2Y0OA

The structure of a d-lyxose isomerase from the sigmab regulon of bacillus subtilis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
171
structure length
171
Chain Sequence
GITKEEVNSYYQKAGIVLTDEEVDQIQLMDYGLGKERKVGLQLFVYVNTDRYCSKELVLFPGQTCPEHRHPPVDGQEGKQETFRCRYGKVYLYVEGEKTPLPKVLPPQEDREHYTVWHEIELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHDIFTDPRILEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE D-LYXOSE KETOL-ISOMERASE
publication title The Structure of a D-Lyxose Isomerase from the Sigmab Regulon of Bacillus Subtilis
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Isomerase
total genus 51
structure length 171
sequence length 171
ec nomenclature ec 5.3.1.15: D-lyxose ketol-isomerase.
pdb deposition date 2010-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2y0oA00
3KGZA 4X6RB 4IEQA 3USSA 1V70A 4EV0A 1O7FA 2VQAA 1ZZ8A 2ZCWA 3SCHA 3OD0A 1TQ5A 3ZDSA 3S0MA 4HMZA 1ZVFA 1SEFA 5CADA 1DGWA 1UD1A 2Q30A 4YYOA 2PTMA 1Q43A 4OFGA 1J1LA 3LOIA 2PFWA 5KHHA 2FQPA 4O9GA 1FI2A 1RC6A 5KHJA 1X82A 4KU7A 3QOPA 4EROA 3MZHA 5FQ0A 3NJZA 1FT9A 1X7NA 1H1IA 2BNOA 2XLGA 4QGNA 4AVAA 3KCCA 4I01A 4HVOA 2IXJA 5BUVA 1O3TA 4Z07A 4MX3A 3B02A 3BPZA 2OZJA 4I3PA 4XF3A 2I45A 3KSCA 4IEVA 2IXIA 3M70A 4CYDA 1CAXA 1LKNA 1PM7A 2XL9A 4Q29A 1Q3EA 5JAXA 4J1XA 1LRHA 4Q0UA 4R8HA 2FMYA 2XKPA 4RD7A 3U0ZA 2VECA 1WGPA 1SQ4A 2BYVE 2GC1A 5I8YA 1J58A 4Q0SA 3S7IA 2PHDA 4FT8A 1ZRRA 3QACA 2O8QA 3LWCA 5FDBA 1XE7A 3IBMA 4R52A 3IWZA 2QJVA 1ZNPA 3U10A 4JTOA 3H3UA 4FAHA 3HT2A 3OGJA 3ES4A 3PNAA 2IXCA 1UCXA 3NL1A 4Z82A 2E9QA 4UBGA 3SXWA 1YFWA 3UKTA 4X6QB 2IXHA 2QCSB 5J7MA 1X8EA 1YFYA 1YUDA 1O3SA 2XL7A 1NZCA 2IC1A 4JV4A 4QMAA 2BNMA 2Q1ZB 1FXZA 3FZ3A 2CGPA 2O1QA 4PJYA 5D1IA 4XFCA 3ST7A 2GAUA 2QVSB 3CEWA 2WFPA 4QGLA 1PMIA 4HN1A 2KXLA 2Q4SA 2OA2A 2B9UA 2P17A 3H7YA 2MPFA 4F8AA 5FLIA 3BU7A 3CO2A 3DV8A 1J3QA 3CJXA 3E5XA 4XF9A 3RYPA 4AQ2A 3RPQA 1ZRDA 1CGPA 5FLHA 3E6CC 1HW5A 1ZZ9A 2B8MA 4FBFA 1RTVA 1CX4A 2GU9A 4JVAA 4L11A 4NVPA 5I0UA 4WZCA 5I8TA 3C3VA 4OLLA 