2Y0FA

Structure of gcpe (ispg) from thermus thermophilus hb27
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
403
structure length
403
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGVEVPLVGDFHFNGHLLLRKYPKMAEALDKFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPSPKEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the E-1-Hydroxy-2-Methyl-But-2-Enyl-4-Diphosphate Synthase (Gcpe) from Thermus Thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords 4-HYDROXY-3-METHYLBUT-2-EN-1-YL DIPHOSPHATE SYNTHASE
total genus 127
structure length 403
sequence length 403
chains with identical sequence B, C, D
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 2y0fA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2y0fA02
4CCZA 3TYZA 3MMBB 4PZVA 1AJZA 2VP8A 1AD1A 3H2FA 3B0GA 4O1EA 3MCOA 3MCMA 3MM9A 2V4JA 2YCLB 2XSJB 7GEPA 1TWZA 3GEOA 3VLZA 4G38A 4S3AA 3TYUA 1ZJ9A 2XSJA 1AD4A 3TR9A 5AOPA 3MMAB 4S38A 3MMBA 4D8ZA 3VKSA 2BMBA 2DQWA 2OGYA 4S39A 2H9AB 4S3DA 4MWAE 4G39A 1EYEA 3H24A 2H9AA 3TYBA 2VEFA 1TX2A 1TWSA 4HB7A 2AKJA 3H21A 2E7FA 3H2OA 5GEPA 3MM8A 2V4JB 2VEGA 4DJED 4DJEC 3TYCA 3VKRA 3MM7A 4MWAD 1F6YA 3VKPA 3TZFA 2YCJA 1TX0A 4S3FA 4S3EA 5JQ9A 4NHVA 4NIRA 1TWWA 4D8AA 2DZAA 3H26A 3B0NA 3B0LA 3MMAA 3OR1B 4MWAA 4D9PA 3BOLA 3TZNA 4GEPA 3BOFA 3H23A 3B0HA 3TYDA 4O1FA 1AJ2A 3MM6A 4DJDC 3OR2B 1Q7MA 2YCLA 4DJEA 3VLYA 4AOPA 4C1NA 3VLXA 1Q8JA 4DJFA 3V5OA 2Y5JA 1ZJ8A 4DAFA 3H2CA 2AOPA 2Y5SA 1Q85A 3MM7B 4S3BA 4NL1A 3VKQA 3MCNA 4S3CA 3MM5B 6GEPA 4DJFC 4DJFD 3MMCA 4G9PA 3TYEA 2DZBA 3H22A 3K13A 4S23A 3MMCB 2YCKX 4DJDA 3VM0A 3H2EA 4MWAB 4DJDD 1Q7QA 3OR2A 3H2MA 3MM9B 3MM6B 3MM8B 4HTRA 3H2AA 3VKTA 3VM1A 4DB7A 3B0MA 4C1NB 1Q7ZA 3NOYA 4O0QA 4MWAC 3H2NA 1AJ0A 3TYAA 3MM5A 8GEPA 4NILA 2GEPA 4DAIA 3AOPA 3B0JA 3OR1A 2Y0FA 1AOPA 2YCIX 1Q8AA
chains in the Genus database with same CATH superfamily
1J01A 3CHCA 4RXGA 2BDQA 5LHEA 4H00A 4QTGA 1Q65A 3VNKA 1Z89A 1JCNA 4JL2A 4WVXA 3A13A 1V6XA 1IT7A 3T6CA 1TCDA 4XSLA 3N4AA 3VD7A 4S39A 1DYSA 3GBDA 1PWLA 4GIYA 3O0KA 1TZ9A 2Q71A 1ECEA 1EIBA 3R2GA 3W2MA 2XVKA 3M0JA 1XYCA 4QS5A 4GJJA 3APYA 1TPDA 5CGMA 3E96A 3SSZA 4XBSA 1F6YA 4FNPA 3VA8A 5I77A 3EPOA 3MO4A 5EY5A 2OT0A 2FFCA 4E2OA 4ERIA 5G2IA 1VBRA 4TMCA 3KFTA 3P62A 3VDAA 1QPOA 2CLHA 3RR4A 4PMOA 5FOOA 3AZSA 4KETA 4FNQA 2F2HA 5C9WA 4V15A 1K4HA 5IM51 3N73A 1JCJA 3UD6A 1E9IA 1BPLB 4C6QA 3LNMA 3W74A 3RLHA 3H2AA 4HZ8A 4O12A 4PB3A 1BF2A 3LRKA 2J62A 3B8DA 1GVRA 4JCLA 8GEPA 4NILA 4HNTA 1AA1B 3VK5A 4CNSA 1RPXA 1E9ZB 3RAOA 1ZBVA 4GZEA 1RSCA 2WKLA 5L6UA 1ZSXA 2E6YA 4MOZA 4UCFA 2NQHA 4K36A 3ZMRA 4OQVA 3C61A 3UNTA 5AC6A 4L1WA 1A5OC 3MY9A 4WKHA 1QBAA 3BAYA 2TSYA 2PEVA 5M03A 2V68A 2OYKA 1EBHA 3VNYA 4RZBA 3LZ3A 2QGHA 3UCCA 2VWTA 3CIVA 2J7CA 2DT0A 3H2OA 3CUHA 2P0OA 3GHUA 1NWSA 6ENLA 3WUFA 1I1WA 2A0NA 1XIFA 3O6AA 3I6EA 4W93A 2ZRWA 3WD4A 2IXUA 8RUCA 4DJEA 4JIPA 3FS2A 4UOQA 2PWGA 2F6XA 2YFNA 3A12A 4FOJA 1BG4A 3S5NA 2GJLA 5C54A 3GDBA 3A4WA 5A8QA 5J5RA 4EPKA 3GXFA 3NR0A 4K7VA 3OG2A 3CASA 1GVFA 4JS3A 1JYNA 4RL3A 3G1AA 1SW3A 1TV3A 4IIFA 4W87A 3E6EA 4CVWA 4PC8A 1K7FA 2G5WA 3LLFA 1BLIA 3G2GA 4GQ0A 4HA4A 1B30A 2XN1A 5AYZA 4EAMA 2X40A 2A5HA 4IFKB 2XIOA 3ONCA 3TX9A 4LYRA 1KM2A 4F66A 2PDLA 1C91A 3NUKA 4Q8WA 1SFJA 3GRIA 4AZ6A 2VEKA 4CNOA 3SGGA 2SFPA 1QOQA 5GJPA 3DIPA 2Z1VA 1T8QA 2DZWA 4O10A 2A6LA 3WQEA 3GTFA 3USBA 5KMYA 4YTSA 2YL8A 4ZB0A 5AC8A 3B9DA 4E5TA 4AX7A 5GVJA 2E7FA 5A5WA 1Q45A 4BF7A 2DIEA 4B5UA 3WF0A 2YCJA 1E4MM 3TN4A 3EKGA 1H41A 1QT1A 3M46A 1JVNA 1US3A 3F4DA 3UZJA 4F79A 3T08A 1UPPA 4PUDA 4H8HA 2Z4GA 1KFKA 4O8RA 3H4WA 3QPEA 2BTMA 3IJIA 3W28A 1T0OA 3CT2A 4UIOA 1B3XA 3VABA 1AZ2A 2XSBA 1RALA 3QW3A 3A64A 1IXOA 1J9YA 4IFKA 3EOSA 3KVMA 1SPQA 1T6MA 4Q8QA 1XH0A 4B91A 3PWAA 2C13A 2DU2A 3H7UA 1V03A 1DQWA 4KMQA 1Y7VA 5L9FA 5KTLA 2GVGA 3AOPA 4AF0B 4QEEA 1KBBA 3O16A 5CPOA 5M3WA 4KKXA 4J3ZA 1JUBA 1WDQA 3U6WA 4GGBA 2ZZ1A 5RUBA 4HMNA 2WSQA 4UR9A 2UZ9A 4FLOA 2Q8LA 1B3YA 1SR0A 5IFPA 4LUJA 2WBKA 4JPGA 1XCFA 2INFA 4GKTA 3VKBA 1G94A 1Q6QA 1I6NA 2W61A 4PMUA 3VMOA 4GISA 3T0BA 3C86A 2J79A 3W1QA 4OOZA 3V7PA 5IBXC 1RLCL 2HE5A 1BRLB 3ES8A 3QZEA 1ENUA 3LGEA 1QNRA 1S1RA 2XIJA 3SW6A 2Z7KA 3I7QA 1CB7B 3JZUA 2XH4A 5G4EA 2P76A 4X60A 3V4BA 2V4JB 4QDWA 2ATSA 1XLIA 4XO6A 4CN1A 3B0PA 4A8IA 4BY3A 4UTUA 3BOLA 3P5YA 1R9ZA 3B9EA 1A5NC 2ACSA 4XTIA 3QOKA 3UR5A 5FEXA 3BK0A 1MNSA 2IKHA 4RE2A 1HP5A 2OTDA 2FHBA 4IPJA 4H8UA 3VOJA 4RW5A 4G9PA 3TEVA 3KBVA 2UBPC 3EX6A 2V9DA 1JD9A 3JR2A 2YR1A 4ERGA 4ZFMA 3DFTA 4LWWA 2X1UA 3VM1A 1CXKA 1QFEA 4Q4RA 4UC5A 3NOYA 4P8XA 1SQ7A 1BQCA 2FZBA 3V75A 3B3DA 1X7FA 3OVQA 4JIQA 1D8WA 2W63A 4IG2B 4X63A 3GKAA 1OCJA 6REQA 4QITA 3R43A 4LB3A 4MJ4A 5GQBA 3BTNA 5HULA 3O1NA 1B9ZA 3ARZA 1FH7A 3SBFA 4Z2LA 3ABSA 2B7PA 2XN2A 1EX5A 1FWHC 5E0KA 2X7WA 3EWCA 1XSJA 3AXKA 6TIMA 3RU6A 3I6TA 4S38A 4RNJA 1JAEA 2Z27A 4PUWA 3G1RA 2JEPA 2E9BA 2PGEA 4HTYA 1J0YA 2Y89A 3TMQA 2V2CA 1YLVA 1ITQA 1JUEA 2CFFA 4DHGA 5KZMA 2RHGA 3DCPA 1BSIA 4IP5A 4XKYA 3UP8A 4GLEA 2D2HA 5GNZA 5DELA 3R10A 4X2RA 3ZSTA 1KRCC 2NZLA 1TUXA 4PL2A 5LXEA 5CG0A 2VFGA 4DELA 3VZYA 3REQB 