7A 1RVGA 2OVLA 1W5MA 4KBXA 1I45A 2R1PA 4JICA 4ML9A 1ZP3A 4OTKA 4U5IA 1FWBC 7TAAA 1H11A 5D30A 4US6A 5EMLA 1DYSA 1BYBA 4PB4A 4RPQA 1TCMA 5D2WA 4H19A 1OQFA 3GKFA 3BCFA 1E6NA 2WHLA 1U1UA 3RIKA 1UUQA 1SUXA 4LUJA 4WY0A 2P50A 3NL5A 5CC7A 1XRVA 1ZJ8A 2FGLA 1F07A 1R87A 1PZ3A 2MUCA 3SJNA 4JTLA 4YJ5A 2VUNA 2P5NA 1WAUA 3VNZA 4Q4SA 5KZMA 1XQLA 3UETA 2W66A 3OTRA 3MUIA 3WBAA 4XAYA 1MMFA 4S3BA 3CHDA 4E2VA 2FFCA 3W7IA 5SWUA 3N6QA 5HR6A 4AWUA 3C3UA 3VKCA 4YHEA 4NYUA 5HNRA 2XSXA 3G22A 1P0NA 4W88A 3MM8B 3E49A 1K9DA 1R9ZA 2PGWA 3CLWA 2OYMA 1Q6CA 3BZGA 4FA3A 4P7QA 3IAPA 1GTHA 1Q2RA 2HXUA 2D2JA 4UTWA 1QFEA 2CBUA 3AC0A 3WYZA 3LCLA 3F1QA 3VAVA 1HJQA 3ARWA 2PTZA 4U5KA 2G8ZA 2P53A 1EP2A 4NI8A 3DYMA 3MA8A 4JTRA 2J8FA 3KRBA 2ZRYA 3O16A 5DY2A 4B5NA 2LLEA 3G2GA 1UHVA 3W7HA 2GGJA 2PSNA 1QPNA 4XZWA 1UWAA 4WOZA 1P7TA 3LX9A 2DSZA 5HANA 2G41A 4C6MA 1XLMA 3JZUA 3R0UA 2Q8ZA 4ZQNA 3RLGA 2FHFA 2CEQA 1EOKA 4BHYA 4LAMA 3DERA 2WZIA 3ZVIA 3N29A 1GOWA 3G1SA 3DDMA 3F7JA 3H2FA 2IUZA 4OQVA 1XLLA 2D2OA 1PHWA 3ZWSA 2FZNA 3B0UX 3VOCA 2I5GA 1XPYA 1JZ2A 3RU8X 1JFXA 3A9BA 3SBFA 1K6WA 4ACZB 2ZUSA 1GQKA 4JTFA 3RG6A 2IXVA 1XICA 2XN2A 1BHGA 1JCTA 4H6KA 4EANA 5LGXA 1GVFA 4DY1A 3LUTA 4O1FA 4I7WA 1OFEA 3MS8A 2YKKA 4PTNA 1G1YA 2B7NA 3EMCA 3KBMA 3NGFA 2ISVA 1GKPA 3F5LA 1XW8A 1ELSA 3KL5A 1CGXA 4UFMA 1W91A 4D8LA 1B3WA 4A4AA 3H4XA 3STEA 3AQUA 1ITQA 1F6PA 2X30A 3AHZA 1EDQA 1VPYA 1Q6FA 4F0LA 3C8NA 1FWEC 2FB3A 3ARSA 3REQA 3UERA 4WLCA 3AROA 3I6RA 1MRAA 1O5RA 1QCWA 1VR6A 3LSCA 1PBGA 3W3OA 4DBSA 1YQ2A 2CLIA 3LERA 3FKKA 4JIPA 4GISA 3OJGA 4Q4RA 1W9PA 2QCEA 3SGUA 3QYSA 4CQCA 3SUTA 2OWXA 1Q66A 5A69A 4DB7A 3W4RA 4LOCA 5K4XA 4JN6A 1GYMA 3HPXA 2GQAA 2EQDA 2RDXA 4NF7A 4MSSA 3UWWA 2DP3A 2NLYA 3VDBA 3WDHA 1I2RA 3EWYA 5IM51 5T26A 4L1GA 5H8MA 1UUMA 4NZ4A 4W84A 5AZ0A 3N9KA 4L1XA 3ZJ8A 3EA3A 4QDWA 2A21A 2WNZA 4F0KA 5HA7A 2X1IA 4M6VA 5M03A 3CEPA 3A3WA 1GOQA 1I0BA 3VO0A 3C0JA 3USZA 1GOKA 2YX0A 2C8NA 1E0TA 5TBOA 1G4SA 1K8CA 2OEKA 1EX1A 1JIBA 1XDLA 2ZA2A 3SCTA 4H6RA 1KR0A 1AQFA 1LOSA 4ZXOA 3N18A 1Q6EA 5A6BD 3OODA 1U5VA 1WBHA 4E4UA 1TV2A 4WDWA 4GK8A 2BGQA 2X1UA 3E96A 1CXEA 3V1PA 4NZ1A 4C6BA 1LG1A 2A1YA 4D71A 3ITGA 5FEPA 4GD0A 4Y8FA 1KR1A 4PE8A 2EPLX 1XSIA 2NT0A 1XUUA 4ZB2A 3ITYA 5I00A 2QMKA 1CNVA 1UMLA 4FXRA 4Y2WA 4I90A 1FTXA 3KL3A 3NEVA 1QWKA 4AVOA 1KGWA 2Z0IA 3PSWA 4U2YA 4DJDD 2RH9A 3HV9A 1BEUA 3VNDA 3SCUA 2C1GA 3LMZA 3M6YA 1VHNA 3OBKA 4D1JA 4O16A 3W70A 5K7JA 1VJIA 1W5PA 3ONBA 3LCFA 3GAYA 4PB5A 3S5ZA 1JDDA 2FZ8A 5E09A 4CD4A 4HTRA 2A7NA 3XISA 1BVWA 3UYIA 5C8BB 3EAUA 3MP4A 4K8GA 5CGQA 1L9WA 7TIMA 3A5VA 3WCZA 4AZIA 1S2VA 3EA2A 4MWAA 1PCKA 3ID7A 1K4GA 3GFYA 1QOXA 4NZJA 5CGMA 5A8QA 4DPQA 1KLZA 2DZPA 3ZFHA 2CZ5A 1IR2A 2O4MA 3FVMA 1SFSA 1JCMP 1HT6A 5HJYA 1W8SA 2OYKA 4Y7EA 3C0QA 3QR0A 1KBBA 1TIWA 2PCEA 1PIFA 4EE9A 1WUFA 5LIUX 3CL7A 5E9AA 1FWNA 1TJ0A 1YW1A 1MW1A 5FSDC 4LANA 1FBAA 3CZGA 3WDQA 5GEPA 5GVJA 3ITLA 1ZNNA 3NTYA 1XGDA 2V63A 4DN1A 1CBGA 4LGXA 1UD6A 4P8UA 3OIHA 2J88A 1EXPA 4P7LA 3L2MA 3SQLA 5G4EA 1UROA 3GAKA 5HXMA 1TCDA 3MM7B 5HJLA 3IGHX 3F2DA 1H5YA 1MW2A 3K4AA 2SFPA 2UBPC 5DCBA 2ZE0A 2VHLA 4NZCA 3QR1A 3VOHA 1DIEA 3PN8A 2WSPA 1FXPA 1UR9A 3C2RA 3NO3A 4N42A 4C65A 3EYPA 1UD5A 3UXAA 1VF8A 1HL9A 1UWTA 4F4RA 5D33A 3UR2A 3V16A 2H3BA 3THCA 2RHGA 2CERA 1UMYA 2F7FA 4F2BA 5FJPA 1YRRA 1A0CA 1NJJA 2E6AA 2ZRWA 3W2NA 2WSYA 5A1AA 2XH4A 3AALA 4JY8A 3G3DA 4LVGA 4QE5A 4PSPA 5FJIA 2FZBA 4UTHA 4KRZA 1XLIA 4FX8A 2Y70A 1DXFA 2AL2A 3M47A 4JX4A 1X1NA 1TE6A 3PZQA 5ABFA 3TEVA 1H41A 4B9ZA 2PP3A 4QDPA 1H1NA 1HJXA 1XYFA 3KWSA 3W76A 2QLYA 4AOPA 3HOJA 1DWAM 2FB2A 1JVNA 4ICMA 4O19A 4R53A 2V8ZA 3E6EA 2DZAA 2EPHA 1FWJC 2QULA 5CSRA 5T9CE 4DM1A 1CDGA 3DHUA 5E6ZA 3I10A 3KHDA 4AC1X 2GZXA 2JALA 2X09A 1FP8A 3GW3A 3O7UA 2HZGA 3R43A 4U3AA 2YDRA 4WD0A 3RX2A 5LHFA 4O14A 2R1MA 3WH9A 3VILA 3C5QA 1H49A 1RCOB 2C16A 2PDBA 2QHAA 4NAEA 2VEIA 4AMCA 3LZ3A 3ANVA 3PPCA 5CQ1A 2ISDA 1ME9A 4C1LA 4DXXA 1OF8A 4CD5A 1D9EA 2C1IA 1GJWA 2HTMA 4FLQA 5I6SA 4UTKA 3KLLA 1NP2A 2OLSA 4C6LA 4JTAA 2PF8A 3XIMA 4MF4A 1SZRA 2YSWA 1W3TA 3UZJA 5GJPA 3NZGA 1ZPTA 3DFPA 3LSBA 5K4ZA 3W2JA 