2K9ZA 4KL1A 5KHKA 4LLOA 3LA7A 4YRDA 4ZU5A 1YWKA 1O3QA 3TNPB 4BIFA 3H1MA 4HN0A 3ACLA 3RDIA 2OPKA 3E5UA 1CAWB 3CL1A 2UYBA 4LULA 5EFUA 5JCTA 5KHGA 2EAAA 3IIAA 1ZZ6A 4YARA 3I7DA 3I59A 1YLLA 4I0BA 1J59A 4XFBA 4ZU7A 2ET1A 1XRUA 4MGYE 4XF4A 1VP6A 2PAKA 4IETA 4META 4N9HA 4GULA 4IEUA 4AQ6A 2GZWA 3SMHA 1VJ2A 3KGLA 2H6CA 4HSJA 2ZKLA 3BB6A 4BYYA 2K0GA 3ES1A 5LRSA 1CAVB 5LEKA 5EZWA 4IEYA 4ORFA 4AVCA 2WC2A 1U12A 3OF1A 4IEOA 2Z2SB 4IEPA 1OI6A 4D7SA 3E6DA 1EYBA 4LA2A 1ZZBA 1XE8A 2BGCA 4FAGA 1JUHA 2GC2A 4XF0A 1Y3TA 3UKVA 4AVBA 4MGIE 2Z69A 4KWLA 2GC0A 1VR3A 3IDCB 3E97A 2GC3A 3O14A 4DINB 5FPXA 2B5HA 4MH0E 2CAUA 2BNNA 2Q0AA 4I0AA 5FPZA 1ZRFA 3EO6A 5LRRA 3I54A 2D5FA 5FCCA 2V09A 3LA2A 2ATFA 5I8SA 4D7TA 3HT1A 3LZZA 5BPXA 4E2QA 5I91A 2BEOA 5JSRA 5JSOA 2UY8A 4XFHA 4IERA 3HIFA 3LAGA 4IESA 3FE5A 1ZZCA 5F1RA 3FFQA 1CAUB 1GQGA 1UW8A 1X8MA 4XFGA 3H1YA 4QXKA 4XEZA 1UIJA 5E1RA 3NKTA 3SCGA 3EBRA 4IEWA 1L3JA 1NXMA 3KMHA 4MV2A 1QY4A 3FJSA 4EWDA 4Q0QA 1EP0A 3FX3A 4MGZE 1RL3A 1UPIA 2QNKA 3VHRA 2ET7A 1YFUA 3EJKA 4MUVA 4BH9A 4IEXA 3RZZA 1RUOA 2XLFA 2EVXA 2CAVA 2PQQA 4ZU4A 3EHKA 1WA4A 3SHRA 1ZREA 3BCWA 2VPVA 4QX5A 3CLPA 4HZFA 4MZUA 1I6XA 2F4PA 5T3NA 2XLAA 3BALA 3WW3A 4H7LA 4QGMA 1O3RA 5KBFA 1QXRA 4QM8A 3SCFA 2DCTA 3RYRA 3DN7A 4E2SA 5FQ0B 3RNSA 2EA7A 1Y9QA 1WLTA 4XFFA 3H8UA 4EWAA 4XF1A 4LEJA 2D93A 1LR5A 5I0RA 1O4TA 4UBHA 5AVPA 3HQXA 5HI0A 2ETEA 3H3ZA 4YNIA 4LUMA 3ETQA 1ZZ7A 2PA7A 3G7DA 4HLTA 1NYWA 3S7EA 1CAXB 4I09A 1O5LA 5K8SA 2GH2A 2QDRA 5JSPA 1NE6A 4HSLA 1OFNA 4HBNA 4IEZA 2OYZA 5E16A 2C0ZA 3WW1A 3JZVA 2OZ6A 2MNGA 5BXXA 3NSTA 1CAWA 2H6BA 2XGXA 4Q0VA 4QM9A 4WBBA 2CV6A 1J3PA 1QWRA 3D82A 4JTNA 4PIXA 3D0JA 3ELNA 4MGKE 1RUNA 3M3IA 3EQEA 4L2NA 1LB2A 4BHPA 3UKNA 2H0VA 2UY9A 2UYAA 4PIYA 4LTAA 5LEJA 4EWEA 4E2GA 2IXKA 2D40A 2PAEA 4PIZA 2Y0OA 3WW4A 1Q5OA 5KHIA 5BV6A 3E6BA 5C8WA 1RGSA 3MPBA 1CAVA 3NVCA 4O9EA 1OD5A 4N9IA 3GBFA 4KWJA 4HVRA 5JR7B 4YSFA 4F7ZA 2IXLA 1SFNA 3D0SA 1DGRA 1DZTA 1YFXA 3ROUA 4AXOA 3FHIB 4I2OA 1DZRA 4I02A 1J3RA 3H1WA 1OMIA 2D5HA 2HJIA 4A2UA 5J3UA 