3OYXA 4JN8A 4L4LA 5EYWA 3VAVA 2C16A 4EXAA 2EG6A 4OBSA 2ZKMX 3C0LA 1CPUA 3PTMA 3OBEA 2DSKA 1IWPA 1WA3A 2RGLA 1MRQA 3AMCA 3P93A 4EACA 3MV11 3S5YA 4GXMA 3S3GA 2E9MA 3GX9A 1KGUA 3TMLA 4PN2A 1ZHAA 4A21A 4LTSA 4MB3A 1GEQA 4A3UA 3M0HA 4D71A 4JNYA 1TA3A 1LWJA 2W27A 3TV8A 4JKKA 3BLKA 4H9YA 3EYPA 1VEMA 3LA4A 4RJEA 1IYXA 2ADAA 2O55A 4HPXA 3AHZA 4W88A 1BVZA 5F2MA 3ZLGA 1Z32X 2ZRYA 3B05A 4A29A 2XSJA 3APGA 4U10A 2AMXA 2X1IA 3K46A 2XVLA 1BQGA 1VHNA 1V6YA 3GVGA 3UFYA 3V0TA 4G8TA 2JIWA 5EMJA 3CQ0A 4YS1A 4DUXA 2BXYA 3FEQA 3MWCA 4LYKA 1JXJA 3BLFA 1W9PA 3VDBA 1OGBA 1B9BA 5BU6A 2DW6A 3T0AA 4JN7A 4H3DA 4FLQA 4HYWA 1V3JA 3KP1A 3EB2A 1W3LA 3BUVA 2XN0A 4MDOA 3WBEA 3VKAA 1J96A 1JCYA 1ZCOA 3T55A 3M44A 4ATDA 4QE4A 1JZ5A 1WZKA 3CZ8A 3IEBA 4XD4A 4XBJA 2PC4A 1OYCA 2Y85A 1ZJ8A 4DAFA 4LEQA 1P0NA 4JTLA 3NZGA 5I3JA 1QI2A 2DEPA 4PTXA 4MUPA 1H7RA 5FJIA 3F2CA 2VOMA 5IBXA 1ZJHA 1S5TA 4RDWA 3K4WA 3WQFA 4DO7A 2CBIA 1XLBA 2YA1A 1F8MA 4NT0A 3HMJG 3OQEA 1C9WA 1DVJA 1XH2A 4D6IA 4BI7A 3L68A 1I2PA 1P0BA 1H0IA 5JBFA 2FDMA 5BYWA 3PJTA 1X38A 4B3ZA 3PY2A 4Y9MA 3KTSA 1YYAA 1EHNA 2XUCA 1E0WA 2I5QA 5C7VA 3STFA 1LLZA 4P7QA 3LTSA 4FSAA 4UFMA 3AIRA 3QC0A 4L6OA 2YBTA 2VX6A 1WUFA 1O5XA 1WO2A 1OB0A 1A3XA 2PAJA 5D9PA 2VDHA 3SCSA 4GNVA 3PUOA 2NXIA 2H9AA 1BWVA 1ZNNA 4UB9A 1DXEA 8A3HA 5I06A 4W4QA 1TMLA 3Q2DA 4Q7IA 1XV8A 3B8SA 4LAKA 4UZSA 5FL1A 1JCTA 1QO2A 3MMUA 1XW8A 2XWEA 1VS1A 1TREA 1UP2A 3M41A 1Z69A 3TLQA 1WAWA 2J66A 2QDGA 4P2VA 4RNFA 1JFXA 4B9ZA 3ZXWA 1F3EA 1G7VA 4UFJA 1XYAA 4O18A 5I3GA 4MNJA 3MJMA 2QUVA 2OLHA 4YVVA 1XLAA 3G1SA 3WLOA 1W2VA 4H7ZA 4WKFA 2Y2WA 3NQ7A 1WAUA 3PJWA 2HCVA 2V5CA 3VIGA 2C8NA 2CHOA 3E02A 4D6EA 1FH8A 1UP0A 2AOSA 2KZHA 2G3NA 1F07A 2FVMA 4XISA 6TAAA 3OZMA 4F40A 2DJXA 2YLAA 2OLSA 2V82A 1DWJM 2CBUA 1TFVA 4AHPA 1XIJA 1UOZA 4RV8A 7CGTA 4PMJA 3AIEA 3GZ3A 4DZHA 4CD8A 3ZWTA 3HJZA 5AHFA 5FEPA 1PXGA 2WHJA 3N1AA 2ZYFA 1U22A 4D1JA 4ZR8A 1U83A 3VGEA 1QCWA 1Q6EA 2Z1WA 4C6LA 3QGKC 5CLWA 1IGWA 5DBUA 2HNHA 3IVTA 3DYMA 2Z1KA 1CIUA 2NX9A 2WQDA 3BOXA 4PRRA 2RJHA 5F4SA 1V0LA 4D9PA 1NDYA 3TZNA 5CAKA 4CNPA 2J8TA 4O1FA 4Z1AA 3VGHA 3WMLA 2OWCA 1W9DM 2FYMA 4YTTA 3PWGA 4IX2A 3WL1A 4DJFA 3SR7A 1XINA 5LA1A 2C0HA 1FDZA 4L4MA 2D3NA 1QBBA 3T40A 1YXYA 1X1OA 3CJPA 4LALA 4KT2A 1ELSA 1RBAA 4DEFA 4QBXA 1PIGA 2CEQA 1XLHA 5CSYA 3CWOX 2VNCA 1XIGA 1DJNA 4UOZA 4HT3A 4GO8A 5A94A 1A50A 4JKMA 3HJEA 2JKPA 1X8FA 4URIA 1AOPA 4UWMA 4YXGA 4IXXA 4L9YA 4NJJA 3DGBA 5GNXA 1GOWA 3DG7A 4PUMA 3GB6A 1AD1A 2OYMA 5TIMA 4L80A 4KRZA 2VEIA 4O53A 1TMQA 4NNBA 1OEPA 3TN6A 1A5UA 1EJTC 3KTXA 2FPYA 4ADTA 5F1UA 1H0GA 1QXLA 1RY0A 3CHVA 1TWSA 4L1XA 4CLMA 4W89A 4HSNA 2VEGA 1AQ0A 3O2LA 4HA0A 1RBOB 2E8YA 1V3MA 3KCLA 5C2XA 4TX9A 1TV7A 5H8UA 3VKPA 3GK0A 4UBPC 1KCXA 1BYCA 1Y8BA 1NELA 3W7LA 2P8BA 4HCLA 2Q3RA 3A9IA 3D3FA 5K2ZA 4GVIA 1H7OA 3KBNA 1AW5A 1QNQA 4JD4A 3MA8A 4K6AA 4J7RA 2D22A 3CPRA 3PN8A 4J9JA 4PCFA 1PHQA 2P10A 4D8LA 4EP8C 3OW1A 1KM1A 1WV2A 4J2PA 1PZ1A 4AAJA 3KS6A 1K7EA 1RQBA 1XPYA 1VFMA 1EP1A 4GK8A 1XP3A 3T9PA 3HQNA 2XVGA 1HW6A 3NVTA 4GH3A 3WBAA 2BY0A 5C6MA 3CK5A 3M0YA 3S2JA 1W0MA 5C0QA 2TAAA 4K1GA 3IIZA 1TJPA 1EDTA 1PUDA 1NJJA 3CPGA 3SUTA 1AK5A 5C2CA 2VGBA 1EJXC 3NEHA 3VD5A 2QDHA 1QUMA 4PEKA 1FWFC 2J8GA 3I7SA 3EWZA 3RGTA 3ARSA 1L6FA 4PL1A 2FPTA 1ZENA 3MZNA 4UTTA 1PX4A 3QZAA 2J7FA 2X2YA 3PJUA 3ATZA 2GVJA 3TSBA 1VAHA 2EO7A 4GJ1A 3GXIA 2H8ZA 2RDXA 1FQ0A 1TJ2A 3AS1A 3W73A 1R3WA 4QG8A 2MANA 3W7JA 3PZIA 4HPGA 4TVDA 3B0NA 1A80A 3SECA 5EKYA 4B5VA 4GEPA 2CLLA 3CLMA 1BVNP 1CGTA 4OTKA 1EO5A 2JIEA 1AW2A 4LS1A 3ZVHA 1OX5A 3UXAA 1XX1A 2DV0A 5DQPA 1EJ7L 2BZNA 3CUXA 3MM5B 1KFLA 3UZ5A 3UJFA 2Y7EA 2IXVA 3QC3A 4IGSA 5CPTA 5FAJA 2QAFA 4JQ2A 3Q94A 4JGDA 1OBAA 1W37A 3VILA 5T26A 2WCSA 4N4QA 2C6QA 2VHLA 2PDKA 2PGFA 3PVFA 1UH4A 1UG6A 4CU6A 2GJXA 1X1NA 1FDYA 1OF6A 1B4KA 1PHWA 3MC5A 4HNCA 5CSUA 3IJ9A 1CCWB 1T41A 4M29A 1JGMA 1G5AA 4LH8A 2DT1A 1FHLA 1JR1A 2PPGA 4LUSB 1Z7AA 4H1ZA 3BICA 1ZP4A 3WQGA 3TYUA 1E5JA 2VD9A 3BLIA 3TQKA 3CS2A 3DOPA 1HN1A 2H9AB 3GFYA 4PBFA 3G1YA 5I03A 1A5KC 4KFPA 3GAKA 4PFMA 3B0VC 4EANA 3IIXA 1XBXA 2A85A 3L2LA 2J7EA 3HTWA 4M5PA 4NNAA 1UMYA 3UT0A 1W1B1 3QTGA 3NZQA 3E49A 1VB9A 4LVBA 3AHXA 1FX6A 4M7TA 3CU2A 4NQ1A 2VQTA 4R85A 3LHZA 3PZTA 3EWUA 2HS6A 1RJRA 1UIOA 2Y6ZA 2Y5JA 4V27A 2W92A 3BAXA 2EEXA 3L66A 1R86A 4NYUA 3BZGA 2VYOA 1KTCA 1TQXA 3R8RA 1VFHA 2ISDA 3WUEA 4CQDA 1AL7A 4HA1A 3LB0A 4JQ3A 2HMCA 3PZ9A 4IP4A 5FF2A 1WDDA 1MQRA 1AG1O 1M7OA 3WUGA 2WC4A 2NXGA 3DUGA 3TNBA 4GQQA 4E8CA 2A4AA 4HA3A 1EEPA 1ZBWA 4DF1A 2AKZA 3WK3A 3FXYA 1TV8A 3KHJA 3GNDA 3C3UA 1HO1A 3LM7A 5EFDA 3TXVA 1EJSC 5I3KA 4QG6A 5D2WA 1G01A 3ALGA 4D8ZA 2Z00A 4DBWA 3W3OA 1NWRA 1R9XA 2HDJA 3CMJA 3GYEA 2OZTA 1W8GA 4TXEA 4F48A 1WBJA 2IKIA 1KM4A 2X42A 4IMGA 4H41A 3G8EA 1ZFJA 1M7JA 2XFWA 4KBXA 4UXDA 1IR2A 1M9HA 3N18A 1LT7A 3QJAA 3TW7A 3ANYA 5FF3A 1XLCA 2E1DA 1IGSA 1XLEA 2ZUMA 2W0UA 2FHFA 3NYZA 4A8RA 3G0UA 1UWSA 1FWWA 3KVKA 2GVLA 8XIMA 3TJXA 3VNIA 2PDBA 3IAPA 1GQJA 2EPOA 1EQPA 2DQXA 1ONWA 1E6NA 1XR2A 2J78A 3VZXA 3RF9A 1X39A 2YXGA 3NOEA 3AZRA 3QF0A 1E3ZA 1XPGA 3QR0A 3FNDA 3VIOA 1L2UA 1UR2A 3IJLA 5CLTA 4QLKA 