4QJ3B 2DPEA 2J78A 4RNIA 3UFYA 2POTA 4MLRA 3SJ3A 1TWDA 1BGAA 1S2AA 2V2HA 4FR6A 3F4DA 4E2OA 1MUMA 4UC5A 2QCCA 4A3YA 3H24A 2WVSA 1TPC1 3TZNA 3TTEA 2D24A 4M7TA 3GNDA 1RK6A 4TR9A 4HZ6A 1JRCA 2VEKA 2YDQA 4IJBA 2PDQA 1REQB 3BSMA 3RAOA 3PJUA 3A12A 4J3XA 3APYA 1FHUA 4CEUC 3W87A 2QGHA 4LPCA 2Z6IA 3CHEA 1X6LA 3UWUA 2ZRXA 3RCYA 1TPUA 2JEPA 1QVBA 5JBFA 5D37A 4O10A 1F3XA 1UD4A 1AG1O 1JGMA 3WF2A 1R0MA 3O06A 3IIPA 4ONVA 1PE1A 1J12A 5I0DA 1JPIA 4YS1A 1ECQA 2BP1A 3IJ7A 3LHZA 4N9CA 3CUXA 4D2JA 3TA9A 3HPAA 4PSRA 1FWSA 1TMQA 3H21A 4PUEA 4L7ZA 5HWJA 1EA0A 4KF1A 4I6KA 3LENA 4W5ZA 3LLFA 3GXFA 2Q8XA 3W82A 3WQ6A 3ARYA 4GUJA 1E6SM 1FWFC 1KD0A 4MB4A 3AIVA 3NQ2A 3RMJA 3OLGA 4HNLA 1ZCCA 1RBAA 3AIUA 1GQLA 3VOJA 1J0YA 3WBYA 3TNBA 3LU2A 5AVNA 3L5MA 4GX8A 4X3ZA 3RLUA 1M41A 1HZYA 2QCFA 2NUYA 4PN2A 4JXCA 2V4JA 3CHFA 1VFLA 1Q4NX 4AEEA 2OGYA 4C6QA 4IICA 1WYIA 3V7PA 2HVMA 1L8NA 4AYSA 1F6KA 3WJXA 4DQWA 2A7RA 4X63A 3W6LA 2VENA 1DL3A 1CT5A 3QY7A 1A50A 3LEPA 3IPWA 2P10A 5DRCA 1RPKA 3NWRA 4WIWA 3W1PA 5G4HC 4JQAA 2A3EA 4IPIA 2PBOA 1U33A 2C6QA 2G4JA 4I7UA 1JI2A 3S2MA 3WENA 1QUMA 4L9YA 2CBIA 2KX9A 4N2YA 3OYXA 3WLOA 3TXVA 1G6CA 4K1GA 1FDJA 3POCA 2G5WA 3U8GA 3U2EA 4XZIA 1UD3A 5AECA 4KW2A 1VFTA 4JN8A 1NU5A 2EO7A 1XRSA 1F05A 4J7RA 3K30A 4MB5A 2QKFA 4BQ2A 3VM5A 3CH0A 3CTLA 3EX6A 3AXXA 4W93A 1WKFA 1GVQA 1P0DA 3NQEA 3VI2A 3TQPA 1R3VA 2ZICA 1RLCL 2R24A 4MFDA 2QCLA 4IGNA 4LVBA 2VO5A 4FP1A 4RNJA 3QLLA 2VR4A 2WBKA 1UBPC 1XDJA 1YPFA 4IPJA 4L6DA 4JFTA 2CKSA 1ZU8A 1QBAA 4PEEA 3R0DA 4HJWA 3M46A 4FLSA 4BEQA 1NF0A 2C91A 2XINA 1O5XA 4H4IA 1KXTA 1TKKA 2ACRA 1FHDA 1XGEA 4ALDA 5EBAA 4ATLA 5I3IA 2GEPA 5HK4A 3I7RA 1RJQA 3POHA 1JF6A 2BVWA 1C8XA 3SCVA 7REQB 3WF1A 2DIEA 3LCHA 4RDWA 5CZSA 3LBCA 4BI6A 4GINA 4DBWA 1ZAHA 1HNYA 2TAAA 1GG1A 2WC7A 3QZEA 2CLMA 5K3VA 4XQ6A 2PTYA 3EX2A 2HPMA 1OJXA 3SFWA 3PAJA 4E38A 1FP9A 3TR9A 1WXYA 2ZYFA 1PKNA 1C8VA 2CHNA 1UKSA 1M7JA 2WKLA 4BF9A 4NIRA 1T41A 4IT1A 1CGUA 2ZC8A 3UCDA 4NXKA 3UR7A 1UQYA 3M5YA 3CYJA 3IJQA 2VKZG 2I5IA 3UWYA 3P7YA 3OU8A 4EK7A 4RR4A 4Z2GA 5DLCA 3EWUA 3FIGA 3MP5A 2VQUA 1MXSA 3G1FA 1MUWA 2WHJA 3BCDA 1DJHA 4XKYB 2ZA3A 1R2SA 3VKTA 2BY1A 2VZUA 3MM5B 2OQYA 3VMPA 1EKOA 3PR2A 3PUOA 3WG6A 1XL9A 3DYPA 2JQXA 2DW6A 5EMMA 2PDLA 3NQDA 3C61A 1PO9A 3EDEA 3W27A 4PCNA 4DUVA 5KZEA 4UNKA 1UWSA 5CAHA 1J2BA 1EBGA 4P7OA 3DEQA 5G5IA 1E6QM 4NAFB 1K77A 1Y7VA 4IH3A 3ABZA 4Q8TA 1SU5A 4PMYA 9RUBA 3U7VA 3CQJA 1K03A 3WJWA 3IK2A 5A6SA 4MTVA 3SEPA 3NPUA 3MANA 5EFDA 5CBIA 3MM5A 4PUDA 2OX4A 4QP0A 1NWUA 3SURA 1XD1A 3EA1A 3BMVA 1RQEA 4JKMA 3C2OA 3MCOA 3KCLA 3SR7A 3K13A 2XGIA 1VRXA 2F8QA 3FSTA 2OZ0A 1YDYA 3B0NA 3OGSA 3URNA 4R85A 3W7EA 1FVPA 3S6TA 2OMAA 3EXSA 3UQNA 1VBHA 4LFYA 2PI6A 1S2TA 2WCGA 2V5BA 3OOQA 2A3CA 6PTDA 2YYTA 4Q4OA 4DIAA 3DGRA 4GYPA 1WAWA 5RUBA 3VM1A 2QV5A 4HSNA 3FSUA 1Z7AA 4JZ5A 3VDHA 2CBJA 4A6GA 3VGHA 1H09A 1A5SA 3YPIA 3KVKA 4MY1A 2G95A 2C0AA 4A8RA 4X22A 1UG6A 3UY7A 1LDCA 2BX7A 4PULA 1B4EA 3MMCB 3LA4A 1WZAA 3OEXA 1R86A 1R5YA 1KBKA 4GACA 4GWEA 1BG4A 1A5BA 3K8KA 1G69A 1W9BM 4B5WA 2YBUA 3ARQA 2HRWA 3PULA 4N4PA 3CO8A 5I78A 3THDA 5M1TA 3WLMA 3A22A 4XAGA 1NFPA 1Q2SA 4O8RA 1I2OA 2QMJA 2C18A 3CUFA 3O9NA 1EDGA 1SYTA 3O6DA 1VQTA 3EZ4A 3WQ4A 3VD7A 4WGHA 3T7VA 1LRTA 3N2BA 4O1EA 1YKWA 1H62A 1KM1A 1X8FA 3FW6A 2VT0A 3UJRA 4TV5A 3N2OA 4S3JA 3WD1A 4RV8A 2WMIA 3F2BA 3UWZA 2DV0A 4GYJA 1L0PA 2JIEA 3WNOA 2BY0A 4IG2B 5DMYA 1IYXA 1UH2A 4S3DA 3E0FA 3VGFA 3BL3A 1C8YA 3DGBA 1WKEA 4Q8WA 2GDUA 2WMGA 1VC4A 4MDPA 2OZ8A 4J4KA 2OKOA 1KCXA 3NDZA 1WBJA 1JD7A 2DH3A 3FCPA 2RUSA 2J79A 2A2IA 2Q09A 4R88A 1MEWA 1DTUA 4NJIA 3OVPA 4JQ4A 2TSYA 3M9YA 2V82A 1OWQA 4KIEA 3NXFA 5G1YA 1VFOA 3CUZA 3H26A 5CCZA 1V3LA 1OYCA 4GC3A 1H7NA 4UQBA 1FRBA 1QI3A 3MMUA 4J3ZA 2OO6A 4JNZA 3W88A 3WEMA 4J27A 1WX0A 4XSLA 1S2UA 4PCSA 2QJHA 4DO6A 3L2IA 4CVWA 1U1JA 1XBZA 3ZLHA 5D09A 1SGJA 3I6EA 2E3ZA 1TVNA 2PB1A 3MU7A 3BOFA 3VKPA 3VNMA 4PL2A 4UMCA 4LS1A 2DVUA 4S23A 4LVAA 5DANA 3BW2A 1XIEA 4O4VA 2O56A 3M7SA 4HT3A 3W1RA 4KWUA 3KBSA 2ZBTA 4BF7A 3IIZA 4QLJA 1F3TA 1OC5A 3CK5A 2F9RA 4ERIA 4C6FA 3AMLA 3ARZA 2Z1VA 3ZS4A 2X7VA 4AB4A 1W37A 