1QXJA 4XFIA 5C6CA 3H7JA 3IDBB 3MDPA 1NE4A 1O5UA 5J48A 4HVQA 3MYXA 4K8FA 5I0SA 3H9AA 4P9GA 3FWEA 5I0TA 4WVZA 2N7GA 3DL3A 5BY5A 4LUKA 3GYDA 4UXAA 3OCPA 3R6SA 1GQHA 2XKOA 5I93A 3U11A 2MHFA 3N4MA 4KU8A 2PHLA 3H50A 3PLQA 1I5ZA 2XHKA 4ONUA 1ZX5A 2HKXA 3L2HA 4J1WA 4Q0PA 3TNQA 1UIKA 3E5QA 4B29A 4LA3A 3OTFA 4KWKA 3WW2A 1ZRCA 3RYKA 5CU1A 1CAUA 3PVBB 3CF6E 2PAMA 1G6NA 1EPZA 1YHFA 3I59B 4XETA 1EY2A 3DKWA 2PYTA 1IPJA 5FLJA 1IPKA 3LA3A 1H1MA 4XFAA 4TLFA 5CVRA 3NW4A
chains in the Genus database with same CATH superfamily
2GN3A 2VCCA 4QB1A 5FUIA 3KVAA 4GIQA 2D3PA 2A6XA 3LQCA 3MFAA 5C8CA 2H0BA 4YZ4A 4Q2FA 1I9RA 4RSUA 3ZO0B 4XIOA 1AZDA 4HMZA 2BUKA 4YFWA 2YUEA 4GALA 3GHNA 2LTNA 4FXKB 5JXHA 3DKQA 1DGWX 1UYXA 1AHSA 1H1AA 2G9GA 4CSWA 4MGTA 1J1LA 2WO3A 2WNOA 3NJXA 2AEYA 3THPA 5FXXA 2BPA2 1S0DA 2BGPA 4CEWA 1RUC2 1W9FA 1LNSA 2HBUA 3POWA 3ZYRA 4CP9B 2JJ6A 1VBE1 2FQPA 3VBHA 2R063 1G9DA 1RC6A 4GB31 1QQP3 5DUUA 4PCRA 2BVVA 3WDVA 1GWKA 4KU7A 1MQTB 3WINE 5JI9A 1XNDA 3AZWA 1WMDA 4AEDC 4CDQC 4TTGA 1J1TA 1ULEA 4RR3B 4UFIA 3WNKA 1UU5A 2KD7A 1R081 4HK9A 5LCWL 3VB9A 1FT9A 4HG6B 3PU8A 1H1IA 1N47A 2BNOA 3MF9A 4AVAA 3KCCA 3K77A 1CZTA 4E4HA 4MO3M 2ZACA 4OQ8A 3BVCA 4Q4W1 4HVOA 1QJX3 1KS5A 4YM2A 4Z07A 2XWJB 5IVCA 4LITA 4NPLA 4XBQA 3RI8A 1UXXX 4Z92B 3N7KA 3P1IA 2OZJA 2R6QA 1MS5A 4RA0A 1RUD2 2EXHA 3KSCA 1E5SA 1FOD2 1DGLA 4R9AA 5IK7A 1AUYA 2ZZJA 4CYDA 1K42A 3TEXA 1LEDA 1LKNA 1PM7A 2XL9A 2VH9A 4Q29A 1GZCA 2XJVA 5A3UA 2CHHA 4Q0UA 5FY9A 4KWUA 1AYN3 1UOJA 4LBNA 5FPUA 3I4IA 4NWWA 4BDVB 3SISA 1JYVA 1F9KA 1LHOA 1SQ4A 5DPNA 1AX0A 2R1DA 3ZYJB 2FDIA 2EAKA 5EHDA 1VBC3 2G4IA 5D8AA 4FT8A 2A3XA 4NMIA 1YYNA 4WZFA 4YGCA 1IG3A 3M3CA 4Q8LA 4LHKA 4YW4A 5FDBA 4FXGB 1FATA 3VBSB 2DCZA 3I3DA 5FYIA 3WVJA 4D6QA 4NPRA 2GH8A 4QKFA 5FOBB 5FK7A 1PZ7A 2R0HA 1BQPA 1TMF2 3U10A 5L36A 2W1UA 3RZHA 5IATA 4KBBA 2WSUA 4QDRA 1AX2A 1IQAA 1O4YA 1FAYA 4QX8A 4AG4A 4AHZA 2VO5A 3CBNA 4TLGA 5DG2A 3VD5A 4D3WA 2RR11 2LUWA 4YGBA 5FPAA 1YFWA 1XJAA 4MVTA 1QDCA 3UKTA 4U36A 4P5YA 2IXHA 3U78A 2QCSB 4QPWA 2CNAA 5J7MA 