1XG3A 3GDKA 3B97A 3AS2A 2GEPA 4CCCA 4J3UA 3CIWA 1OF8A 3MI6A 1W1VA 3C2YA 6PTDA 1JD7A 3N6HA 1XGZA 1M04A 1EGMA 4GOAA 1DJXA 4RKAA 3I4EA 4RPPA 2BOFX 2W62A 5BRBA 1XIIA 3S83A 1FWJC 3G8RA 3VKSA 5LIUX 2EJ1A 5A6LA 3B0XA 2FDSA 1OIMA 2O4MA 1TZZA 5GEPA 3RLUA 2ZICA 1K3UA 5AZ0A 1XBZA 4FAMA 1MUWA 3BXWA 2YA2A 1BGAA 5T9CE 1C90A 2EG7A 3KBWA 2ZWZA 4HJWA 1VYPX 5BW6A 1EF2A 4GI4A 3W53A 1KBKA 4HJFA 3PAOA 3BLLA 4IOTA 1PIIA 4XZLX 4QIUA 3VDGA 3SY8A 5JU6A 3RR1A 1M03A 2NQJA 4C6PA 3PHAA 2I5GA 3B8UA 3LCWA 2FZNA 5E6ZA 4BK9A 4MDPA 5H1WA 4DF2A 3QZ6A 2ISFA 4PMXA 1TIMA 5AB3A 4Z2GA 1ZZMA 3CHEA 1FTXA 2D0GA 4WF7A 1V51A 4JDYA 3W1PA 3KCOA 3P3BA 2OEJA 5AHIA 3SQLA 1ITXA 2DZUA 3DBPA 3MS8A 4AIBA 3MCOA 3V16A 1GEHA 2WVUA 2ZUVA 3DG3A 2PRLA 4US5A 3R13A 4GZJA 2ZUTA 1US2A 1BKSA 1FWBC 1ZPTA 3AWOA 3VINA 1W54A 3OZPA 2Y62A 3VC6A 2XG9A 3KL0A 4W7VA 1W1TA 3AC0A 1RK5A 1KBLA 1XFCA 2PGWA 4C7FA 4WDXA 1HQTA 3QLDA 1T96A 1AQFA 3BAIA 3IARA 3M64A 1IF2A 2ASHA 3UWVA 1G4EA 4D8AA 4AF0A 4JTIA 2A3AA 2NLIA 4N6FA 3T4CA 2YIHA 4Q4OA 3QHMA 3ZJ8A 5EL1A 3UA4A 2GGHA 1X98A 4M19A 1LJYA 5G2HA 1E73M 1AUSL 1YPXA 3F5JA 3KLKA 2VVSA 3W75A 3C4UA 2Y7DA 4DJFD 4JIHA 3WK0A 1UKTA 4HTBA 3P81A 2WO5A 3CUGA 1YADA 3EDFA 4C6DA 2D0HA 4C6FA 3G6LA 1ADSA 2PP0A 5JMUA 5CPSA 3JW7A 2PS2A 4ICNA 3ZLFA 2RAGA 3RCNA 1AFSA 1I2OA 1PBGA 2RDWA 1J10A 2FGZA 1E9YB 3GDLA 4JIIX 4HU0A 1FWSA 1UZ1A 1NQ6A 1GK8A 1XKYA 3UG3A 5A6BA 3S2NA 1HJWA 2FMOA 3FV9A 1HNYA 4M3PA 5AHLA 3GXNA 1FVPA 2OZ3A 1EOMA 4OU1A 1TJRA 3KZPA 1I4NA 3GNRA 3T8LA 2EF9A 2ISWA 4DXVA 1TTJA 3IGSA 5EMMA 2HVOA 3B8WA 5LHFA 4QXIA 4UQBA 3AYSA 1X7IA 5FACA 1TPH1 4ZB5A 3PZMA 4QFUA 2LLEA 4YHGA 2VZUA 3MU7A 1IXNA 3MM7A 1D2KA 3GZAA 5JQ9A 3DN5A 1A49A 1ZBKA 1LOQA 1HKKA 3ISIX 4AG0A 1UC4A 3NQDA 1G1YA 2BP1A 1MDLA 3QPZA 1ITCA 3ITYA 2BSLA 1MMFA 1H49A 4O11A 3CO8A 4HN4A 2CW6A 4LUSA 3I3EA 1PYMA 2JE8A 4QHRA 4Z2HA 1UPMB 3EOOA 1W3KA 4F0KA 1TO3A 4LV9A 2XSXA 3LPFA 1ZALA 2G3MA 2I17A 5GPRA 1Z48A 1Z6KA 3KRZA 1JEZA 2W5FA 5XINA 3F5LA 2OXNA 2QIWA 1VRDA 2BX7A 3GYCA 2NQ5A 3ZYZA 1AH3A 3VU2A 3OP2A 4CGTA 4O1DA 5DMYA 4US6A 2OR2A 4B5WA 1EJRC 1VR6A 4L9ZA 1R46A 4Q4KA 4KCVA 3REQA 2BS9A 5CH9A 4HK5A 4X3ZA 4A05A 2TODA 1EC7A 2ACRA 1JF5A 3LHVA 1SUXA 1HUVA 4IPIA 2I16A 3FXGA 4ERAA 3BLOA 3WQPA 4HZMA 1OFBA 1AMYA 4Y9NA 1GW1A 3BLEA 5JIPA 1WDWA 3GR7A 4HN8A 4N02A 4V1XA 4OV9A 4NZCA 2VDGA 1GKQA 2ZZ6A 4KFOA 1RUSA 4LYQA 1UA3A 2DZAA 3OR1B 3EDJA 1TPUA 1P48A 1RAKA 4ZENA 3T81A 1TVNA 4RDZA 1ICPA 2ZDRA 4QX4A 4NX5A 4DO6A 1KLZA 3W07A 2VM8A 1HF6A 1EJUC 1H4PA 5EU9A 4UTMA 2Y5SA 5EB8A 1QHZA 1CZ1A 2GPTA 1F8IA 1M7XA 4NSBA 3YPIA 1G4SA 5EBUA 5FIPA 3QQ1A 4BF9A 3MM8B 3KBSA 3KEHA 3N2XA 1H09A 2HNEA 3UJRA 3C0QA 4HQVA 1GCYA 1XICA 3D47A 1QRQA 1HKWA 1GTEA 1NDWA 4NY2A 1N82A 1OG0A 3QGVA 1TPWA 2RUSA 4Q6XA 1YTDA 3FN9A 2D24A 1RD6A 3FJNA 1MUMA 5I3FA 4NASA 4UZUA 1AQMA 1YRRA 4WIWA 1KW1A 4YU1A 2QPSA 4MTVA 5HNUA 3THQA 4Z17A 2O56A 3TN5A 2YKKA 3AYVA 3CHDA 3GNOA 3TOYA 4JTRA 3QGAC 4KEVA 3W26A 3KCJA 1NM9A 1UUMA 4HNLA 3L4ZA 4G39A 1CEOA 3WQ4A 1Q6DA 2Q09A 3MMDA 7A3HA 4JBRA 4FOKA 5HWNA 1W32A 3IGUA 2D2GA 1W2PA 4G2DA 1KM0A 1FCQA 3WFZA 4CQ9A 3M1ZA 5AN7A 3G1HA 1F74A 1EWEA 1UWUA 3QY6A 2Q8XA 1KNWA 1MYRA 2ZCGA 4I5RA 1S38A 2E5CA 1EC8A 1OIFA 3LPOA 3UZWA 5C5YA 1DJZA 1QWGA 3FAWA 3U7BA 1EBGA 4GUJA 1FBAA 2QCDA 3SUUA 3L2IA 3AHYA 5A6MA 2BG5A 4ZQMA 2EGZA 3RPTA 3CNYA 1E0TA 2CZEA 1KCZA 3NQ2A 2QMJA 4UTKA 2IKJA 2OO6A 3NO3A 4AWUA 2BVWA 2DVXA 2VD8A 3Q58A 3G1DA 1HJVA 3VMNA 2BVYA 1TYGA 2VELA 1JZ8A 2ALRA 2PDXA 5DFAA 2FFIA 2R94A 2J77A 3CXOA 4KWUA 1AJZA 3TC6A 2PDJA 4UQDA 3MCMA 3LY0A 4QNWA 1QNVA 2XTKA 3GVRA 3IACA 4QEHA 2IPWA 3OU8A 2D73A 3GDRA 4UNIA 4JEQA 1UD8A 4GCXA 3I68A 4JQ4A 3P6LA 1F5ZA 3VIMA 3OPSA 3WQCA 1I45A 3FJ4A 1JDDA 1ZUAX 4DBEA 2G3FA 4EE9A 3IS4A 2YW3A 2I5IA 1X6LA 4UFKA 3L67A 3SSJA 1K7XA 3COTA 4DUOA 4JQ1A 2WHLA 2EHHA 3M9YA 1UD4A 3W0KA 3S1UA 1BG9A 1R9YA 1UBPC 5F4XA 2WMKA 2OO0A 1NOWA 4IQDA 3AJXA 2VEMA 3FSUA 3N6QA 4C6KA 4C1NA 2WPGA 3GWQA 4QJ4B 3VCCA 4V28A 3OHIA 1VEOA 5EMUA 3MUY1 5AYBA 1QU4A 3NQ6A 3OGSA 3HURA 3MI2A 1LDCA 1KFWA 3THUA 1J4EA 4KIEA 4ATWA 3ABQA 3IJQA 3MM9B 2FKPA 3CV2A 2HRWA 2VEPA 3BJSA 3SURA 4L56A 3MB9A 4HNVA 4DUVA 1Q6FA 1XLKA 4IX0A 3FIGA 3TROA 2FB3A 3E74A 4Y90A 4CKQA 2WMHA 4EK7A 5K4XA 2NT0A 3L4XA 1SMAA 3L4UA 3P5ZA 3CV6A 2XVNA 4WUIA 1PX8A 5C7HA 3MANA 2DJLA 3W1TA 2ODOA 3ARQA 2RDUA 5I78A 1QATA 1QHPA 2IS7A 2W66A 2QCGA 3WYZA 1UJQA 3T07A 2NLYA 3UWUA 2PDQA 2YDRA 4ZOBA 5A8OA 3W81A 1XKJA 1QOXA 4NNCA 4I9MA 2VXNA 1XISA 1E70M 5C9ZA 3PBWA 3W7PA 4GY0A 3EDDA 5C9XA 1GONA 2J74A 5D9MA 3SN0A 1HGWA 3SCTA 5AZ1A 2E09A 3A23A 3PP7A 1DOSA 4BF5A 3GBEA 3KDOA 2BNJA 1HGYA 1O5RA 1KFJA 4LGXA 4JTCA 3W83A 4OJYA 1ZL1A 3FYOA 5C9RA 3WK1A 2WVVA 3LCGA 1YW1A 3SRFA 3H7VA 2XINA 4N0RA 3M5VA 3BLDA 3GUWA 3IGXA 2V5JA 3PTDA 2Y0FA 1OJXA 2O0TA 1L0PA 3GHSA 4LF1A 2C1HA 1BWLA 2ZX7A 2WNWA 1ML1A 4MJZA 1OABA 3LXCA 1GYNA 4G6CA 3QKEA 3S42A 1ONXA 3BSMA 2XFFA 1CLVA 1HVXA 4KPLA 3LRMA 1GWJA 3A4XA 3TP4A 3CV7A 2JBMA 1M7PA 1J6OA 4QDPA 4PUUA 1PKLA 3IVSA 5CCZA 3S9ZA 2VZVA 2XU2A 2YPIA 3K1GA 4PCTA 2HXTA 4UTJA 3DFNA 4RXFA 3VUSA 1CECA 1XYZA 3LM3A 1CB2A 2FZDA 5H6HA 4MWAA 1TCMA 2HSAA 4IFRA 