3F4WA 3LRLA 5I3GA 1TUFA 2PWDA 4YTQA 5AN7A 2P3EA 4AVNA 3TLLA 1MDRA 3MMWA 1Z42A 1QASA 4P7RA 2GOUA 3ARRA 3IGXA 4UQDA 3S3GA 4OZOA 1EO5A 3BJFA 5DELA 2R14A 4ADUA 1JAKA 3DESA 3IANA 3W7LA 4JPGA 4QG9A 1B3YA 4G38A 4TX8A 3H2CA 1Z41A 3T44A 5F7UA 4Z08A 2PMQA 3TOYA 4F2UA 1HFBA 3NSMA 2AAAA 2XFRA 2VDHA 3P82A 3IVTA 1TV5A 3C3NA 1QRQA 4JKLA 3GFXA 5CGTA 1XIHA 3GBEA 4CQAA 2PWVA 3S2NA 3TW7A 1MO0A 1ZS2A 2RDWA 3HZ3A 4Q7IA 3U4FA 3BK0A 1YLVA 3EPNA 3KXQA 4QR6A 3CT7A 2H6RA 3KBWA 3HG2A 2R1LA 3VGGA 4HA4A 3HPZA 3R58A 4W87A 6REQB 3R1ZA 1WO2A 3WQ5A 5C5YA 4ZEPA 1DWFM 5AB3A 4QSFA 3MO7A 3FJ6A 3GK0A 1IEXA 4JNMA 1CLVA 1DE5A 5LKYA 2VGGA 1FWDC 3KP0A 4KS0A 2IPFA 2WJDA 4JYFA 2HISA 3TW9A 4ES4A 2QAFA 4XZHA 3IV8A 5G2HA 2HSAA 3O6CA 1YXCA 2ZWZA 3P93A 1G4PA 3SFKA 2XVKA 2E1DA 2PTXA 4BQ4A 1N7KA 3V75A 4EOUA 1LLWA 4PMOA 1K8ZA 4Z2IA 1A5AA 4OIFA 2WVVB 4ZQMA 1A80A 5H8PA 3ZOAA 4D72A 2E1WA 4L56A 5C9XA 1IXNA 1QK2A 1ZY9A 4J28A 1OF6A 4NQ1A 4CD7A 3WNNA 3P74A 1FH7A 4GQRA 4HP5A 1POKA 3HFTA 3HQOA 4TIMA 1PX3A 4KH2A 3WLTA 5LYRA 2OYLA 5CBJA 4FO4A 1E70M 3GE7A 3TX9A 4LCRA 2Y7DA 2FGBA 3BSHA 3IRSA 2WOQA 1J01A 3H2MA 4WK9A 1WKYA 3G1DA 4XAFA 3RJYA 1BRLA 3LI1A 3SUSA 1I2PA 3LYEA 5I09A 4GOAA 1WOAA 3MV01 4F0SA 4ZFMA 4BI7A 1HF6A 4IPNB 1QJWA 4BKNA 3C6CA 4JDYA 4H83A 4EKJA 2F61A 3CAWA 2PDYA 3GG1A 1FWHC 3L4WA 5U4NA 2QJIA 4S38A 3TN4A 4QQ3A 4LRSA 2YL6A 4D6EA 5JIWA 5LNSA 3LHVA 4FOKA 2VL4A 2PDCA 4C7DA 3GBDA 1QK0A 3CBWA 4NJKA 4C60A 5F4XA 2Y8UA 3BGGA 5BRBA 4H2CA 2XH0A 1J4EA 1OFDA 4EAMA 4DJFA 2GJXB 4TX9A 2QVNA 1AH4A 4LS0A 4HOXA 4LV9A 2F38A 1V03A 3NQFA 2FTWA 3B9OA 8RUCA 3GHTA 3LBOA 1NQKA 4Q8MA 1CLXA 1UH3A 4ZOBA 1AODA 1WXJA 3NVDA 2F6UA 2GWGA 2QAPA 1GG0A 2HPIA 4A22A 3H70A 1FWCC 2CZVA 1ZJBA 3GWQA 1DJXA 2Z25A 5DXXA 1EGVA 3W75A 1PB0A 2HV5A 2GDVA 1JEZA 3P80A 4UR7A 1MXGA 1C7SA 1WDSA 4IGMA 4GQQA 3TROA 3V36A 3KDNA 3DCPA 1KFKA 1NIUA 4OVXA 2AKJA 1ZAIA 3IGSA 1PIGA 3VKQA 5XINA 4U33A 2WO5A 1JCYA 2ODOA 2PRMA 3NCOA 2VCBA 5E70A 2BVTA 2UY2A 3UZYA 4EF9A 4AZCB 5HMEA 5D2YA 5DBUA 4XO6A 1FWTA 4UTMA 3EXTA 3W1AA 1QI2A 2Z2BA 3ITVA 4XD5A 2J25A 1XWYA 4UXDA 7GEPA 3OO2A 4EWND 4M1BA 5CG7A 1VRDA 2BGSA 1ZAJA 4OE7A 2V5KA 1J79A 1JFHA 4AD0A 4ZE4A 2YLLA 4R7OA 2Q71A 3LCGA 8XIMA 3BXWA 3P5YA 3UWVA 1HVQA 3KDOA 3AJ7A 2HK1A 4DPPA 3WSUA 3AZRA 3RR1A 5LGZA 1GQNA 1HGYA 4RDYA 1WP6A 1ISZA 3EX1A 3MHFA 3VZYA 3KW3A 3NO5A 3FK4A 3VUPA 4LY4A 1ZCOA 1PJ9A 1TWSA 2CETA 1R7OA 4CQDA 1KV8A 3PNUA 1I1WA 4B5VA 2ZQ0A 3OYZA 3TNOA 1EL3A 4JTCA 4M1RA 3EWBX 1XF0A 1MQRA 3GG0A 4JL1A 2XTKA 5LA0A 4IQJA 3WUBA 4PCPA 3MM6B 4FK9A 3WBWA 1TSIA 4XTDA 3OG2A 1CGYA 2O92A 2J7DA 4X60A 4C91A 3NZRA 4PMXA 4EAYA 1W8GA 1VFHA 4RPPA 2QW5A 9XIAA 1GVSA 3II1A 3KTCA 4IQDA 4IFOA 3URBA 5B80A 1H60A 2WWCA 4HOZA 3LG3A 4WF7A 1DIKA 1W3IA 1BGGA 3O3RA 1TB3A 4UR9A 4I6VA 4QAIA 3WDJA 4DWSC 2OPJA 4DO5A 3PBYA 2OCZA 2QCGA 4PC8A 4WKHA 4FOUA 5F2IA 3ES8A 3N15A 4QJ1A 2JKAA 4JGDA 4HHHA 4UTTC 4JFVA 4M0XA 2V0TA 3QJAA 1HL2A 1HG3A 1IXQA 3LV6A 8TIMA 4HNNA 4DBDA 1JDFA 1FWRA 1IWAA 3Q58A 1UR3M 4JFWA 2YL9A 2VRQA 1K9FA 2Z00A 1OGGA 2WM0A 2Q6ZA 5LXEA 3VUSA 4Q3MA 4PEKA 5AHIA 5A6JA 1Z6KA 4KESA 5A6LA 1V3HA 2KAUC 4AIEA 1OX4B 2YDAA 3S1UA 3ZT6A 4RXFA 2EPMX 3CHCA 4RE0A 3HJZA 5BRQA 2QJNA 2B7QA 3P2VA 5F4SA 2XISA 4K37A 3PC0A 4JHZA 3VKRA 2WCAA 2ZTKA 1LORA 1VYSX 4QSHA 3V18A 2PDMA 4K8EA 3S47A 3IJ9A 2FH6A 4HNVA 3KTSA 4E8GA 1XLEA 3VIPA 2FTPA 1I0DA 3O6YX 1CXLA 3DZ1A 3VZXA 3F2CA 1QPKA 2HNHA 4IMEA 3FA3A 1ZJIA 4C6EA 4F9JA 2YCLB 3IGUA 4L4MA 1Q63A 5LA2A 1MEIA 5CC6A 1J8VA 3AU2A 3D47A 2NVDA 3TJ4A 3BSGA 1JD9A 3V0UA 3WMLA 1C9DA 3I68A 1LYXA 5IOBA 3PG9A 5I3HA 1NOUA 2XSJA 4RLIA 3K8LA 5CZTA 4F3HA 3G0XA 3FN9A 1E1FA 5BU9A 5BU6A 4B2DA 4AQLA 4QBXA 3MW7A 1Q6QA 4TO8A 1JL8A 1TRDA 3ALFA 1ZUAX 3ITXA 3GIPA 4FPSA 4Y6GA 2CLOA 4GIYA 5LZLA 3BUVA 3GH4A 1Q7MA 1T99A 4GQ0A 1GJPA 2WNQA 1DWIM 3L4ZA 3K5XA 1I6NA 2A0NA 4DNHA 3Q2DA 3SQMA 1MUCA 3BAJA 4HA3A 3GY1A 3QHMA 1D2KA 1JDCA 1EHNA 1Q8AA 3S42A 2W61A 1GCYA 2Y5SA 1G94A 4JDBA 2Z1WA 2EJAA 3VIHA 1D8CA 3STPA 2CITA 2OXNA 1SPQA 1UWRA 1AZ2A 1NARA 1JG9A 3GDKA 4I5UA 4IM4A 3KZSA 2XGBA 3OGRA 3L4XA 4PODA 1W1PA 2DZBA 4KCUA 1JYWA 5M3WA 3QPYA 1V0LA 