1JHJA 1NA1B 3MLLA 4LE3A 1V6LA 1NCRA 3F2ZA 1MEC3 1O3SA 4M3CB 3RMYA 4CA9A 1NX9A 3HOBA 2D6NA 4JV4A 2YZ4A 2ZGNA 3N36A 4OULA 3TWIA 2BNMA 3ZXAC 1MR5A 5A32A 5HXMA 3FZ3A 1W8NA 2XJPA 3PUAA 1PX4A 5D1IA 1O59A 3ZSMA 1JZ2A 2QQNA 4G9SB 3KT7A 2AUYA 2WKKA 2WNUA 4XTPA 5HXVA 1W05A 4OYUA 4OI1A 4S2DA 2WFPA 3KV6A 4QGLA 2VJXA 1PMIA 4HN1A 4UOJA 2E6VA 2FDKA 1UO9A 2XUMA 1L7QA 1KITA 1AR83 2FBEA 2B9UA 4AI0A 4QU1A 1I1EA 1RB8G 2MPFA 2XXZA 3QBQA 1IKPA 1OC1A 4EJRA 1JUIA 1K12A 5FYYA 2PXJA 4PQQA 4A42A 2JB8A 4QX3A 2X10A 1J3QA 1TEIA 3E5XA 2RM22 3RYPA 1PO22 2VBBA 4HFSA 1A6CA 1IGOA 3A7QA 3LIHA 2HBTA 2AC1A 3O1RA 1F4AA 5K0UC 1CGPA 4PF1A 3B00A 3N3HA 3LPFA 4XCAA 5F37A 1FPN2 5FP7A 2R072 1GP4A 4L11A 2BWAA 4J6GA 1MZEA 2VVFA 4NUBA 4PDWC 3BIEA 4SLIA 3C3VA 3VKOA 3J8F2 4QQHA 3N35A 1HB3A 2ILMA 4OLLA 5KHKA 5B4XA 3JU9A 1LGCA 2KM2A 1C1FA 1NLSA 1PIV2 1O3QA 3INAA 1BBT3 1TME1 3L2YA 4BIFA 3ACLA 3ATGA 5GZFA 1WUVA 1W9SA 3EXUA 3MLKA 3ZSEA 3PDQA 1S0GA 3WF0A 4COVA 2HWB2 5A1AA 3AP5A 4IV3A 1VPHA 1RINA 2HWD2 1CR7A 2VTFA 2BBVA 2UYBA 3ZM8A 5FJHA 2QQJA 3WUDA 2B9VA 3D5OA 4TN7A 3IIAA 4YARA 1ALYA 2CDOA 2RDQA 3I97A 2YU1A 2A6VA 2IZWA 2J42A 3LFMA 2WL1A 4FTEA 4AEDA 5IFTA 5HCFA 2VZTA 3NAPB 4I0BA 4MXWB 3T4HB 4K9SA 3VZOA 3AZZA 4RHV3 4A6SA 5IFPA 4NN0A 5APAA 1HRI3 3VZKA 4XF4A 3T2QA 1ULGA 3SQOA 1VMJA 2JENA 4OZXA 1C1LA 1TVGA 4IETA 3SC7X 5H9QA 1UZVA 1MVEA 5F5CA 4AQ6A 3LOBA 3LDRA 4FI9A 1JODA 4Y1UA 1CIWA 2E51A 3K3OA 1AL23 3VBFC 3IAPA 3GGLA 2JICA 1R092 5L9BA 4ET7A 1N3QA 3IKWA 3ZXGA 4A7ZA 4K7JA 1RUI3 4Q1PA 3IZOA 1RUH3 2RVAA 3ZIWA 4CDUC 2NZ9A 3GHMA 2VQ0A 2Z2SB 5E88A 4NHYA 3T30A 3WDXA 2LROA 3V56A 3WZ1A 3TRSB 3O1TA 4V2WA 1V6IA 1XE0A 1ONAA 1EYBA 2BFUS 2FDHA 1QJY1 1SBDA 1VBA1 1WD4A 3WF2A 1S0CA 1XE8A 4BQ4A 4FAGA 2GC2A 1EUTA 1AR62 4LKFA 4AFAA 4KWLA 2GC0A 1EUUA 3T2OA 2Q8DA 3IDCB 4O61A 3N9OA 3E97A 2G9ZA 5BNPB 4FFGA 4LBLA 3ZYGA 3VBOB 2C6SA 2YC4A 1V6KA 2B5HA 4BQ1A 2RMU2 2VBPA 5L7OA 5FPLA 3CHXA 2WFF2 4AW7A 2ARBA 5IT6A 4IE0A 2XVLA 2ZHNA 3GCXA 3AYAA 3CQOA 4FPKA 3ME2A 5JMOA 2BNNA 3ZKYA 2WA3A 1RUC3 1ZRFA 1QGLA 1Q8OA 