5AHEA 1OFAA 1LQ2A 4PBGA 2PWFA 1SYTA 4O1AA 1QW9A 4J1OA 3BDKA 1OCBA 1LUCB 2UY5A 3MDUA 1WOAA 3K8LA 3SUVA 3SGUA 1G4PA 1GUVA 2X7VA 3ZOAA 1DWIM 5FF0A 1OGGA 3WH7A 2XHYA 1P6BA 1KRAC 1NU5A 1T5AA 4MUZA 5I79A 3KRUA 5A95A 3KOZA 4O0QA 4TVUA 2WNNA 4ZEPA 9RUBA 4PCPA 1CTNA 4N4PA 3N34A 4HBKA 4ZL1A 1KTBA 2BGNE 3HG5A 5D2YA 3QSTA 2EPNA 5A8PA 1RA5A 4ZGYA 3LCIA 4LANA 3H53A 4MPQA 1EUAA 4Y6GA 2D2JA 4M51A 3BV4A 4AHOA 2WVTA 3V0UA 3NPUA 2VUYA 2FPVA 1XD0A 2CETA 2Z29A 3AAMA 1XLFA 2GVYA 3M43A 4B15A 1IEXA 1K9FA 4GYPC 1EC9A 4O0ZA 1UUOA 2PDNA 3N29A 3NO5A 3DYPA 2WAGA 2AGTA 3IIOA 3GH5A 1W9XA 2V38A 4MM1A 4JKLA 2NQZA 3LBOA 4R88A 2BGQA 2Y7FA 1LQ0A 4PODA 1PZ0A 3Q37A 1R0MA 1NF0A 4PUJA 3MUXA 4UR8A 1Z8AA 1OX4A 2PWDA 3DENA 5AHNA 1DXIA 2PRHA 1N2VA 1RK6A 1OT2A 5CZSA 4DWSD 4QROA 1UR1A 2NUXA 5A6AA 1W3NA 3NSMA 4L9XA 3LDVA 2H90A 3O6DA 1T8XA 1Q13A 3CYVA 3VOFA 2E77A 3SN4A 1AL8A 2EG8A 5LNRA 3CZGA 2GQ8A 2VFFA 4QG9A 3GG0A 1F9CA 1IXQA 1GKRA 3B0JA 4GPNA 1WXJA 3TQPA 2J75A 2VRQA 4JZ5A 3STEA 3AIWA 1FY6A 1LT8A 3B03A 2VUNA 3SFWA 3FX4A 5HINA 2WMIA 3B4YA 4QDMA 3VNDA 1UR3M 1XI3A 4JHOA 3UJSA 5FCZA 1ZS2A 4D6GA 2QW5A 4J27A 4GYJA 3ARTA 1GVEA 4AIEA 3BJFA 2GJRA 3DBNA 1DHPA 4P7OA 4M81A 1B0IA 2GUYA 4IMDA 4MWAE 2OSYA 3QHOA 1ZAHA 3A3HA 2DIKA 3GU2A 5JVLA 2DY3A 4YVXA 4NKCA 4ZO9A 4U5KA 2E0PA 3XIMA 1JRCA 1R3VA 2C1IA 2QIIA 1IE7C 2CKSA 3NZPA 4UTWA 2X0HA 3EX4A 1I2NA 3HF3A 3W85A 1SJCA 2HWGA 3SCQA 3CMGA 2PWUA 5H2ZA 1V79A 4KH2A 1ICQA 1I2QA 2TRSA 3E3HA 3MW7A 4GO9A 1DV7A 3S6DA 2H8XA 4U3CA 3RJXA 4AD1A 1TRDA 2PDMA 4U31A 5BROA 2WSPA 5LNUA 1F3WA 2QJJA 4Q3MA 1B4EA 3EMCA 1A0DA 4CNUA 1MI3A 2O7QA 4DXXA 3VIIA 4J28A 4NRSA 3I4KA 4PMVA 4WD0A 3P0WA 3NJ3A 1Q5MA 3NL5A 3R12A 1PVNA 2INZA 4YPJA 2NSXA 4E8GA 3MMBB 3RMEA 2PLJA 1OWQA 1TV5A 3C8FA 4PMQA 3H2FA 4JTTA 4IXHA 1ODZA 2Q8ZA 5D2XA 4P8WA 3IUDA 1Q4WA 1FHDA 2WJDA 3SEPA 4O19A 4TMBA 2PTDA 4BWLA 3EKZA 2BY1A 4F9JA 4QM1A 3MVTA 3UVAA 3GSMA 2R24A 5AYIA 4MAZA 1XIEA 1XGEA 4OT7A 3H21A 2Z6IA 3WBYA 5CZTA 4A22A 2R1PA 4WCJA 5CXPA 3RYSA 1UOKA 4BS0A 2D0FA 4JFWA 4S3EA 3EAUA 1F3TA 1RJPA 2CZDA 3QLLA 4MIMA 2IW0A 5F4WA 4A3QA 3O6CA 2OODA 3MMTA 2XDFA 3RFAA 1P6CA 4KCWA 4NZFA 3A6OA 2E3ZA 3DGRA 3W2NA 2AMGA 2QJNA 3B06A 1SW7A 2WOQA 1XD1A 2PD9A 3VKKA 4N42A 4LUYA 3GR4A 3LLDA 3DERA 1XJBA 1SVDA 4S23A 4EWND 3BMVA 3U4AA 3WQVA 1UQZA 1OADA 4NI8A 5GJNA 4Y8FA 3DZ1A 1TWIA 4I5UA 1QWKA 3ARYA 3UF9A 2BWGA 3W1UA 2J9ZA 4C1NB 3N3TA 3SRHA 1B31A 1EJVC 3FCPA 3F5KA 1S5VA 3U9IA 1Z41A 1OY0A 3RDKA 1IZKA 2Z26A 1DTUA 2B4GA 3W6MA 1FXPA 5T8GA 3A3XA 1R85A 4GC4A 1XYBA 1LL6A 1UCWA 2PDUA 2CBVA 5JBEA 4FXRA 3W71A 1PV8A 3I3BA 3MQTA 3KUMA 2HS8A 4HCHA 3BO9A 4WDTA 2FQIA 1XWYA 4D6CA 1SZNA 1THFD 2VKZG 1FCUA 2X1RA 1KQYA 4FNSA 1KR0A 3CZJA 2BOGX 3W7HA 5FJRA 4J5NA 3AO0A 1VBUA 1YNQA 4GINA 1LUCA 3HO8A 3T0TA 1N8IA 2X2GA 3WD0A 3T78A 1PTAA 2WCAA 2QJMA 3O07A 4HU3A 4ZE5A 3VGFA 1VJIA 2V3EA 4H04A 5ECUA 3ITVA 3BLPX 2RGMA 3MUCA 1Q2RA 4PUNA 1HKVA 4IIHA 5HK4A 3CPUA 3GLCA 1XLJA 1EQCA 3R0DA 5BMWA 4FP1A 4HSHA 1CXEA 1VPXA 1Z9AA 3DFQA 4GBUA 3DHPA 5IRPA 3LV5A 4OOUA 3UBPC 2QV4A 3GC4A 1Y0EA 4L5ZA 4C7GA 2WZIA 2CERA 1OC5A 2VFEA 1EJWC 2BLEA 1POKA 5AHMA 3LGGA 4Z2JA 1O94A 4ZZ9A 4YTUA 3WF4A 1XXXA 3DKLA 2C19A 3CIXA 3HFYA 3HIJA 4UQAA 4C6IA 2WM0A 3NFUA 3L12A 2DGAA 3TUUA 1NP0A 3OIHA 1PPIA 3ARRA 1EPXA 3FJLA 5M5DA 5HMEA 3N13A 3PPFA 3RLGA 4AFYA 1ALDA 1OX4B 1UZDA 2ZDSA 1O5KA 3W1AA 1G7UA 3WLHA 4S1FA 2NX3A 3P84A 1GW9A 1Q6LA 4JR5A 5AYXA 3MM6A 3QQ0A 1E9LA 3NAVA 2GFTA 4Z1YA 4IQJA 1S2TA 1SJAA 4S3CA 4PB5A 4N2YA 4AD5A 1S39A 2TYSA 4WSHA 3QMRA 4O0KA 4MVAA 4MWAB 4JTKA 3IANA 1UYQA 4BEUA 1E5NA 3PBUA 4Y9PA 4GG9A 3H7RA 5DRIA 4RZ5A 2R6OA 3NEVA 5A8NA 5BNKA 3L4TA 4AMAA 1HVQA 4DAIA 3PUEA 1S5NA 3IJ8A 4X0NA 3M0KA 1JI2A 5DY2A 4AU0A 1OFPA 1LLWA 5C2GA 4AIOA 4G7EA 3TA6A 4S3GA 5ABFB 2BBFA 3AS0A 3P8IA 1H51A 1E4NA 5CAHA 3PC0A 3RN6A 5LYRA 4EPDC 1R87A 1XSKA 3DH7A 1S2UA 1YDVA 3GHRA 2BY2A 3O63A 2F2KA 4BEQA 1CT5A 4S3DA 1JRBA 1U2YA 4DPPA 1JIBA 4RLIA 3LSCA 3L0KA 1EP3A 1LM1A 2VC5A 2OCZA 2VX7A 2GDQA 3UJ2A 1X8CA 2A7PA 3IK2A 2O4QA 4MB1A 2AQOA 4IM4A 2PDFA 1CXLA 3N2BA 2WWCA 3QYQA 2NV1A 3CB3A 3W6LA 1NY1A 3ARUA 2XH0A 4JCMA 3ZR4A 4DBUA 3MO7A 5CBJA 5KETA 1Z44A 2OOFA 3W7QA 1KRMA 2QPUA 1OCNA 3N14A 4ZO7A 3KAOA 1HT6A 3EOUA 4QNEA 1ODUA 3UZZA 1H5VA 4NAEB 2VZTA 2ONEA 2JQXA 2Y61A 3ARXA 4HK7A 3WF2A 1TUFA 4ICMA 2D3LA 3E0LA 4XZIA 5E6YA 1TIWA 1BKHA 2DH2A 3UR8A 4M1BA 3M0ZA 5AC7A 3PZOA 4RDVA 1NOFA 3FAXA 4PCNA 1IT0A 3IJDA 4LW7A 2YCIX 3PZQA 1OC6A 1HJQA 2C14A 4C5YA 2ACUA 3M0LA 1O1ZA 3NNTA 4PE8A 2F61A 1FP8A 4B5TA 4LU0A 5DEZA 3ZT5A 3MJYA 4DBSA 5FSEC 1B57A 1CDGA 2J9YA 5D04C 1ME7A 3PPCA 3QYSA 4G38A 1N55A 2Z0IA 3DAQA 2Y70A 4JX5A 4LS2A 3ITOA 3M4HA 3OVRA 2WNZA 4IMCA 3UYCA 3EWDA 1VFFA 3BW4A 3AHVA 6XIAA 2VURA 3A9BA 4C6MA 4Q4SA 1JYXA 4H7CA 3R94A 4I6VA 1XYLA 5EMYA 4ORIA 2J27A 1RH9A 1P1MA 3V0SA 2UY4A 2XIQA 3NM3A 4ZXLA 2GK1A 7REQA 4D72A 2XM1A 2QULA 4UMBA 3LD5A 1LWHA 5REQB 2IPGA 1CGYA 2XIBA 1OQFA 4XZWA 4JQAA 2YBVA 3P80A 3OLGA 2I56A 2AOPA 4QSHA 2Y63A 2G4FA 5H8MA 2QR6A 4GD0A 1VBHA 1WCGA 1PKNA 2R14A 1PL9A 1YTEA 4RE0A 4JL1A 3AIVA 3CEUA 7ENLA 3QEZA 5I7GA 3E5BA 2DZPA 4GI9A 7TIMA 4YJ5A 3QY8A 