1F5ZA 3MM9B 3ITTA 2OQLA 1Q4WA 5ECVA 4WUIA 5ABHA 4KRUA 2F2HA 1KFBA 4AY1A 1FDYA 1UIOA 4AU0A 1GVRA 3N9RA 3UA4A 4JX5A 2NWRA 2FPYA 1TA3A 1P6BA 3ARVA 5LHEA 1JCJA 1QNQA 1CPUA 2YJQA 3WLJA 3B8TA 7ODCA 3BW3A 2WQPA 4OBSA 1DJWA 2Z24A 4J5NA 1YADA 5HNUA 1DJIA 2I57A 4GC4A 4J40A 3PZNA 4DF1A 1YDVA 2PWEA 4QEEA 4GXWA 3GDMA 4HKPA 3RLVA 3PTMA 4FXJA 3P14A 4ZVJA 1AZ1A 3AZSA 4HNOA 1LWIA 2PTDA 4E8DA 3WLQA 4S1FA 1TO3A 1DHPA 3BANA 2WQDA 4NZ5A 4CQ9A 3HGOA 4FZIA 5REQB 3DFNA 3H2OA 3B8UA 3E5BA 2F6KA 3D0CA 1BAGA 1RLDA 3V35A 2BOEX 4ATDA 3PAOA 3IV3A 1HTIA 4U31A 1CENA 4O1CA 1V8EA 4PUWA 2NX1A 2VX6A 3W6YA 1IGWA 4L4PA 4WDXA 4GH1A 1F7BA 3T4WA 4LAZA 4MNJA 1A47A 5PTDA 4Q4QA 4QRNA 1EJRC 3L2LA 3T55A 4NJJA 3ZR6A 1W9VA 4V28A 4O53A 4GGBA 4UUIA 2NUWA 5F1UA 2FVMA 3MCMA 4UFLA 4O4WA 5I3KA 4DRSA 4QGCA 3DBPA 1PZ1A 2CLPA 3LI0A 3OR2A 2GUUA 3FA5A 3ITOA 2OELA 3RPDA 1EGZA 2BWGA 3DKJA 1EFZA 2XSBA 1X1ZA 5KMYA 1FWGC 4GUIA 2ZX6A 4LAUA 3HMJG 1FHLA 3W2UA 5IDZA 4G1KA 3DFOA 5A8MA 4QROA 4OGZA 4HD5A 1ONXA 2YCEA 1E0XA 4H2HA 5A6BA 1S39A 3E0VA 2OSYA 1DHKA 2CXEA 3VCCA 1XC6A 2VI0A 1JDEA 4PFHA 2V5DA 3K1DA 4HJFA 3CPUA 2NSXA 3VA8A 2XIOA 2VQTA 4JL2A 4CNTA 2YFOA 1UD2A 3GD6A 1RY8A 3BZJA 3RPTA 1E5NA 4MZ1A 3AYRA 3CV2A 3S1VA 3D46A 4AF0A 4UFHA 1Q85A 6TAAA 3G0UA 3QOMA 3V5OA 4GPNA 3L7RA 1V7AA 5D04C 3GR8A 3DI0A 2VM8A 3MVIA 3VZZA 1GEHA 1Y5XA 2NQLA 4IIDA 4RNFA 4DJDA 3WDPP 3W7JA 3GO2A 3IJIA 4PTXA 2WK2A 4H6EA 3NQAA 3DENA 2ZZ5A 5EMYA 4JIEA 1UOKA 1RA0A 4G7EB 1GOIA 5HWNA 1ONRA 3WUEA 1O94A 4NYYA 4O1BA 3WD2A 1AQMA 4IP7A 1ICPA 2RKXA 1M7PA 3M41A 1RSCA 3BW4A 2WJZA 5D4YA 1RA5A 2BS9A 1MZRA 3QTPA 3A9IA 4IJCA 1K8YA 2DQXA 3A4XA 5BW6A 5AOUA 4UNIA 2PWFA 3OHIA 2OX1A 3CGTA 1UP0A 1KQYA 3DU0A 3W71A 2X42A 3AIBA 2D3NA 3E2RA 3PSVA 3QTGA 1EDTA 1ICQA 2YFNA 2CESA 4TUFA 3CMFA 3ES7A 4NJHA 1OC6A 3AS0A 1W3JA 1GVOA 4HYVA 4LNYA 3VLXA 1OHLA 1M9HA 2H9AB 2O0TA 4Z42C 2ZRVA 4UMAA 1XIGA 3R79A 1CI1A 4IHCA 4N0RA 3CC1A 3BLDA 4LSBA 1DJNA 3TN5A 3KOXA 2QIIA 3WLIA 5A6TC 1ODUA 3DIPA 6XIMA 1UASA 2ATMA 3W1UA 3B0MA 1LUCA 5ECUA 3OP2A 1RZMA 2QCDA 3PUGA 4AXNA 5F4WA 3NXLA 1E5JA 4LUSB 1XIJA 1YIXA 1XD0A 2MANA 1OD8A 2WZEA 3BE7A 3NQCA 3LPGA 2PLJA 2WMJA 5FEZA 1XDMA 1IV8A 2DSUA 3AU6A 2D20A 1E1CA 1Z8AA 2XH2A 3NZPA 3DC8A 4RKAA 4PUMA 4AWSA 4N6EA 3WMCA 4Y9MA 2PDPA 4O57A 4C90A 1MNSA 2YL8A 2DZTA 1ZALA 1E6XM 2INFA 2VFIA 4DUXA 4HTYA 2E68A 3SSZA 2VGFA 5A5WA 3IVSA 3OLIA 4UZSA 1FKWA 3OLEA 4YMZA 3E0IA 1WQ5A 2WNNA 4XBKA 2XSAA 1QW9A 2PDJA 1VCVA 5D05A 4AY8A 2GJRA 3GNNA 1EC9A 2DZWA 1RHCA 1D3CA 1VFMA 2VX5A 3TJIA 2F6XA 2PGRA 3CWNA 1ZJHA 4S3CA 2Y8VA 1E72M 1KKRA 1O4UA 1OFQA 3BMWA 3VKDA 3N2CA 2B31A 1LF1A 4CD6A 1X7FA 4Z1DA 2ZUWA 2CLFA 1V93A 3VOIA 3AYSA 5AKQA 2GSHA 3VXGA 1PKMA 1L2UA 3OR1A 4RE4A 3VM7A 1ZJAA 2E9LA 3RX4A 2QUVA 1RBOB 4CCDA 4AVFA 4J9JA 4Q33A 3H4GA 1NDZA 3MJYA 3NPXA 4J2PA 5K9XA 2QF8A 5A3HA 2EKCA 2HMCA 1KFEA 3EXRA 2KZHA 1A4LA 1IEWA 2VOTA 4U10A 3S5YA 2L5HA 3S83A 1QHOA 4H8NA 4OWGA 1OD0A 4KEVA 1LOQA 2C71A 3SRHA 2PCQA 3B8VA 4YN5A 2E6FA 5I3FA 3MCNA 1GHRA 4MB3A 3WQGA 1B2YA 3OVRA 4FNRA 1CLKA 2DZVA 3W72A 1KFWA 5JH1A 1GOOA 4YTUA 4J3VA 1ZQ5A 2BVDA 4X61A 4UTUA 3W85A 3R8RA 4FOJA 1QXLA 1O6IA 4GCAA 1YTKA 4HMEA 4BS0A 4WXYA 2FDMA 4NNAA 3HMCA 4L9ZA 1OYAA 4KCTA 4K3ZA 1MYRA 3MMBB 3B9DA 3NQBA 4F8XA 4LUIA 1FWAC 2GDQA 4ENLA 2CBVA 1ODZA 1VFSA 5I3JA 3QW4B 1RAKA 3Q45A 5MKGB 5HINA 1OADA 3KLKA 3PJWA 2YB1A 2QGYA 1PTDA 1EQCA 1OBAA 4QJ5B 3S5NA 3QSTA 4LWWA 2ZADA 3G5EA 3UPWA 4UQCA 1KRMA 4US5D 2XFFA 1AJZA 4RDVA 3VFCA 3GTIA 3WQ8A 1MZHA 2EXOA 4DX3A 3MHUA 4OUIA 4NX0A 3A21A 4URIA 3RCMA 1ZB5A 2QUTA 3M0JA 4FHAA 2DVXA 2G3IA 1OT1A 4KT2A 3UXDA 3ZQ9A 3R10A 3GYEA 3BV4A 2ZUVA 4ZOEA 3IJ8A 3QRHA 2CW6A 4LBUA 3LXBA 3RRXA 1O5QA 4DZAA 2BY2A 3MBDA 7PTDA 3L12A 5HUOA 3WQWA 4AZGA 2YA0A 4FXFA 1W31A 3P60A 4RZ6A 4LBRA 5JVLA 5G1MA 3CYVA 1FCQA 1H3GA 1LBLA 1YXYA 1XIMA 2GK1A 4H01A 3MZNA 4ZQRA 1IE7C 4WVXA 1HKMA 5BOFA 1TQXA 3PUEA 3LHTA 3WFLA 4ERAA 3JU2A 2ISWA 2G97A 5CPTA 3LGGA 1JCNA 3GUWA 3R6IA 4QS5A 4Y9NA 3ZT5A 1XSJA 4H41A 3T81A 6ENLA 1Q45A 3EOLA 1OSEA 5XIMA 3I4KA 1DIOA 3DAQA 1S5WA 1UWQA 1UZ1A 2I5QA 3CEUA 4C7FA 1KCLA 3G8RA 1V6TA 2ZX5A 1G01A 