2HEWF 2ZGTA 4IV1A 4ZY9A 2D5FA 5FCCA 1STMA 1V6NA 1JI6A 2V09A 5IUQA 2DUPA 2CWMA 2RE9A 5DG1A 4D7TA 5BPXA 2BEOA 5JSRA 2FCVA 5EJ1B 1R1ZA 2QQWA 2DBIA 4E9KA 3KB5A 4CDXC 1X9PA 1LHUA 2E7QA 4PBOA 3K4AA 3C7OA 5LBCA 1FX5A 3HIFA 4GWJA 4K3UA 1UF2C 4IESA 3FE5A 5F1RA 3KV9A 2JG9C 4L97A 2VZQA 2Y64A 1E5HA 1LGBA 1CAUB 3MUY1 3THTA 3WOGA 4BMEA 1RUF1 1S0JA 2Q8OA 4XABA 4UFKA 5FY1A 2B7YA 1F15A 3WG2A 3M2MA 3LDBA 1W3VA 3OEBA 1RUD3 1BEV2 1RITA 1V9U1 3LEIA 2ZBJA 1FOD3 1OOPB 3EBRA 3MHZA 3NKTA 3SCGA 3O1MA 4MV2A 5FMOS 3USUB 1QY4A 4F83A 5E89A 3WNOA 1JXNA 1UY4A 2RS31 4Y1XA 1HIXA 4A41A 1E5IA 1MS4A 4GMP0 1HKDA 2W1WA 4CPBD 5J98B 1QOOA 3SEPA 4MGZE 2E26A 4AQSA 1MZFA 1RL3A 3B9IA 1GZTA 4O65A 4RGAA 4G3YC 3MW3A 4CP0A 3OG2A 5C8CB 2YBKA 2QQLA 2TBVA 3AXDA 2ZGPA 4MLOA 4BH9A 4LE4A 4JDMA 1BZWA 4ZU4A 1BYHA 2CAVA 3I3QA 4LBKA 5A7OA 4PDWA 4BM8A 2CWSA 5FZ9A 1UMHA 2VM9A 5CFDC 3BCWA 1SCSA 2PHTA 2J1AA 2VPVA 4XHBA 1VAKA 4HZFA 3VBUA 1OVSA 1OUXA 5T3NA 4CU6A 5JOWA 1KD7A 2XJTA 4CEWB 2VOTA 1O3RA 3UJQA 1REDA 4QQLA 3VBHB 1AVBA 2DCTA 3RYRA 5C4WC 1S2EA 4E2SA 2Y33A 1FYUA 4XDQA 3SITA 5ACA2 1S0BA 5GLVA 2B4KA 1DYOA 3RNSA 2X29A 2EA7A 1R1A2 4DUVA 3SLIA 5ISLA 1VRH2 1WLTA 4XFFA 3H8UA 5GZEA 2DBNA 3CU7A 1HJFA 4FQZA 2OX0A 1G86A 1L7LA 1LR5A 4QX0A 1MS9A 1O4TA 1WWYA 4PHZA 2DFBA 1YXWA 3HNMA 3H3ZA 4YNIA 3MIDA 3FLTA 1Y4WA 3G7DA 2YY1A 4HLTA 2QBXA 3R4UA 3VBFA 3CNAA 5LA0A 1O5LA 2PHWA 1MS3A 2Y6GA 2ZTNA 3AKSA 4FPFA 4YG3A 4HSLA 5E16A 3K48A 4CDUA 5AFBA 3JZVA 2YROA 5CFCA 3O1OA 1NY71 1ULOA 2DVAA 2A3WA 3NJVA 4FPGA 5L73A 4EZ4A 4YZ5A 2QZ2A 2H6BA 5K9YA 1WLWA 3MFCA 5D8AB 4MYEA 1QWRA 3D82A 3NMBA 4OMCA 4P9WA 2RM23 4PIXA 3LPGA 1PO23 3CMGA 4XAAA 5H9PA 3VD7A 3M3IA 5DAWA 4H55A 1JH5A 1QXPA 1ZBE2 3N9PA 1PIV1 2ZGOA 1O8PA 4P9YA 4BHPA 1RUG3 3HN3A 2C5DA 2H0VA 1O4ZA 3NNMA 1FPN3 2W39A 4WM8C 4AI2A 5SV8A 2R073 3NAPC 4LKDA 4E2GA 4MOAA 2IXKA 1GMMA 3EYPA 1NCQB 1W2TA 2J1RA 1UMZA 4FTSA 5BV6A 1UKRA 3E6BA 1ULCA 4YW6A 4QXBA 1H2MA 2C9AA 2R042 4PI2A 5A70A 2HWB3 4WVMA 5IAVA 3ZYIB 2HWD3 2FZ2A 1CAVA 1HN1A 1QDOA 1U5XA 4O9EA 1QJU3 4QQPA 3J7MA 5GM0A 