5HWMA 3WNLA 1QVBA 1XDLA 1CGXA 2D20A 3RXZA 3E12A 3WSUA 2BY3A 4UOJA 3LBMA 3MT1A 1J5SA 5JIWA 3OO2A 4WX2A 2OLAA 2PODA 3WNOA 1A5BA 3S47A 2VL4A 1MQQA 5H8PA 1I60A 4GBDA 2XJ7A 5KZEA 1E4IA 5A6BD 3MHGA 5CG7A 5SWUA 4L4PA 3Q67A 5AC5A 2FMNA 4B90A 1REQA 1JXKA 1RVGA 3POHA 4PSRA 3M6YA 1Y5WA 4M6VA 2E6DA 3LXBA 5HPCA 4WY0A 2CU0A 2VGGA 3CO4A 1DJIA 3ZVIA 3FA5A 4C6BA 4LNCA 1BXBA 4YYFA 3TR2A 4HU4A 2X09A 4GHRA 2WZTA 3VD4A 1GG1A 3K2GA 4I9JA 3PANA 3V36A 3BCDA 2PCQA 3WQOA 1PSCA 4J3VA 1LLOA 3MSRA 3W02A 1XIMA 3WJSA 1Q6OA 4WHBA 4E8DA 2CLEA 3LTYA 5CZ0A 4DJDA 2AL2A 5LKYA 1EOKA 4HTRA 3CAKA 1W56A 4HSOA 5A2AA 4K1WA 4X9YA 5I3HA 4WKAA 3H2NA 4UFHA 4JTAA 4NJIA 2DT2A 1DJQA 4JNMA 2WM1A 5K3VA 4KW2A 2CWNA 4E4PA 4DWSA 3XINA 2CPUA 2C3ZA 3KOFA 3II1A 3ICJA 4BJHA 4KWVA 4UMAA 3EA1A 1VJSA 4NUWA 3L4WA 3ZZ1A 3W1RA 5CSRA 5A8GA 2ESCA 5BWFA 4XUYA 1R5YA 3M0MA 3ITCA 3MMAB 3RJYA 3W1MA 2FH8A 2UY3A 4LAUA 3AS3A 4HKPA 4XWUA 3OG3A 4JFVA 3QR1A 4LFYA 3BZJA 2YZ5A 5G1YA 1OD0A 4PBEA 2ISVA 1WUEA 4NXKA 1VPQA 4JY8A 5LNSA 3LZ5A 4F0MA 4F0HA 1E6PA 2IQ0A 2B0MA 3NCOA 1Y65A 4NIRA 1C8QA 3LHUA 1WPCA 7TAAA 1LOLA 2QMKA 1Y5XA 3A47A 4KGJA 4GACA 4INFA 4DO5A 4D2JA 1SGJA 4ROQA 4YLWA 3N2TA 3VM7A 1XFBA 1V0NA 4V1YA 2WBGA 4Q4QA 1ECQA 3NDZA 3N9KA 2E6FA 3W7KA 5I2UA 1R3QA 3RO6A 1PJ9A 3GIYA 4GI8A 5LA0A 4R53A 3SRKA 4WDWA 5AKQA 3W4RA 2BV9A 3DFSA 3W82A 4QLLA 4RW3A 4DIAA 4YWIA 3LBCA 3GG1A 1I8JA 3THCA 4IIGA 3OIXA 2V0TA 5JH2A 4NYYA 3DFYA 4XBKA 1VFTA 5GNYA 4Z2KA 1XHGA 2G97A 2KX9A 3ZIZA 3PM6A 2Z25A 1E0XA 5I6SA 3W2LA 3ORWA 3H6OA 3EEGA 1KFEA 3VDCA 5I3DA 1MVYA 1NSJA 2PMQA 4ZCWA 2YSWA 3FVMA 1EYWA 4WLCA 3T0DA 2PDPA 3SGZA 4JTJA 4LCSA 1RBLA 3DC8A 3OB8A 4MKVA 3DFHA 1PCKA 5FJPA 2PUZA 1B1YA 1I75A 1W1YA 1MW2A 3O15A 5DY3A 5JXQA 1XLLA 1B90A 3PFRA 4XV0A 4M80A 4HU8A 2WHKA 3NTYA 1QR7A 4W8AA 3P61A 9CGTA 2O7SA 2AKMA 4LF2A 2GQ3A 4NP7A 4FS9A 3TIMA 3CUIA 2BGSA 4PTVA 3H2MA 1X97A 3BAWA 4GKLA 5DCDA 1U1JA 3QPYA 2VENA 1FWDC 4ZQOA 2HVNA 1QJWA 2GJPA 2OT1A 2D2OA 1ICSA 3L21A 4CCZA 2QVNA 5KITA 2VCAA 5DX7A 1OVDA 4B9YA 4W85A 3CBWA 4ZA0A 2NV2A 3STCA 1DORA 1H63A 3NIYA 1MFUA 4K8EA 1E43A 2P3ZA 3U8GA 4IP7A 2P5NA 2V3FA 1SW0A 2HV5A 1C92A 3LV6A 1LL7A 3I3DA 3Q45A 4Z1BA 1PIFA 3EEZA 4ZFCA 3N4EA 2WMIB 3LK6A 3RPDA 2WSYA 3PBGA 4XD3A 1FWAC 3ITGA 1DJGA 3NSNA 3E2VA 2YOCA 3PPGA 1KFBA 4MJ2A 2CXEA 1H62A 5LSMA 1EGVA 1SR9A 2QF7A 2GLKA 2G37A 5A2BA 4RDYA 1IR1A 4AOPA 1EGZA 3W7GA 3VLXA 4QJ1A 3FKRA 1JG9A 4ML4A 4CCEA 1TVLA 1GG0A 2PRMA 1HFBA 1ZJBA 2VJXA 5HWJA 1MFVA 1OINA 2A7NA 4CQCA 5HMSA 5D02A 4O8AA 2ZE0A 3H22A 5A69A 4BWLC 2H6RA 1C93A 2B7QA 4OGZA 2QS8A 5I23A 1ME9A 1PB0A 3G0XA 3WF3A 3Q65A 1AVAA 3BQ6A 4MZ1A 4E0CA 4ACZA 1ESWA 3M07A 4ZOAA 3STGA 3GY1A 5HNNA 1TSIA 1WKDA 2HPMA 1J11A 3FDKA 3AI0A 3E9AA 4S3JA 5DMLA 4U28A 3AMGA 1SU5A 1PO9A 4XSMA 5K9CA 1VF8A 5HR7A 2W91A 2ZC8A 4HZ6A 2EBNA 5CPQA 3KOXA 4ZOEA 3ARPA 3O05A 3VX0A 2C18A 4R34A 4DI8A 3STPA 3M0VA 1UROA 5PTDA 4GQBA 5ABTA 3MMBA 4YCPA 1TG7A 2YZRA 4ENLA 5H91A 2GUUA 3WKZA 4OE7A 1EO7A 3UPMA 2VDIA 4UCGA 3LU2A 1V77A 3ME3A 4N6EA 4FALA 1GORA 1R2TA 3ALFA 3GG7A 4PMRA 1UASA 4BQ2A 3U0HA 5K9XA 3G22A 2OX4A 1ZQ5A 1DIOA 1M01A 4K68A 3LQLA 2PWVA 2QCHA 3CZKA 5XIAA 4AZCA 1PCWA 3WEZA 4LBRA 1F7BA 3HA1A 4H8NA 1QMLA 1GJUA 4JAWA 3RMJA 4CUCA 1N8FA 1GQIA 3ZQ9A 3C2RA 1W91A 4U2ZA 5FAGA 4KEUA 3W37A 3BL3A 1KXTA 3T4WA 3VCNA 1HZYA 1JDCA 3UY7A 4LJ3A 2BASA 4O15A 1IIHA 1W5MA 3O3RA 2WCGA 2IPJA 1W5QA 1SFSA 1C3FA 4FR1A 5LIWX 5FF4A 4QLJA 4MHBA 1DWGM 4MLJA 1B54A 4NRRA 3SFKA 1R3TA 4GC3A 1LQAA 3FSTA 2WSRA 2Y8KA 1E6XM 3EOLA 1P7TB 1U1UA 2E68A 3SY5A 3TQ0A 4UTIA 3RX4A 4OBRA 9XIAA 4DWDA 2F84A 4A3RA 2OZ8A 2Z1BA 4G1KA 1OHLA 1YEYA 3TJLA 4GQGA 1DQUA 2CIPA 4JOMA 3WQ5A 4C6JA 3QV9A 2ZUSA 4Z1CA 4KRUA 1OGSA 4LNYA 1OFEA 4LX4A 1LBMA 5CEWA 2WVVB 1IEQA 2X0SA 3B9NA 3VO0A 1GPFA 4ORMA 3VNZA 1HKIA 3LN3A 2G8ZA 4I90A 3L65A 4ILSA 2GSHA 3G24A 1IIGA 2JF6A 3SIMA 2CXGA 3LHWA 1PTDA 1C7SA 3CQHA 2IKGA 4CU8A 1EUNA 1JYWA 2E5DA 1O66A 1RR2A 3HPXA 3SCOA 3QY7A 4AEOA 4IIBA 1V5XA 2ZTJA 4FIQA 3AUJA 1AJ0A 4GVGA 3DEQA 2PC8A 2G50A 2HISA 2ZZ3A 1A0EA 4DI9A 1W6TA 1UKQA 4TTUA 3NQFA 3ECQA 3SQSA 3VZZA 3V35A 1K8YA 5HQLA 1L8NA 2V4JA 3OBAA 1I0DA 2PU0A 1KM5A 3M0IA 1HTIA 5CJNA 3AOFA 3XISA 5IHRA 3C2EA 4AX6A 2DQWA 1WNOA 4K39A 3SDOA 4QE5A 1FKXA 2PGRA 2ZBTA 3C0SA 3VOCA 4HPHA 5HPOA 3AIUA 1XIDA 4C6NA 4F4RA 3A22A 1GOMA 1V7YA 5D09A 3VKCA 5HNTA 3TK7A 5T91A 2VGFA 2DZTA 3URAA 4MNMA 4GVFA 3PWIA 1FOBA 2QCEA 4EIVA 1TJ1A 1DP0A 3CWNA 4LAZA 4JY9A 4IG2A 5AVHA 3UZXA 3OZYA 3GUGA 4H9TA 2DPEA 4XAYA 2E8ZA 5B7ZA 5LNWA 1C29A 3ITXA 1CGWA 3QOMA 3PNZA 3T2PA 3VKTA 1JJKA 3R58A 3PFMA 2PZ0A 4LUIA 2FVLA 3VIJA 3G1XA 3JRKA 3F03K 1R2RA 4OKDA 4Q8UA 3OR1A 4RE3A 1Q8AA 4F9DA 4GNKB 1XF0A 2X0YA 5CGTA 2ZUUA 3CTLA 4PTNA 3CZLA 3AU6A 1UZ4A 7GEPA 1DWHM 4KEZA 1H11A 1H1NA 2XIIA 3V5CA 4HOWA 3E2SA 1J93A 2E5BA 2Z1SA 4C60A 4Z0SA 1UKOA 5D03A 4YTQA 3ZJ7A 4P7NA 4AZ5A 1GZJA 4YIWA 1DJHA 4FPSA 3H24A 1ZLPA 1UD2A 4RNHA 5D33A 4LBUA 1VFLA 4H8VA 4KERA 3VKRA 4MPKA 4W8LA 1YXDA 2FJUB 2CLKA 2CCRA 5I02A 1TWWA 3H23A 4AXNA 4FF5A 4E2VA 4AYGA 1GQKA 4LUTA 1P0DA 4FNUA 1E6SM 4R3UA 1TA3B 3VCRA 4OUEA 3UXIA 4GIAA 2J24A 1W1ZA 4HZ7A 2P53A 