2FVLA 1KA9F 1C7TA 1MEHA 5CEWA 5AYZA 4GX9A 3W2LA 4I8YA 3H2NA 3JW7A 3W81A 2NWSA 4Q4KA 6A3HA 1WE5A 2YA1A 2ZZ6A 3TYBA 4D8AA 4H04A 4MY8A 4MG4A 3STCA 6TIMA 3MDWA 3CIXA 4GYFA 4K7YA 2NXHA 5GNYA 2PP1A 3QM3A 3EB3A 3GZ3A 3URAA 3S5OA 3SADA 2IKIA 4GUGA 3W2KA 4N7QA 3SGGA 3KOZA 2OZ3A 2NQZA 4V33A 2WHMA 4Y9PA 4HPXA 1XYZA 2WZTA 4OBTA 1MI3A 1ZP4A 4MUPA 2IKHA 2Z7KA 1CX9A 1FOBA 9CGTA 4R33A 5C70A 4DYJA 3CUJA 3S4TA 1IZKA 3WNLA 2EJ1A 5C2CA 1J18A 1RV8A 1VENA 2DIKA 2HJPA 5IDIA 1RH9A 4AISA 2TODA 1JXJA 1I8JA 3T9PA 4GUFA 3H7VA 3ZZ1A 2NQ9A 1YMYA 4AC7C 3B4UA 1F3EA 2RJGA 1LWHA 3F4NA 3L4YA 2C0HA 2O7QA 3ARUA 2REQB 1W5NA 4DI8A 4S3EA 3CB8A 1R3TA 3GTXA 3ZO9A 3ALGA 4HNTA 1TTQA 1CXHA 2XPKA 1OX6A 3PZGA 4BQ3A 3PBUA 3W00A 4GKLA 3MMAB 1JQXA 3S6OA 1VIZA 3OGVA 1GZ1A 3WMSA 1OFBA 3WD3A 1L6SA 3FXYA 3GIQA 2ISSA 4DXKA 5M17A 3NVTA 1HJWA 1UA7A 1YTDA 1UKPA 3QEZA 3CV1A 3CWHA 4GUHA 1P0BA 1P1MA 4OFCA 5DF0A 3R12A 3MMDA 1AOPA 1LQAA 3JS3A 1FA2A 4UTWC 4PTWA 3EKZA 3JZEA 3MJMA 2C7FA 3VDGA 4D1IA 3AHVA 3SM0A 3G0SA 5AZ1A 1FFQA 4CKQA 1QW8A 4JTSA 1DVJA 2E09A 3O07A 2J74A 3W9ZA 3GX9A 2DU2A 5I02A 3GSMA 1PWMA 1TX0A 2WCSA 1RXOB 1XI3A 3WH5A 1MRQA 1OGBA 2QT3A 4MYXA 1BG9A 2PTWA 3GKAA 1XLFA 1A3WA 3SCQA 3UU0A 4XZLX 3BGAA 2CLKA 3DUGA 2ZCGA 4UBPC 4DZHA 4Q8NA 2ZDRA 3V1HA 1R2RA 4WXZA 4IL0A 1GW1A 5HPOA 5FF3A 3IJ6A 3TTSA 3B03A 2ZKMX 4AXKA 1XIFA 1TTPA 3NM3A 5BOEA 3GRIA 1P4CA 1LWJA 1TWZA 3BAIA 5CSSA 3R89A 1RD5A 1ZHAA 2AQVA 1BVNP 3SN0A 5AC5A 5AYYA 2P3ZA 2VC7A 3MI3A 2EBNA 3STGA 3JRKA 4OOZA 3RITA 5IBXA 2X40A 1J5TA 2YGYA 3IVUA 4H7CA 2TRSA 4G2DA 1KM3A 1FQ0A 3K4DA 2A3HA 2DGAA 4E2BA 3LTYA 1M03A 3APTA 4JFSA 2HVOA 4I9AA 2YR1A 3LNMA 3MO4A 3DBNA 3WL1A 2XUCA 3AUJA 3QLDA 3UZZA 1C90A 1CXKA 3WQCA 3NIYA 3BAWA 2DIJA 5DMMA 4O8AA 4Q4PA 4OKDA 4QLLA 5FL1A 5LIKX 4C6DA 1UQZA 1A0EA 5CPNA 2AGKA 2PDXA 3XINA 3VE7A 2NW0A 1XBXA 2AMXA 2ZZ1A 4F66A 1GVEA 3UXKA 3DECA 1HKVA 3TVAA 4F48A 1G5AA 3I6TA 5HQMA 4GJ1A 3PFRA 1BXNA 3QZAA 2BHUA 2OZTA 2XM2A 4UNLA 3BLIA 2WC3A 3UGVA 3C0SA 5D2XA 1K70A 2YBTA 2QPSA 4GJIA 3L4TA 5DN1A 8CGTA 2XM1A 3ARTA 2YCKX 1ME8A 1TG7A 2YXXA 4W8AA 4V15A 3VOGA 1JZ3A 3M0XA 1PEZA 3WUFA 4A2RA 4ADTA 3ZVHB 3GW0A 4YHGA 1YHTA 4NRSA 3VLYA 4KEZA 3W7OA 1JGIA 1EYEA 1HQTA 3G6MA 4M24A 3PZTA 1SO5A 3IEBA 1A0DA 1EX5A 3HU7A 1ITXA 3AHXA 3V3WA 4UOJA 3UVIA 4AX6A 3C0LA 1UC4A 3ISIX 4YWSA 2R1NA 3SCNA 1OIFA 3LV5A 5AHMA 2J6VA 4FXSA 3S1WA 1IT7A 1ENUA 4A3HA 4IIHA 5FAJA 4B90A 4WJEA 2ZWYA 1PCWA 4GABA 3MBFA 3B04A 3N6HA 5DMLA 3W7NA 1DXIA 3VNYA 4HU8A 3AXHA 1J0KA 2YYUA 1THFD 2VRJA 2CLEA 4UOQA 1W3NA 3IS4A 4BJHA 1XIBA 2NLIA 2Y7FA 2JGQA 3ZR4A 4ROQA 2D0GA 5J5DA 2W6RA 4HK5A 2VCAA 2VWTA 3WUGA 1XS2A 1ALDA 3BTNA 1XGZA 2VC9A 5ABGA 2XIBA 3KOWA 1V08A 3S2LA 1LROA 1WDDA 4GI6A 2IS7A 4PL1A 2OSWA 2NZLA 7CGTA 1XIIA 2QQ6A 3ZLFA 3RK8A 1H7OA 3Q94A 1IF2A 5AC8A 5KITA 4Y9AA 3AMCA 3RRAA 3MM8A 1TMHA 8XIAA 2J6XA 4LEQA 3R7MA 2HS6A 5BXTA 1V3KA 1AW1A 1EA9C 3G1RA 3SIMA 2VFEA 4QJ4B 3I65A 1IHIA 2X1TA 3W74A 1VBUA 2DFAA 1KBJA 2X1SA 3NDOA 4DWSB 4CEXC 4HSOA 3WL0A 3WK2A 2Y8KA 1JAEA 1XLHA 4MWAC 3NR0A 2VEGA 1DEDA 1SMDA 4PMDA 3DG3A 5HR7A 1BKSA 3HO8A 2J7FA 3BLFA 2DSWA 4YXGA 4DAIA 3C56A 2VGBA 3FGCB 1UR2A 3HURA 3PHAA 2VFFA 4LS2A 5BYWA 2WMFA 4E4FA 5J5RA 1O66A 2BXZA 2ZC1A 5C9ZA 3B0JA 1S38A 2P76A 1JRBA 3K2GA 3WNKA 4XV0A 3L66A 4E0CA 4GNKB 4PMZA 1Y5VA 1DQUA 5GQBA 4ZOAA 3W37A 3FAWA 3R8GA 5C2XA 2J8GA 4EPKA 2CHRA 4C7GA 2ZOXA 4FIRA 2RJHA 1KKOA 4ZENA 2I9UA 1K7EA 3TKFA 4XX6A 1BQCA 4IMGA 2W91A 3FYYA 1ZSXA 4R9OA 4K1WA 4ROPA 4M56A 3TZFA 1IXOA 1KQZA 2VJXA 3M44A 3MSYA 5U7SA 4FIQA 3P8IA 3KOYA 3K46A 1HGWA 1RY0A 3GIYA 2PU1A 4HHPA 3RLHA 4HNUA 4UTTA 2WJEA 2DQWA 4ACZA 3HGJA 1BD0A 5B7YA 3SW6A 1O12A 1LQ0A 1HKJA 1GT8A 2R94A 4LF2A 1XM3A 2O9OA 1CB7B 2Y89A 4FLRA 5CH9A 5CLWA 2ISFA 3TU9A 1PTAA 5CPOA 1OCNA 4PH6A 2X16A 5KSWA 3ZM8A 4LX4A 4K68A 1JYNA 3NNTA 3QGKC 1SZNA 1CEOA 2GLKA 4IPLA 2P8BA 4M51A 3TH6A 1A5NC 4CN1A 1IIHA 1ONWA 4KEMA 1BSLA 1XLDA 2FMNA 2ONEA 1GHSA 3M5VA 5AOPA 1RJRA 3AWNA 4UOZA 2ESCA 5D38A 3CAVA 4CCEA 1E51A 1J0IA 3H55A 4ZZ9A 3AMGA 1PZ2A 1A3HA 1AUSL 2BODX 4RNHA 2QCMA 1NM9A 5G2WA 1I2NA 4U4MA 3PWAA 4JTIA 4JIQA 1GQJA 