1ZA7A 1XPWA 3NNLA 1NCRB 4KWJA 4Q1RA 1ENSA 3LGRA 3PMEA 4YSFA 4E8CA 5G05L 4L92A 1VIWB 3T2TA 2JWPA 2WS92 1W03A 4DXSA 1DGRA 1YEWA 5C3QA 4LPLA 3HMYA 4P9LA 1RVF2 3ZMOA 5FY5A 4I2OA 3B5LB 2ARAA 5KXBA 2BDRA 4CDXA 1J3RA 4P08A 4Q4Y3 4A2UA 2WNUB 1BK1A 4LIUA 1JOPA 2WT2A 1ZM1A 5KXDA 3QCWA 2W9XA 3H7JA 3WLUA 3AYEA 1IOAA 4IDZA 1POQA 4XJ9A 4CTEA 1VMFA 3TEWA 1ULFA 4Q4X1 4LHSA 2WIIB 2JX9A 1UMIA 2VVEA 2ZKNA 3WNPA 3ZYPA 3PL0A 1Y9GA 4AQTA 1D2SA 4K8FA 3M3OA 1GANA 1GWLA 4YG6A 3H9AA 3ZXDA 1JYIA 4OI0A 4MHRA 2BFUL 3AMQA 3DL3A 5BY5A 2VUAA 5FYMA 2YG0A 1SLLA 2Z79A 3H8XA 4UXAA 4DUXA 5CBLA 3OCPA 3GZUC 2VTXJ 2JDNA 2VZRA 3R6SA 5E6HA 5FJKA 5FY4A 5I93A 3U11A 3N4MA 1COV3 4FFFA 4K1ZA 3VGIA 3H50A 2JXAA 5FKBA 3B01A 1UYYA 5EYXA 2OW4A 2ENRA 1AR63 3PLQA 1XOYA 1C28A 1SFYA 2VBDA 1VBE2 2BV4A 4A7YA 5IAXA 3C7FA 3GXUA 3ZVXA 1GBGA 2A6WA 2NM1A 2X53S 3BYWA 3L2HA 4GB32 4LORA 1CIYA 2GNBA 3O5SA 4A4AA 3HBZA 5CISA 3TNQA 3VZMA 3VDDA 3OJBA 3OTFA 4LA3A 4QPIC 3PVOA 4IV3B 1R082 2AREA 3BU0A 4XHXA 3V65A 2RMU3 2LM3A 2ZHLA 1RYYA 4GKYA 5JXJA 2PAMA 2WFF3 4Q4W2 1DU3D 1G6NA 1WCUA 4RS5C 3CIHA 5F2SA 5T5LA 4AEDB 1BMV1 1F8VA 1PX3A 1W2UA 2PYTA 3DKWA 4W6YA 2VNRA 4FVVA 5FYHA 1WW5A 3MV01 1EPWA 2J1TA 3RGBA 1OPMA 3RQ0A 4AF9A 3GBWA 3LA3A 1H1MA 3MICA 2ZS6B 1Q8QA 4YVWA 3NW4A 4D94A 3KGZA 4XZPA 4DZGA 4Z8BA 1RMU1 1AX1A 4IEQA 1QH6A 2CGNA 1DGRN 1V70A 2EICA 5KR7A 1H8VA 1OQ1A 3T1LA 1AXZA 1ZZ8A 2NMNA 1REFA 3LEMA 2GMMA 1TQ5A 4BQ2A 3MW4A 1GNYA 3DYMA 5GLWA 3S0MA 5C8CC 1ZVFA 1G9CA 3ACHA 3WX5A 2VZPA 1UD1A 4PI0A 4CPBA 5CADA 4YYOA 1VRBA 1XNCA 5FMOL 5LB6A 4B1LA 2PTMA 4LBOA 4RGGA 4OFGA 2I2SA 4XMIA 1HLCA 5GZDA 3FLPA 2PFWA 4ZS2A 5FZOA 3HAGA 5T5OA 4HT1T 4RL7A 3B3QE 1W8ZA 1IQDC 4OHVA 4CVUA 3ORJA 4DMIA 3PURA 1LCLA 3QOPA 3C7HA 3M3EA 3VBHC 5GZCA 2VXJA 3MZHA 1ZBA3 4UFJA 5A3PA 1DQ1A 3NJZA 1VBD1 5F3GA 2RJ2A 5DZGA 1G8WA 4PT6A 4WM8A 4QGNA 2RR12 2W46A 4I01A 2IVIB 3P3PA 1W9TA 5BUVA 4GJYA 1OH4A 2VMDA 3IM0A 2PHUA 5L7OB 1RJ7A 2XQRA 2ZEYA 3ZN6A 4YG0A 4I3PA 4XF3A 2FDFA 3MF6A 1W0PA 2IXIA 4IEVA 4AI3A 3KHBA 5JAXA 4J1XA 5A3MA 4UF0A 2WZR2 