4F2UA 4K7YA 3KOWA 4Z08A 5FJTA 5CC6A 4QP0A 2XGBA 1EZ2A 2ZVIA 5C71A 2ZADA 1FH9A 4AEFA 2YCKX 4H2CA 2FGLA 1IXPA 4HNUA 2AQVA 4KWOA 3WLIA 2CLPA 1J0IA 2O92A 1CW2A 5B80A 4WGHA 4F0SA 1NF7A 3JS3A 4O1BA 3O7UA 3GW3A 4J3WA 1GGOA 2O9PA 3PZNA 1NOUA 4X22A 4A3HA 3U2CA 4FXJA 4NAEA 4TIMA 1DJYA 1K02A 1KFCA 1N7KA 5ABFA 3HB9A 2XZ9A 3VGBA 4XZNX 1MW1A 5EA9A 3WLLA 1UWIA 3WNPA 1WOBA 3KOYA 4DQWA 1J79A 2POTA 4C1LA 1CXHA 2OQHA 4LPCA 3CT7A 1L6SA 4JHMA 3E0FA 4TX6A 5E70A 3PUDA 3RITA 1SO4A 5EGRA 3UW6A 1DBTA 3EMQA 2GWGA 1TPC1 4MNKA 3U2OA 4ZBCA 4F0LA 4MYXA 5KEZA 4P8UA 1E0VA 1P6WA 2W79A 4WDUA 1EA0A 3M16A 4DYKA 3SAZA 4LAMA 4JYEA 2P3EA 1J2BA 4XZBA 4TV6A 4P8VA 3GKFA 4EPBC 2DUZA 3TCEA 1S1PA 1EEXA 1KWKA 1NARA 3BC9A 4YWSA 4XAFA 2IPFA 3WLQA 4L61A 5FJOA 4DYEA 1PZ2A 3AROA 4OBTA 4EPEC 5CJ5A 5FD0A 1EP2A 4TO8A 2BFGA 4ACYA 1WYIA 3HGOA 3W84A 3BARA 2VQUA 1TPFA 1KC7A 2DIJA 3K30A 1OX6A 2WZHA 1W8SA 1JNDA 4HNOA 1J0JA 1UUQA 3OZOA 4LCRA 2OQYA 1RV8A 2Z7GA 2NUYA 5DT5A 4W8BA 4DY1A 1K9DA 1JI1A 4U3AA 1JQVA 4UR7A 1IWBA 2VRJA 3OVGA 4MFDA 3UPWA 1XQKA 4AY1A 2QPXA 5E0FA 4AB4A 2OELA 3VVGA 1V6UA 1O4UA 1A4LA 1V3HA 1B2YA 3JZEA 5HR6A 4H9VA 3RX3A 2J7DA 3TR9A 1IZJA 3TQVA 3UERA 5FKYA 1LTDA 1JDFA 1X1ZA 4UTLA 2VO5A 3UG5A 3BV7A 1VRXA 5XIMA 3RG6A 1LG2A 3BMWA 2GQ9A 2QUNA 3BE7A 1E1FA 3W1LA 4GNJA 4EVZA 4BI5A 3A21A 1W5OA 3WNNA 1W9VA 1UKSA 3OOQA 2ZZ7A 3E2QA 3KVLA 3SQMA 1SSDA 3IIPA 3PBMA 2OWWA 1VP5A 3HMCA 4K38A 1O60A 2YXXA 3C56A 2EQDA 2WJFA 5HJLA 1UR0A 4FIRA 1Q85A 4O13A 4JNZA 3KL5A 1P7TA 4DJFC 1J0ZA 5D2VA 1S2CA 4E38A 2ZA1A 2EPMX 3KP0A 2V5DA 4IGMA 2CHRA 4A2SA 4OUIA 2A6NA 5DXYA 1MW3A 5HUPA 1O7AA 1W3IA 4GY7A 3W7IA 3U3HA 2FLIA 3W87A 4IJRA 1GZGA 3LEPA 4J3XA 3WQDA 3PTQA 1E1EA 3POCA 2DORA 3PJXA 5JH1A 3RO8A 3CC1A 2AL2B 3LYEA 4JTDA 1RY8A 5FL0A 1CX9A 4PMDA 4HVXA 3VIKA 2I1OA 3R11A 2PTWA 2QJIA 2VI0A 2V5BA 2EPKX 3IGHX 3UNDA 1B3OA 4MSSA 1LBFA 3SCVA 3V1HA 2QCMA 3VKDA 1ME8A 2XVPA 3MHFA 2VFDA 5IDZA 1UBSA 1H7PA 3C6CA 2ZA3A 3KZSA 4V33A 4BI6A 1L9WA 1GTHA 5G4WA 1O5QA 2WJEA 3L5LA 3ERPA 3MUIA 2QV5A 1CGUA 1CXFA 2GGJA 3DU0A 4WOZA 1ZAIA 3QSRA 2X1SA 1OC7A 4KF1A 3FHAA 4L1GA 1LROA 1MQPA 2IMRA 2V67A 3NL2A 4ZVJA 1D7KA 2I9EA 2WZEA 1G4TA 1SM9A 1SMDA 3FA4A 4XVEA 3O8AA 2GDVA 1LCOA 5FEWA 4NVTA 3P7YA 2PF8A 3FYYA 1XL9A 5CBIA 2XYLA 2QLYA 2WNQA 4EXBA 3UWYA 1OCQA 4PULA 4RZ6A 4H19A 1OYBA 3GS6A 2J47A 2PTXA 3EXRA 1ISYA 1ADOA 4E3VA 3HQPA 1UR8A 4LVFA 4W84A 4ZQCA 1DJWA 2Z28A 1AH0A 4AEEA 5KINA 2JALA 1KR1A 4I8YA 3KXQA 3VDHA 1GOQA 2D1ZA 3HM7A 2YDAA 4IMFA 4O1CA 3LMYA 1EDGA 3MP3A 2GSJA 1JL8A 3UG8A 4GYKA 1J2WA 1ZRQA 3MWAA 6XIMA 4KCTA 1PS9A 5FJUA 4AY7A 4XKMA 1ISXA 4NXSA 2KAUC 2OPJA 4MY1A 3L0GA 3NPXA 2YX0A 4LC6A 1C7TA 3BQ5A 3HGJA 4CN6A 3VLYA 5EBAA 2PD5A 3W76A 2V2DA 4HP5A 3B9AA 1FWEC 3EMZA 3E0WA 4FNTA 3GXTA 1UD6A 3U57A 4PTMA 3VKQA 3TTYA 2Q3OA 3FYPA 3DYOA 2X8RA 2PU1A 3N9SA 2BVDA 2A2IA 1E0UA 4B2DD 3TH6A 1NAL1 2VWSA 5DO8A 2GGIA 4S2CA 4ZQPA 1QNSA 2E28A 3N12A 2DZSA 3R5EA 4JTHA 3AZTA 4WSKA 4H9XA 3WL0A 4AISA 1OFQA 4BFAA 4KFNA 3D46A 3GFZA 3G5EA 1OK6A 3KWSA 1S3HA 4JEJA 3RM8A 2ICSA 2QJGA 2DVTA 1TR9A 4ZO8A 4GYPA 2QEZA 3WUBA 5BXPA 3IRDA 1PX3A 3WENA 2GSEA 5CC5A 3ATYA 3RCYA 1VYRA 3NPVA 3FA3A 2BB0A 3EGJA 2FH6A 2WMJA 1LL4A 3VUPA 3B8VA 1KV5A 2PDIA 1UZHA 5I5RA 4L64A 5FA5A 1F76A 3GG8A 1L2QA 5HQMA 4TVCA 3VNMA 1XRFA 3O0FA 2P50A 1XIHA 3TW6A 2TMDA 4OIFA 2XIMA 2PDWA 3R25A 4O16A 3ZR5A 2R1KA 4DM2A 2OGJA 3OEXA 4J2MA 2JK2A 3TAOA 3TTOA 1BD0A 1V0MA 2HROA 2P1FA 2PP3A 1W3TA 4AY8A 1GKPA 4UMCA 3EA2A 1L8PA 1UIPA 4NL1A 5ECVA 2GZXA 3SCUA 2F38A 1YE6A 4IFOA 1JPIA 2Z2AA 2YL5A 4AW7A 3SRDA 3CB8A 1XS2A 1PAMA 3GVQA 4K3ZA 4PEEA 1NWTA 3JUGA 1M65A 4EF9A 4ROPA 4MWAC 3SUSA 5A6TC 1VBGA 1BYBA 3IWPA 1DPMA 1EHAA 3T05A 2VP8A 1GOXA 4ICCX 4ES4A 1BXCA 3N19B 5DMNA 1GVQA 4MKNA 2C79A 4Z1DA 4S3AA 2JGYA 4PMNA 4KESA 2ABBA 3UEQA 1Z3NA 3A5FA 3CH9A 2OYLA 3HFTA 3LCXA 3KTCA 3IJ6A 1SO3A 4CU7A 3GQYA 2NSOA 5HNRA 1KLYA 3W6YA 5KZ6A 3E0VA 4U2YA 1JZ2A 4QQ3A 4E6MA 3KRSA 4X61A 4IL0A 1XIBA 2VX4A 1FWCC 4C6EA 1V93A 3QKZA 2V5LA 3F4CA 1W17A 4MYAA 1QOPA 1GOIA 3S5OA 1CWYA 2ALDA 4ECLA 2HBXA 1TTIA 4DLFA 3SUWA 3RHGA 1EXPA 4AC1X 3BW2A 3GXPA 3TCSA 3VI2A 1GQLA 1YQ2A 2QVHA 1Z42A 4MY9A 4M8UA 3AISA 3UWZA 4LOCA 3WEOA 4K8GA 3VM0A 3ABZA 2AQWA 1BXNA 5AVNA 3WBXA 4Q7NA 3B4UA 4DF0A 3KBJA 3UESA 4AQLA 1QW7A 4R7OA 4K2SA 4G56A 1GT8A 1JQXA 2DUAA 4BQ5A 4KIRA 3TN3A 3K8KA 2VFIA 2HQAA 4HMEA 4B3LA 4IIDA 3WO8A 4QJ5B 1H3GA 2YCLB 5K4ZA 4I9AA 1X6UA 4WY0F 2PB1A 5D32A 3WEMA 4B2DA 1WBHA 3BMXA 3UGVA 5HBFA 3N17A 4O4WA 2DSZA 3N2CA 1LF1A 2YW4A 2ZX9A 3FY1A 1WB0A 3VTRA 4YCOA 5I0DA 2OSXA 2WYSA 4XQ6A 2J7BA 1MNZA 4UQEA 1C8VA 4FHAA 2B31A 3HV8A 3W27A 1R47A 1J8VA 4C1KA 3H26A 5D9NA 4ZE4A 4GVHA 3W2UA 4AZCB 1JZ4A 3OR2B 1EH9A 3VOHA 2YL9A 1GZ1A 1LRNA 3WJZA 1K1DA 4S3BA 2CLIA 4XO7A 2QCDB 3H8AA 3HZ3A 3LERA 4LQ1A 2REQA 3V1PA 3UYIA 1MEHA 1L6GA 2NVCA 1HL9A 1R7OA 4WJ8A 4HNNA 2OEKA 4IPNB 3BG3A 1RXOB 4H9ZA 1MWOA 3LS9A 3WLPA 3B04A 5TQLA 2EXOA 3RRAA 1W9BM 1FXQA 3WDIA 5B7YA 2R91A 3NPWA 4DVOA 1DTNA 3VIHA 2CWXA 3D0CA 3U5UA 4Q4PA 1D3CA 4AZBA 5I00A 4JFTA 1M1BA 2RKXA 3ZO9A 1YPIA 1ZCCA 1MSSA 2VGIA 1XBYA 2OQLA 4Y8EA 3UG4A 2DZVA 3QRHA 