4WEVX 2QPUA 1ISXA 3GDRA 3BMXA 1DJGA 2YBVA 3CQHA 1OFAA 3M0VA 4O28A 3OIXA 3QSRA 3C8FA 3RM8A 2AOPA 4HU0A 1LQ2A 4IX0A 3CPRA 1OYBA 2D0HA 3GG7A 4ML4A 2GJPA 4H9UA 4IF2A 3W24A 4IMAA 1BVZA 1J10A 1YNYA 3FYPA 3CZJA 4HU4A 3U6WA 1KM5A 3FV9A 1W17A 4QLKA 2V30A 1P0KA 3GDBA 3DX5A 3PANA 3EMQA 4RJEA 1TFVA 1SZGA 1KXHA 1QPRA 1J96A 4REQB 3EKLA 5AFDA 4XTIA 1PDYA 1E9IA 1SZEA 2CXGA 2X0SA 4F0RA 3UNTA 2CKRA 5HMFA 3PTDA 4B3ZA 1H1ZA 1UKOA 3N12A 3FNDA 3M0ZA 4INFA 1U22A 5EB8A 1EO7A 3W7CA 4K6AA 4C5ZA 4WGXA 5CC5A 3AXIA 1RBLA 2FPVA 3VIOA 3DOPA 1BTCA 4K39A 3N73A 4R5EA 3BC9A 3LPOA 2VX7A 1VAHA 4GCXA 4IP4A 2OSXA 2NQ5A 1K02A 2E5CA 3N25A 3PP7A 4NT0A 3TUUA 3GH5A 1V3IA 4JQ3A 2BNJA 2Y62A 2NXGA 3LLDA 1TPVA 2OWCA 2R82A 1PX4A 3W1XA 2Z26A 1JQVA 4IWWA 1WA3A 3TN3A 3ECQA 1QT1A 1GUVA 4I9TA 2WJFA 4TVDA 3R4IA 3USBA 1E4LA 4BQ5A 3DYOA 1W9UA 5FEXA 4Z1AA 3P84A 4MKVA 3KCOA 2GGGA 1LL6A 3N4AA 4JCLA 4LJ3A 1I4NA 3B9AA 3MUXA 4ZQCA 1C9WA 1Q6GA 2G37A 4Q4MA 3L68A 1F3WA 4XZNX 3UR8A 4MZ8A 1MW3A 4CD8A 2V6AA 4JYEA 3DXIA 4EPDC 2ZX8A 3L5LA 1Y8BA 2J9YA 2XFWA 4RW5A 3BICA 2DH2A 1NWSA 2DUAA 3MUY1 3R0KA 2CZEA 1NH6A 2A7PA 2QVHA 3O0KA 2YW4A 1UYQA 1EP3A 4ZXLA 4F79A 2ZDSA 4AD3A 3O63A 4PMVA 2GPTA 4GQGA 2R8WA 4JTEA 4MMWA 3MT1A 1P1XA 5EKYA 2DSKA 4A21A 3NL2A 2ZX7A 1EXBA 3L65A 3MUZ1 4ZTYA 3KBVA 1TPWA 3THAA 3SUWA 2UY3A 3MVTA 3GR4A 5DCDA 1DJZA 5JBEA 1ADSA 3S2JA 4EACA 3P5ZA 5BXRA 1OCQA 2X05A 3R5EA 4QS6A 3QV9A 3N6JA 6GEPA 3MI2A 1SO3A 3WF0A 4DYEA 2NSOA 2B7OA 3GTHA 3AHYA 3GNOA 3CT2A 2GQ8A 1QNPA 3MM7A 4W7VA 3VM0A 5FKYA 5CZKA 1PUDA 1QDSA 3OBAA 2GVGA 4JTDA 2ZZ2A 3AICA 2D69A 1TJ2A 2VVSA 1JULA 3BLKA 2J77A 3QVQA 4FF7A 3W83A 1BLIA 3QY8A 3VIIA 4JFUA 3GU2A 4W4QA 5DQPA 3DC0A 2WPGA 2QDGA 5LXXA 2D23A 3TFXA 3WFAA 4PUUA 3QW3A 3EWDA 5J04A 3GXDA 3VNJA 3P3BA 1WV2A 2H8XA 1EF2A 3MMTA 4A2SA 1VBGA 1TZ9A 1LT7A 3DI1A 3PZ9A 2B81A 3ABSA 5TD4A 4GY7A 2YCIX 2FZ9A 1LJYA 4IFKB 1OGSA 1HUVA 3WFZA 1F76A 3DHFA 3G18A 3GXPA 1GOXA 1P6CA 2E77A 4LAOA 2FJKA 1T96A 3Q4DA 3W1NA 1F4AA 1KGUA 1B3VA 3DH7A 3RM9A 2QEZA 5F1VA 4O50A 1AJ2A 1R3QA 1YPIA 3A4JA 2E7FA 4J3TA 4WJ8A 2EHHA 3QMSA 2A5HA 1E6ZA 4DM2A 4NG3A 4Z1YA 5LIWX 2UV8G 1SQ7A 2C15A 4LU0A 4GG9A 2CNCA 4ZO7A 4MKSA 4XZMX 1PKLA 2V69A 4YYCA 1PL9A 3UVAA 1W3HA 3QQ1A 2JF7A 4A05A 1TZZA 1H51A 3CLMA 1IQ8A 1U83A 4NKCA 1F2JA 2J13A 2CCRA 1Y65A 1OZMA 1T40A 4Q8VA 1R9XA 5LNWA 4MAZA 1GYNA 3N2TA 1R3RA 1ZTVA 2ZE3A 5I79A 1NTHA 3ERPA 1IT8A 3NM1A 1D3GA 3FHAA 3A24A 5DY3A 3MB9A 1BXBA 1V6UA 5L6UA 2X2GA 1V0NA 2BXVA 1SW7A 4YCOA 4YVVA 4K7VA 3J7HA 3B3DA 2YB4A 1N82A 3QPEA 3QOKA 4TTUA 2PRLA 3CUGA 4GFSA 4Y8EA 1TZ7A 4Q8PA 4LYKA 1P5BA 1EEPA 3E12A 1F9CA 3SDOA 3U57A 4F9DA 4GA8A 1HL8A 1PS9A 4J3SA 3AUOA 3HM7A 1OVDA 4M8UA 3WKZA 1BFNA 3W29A 2CFFA 2XIQA 2W92A 3ICJA 4TMBA 3SCRA 5D9PA 1BWVA 4OU1A 1REQA 4YTRA 2CWNA 3R94A 4MLJA 4KERA 4MJ2A 2BDQA 3FAXA 5E6YA 1IXPA 5EY5A 2YZ5A 1AVAA 2AKMA 4EXAA 1O68A 3AOFA 3LCXA 4HNCA 3GB6A 4FNSA 2Z1KA 1QNVA 4O54A 3SAZA 1QHZA 5A8GA 2J24A 4A29A 3PWGA 2I9EA 3U3HA 1KWGA 3LHYA 3TYUA 4L6HA 3WF4A 4BWLC 2PDWA 4IP5A 3A5FA 2VTFA 1QI0A 3LLXA 4AEFA 3DFQA 3QY6A 3UW6A 2BLEA 2ZXDA 1VYPX 3OG3A 2NX3A 1ISVA 4KWSA 3PBVA 3GUGA 4GVHA 1W1TA 2W4XA 1JF5A 3MYPA 2VFHA 3CL8A 4IGHA 3TWAA 2CWXA 3EPOA 5FJOA 4C6KA 2OU4A 1W1IE 1VIWA 3TSDA 3BPWA 5EMJA 1BPLB 2NVCA 4CLMA 3BVJA 4Q6XA 4PRTA 2V3EA 1KXVA 2DZUA 4QM1A 5DMNA 2G50A 3ONCA 2DJLA 3TAOA 4A3UA 1V5XA 1H63A 2WSRA 1YE4A 1QO2A 2Q3OA 4CNPA 2PD5A 1B0IA 4LUTB 3W7RA 1E4IA 3E02A 5HULA 1TE1A 4GYPC 3U2CA 1KO0A 4EIVA 4BZYA 3LOTA 1ONEA 4X0NA 3QFEA 1Q65A 3B8DA 1UZHA 1PVNA 3GLCA 3RU6A 3SCPA 4HN8A 3E2VA 1UP3A 3T2PA 4D6GA 3HF3A 1DPMA 3WEZA 1GKRA 1F61A 3V4BA 3M4HA 3L0GA 3U5UA 3WD4A 1KWKA 3GXIA 2CPUA 3B9EA 1SR9A 3OBEA 3UZWA 3WH8A 4H9YA 2P0IA 1WNOA 3BGJA 2J7GA 2GOKA 1S1PA 3AHTA 1W3LA 3ELFA 4DZ5A 1OCJA 1KXQA 3A3HA 3GVGA 5GJNA 4H6QA 1CIUA 3HA1A 4I9MA 3SO7A 1DWGM 2D22A 3QC3A 1EEXA 2WLZA 3BLLA 1DOSA 1EIXA 2AQWA 4JS3A 2VDIA 2VXNA 3HG4A 5KZ6A 5DFAA 3BQ6A 4AWEA 3F4CA 5E5CA 3BLPX 1V79A 1DP0A 3AOPA 4MPQA 4GVIA 3WJYA 1TPEA 1GONA 4XG1A 1V4YA 3VIJA 3E9AA 2WVTA 1OK6A 1QI4A 3KTXA 5K9CA 2FLIA 1RJPA 3LTSA 4NXSA 3BG3A 3S9ZA 1TRIA 