4QXCA 1LRHA 3TAYA 3RMXA 4CCNA 1H0BA 2Y26A 5LBBA 5ACA3 2VECA 2KA3A 1B09A 4RGKA 4OHZA 1A3KA 4CUAA 1J58A 1R1A3 1WMEA 4Q0SA 4QXHA 2PHDA 4LBQD 1VRH3 3S7IA 2JD4A 4CDWA 4BJ0A 3KZ4C 2SLIA 5IK5A 4RQPA 1W8HA 2ZOEB 1EAH1 1M06G 3R4DB 2ZEZA 5B2GB 3B7MA 4FSJA 3RJ2X 4K21A 5DAXA 3IBMA 1K5JA 1WW6A 4A3XA 4R52A 2UWAA 3NNFA 1GKBA 2QJVA 2VW1A 2G1MA 3O1PA 3H3UA 3IAQA 1W2OA 3HT2A 5IYYA 4GH4C 2ORZA 3U4SA 5DABA 5CG9A 4DEQA 4L8QA 5FOJB 4BWOA 1XU1A 4IQPA 2JEMA 3KF3A 1F5FA 4UBGA 3ZFFA 1H2KA 3AZVA 1E57A 3BI3A 1C8M3 1OFSA 1OQEA 1WA6X 1WCSA 2JIGA 3CJIC 4X6QB 3I2OA 3NNGA 2WQ4A 1TME2 2CU5A 2BZDA 2DURA 3ACIA 1OA4A 5CIRA 3SH4A 1XBFA 1IS5A 4OCTA 4PDWB 5BNNC 2IC1A 4C8DA 2AEZA 3HNYM 4XUNA 3C2UA 4LKSA 2PN5A 4XMAA 1FXZA 5T50A 1VBB1 1H2NA 4BB3A 3ZFGA 4PJYA 1XYPA 3UT0A 4Y26A 2QTWB 2PLV1 4XFCA 4QPIA 3DYOA 2R0FA 1W28A 4ATFA 3BOPA 1LESA 2HWC3 4UWDA 3LCPA 5IK8A 1PNFA 2R043 2Q4SA 4RS5A 4DUWA 1RUE2 2OA2A 2JE8A 3H7YA 3SKVA 2ZMKA 1MZ5A 4AEJA 3UETA 4LBMA 1OURA 4M4PA 2J22A 2C9KA 1AR73 3AXEA 3BU7A 1UX7A 3ZXEA 1OVPA 2E63A 4FOQA 5BNOA 4AQ2A 3AMMA 1JU3A 2RDSA 2VGDA 1IZ3A 1HV1A 2WS93 5SV5A 2UU8A 4OHWA 5FLHA 3E6CC 1H30A 2OIIA 2Q5TA 2Q1MA 2ZEWA 1SLTA 2GU9A 4JVAA 4ES8A 1DCSA 4QPGA 4WZCA 5I8TA 2A73B 3KWVA 3VBFB 1JZ3A 4KL1A 1US2A 1QJY2 4LLOA 5CAZA 5FYTA 1VBA2 1BVVA 2WO1A 3H1MA 4JHTA 1FMD3 4QQ2A 5A7WA 4DB5A 4CDUB 1RUJ1 2BGOA 1UAIA 3E5UA 4PLMA 1H4HA 2OXBA 1S1AA 3NKGA 5EFUA 5JCTA 4WM7A 2EAAA 3S6PA 2TUNA 2JE7A 4IV3C 1ZZ6A 2A7AA 2RG4A 3VL9A 3GZAA 3URFA 1MPXA 5F9TA 1YLLA 5GLUA 3VLBB 4A3ZA 2Y6HA 4B1MA 2FMDA 1J59A 2AR6A 4XFBA 4AVTA 1QF3A 1Q8PA 2ET1A 3ECQA 4HK8A 1VP6A 2WRAA 3FLRA 3NV4A 5A6XA 1H9WA 4OUEA 2MEV3 2PAKA 1JS9A 3AKRA 2YGLA 1VBE3 2GZWA 1POV1 2RS11 3AFKA 3KGLA 3SMHA 5JVVA 4GB33 3K51A 4D6SA 4MHUA 2E32A 2VNOA 3FMGA 3H3LA 3PVNA 2K0GA 3T3YA 1DHKB 3THCA 4WVMB 1QOSA 5LRSA 1CAVB 1R083 5FO8B 2VCAA 5EZWA 5LK7B 4AVCA 4BQ5A 4OQ9A 4FP2A 2OT7A 3FUQA 1OKOA 3VBRA 3ILNA 4I0WB 4Q4W3 3V0AA 4IEOA 4BOWA 2UWCA 4L9BA 2P2KA 1HQNA 1OI6A 2WLPA 5DAPA 4D7SA 1U5IA 1URXA 2ZGLA 3IPVA 4QB2A 1RUF2 2D6KA 4CDXB 