3ABOA 3S1GA 2E6AA 2FTYA 3WK2A 2J4GA 4A8NA 2I57A 5CZKA 2FHCA 3PB2A 4DRSA 3UETA 1S2AA 2NW0A 2Z24A 2X41A 4EWJA 4Q6JA 5AFDA 2XGZA 2IUZA 1KGXA 3C2FA 1HP4A 1KM3A 2VC9A 3QVQA 3SADA 1EF3A 1DKWA 7PTDA 2VRKA 2REQB 3UCDA 1V6TA 5DT7A 3S5SA 4V2XA 3FK4A 3KBMA 3T44A 5IFTA 5D37A 2QNEA 4AVOA 1MEWA 1LOSA 1N8WA 4GH1A 2J25A 3ZWSA 1WKYA 2J9XA 4GCAA 4UTHA 3W9ZA 3NXFA 1UH2A 2QQ6A 4DJDD 3L0NA 4PMYA 2W67A 5AY7A 5BWAA 1VC4A 3MUZ1 1PZ3A 3EDEA 5TNVA 2E1WA 3UA3A 3GR8A 3N25A 4A2RA 1K8ZA 5LZLA 1KBIA 3AXIA 3E2RA 5LNVA 4RPQA 2ISSA 3KL3A 2WPBA 4MLRA 3EX3A 2W9MA 1F61A 1KRBC 3MI3A 1YBQA 2NT1A 1E56A 1VLWA 5D4YA 3OLDA 1W5NA 1G6CA 1UKPA 2NVDA 2OU4A 3QXBA 4H4IA 1AD4A 1U5VA 3UU0A 3V3WA 1QDSA 4DM1A 2NX1A 3N3MA 1EYEA 4MZYA 4W5ZA 5I09A 3FOKA 2QCFA 4H2HA 4REQA 4JTGA 3HGRA 1K70A 3KVJA 1HJXA 4W5UA 1YPFA 3WLRA 2Y8UA 3N2OA 2BODX 1TB3A 1KO0A 1UWRA 3ZLHA 4I9TA 4ZTXA 3B0HA 3SN1A 2ZTKA 1BTCA 2NXHA 1SZGA 5BU9A 5A6KA 3TSDA 1XG4A 3QMTA 4BR1A 1KBJA 2VC6A 3S6TA 1FHVA 4HHLA 3NQEA 1OFDA 3KM8A 1WKFA 5D8WA 2WW5A 4B4FA 4AWEA 3TTQA 3UVIA 2A3BA 1QHOA 3G3MA 4LBSA 5A6SA 5IOBA 3AWNA 1POJA 4FZIA 2WC7A 3B40A 5IDIA 5I3IA 2HVMA 5HATA 4AWSA 3ENLA 3R8GA 4DPQA 5C9UA 3J7HA 4NG3A 3MZ2A 1D7FA 1IEIA 4AD4A 4TOQA 3ZT7A 3NQGA 4REQB 2ZXBA 1TWZA 3VLZA 2QCCA 4GUFA 5E9AA 1Q63A 4FK9A 1M6JA 1JULA 4AD0A 3KW3A 3OA5A 3BG5A 4DN1A 5BMXA 5CSSA 4LB4A 3TAKA 2CZ5A 4HCDA 5LIYX 3TYBA 4GFSA 1J18A 4DZIA 1S5WA 1U5JA 1ZU8A 2P0IA 3L5AA 1K03A 3NGFA 5C8BB 4QRNA 2E40A 1E1CB 1ZAJA 1PDZA 4IPPA 3EWWA 2A7RA 3W7NA 1S2VA 5JUVA 1PE1A 4GZIA 3WG6A 4RNIA 3MKVA 2FZ9A 1JNEA 3NQVA 2Y7GA 4QSFA 4TX8A 3M7WA 4Q8MA 4TTGA 4H6RA 2POZA 2C91A 3WX7A 1FWIC 1ISZA 3IJ7A 4Z2IA 4G7FA 1RQHA 5MF5A 2WXDM 3OGVA 4G7EB 4ADSA 1K9TA 3RPMA 3MSGA 1CNVA 4FXSA 2X1TA 1WZLA 3UCQA 3P8JA 1OZMA 1SO6A 1UWTA 4ZQNA 4Q8NA 3IPWA 3GNPA 4FEZA 4N9DA 3A4JA 4BKNA 5BOFA 3T42A 2JFEX 1Q4NX 3DI0A 1XDMA 3TW9A 3THDA 3KDNA 5GJMA 2ZZ5A 3BSHA 5HOSA 3ES7A 4Y7EA 4P61A 2BOEX 4JTQA 2YJQA 2PTYA 2GYIA 1SFTA 1R38A 1XRVA 4LAOA 4HB7A 3W22A 5MKGB 4QGCA 1NWUA 3BSGA 2V63A 3RNDA 1TPEA 4IQLA 3M7SA 1VPYA 1P43A 3N11A 4S3FA 4J35A 3P14A 4HYVA 3G1FA 1GJPA 1ZBCA 1RD5A 4QISA 4RE4A 1T7LA 4FNRA 1WE5A 4IZGA 3AIBA 1QNPA 3AMKA 1S5MA 2CZFA 1G0CA 4Z0JA 5REQA 1XLGA 5TD4A 3ZJKA 1K77A 4IPLA 5LGXA 4CD7A 1YMYA 4JTEA 3WF1A 5K7JA 3W7DA 1XUUA 5F2IA 3WJXA 1US0A 3H2EA 3VM5A 3FKKA 3MBDA 4WZHA 3T1GA 3PTKA 1V02A 4WSJA 4WY0B 2VR4A 3WLNA 3PULA 4UNLA 3MPGA 4IMAA 1F3XA 3WY1A 2R82A 5D8ZA 2WB5A 3S8HA 1XYMA 1KQZA 2CNCA 4NX0A 3TYZA 3P0XA 4POCA 2PI6A 1OZQA 2WWDA 3AXMA 2NQ9A 1BAGA 4UFLA 3MM9A 3ARWA 2WKGA 1SZRA 4XUGA 1QAPA 4QE1A 1HKJA 5FESA 1WP6A 2HTMA 2BVTA 3R1ZA 1NDVA 1V8EA 3IAQA 4U4MA 3EXSA 3L9CA 2GK1B 3WLTA 7REQB 1H60A 1D3HA 2VEFA 1UW9A 3VGGA 5FSDC 4A4AA 4XAPA 3IVUA 1UWQA 1V08A 4IICA 3GXDA 1UHVA 4B5XA 2V69A 4JICA 1DIDA 3U48A 1VIZA 4X2PA 2RJGA 4P5UA 3AUOA 4GUGA 1AJ2A 1Q7MA 3IV3A 2IQDA 2FJKA 2XGIA 3MKKA 1Q6CA 4CNTA 2Y88A 2XFRA 4GXPA 4S3KA 2GVEA 3ZFHA 2NWRA 3WMCA 3NURA 3LCFA 4IHCA 1IEVA 3IRSA 3MHUA 4GJIA 3AJ7A 4JX4A 3M47A 2F9RA 1P0KA 1M53A 3GC5A 3UWEA 3HG2A 4U33A 2YLLA 5HXMA 1OFOA 4L6HA 3TDFA 3BAKA 1YBQB 4QAIA 2G3JA 3EOEA 2WLYA 1VENA 4KWSA 5K9DA 2CBJA 1VKFA 2F6UA 1U1HA 4HHPA 3NYDA 2R1NA 2QCNA 2WC3A 4DLMA 1A47A 1H1YA 1RCOB 1K9EA 1FCVA 4R9XA 3BAJA 3GH7A 3U5YA 1BSLA 4HK6A 3OGRA 4ZTYA 4IT1A 4FB7A 2H3DA 4WJXA 3O06A 4GY1A 2V5KA 1S3TC 5BXSA 3NSXA 4BQ4A 1TKKA 4AD3A 4M7SA 1DE5A 4GX9A 4R9OA 1V3KA 3W23A 4ZXOA 4JXCA 4JTSA 5A8MA 1J0KA 4DO4A 4BZYA 4AC7C 3ONBA 3ELFA 4LCQA 6ALDA 4LYPA 1ISWA 2MNRA 2Z6JA 4N9BA 1UMLA 1TTPA 3H4XA 1LORA 5KSWA 1BYAA 3WH8A 1VLIA 4YL2A 3W2JA 4ATLA 2YXOA 4EKJA 3SZ8A 3TC7A 3W7EA 1TELA 4PR4A 1EA9C 1A3HA 4MKSA 1A5MC 2C0AA 5TAOA 4M6QA 4D6FA 3UQNA 4G1NA 5F2GA 1I9CB 5HAOA 4Q8OA 1ZJIA 3G18A 2QGYA 4CN4A 1QK0A 1XM3A 1TE1A 3ZSSA 4IF2A 1H61A 4X0VA 3IV8A 2G41A 1HX0A 2DP3A 6REQB 2Q6ZA 3HG4A 4JN6A 4L7ZA 3D5HA 4I7WA 3EBVA 1VIWA 1UP3A 2V30A 1MZRA 4O50A 3F4WA 4H01A 8XIAA 4IUGA 5CQ1A 3THAA 3GTHA 4A6GA 3UR2A 2PFHA 4C5ZA 3EX1A 1XYFA 1HL2A 4G5DA 4KWWA 3W1XA 2ZE3A 1ZTVA 3RX2A 4HD5A 2PDCA 4RCXA 2OSWA 3LHTA 1AZ1A 2HZGA 4XG1A 4DJDC 3W24A 2OFJA 3BH4A 1W1IE 4LEFA 4YHEA 4Q7BA 4UTTC 4PGLA 3MUAA 1JUKA 1OM0A 4DZAA 5U4NA 4HIBA 4C6OA 3RUBL 3NWRA 3OJGA 1JF6A 3GAYA 2EKCA 1R3YA 1Q2SA 3H55A 3EXTA 3L4YA 3DX5A 3U2EA 5G5IA 1JPDX 4AVFA 5A1AA 2DVUA 4TR9A 4I7UA 2VR2A 1FWNA 5KZDA 1E4LA 1RLDA 4O1EA 3AHTA 3HBLA 2R8WA 3AQUA 5FI8A 4UTFA 1F6PA 4J40A 3E38A 3QW4B 3SB0A 3OLEA 3GIPA 4K8HA 1KM6A 4UQ9A 5HUOA 3SJ3A 4FX8A 2FTWA 4ACZB 4JYDA 3OBKA 3UPBA 3VE9A 3TFCA 1CYGA 2ZC1A 5IXEA 1JPHA 3VD9A 4O17A 3HPAA 1CLKA 3UGRA 4CD6A 4NI3A 1HJSA 2CESA 4Q22A 1QPNA 2VVNA 2ATMA 2FIQA 1K8CA 2GJXB 5ABEA 3FGCB 4GUIA 5D30A 4RUBA 1QPQA 2ZWYA 3P74A 5ABGA 5BRPA 1E6ZA 1ISVA 1ADDA 4E4UA 3EPMA 4PTDA 3QQWA 1P1XA 4LVAA 3I10A 1JCMP 1AMKA 3MMWA 3WH9A 4B4HA 4GIEA 5HJYA 3WN6A 5AYYA 3PZVA 1RA0A 3TVAA 1QI3A 1O6IA 5E93A 3CZEA 4IISA 1NQKA 2OOGA 3GU1A 4U5IA 4GE8A 2OJPA 1JCXA 1P5BA 3WFLA 3WJYA 5DXXA 1H2JA 3PG8A 1BTMA 1S2WA 4ZB2A 1HJUA 1F2JA 1KA9F 1UJPA 3URBA 2XSJB 1V7AA 5J8LA 3LSBA 2PTZA 2WSKA 2X16A 1F6KA 2XH2A 3MYPA 4ONVA 1RQEA 3C0JA 3N9RA 2BMBA 4I7VA 