4RXGA 1P0EA 1EJXC 1FH9A 1RCQA 3N04A 1JZ4A 4P5UA 3MZ2A 7REQA 4OOUA 2QIWA 3CASA 4A35A 4X9SA 2PDHA 4PBFA 1V7YA 3AYVA 1MWOA 3FS2A 5D8ZA 3CMGA 1PHQA 2IPJA 3WK3A 1V0MA 4PMRA 3BH4A 4HN4A 2VD8A 3FOKA 2XJ7A 1TUXA 1S46A 3BWWA 1XYBA 1M53A 4KQNA 3P8JA 3NQ8A 1HO1A 1OB0A 1LCOA 3VGDA 2WKGA 4HVXA 1IWPA 3F5JA 1Z9AA 1Z3NA 3A6OA 4B5XA 2W67A 4ZSTA 4UR8A 1IIGA 1BKHA 2OLAA 4Z0SA 4LXFA 2I16A 2Z2UA 3EDDA 4OUEA 3T07A 1VFUA 3CS2A 3PUDA 1L6YA 3PFMA 3EEGA 4XKYA 3HFYA 1K8XA 3W07A 1PYMA 5JH2A 4CQ8A 1RALA 3HGSA 1KTCA 4MWAE 1ZJ9A 3GHRA 2WC4A 2YL5A 5CJMA 2JBMA 1F6YA 3THQA 1B4KA 1RP8A 3MKKA 1XRTA 2GVJA 1HW6A 5DX7A 1U30A 2EPOA 3MWAA 2V38A 4P7NA 1XCWA 4NAFA 2FDSA 3B97A 2ON3A 3KAOA 3TA6A 3L67A 2HE8A 2PA6A 2A3AA 2QNEA 2PWUA 1J0HA 3NJ3A 4NSBA 3WH6A 3CU2A 2DW7A 4S39A 4WSHA 4N4QA 3ZMRA 1K1DA 5FJTA 3K8MA 4WY0B 3SRDA 4H9ZA 1KNWA 3QBUA 1DKWA 1KLYA 4FEZA 3WY1A 2DZSA 4YVPA 4GY0A 4S3AA 2VFGA 3LXAA 5XIAA 3VNLA 1W6TA 2AL1A 1V51A 3VKBA 4XZ9A 4B4FA 1HKIA 2BTMA 4RK8A 2DVTA 1EOMA 3M5XA 5CSYA 1B3XA 1KM0A 5AYIA 1ECEA 3LM3A 1GZGA 3S1XA 3G1XA 5C2GA 3QN3A 2WZMA 4MNKA 1PIIA 3GHSA 4LF1A 2Y5EA 1FDZA 4RZBA 3IK4A 1W1B1 7XIMA 2HVNA 2QCNA 1O5KA 2DT0A 3MI6A 3FA4A 5G1TA 2G96A 1IZCA 4YVXA 1SVDA 2VEMA 1S5MA 3SCWA 1Q8JA 3MKVA 1GZJA 1KW1A 4EP8C 3FYOA 4KCWA 3EDKA 4C6OA 1EUNA 3FEQA 2EF9A 3LHUA 2Q02A 2I7GA 3TQKA 1GGOA 4B2DD 5DT5A 1AQHA 1DE6A 1JXKA 1EZWA 1P7TB 1BF6A 2IKJA 3MMCA 1XR2A 3UG3A 4ZMGA 1E6PA 4BF5A 3T0TA 1BF2A 1EC8A 1DWHM 2X2YA 4C6CA 1EYWA 5CSUA 1VFFA 2XGZA 4HZ8A 1AW2A 4B3LA 1QR7A 3P61A 4A8NA 2V2CA 4DBUA 4ATWA 4PTDA 2XVGA 3PB2A 1HX0A 2YPIA 4IQLA 1RUSA 8A3HA 3LQGA 2X0YA 1LZOA 2XH7A 3WO8A 3WQOA 1SW0A 2P8CA 4XVDA 5I2UA 3ITCA 3UPMA 2GVEA 2V3GA 1RPXA 3MC5A 1XLKA 2XN1A 2XIIA 2ZXAA 2P88A 4WCJA 1RP9A 2Q8LA 4HZ7A 2PE4A 4IG2A 1W32A 3NL3A 2AQOA 2GUYA 3M0MA 3W0KA 4HMDA 3QF0A 1UR1A 5I3DA 3REQB 4FS9A 3QGVA 5TIMA 2G3NA 1FKXA 3RUBL 5CC3A 5IHRA 4DJFC 2GVLA 4UCFA 2BVYA 3BOLA 3A64A 4PZVA 4WRHA 4HK6A 3OQ8A 3PBWA 5BRPA 2ABBA 4AEOA 1N8FA 4YTSA 1LLZA 5BWFA 1UD8A 4NILA 4GZJA 1A49A 3FX4A 3BG5A 3RJXA 4E3VA 3WQFA 4DWSD 1W1YA 1POJA 2ZTJA 3N19B 1TYGA 4AIBA 2TMDA 2QS8A 3O05A 3VX1A 3CB3A 1YXDA 1SSDA 3UT0A 3KX6A 3H12A 4MVAA 1Z32X 2O9PA 1E0VA 3UESA 2IPWA 3E2QA 4ZOCA 4QFUA 3VGEA 3ZSTA 1OIMA 1XYMA 3H7RA 2UZ9A 3R25A 2HDJA 4LW7A 3IAQA 2C14A 5FEWA 4QXIA 1B54A 2J66A 3WZ0E 4KEUA 1EF3A 4F40A 1K3UA 2UY5A 3W7DA 5HNTA 5BROA 4KMQA 4H7VA 1QPQA 1OG0A 4XAZA 4US5A 1CZ1A 1XXXA 3I4EA 4MKNA 5HPCA 3KM8A 2OJPA 3TTQA 2A6NA 4HCLA 2RFGA 1VP5A 3HQPA 3UCQA 2DEPA 2EEXA 2YIHA 1MQQA 2PDKA 4MZYA 4YIWA 2CLHA 5H2ZA 2BMBA 1TTJA 3WELA 1Q13A 2G3MA 3P81A 2V67A 4ZQOA 3KS6A 3TP4A 5JU6A 3AAMA 4QNWA 2E8YA 2Z4GA 3A13A 1SO6A 3SB0A 4UZUA 1NFBA 3I7QA 1N55A 4I9JA 4RX0A 4L80A 3FLUA 2PLKA 3G6LA 4QISA 1ESWA 3ABRA 4HB7A 5D9MA 2ABAA 4BI5A 3LK6A 5HWMA 1A4MA 1XCFA 2QDDA 1HIZA 2EG7A 3KS5A 3PJTA 4NASA 1JZ7A 1LOLA 2Z2AA 4UTIA 4G1NA 4IMCA 2J47A 1T5AA 3TDFA 4WDTA 2BG5A 4O13A 1N8WA 4I8DA 3NQMA 3Q65A 5G2IA 1ZGDA 2FFIA 6REQA 3GYCA 2WXDM 4N9DA 4ZTXA 1GJUA 3EOUA 4FNPA 3LZ5A 4MWAB 1XYLA 4CU8A 4CN6A 3B05A 3I3DA 1NQ6A 4GQBA 3N4EA 4XSMA 2Z27A 1M65A 3T78A 4YU1A 4HU3A 4RCXA 1OABA 4DBEA 1VEPA 2VX4A 2WVVA 3W53A 4IMDA 5I7GA 2FVKA 1SJAA 3KEHA 3CL6A 4YCPA 4YPJA 3CQ0A 1GPWA 4QAWA 4LCQA 3TMQA 1T8XA 3F03K 3PTKA 3WNPA 1NVMA 2BB0A 1FCUA 1CCWB 3GC2A 4GZIA 1R30A 2B4GA 4M82A 5A2AA 1NEYA 4BA0A 1XG3A 4I5XA 1OINA 2Y61A 3UXIA 2PWGA 2VMFA 4JHMA 4IUGA 1R9YA 1EWEA 2PS2A 2GJLA 4QDMA 3TSMA 3GC4A 5KINA 1PDZA 2E25A 3ZSSA 3K1GA 1I2QA 2GQ9A 4H3DA 4LT9A 5E0FA 1AA1B 3H53A 3C2VA 3UGRA 3E1F1 5GNXA 4B5SA 3UG4A 4CCCA 1MW0A 3GG8A 4RDZA 3TR2A 1KCZA 2OFJA 4IZGA 1C91A 5LSMA 3M0YA 3VDAA 4V1YA 3WDIA 4AD1A 1TQJA 3PJXA 2Y88A 4POCA 4S3GA 3TCSA 3VNKA 4PUKA 1WKDA 3SN4A 1RQHA 3NQVA 1QOQA 1BTMA 5FSEC 3E74A 1M01A 1R3WA 4UTJA 4F0HA 4GMEA 1OX5A 4QX4A 2GJXA 3LPPA 1GQIA 1AMKA 2W27A 4FMVA 4H8UA 4UFIA 3SCSA 3OQEA 4Z2JA 1GWJA 4I3GA 2DT1A 4AY7A 5CXPA 4PR4A 3EX3A 4IMFA 1BWLA 3UF9A 2AL2B 4LYRA 1VH7A 2TYSA 4QE1A 2E6YA 3S6DA 3W86A 5ABFB 2W79A 3RO8A 5BXSA 4LC6A 1WDRA 1R3YA 3O15A 1D3HA 3IJLA 1V3MA 1TJ1A 5A8PA 2XWDA 4JHOA 2VURA 2PURA 6ALDA 2GL5A 1TIMA 2HNEA 4D9PA 2NX9A 1EB3A 2CHOA 1GKQA 3TE9A 4RV3A 1SJBA 4B9YA 4WJXA 3FVDA 4AZCA 2NVAA 3RFAA 3NL6A 4NU7A 1UR8A 4AAJA 1ZL1A 4GI9A 2GYIA 3QMTA 4UQ9A 4PMUA 1YBQB 2QZRA 4NAEB 1TJRA 3ZJKA 2BXYA 1I60A 5KZDA 4LTSA 5A6KA 3CJPA 3KHJA 1QNSA 4Z2LA 4A8LA 5G4WA 1XV8A 3TV8A 1M7OA 1UJPA 2VRKA 1XFCA 4Z1CA 2PD9A 1K7XA 5MHBA 3FEMA 3W22A 5DBTA 4EX4A 4XK2A 2VR2A 3IIOA 2XFYA 3H54A 3PPGA 5BNKA 3GTFA 4LVFA 5T91A 1WXZA 2XIMA 3WH7A 2ZVIA 3KCJA 4IOTA 4AH7A 2QJMA 3U4AA 4XVEA 4ZL1A 2VELA 3L0KA 2FH8A 1TREA 3OZYA 3MM6A 2QJGA 3A4WA 4KRTA 1YBQA 3PBGA 4NNBA 3L21A 2YXOA 4J1OA 3QV8A 1FCVA 2ICSA 1F8MA 1YDOA 1TV4A 1E55A 2DJXA 4ASTA 1MFUA 3GXMA 3TOPA 3OA3A 2WB5A 2D0FA 1JDAA 1J0ZA 1E40A 1H7PA 5LA1A 1C3FA 3P0WA 4KCVA 1ME7A 2W3ZA 2X0HA 1UJQA 2GVYA 1HKKA 4JAWA 2IXUA 3IUDA 1KM4A 1AW5A 3O8AA 3W73A 5H8UA 5A8NA 1XX1A 1B3ZA 3SY1A 2BGNE 1W5QA 1AK5A 2WSQA 2EG6A 3LN3A 3A23A 4YTTA 4UIOA 5B7ZA 1SFTA 4HOWA 5IHSA 1W9DM 4PBEA 1IEIA 3LBMA 4HMNA 5JBDA 2QDEA 3GU1A 1V02E 4UQEA 3VDCA 4XD4A 4PUJA 3VCRA 3EPMA 4JQ1A 1V6XA 1VZWA 5IFPA 2DUXA 1ZENA 3WK1A 4P2VA 1ICSA 4IISA 1A5LC 4OHQA 2J4GA 1OX4A 1VLIA 3MSRA 1J11A 4GI8A 2BBFA 1ZRQA 2OG9A 2J27A 1PTGA 1XLAA 4HSHA 3F4VA 3PWIA 3SY8A 4Z2KA 4DI9A 4TQTA 4W5UA 3N1AA 5HQEA 2V4JB 4ZO9A 4C6JA 4GZEA 4H9XA 1RK5A 2YCLA 2PZNA 1QTWA 1R38A 3G8EA 1Q6OA 5FA5A 4DVOA 5HBFA 5E9XA 1PPIA 4AD4A 5T8GA 1EC7A 2WPBA 2MNRA 3WBEA 2PWHA 4IPPA 3CAQA 1P43A 4M5PA 3RM4A 2J7CA 4MB1A 3VD4A 2VYOA 3VTRA 2ZUUA 2HQAA 1S3TC 1XLBA 3AXMA 3BCJA 4O0KA 3HIJA 4UFJA 2PDNA 3M0HA 1EJUC 4DJDC 3N2MA 3HQNA 4ZSUA 1H50A 1X96A 4JQ2A 2E5BA 1VHCA 3TFCA 1QW7A 2E9BA 4JNYA 3UJSA 1MXDA 1RCXB 1O1HA 4S2BA 1FWIC 4IIBA 1AFSA 5A6AA 3HQ1A 2PDUA 5FACA 4W9TA 5AC7A 1L6WA 4KKXA 4G6CA 5HMSA 3CZ8A 1SM9A 3LNPA 4XKMA 2R6OA 3O2LA 3NDYA 3D5HA 4HYWA 4GE8A 3SY5A 4FX6M 2QR6A 1T7LA 3FHQA 8GEPA 5JQ9A 1MSSA 4M6PA 1JZ8A 3FJNA 4QITA 3UY8A 2AKZA 2PZ0A 2GSEA 5CPSA 4B92A 3T2OA 2OODA 3VC5A 4RUBA 1RD6A 3ARPA 1G4TA 1B31A 3TWBA 2ZRZA 2ASHA 1AH0A 2VNCA 2X8RA 4A8IA 1HJUA 4DHGA 3PBMA 4JIRA 2P1FA 2P0OA 4ZODA 4MUZA 2B0MA 3GNXA 1JNDA 1W2VA 3MM9A 1B90A 2YDSA 4AW7A 4GJJA 3SRFA 3VC6A 5K9DA 3WLNA 4HIBA 2EG8A 1R6WA 2YW3A 3T05A 4AX7A 5BOOA 1KC7A 3WD0A 1C92A 3NFUA 4FX7A 1C29A 4J2MA 5ABEA 3CV6A 1GK8A 2EPNA 1OFOA 3EDJA 2YOCA 1XLGA 2PP0A 3ATYA 2G3FA 1AQ0A 2HCVA 2Z29A 3BV7A 2GWNA 1B5TA 1QOPA 5E0KA 3QR3A 3WMBA 2VFDA 4ZBCA 1PAMA 1EUAA 3HJEA 3LY0A 1ITUA 1WZKA 4EXBA 1SFJA 5TAOA 2DT2A 4HHMA 1JCLA 3UZXA 1K9EA 1ZFJA 1EJ7L 3WJZA 3DKLA 4LV4A 2W62A 3W23A 1V6VA 2HXTA 3V5CA 4Q22A 4Q6JA 4FNTA 4Q8UA 1HP5A 3ZJ7A 3APGA 1EP1A 1Q6LA 3AS1A 4LBSA 4JR5A 5D32A 1FXQA 4WZHA 3UZ5A 5DEZA 5REQA 4TU1A 4XUGA 4XBSA 2Q3RA 4IIEA 4JBRA 1OY0A 1GPFA 5HQLA 3IACA 3QH2A 2R9RA 2ZUMA 3TSBA 5BMXA 4OJYA 1DV7A 1IT0A 1YEYA 2WMHA 5HUPA 2FJUB 5E93A 1VS1A 1VYRA 1JUEA 4ZCWA 4J3WA 4Z1BA 3DFHA 3W25A 3RN6A 4R7JA 4GI4A 4WOQA 5D8WA 5ABTA 3WEOA 2C19A 2JEQA 3HG5A 1TPB1 4RL3A 3JUGA 2XVLA 3TJXA 3ZWTA 2W9MA 3PM6A 3QV6A 3HPFA 5DXYA 6XIAA 1T0OA 1VBJA 2A79A 2CZFA 2VOMA 2OB3A 1L8PA 1EPXA 3LXCA 4ADSA 2A4AA 1M68A 3H2EA 4M6QA 1ZBKA 2W0UA 2J75A 3TYEA 4D8ZA 4A3RA 3VK5A 3WNMA 2HS8A 2OTDA 4K38A 1R85A 3GTNA 1B30A 3EOEA 5JIPA 2CIPA 4MOZA 3WLHA 4BWLA 1JUBA 3TTOA 3MUCA 4FAMA 1FY6A 4FNQA 1US0A 3G1HA 4KIRA 4DELA 5AYXA 5K2ZA 4NVTA 3TTYA 4C6IA 2PDFA 1NELA 2XVNA 1KM6A 2Y7GA 3VPLA 1VLWA 5EBUA 4H8VA 4UWMA 4JEJA 3W38A 3L4VA 1KB3A 4L6OA 2PRHA 2ACQA 1OZQA 2G3JA 3KP1A 4Q8QA 2FHCA 4AHOA 4E8CA 2BHZA 4DJED 1UA3A 4Q8OA 3VVGA 4MNMA 3ABOA 3IARA 2E8ZA 4J3UA 3B0PA 2F2KA 3OVGA 4FALA 3QYQA 2ADAA 1H5VA 1TVPA 4H1ZA 4G7EA 5FF7A 2HROA 3P0XA 4OV4A 3KRUA 2V3DA 4HK7A 3R11A 1AH3A 2Z6JA 4JX6A 5HATA 3KBNA 3W1QA 1ITCA 5EGRA 4HBKA 2WVUA 4LB4A 3M43A 3AFBA 3CH9A 2PC4A 3GM8A 4R34A 4R9XA 3GH7A 1ADDA 4ZFCA 1QI5A 5D9NA 2WMIB 3B0GA 4LVDA 2QCHA 5LNUA 2Z28A 1QWGA 5C55A 3T0CA 5M5DA 3DG7A 3NAVA 3QHOA 1A5MC 4QTGA 4M6UA 3MY9A 2BSLA 4X2PA 4G56A 5C7HA 3NOEA 3PZIA 4XB3A 3FDKA 1DQWA 3SZ8A 1J9YA 1UIPA 1TV7A 3P67A 3CO4A 4FF5A 1KCKA 2V2DA 2H9AA 4IUOA 3MQTA 1V02A 1NOFA 1XINA 5CJ5A 3FJLA 4PRWA 3S5SA 1XH2A 1E43A 2O9RA 2ZUTA 4M19A 3TQ0A 2GFTA 2VCCA 1QHPA 3CZLA 4AZ5A