3QHNA 3S6OA 1M5WA 2BHYA 2PDYA 3FGCA 2PE4A 3A3WA 3EZ4A 4Q8VA 4LS0A 5LGZA 3NQAA 5U7SA 2AGKA 3W2KA 1H7NA 3LRLA 1OG6A 4RV3A 3CV1A 4LVGA 2YL6A 2WMGA 2ZX8A 2ZRUA 4MGGA 1SJDA 2HEJA 2YDSA 5C70A 4B5SA 4XAZA 4CQAA 3TWAA 2QYGA 2VT0A 3PBYA 2OMAA 3VX1A 3H2CA 2J8FA 4DBDA 1WDPA 1TMHA 3S1XA 1UD5A 1TZ7A 3BGAA 1RPKA 4JX6A 3GFXA 1Q7QA 3ABRA 1NDZA 1PDYA 2A21A 1XLMA 3R8HA 2QCLA 2ZZ2A 3GVVA 3LPGA 3JU2A 4DNMA 3ZM8A 4GFIA 4O14A 5EPDA 4QJ3B 1TPB1 2QKFA 3LCHA 3W86A 2ON3A 4KGLA 1Q3NA 5J04A 1UQYA 1U33A 2INEA 4C91A 3LG3A 3WELA 1MZHA 4QAWA 3ZT6A 1W5PA 3AYTA 2HXUA 5DLCA 3AXXA 1OK4A 2YCEA 2ZRVA 2ZXDA 1UD3A 4F3HA 1UR4A 3CAVA 4YVPA 2CHNA 2B7OA 3OTRA 5TBOA 2ZA2A 3W25A 2OGYA 4HOXA 4MJMA 1A4MA 4PRWA 3GU9A 4DJEC 3SI9A 2FZ8A 4R5EA 1NTHA 2QDEA 3TTSA 3N2MA 4XZHA 2ZXAA 1GYMA 2XISA 3U7VA 2V2HA 3DFPA 2MUCA 3CLWA 3EDKA 2AL1A 2GQAA 2QUTA 2ZQ0A 3C8NA 3GDTA 3TXZA 3FHQA 1FUYA 4WJEA 1VJZA 6GEPA 3I65A 1BVWA 2FVKA 7XIMA 4NJKA 4AUBA 1VCGA 2DZXA 3WJWA 3K8MA 3CYJA 2HE8A 3HN3A 5DANA 3HOJA 3GC2A 5BXTA 1QPRA 1AW1A 3TYAA 2Z2UA 3CQJA 5F2LA 2PDGA 4FOUA 3E5PA 3PSWA 2JEQA 3NL3A 4B92A 4YN5A 2A3EA 3VGDA 2EKGA 4FXFA 3B0GA 1E6QM 1IZCA 2V3DA 3PS7A 3F4VA 3DESA 1NFBA 3F2DA 2FTPA 2VZSA 4GI6A 2J6VA 3MSDA 3VIFA 4GXWA 2Z2BA 1PKMA 3WLSA 4CVUA 4BHYA 4GWEA 4MMWA 1DWAM 1LYXA 3K4DA 2OWXA 3CH0A 4Y9AA 3QH2A 3LX9A 5E0CA 4AHQA 1ONEA 1JAKA 5LIKX 1R30A 3R89A 1WKEA 3PR2A 3PF3A 1KKOA 3P60A 1JZ6A 3QN3A 1NFPA 4R33A 2XSAA 3PSVA 5J5DA 4GA8A 4IGNA 4KRTA 1FP9A 4MAVA 3QTPA 3N4FA 5D2TA 1GHSA 1BGGA 3WH6A 3GH4A 1I2RA 3VC5A 3MYOA 2OKOA 2YYUA 2ZXQA 3DXIA 2WHMA 3HU7A 1ZB5A 1XCWA 1RCQA 2PWEA 2PLKA 3VIPA 3RLVA 5DCBA 3TWBA 2QDDA 1UA7A 4WEVX 3PAJA 1EFZA 1YDOA 1TRIA 3B8TA 1X96A 3ID7A 2WV8A 5CPNA 4LY4A 1LBLA 5DCEA 3C52A 1H7WA 2ZX6A 3PBVA 3RM4A 4F2TA 1RVKA 3MM6B 2CC0A 4JHZA 1HL8A 4D6DA 3LMZA 5A6JA 2WLZA 4GIRA 1LRQA 3MBFA 4NU7A 3VKJA 3VNJA 2YGYA 4JFSA 2VCCA 1IQ8A 4AZHA 3SO7A 3B0UX 2V3GA 5HJXA 4RX0A 1NFGA 4JDBA 3ITTA 2DFAA 3NO1A 4D6JA 3K5XA 3NQMA 2C7FA 3HGSA 1XBVA 1CBGA 2GJNA 2VX5A 1QW8A 3MP5A 5ABHA 3W88A 1QASA 2YDQA 4LV4A 1XC6A 1J0HA 3BCFA 3FVDA 1OSEA 3VFCA 3DI1A 1EXBA 2VC7A 4ZQRA 3EB3A 3GNXA 2AKJA 3WD3A 4I5XA 5C55A 4PMZA 1GOOA 2PDHA 1FDJA 1XUZA 1GOKA 4HPNA 4NJHA 4B16A 2OVLA 1JFHA 4UUIA 2FZMA 5CJMA 4A3YA 4N7QA 4WXYA 1TX0A 4O54A 2Y4SA 1DIEA 2WZMA 1SZEA 1P4CA 5LIXX 3O9NA 4D1IA 1YIXA 2W6RA 1QTWA 3DHDA 3C3NA 3EWYA 3PPHA 3TLLA 4C6CA 3ZR6A 3TTEA 1A5SA 4ZSUA 1JCLA 4ALDA 1OFRA 3CAQA 1K8XA 2G4JA 1PYFA 2GOKA 2Y8VA 3CL6A 2VMFA 3LNPA 3EA3A 2CKRA 3QFWA 4MG4A 3M5ZA 1R3SA 1PKYA 3UXLA 2QT3A 2EAWA 5LXXA 1XC4A 3WBWA 2XFYA 5M2FX 3GM8A 3L4VA 3P82A 1M3UA 4NZ1A 3GTNA 3BG9A 4DB7A 1UWAA 4MZ8A 3G6MA 5HANA 3MDWA 4DX3A 1JZ7A 3R6IA 4HHMA 4IL2A 4M82A 1YNYA 1EDQA 3CL7A 1OD8A 1J5TA 4OECA 3NQBA 4F8XA 4WGXA 2B81A 2JGQA 2WQPA 3NA8A 3WFAA 3GHTA 3MKCA 5FEZA 3TE9A 3VOGA 3HQOA 4CD5A 3CQKA 2ZZ4A 3EB4A 2GL5A 1Y5VA 2DUXA 2DSWA 3G3DA 3UJEA 1EX1A 3KX6A 4NZ3A 2ZUWA 1A5CA 2R1MA 5AOUA 2VTFA 1HO4A 4LC8A 4P7RA 3WNKA 3VYLA 3W7OA 1GQNA 1IT8A 5G4HC 5HMFA 4W7WA 1XDJA 4EX4A 4M6UA 4ZO6A 4DJED 3PUGA 1T40A 1L6WA 4R7JA 4MWAD 4C65A 2RFGA 4WRHA 3B0YA 2VZOA 1D9EA 2PA6A 2PF0A 2EPHA 4M56A 2VOTA 3GDMA 3TYDA 4O57A 3ANUA 2JF7A 5DRCA 3K4AA 5F7UA 2A79A 2E67A 3WQ8A 1WZAA 3FEMA 4PTWA 4YTRA 3GVWA 3WCZA 5FJJA 2F7FA 2QF8A 4PCSA 1PEZA 5AC4A 1EZWA 4H6KA 1S46A 5CC3A 3KS5A 1ZY9A 1VEPA 4UTWC 3P2VA 3T2OA 2ABAA 3IIVA 3VNLA 3OODA 1M41A 3GD6A 4MB4A 2DDXA 2O9RA 1IV8A 4E2DA 4JFUA 1XCXA 3S0CA 2HPIA 4E4FA 5CKSA 4FF7A 2NWSA 1QI4A 1DL3A 2DSVA 4DXKA 2Q02A 3NDOA 1VHCA 2WVSA 1GPWA 1LWIA 3E0IA 4FA3A 1E72M 3CM4A 1WDSA 4DNHA 4AXKA 3MP4A 4FX7A 1BFNA 4C7DA 1LP6A 4PFHA 1EWDA 2QUMA 4M24A 3DG6A 1YHTA 1B5TA 4HGXA 2ZOXA 4QCEA 2XH7A 3URQA 5AOPA 3WQ6A 2FGBA 1TQJA 2RH9A 1RZMA 1O1HA 4AH7A 1AH4A 4HOZA 4IQEA 2OB3A 2Q01A 1YDNA 3OYZA 5I24A 3BW3A 2NQLA 1E6RA 1R8LA 1GVIA 2PLCA 1DEDA 3TZFA 4N9EA 1SJBA 3FFSA 4H6EA 1F4HA 3BJTA 4FLRA 3WLMA 5BZAA 1LG1A 2YB4A 4FMVA 3WLKX 4J3SA 1KV8A 1QI5A 3IUIA 1CI1A 2V6AA 3T8QA 5D38A 1W3JA 1KCLA 1MXGA 4R27A 3BWWA 4ASTA 4QCFA 3KE0A 1XH1A 3S1VA 2GGGA 2F6KA 1FWTA 2J7HA 4PUEA 2YBUA 3R7MA 2J6XA 1VCVA 1B3VA 2OG9A 1RP8A 5MKGA 2E4TA 1FWRA 4AZ7A 4LRSA 3K1DA 4OWGA 5M17A 4Z42C 1VFSA 3LGDA 3DFOA 3NVDA 4TU1A 1EKOA 2GWNA 3CQIA 3DECA 3GTXA 1IHIA 2ACQA 1Q6RA 4Y2WA 4OHQA 4IIEA 2EPLX 3RILA 2QZRA 2V81A 1KXHA 3OHMB 3L7RA 3SCNA 1MO0A 2PLMA 1ITUA 3RU8X 2GGEA 2X05A 3FDGA 4S2BA 1SFLA 4QQUA 4IMEA 1GYLA 4GRSA 4DZ5A 3TONA 4CEXC 1UC5A 1WXYA 5CZJA 3F1QA 4JTUA 1GJWA 3MMAA 2QXWA 5DF0A 1HKMA 4Y96A 4ZMGA 3WIJA 3MTWA 3CGTA 3H12A 4HMDA 1A0CA 2QJHA 3DHFA 3SJNA 4WR3A 3AMDA 1RCXB 1WDRA 3DC0A 2AAAA 4PYSA 4US5D 1VGAA 1BWKA 4DYJA 1W1A1 3CWHA 5E5CA 3WLJA 4Q8TA 2UWFA 3OR2A 3AMLA 3SCRA 4FLSA 4J3TA 1HG3A 4K37A 3NXLA 4AYSA 4DWSC 1MW0A 1FFQA 3BVJA 1KXQA 4E3TA 3WQWA 1REQB 4LRTA 3NZ1A 4KEMA 2OKTA 1TV4A 3SCPA 3C2OA 5D05A 3UWWA 2HK1A 1K6WA 5HMDA 4EOUA 4AMCA 2PBGA 3N15A 3MSYA 4PB4A 1DIKA 3VE7A 2X30A 3EKLA 5CBBA 1SO5A 3QR3A 4EAYA 3DHUA 1TJ0A 3W00A 1NIUA 1ZGDA 3SY1A 2UV8G 4CNNA 1QPKA 2HK0A 1KB3A 1AODA 5F1VA 3ZS4A 2D69A 2BHUA 5JBDA 1XQLA 3NM1A 5E1QA 3W1NA 2IQTA 1F73A 4HMCA 4EF8A 4KCUA