2KR2A 2W1SA 3PUSA 3T0AA 4C1XA 4D8MA 2YBPA 1V9U2 4LA2A 2BJSA 3HR9A 2A70A 1BK0A 1JUHA 1D0GA 3AL6A 4UFMA 4Y1ZA 2JG9B 5LBEA 4UW5A 4Y33A 3UKVA 4R9BA 4AVBA 2R1BA 2RS32 4MGIE 4CCDA 4E4SA 4CE8A 4NIHA 1LOAA 2RDRA 2GMPA 3FN9A 4BE3A 3BTXA 2NN8A 1VR3A 4BLIA 2D6LX 4OI4A 3BTZA 3Q8CA 4AGRA 1HXS3 1VBC1 3U37A 4I30A 2GC3A 2OVUA 3OB8A 4GH4A 5FPXA 2NQYA 2ZX0A 4XACA 3ZN4A 5F7UA 3QH6A 4MH0E 1Y9MA 2YPDA 3B69A 5BYNA 2CAUA 4YGEA 5T5PA 1S55A 2XVKA 3OGRA 4AFMA 4NPMA 2E53A 5FYZA 5L7OC 4I0AA 2ZHMA 3EO6A 4XE9A 2X05A 3CJIA 3I54A 1XNTA 2RJLA 2VOKA 4TWTA 5FY8A 5LASA 3VKFC 4BIOA 1GFF2 5FP8A 3H8OA 3KCXA 3KS7A 2JDHA 4IV1C 4IXLA 1QNWA 3TN91 4CU7A 1UYZA 3HT1A 5BNNA 1KJRA 1QH7A 5A7SA 1LEMA 1QNYA 3DUIA 2D6MA 5EXOA 4NRMA 4E27A 4XFHA 1F31A 2RR13 1KDMA 3VDDB 1W06A 3LAGA 1PMJX 4XIKA 1GR3A 1ZZCA 1OBNA 2WR9A 2W68A 4AHYA 1MEC1 1ENXA 1GQGA 2WZR1 3FFQA 1UW8A 1OLME 2K46A 3GJAA 4LLFA 1VLNA 4XJWA 3VUOA 2RDNA 1UYPA 5J09A 5C4WB 1GUIA 4LQRA 3QH7A 4V2VA 3ZR5A 4AEMA 4LBQA 3RZLA 1UQXA 1L3JA 1NXMA 2IWGB 3MEPA 1DYPA 3P5BA 4XZUG 4M0NA 5FZMA 5GJ6A 1AXYA 4LO4B 4IGPA 1T6GC 4PLNA 4IL7A 4YVWB 5IVVA 1NKGA 4B7KA 1BLZA 4Q0QA 4CCKA 3FX3A 1QU0A 3PIJA 1UPIA 4MGSA 2JKXA 4K20A 3VHRA 2VMGA 4EN8B 1RXFA 4TXWA 1HB2A 3SEEA 4AE2A 2OKXA 3EJKA 4MUVA 3RSJA 4HPKB 4HOOA 3RZZA 4HKOA 3WCRA 2EVXA 1I5PA 2J7MA 3AVRA 2VXRA 1NY72 4WV8A 1ND2C 5T54A 1JZ6A 2CGOA 1W8OA 3UGFA 1O91A 4QX5A 1LULA 3CLPA 3M4FA 3U4XA 2W95A 1I6XA 1XNKA 3TEZA 1LHNA 5JOZA 1QJEA 2XLAA 2P3JA 3BALA 3WQ0A 3WW3A 3VBUC 5FZOB 4NIDA 4Q4V3 5ANQA 4QM8A 5HBAA 1ENRA 3WXPA 2OS2A 4NJ4A 4EZHA 1C4RA 2VNVA 4IW3A 1NG0A 1RHI1 3P6BA 3AMPA 1CD3G 2Z4FA 3A23A 3PMSA 5LY2A 5ANNA 4DRVA 1G9BA 1TME3 1VB4A 4LO6B 4WM8B 4UFHA 1DQ5A 3NO8A 4FQ4A 4P00B 3V64A 5CKQA 1AL0G 2BOIA 1W6NA 1GOGA 4M3CF 5FXVA 5FYUA 2V4AA 3Q9OA 1PVC3 3AK0A 2VMIA 3HQXA 3KHCA 3ZN6B 5HCAA 1RUE1 4LUMA 3ETQA 1ZZ7A 2PA7A 1G9AA 4RHV1 2W47A 4FPEA 1OLMA 3S7EA 1OF4A 4I09A 3FL7A 2GH2A 3FHAA 5FZ8A 3JB8A 4QHOA 4UF0B 4HBNA 2C0ZA 5A3LA 2RJKA 2OZ6A 1KXGA 1C3HA 3HD8B 2WWSA 1CESA 4XPVA 2XGXA 1AL21 2VUCA 4QM9A 1GZWA 2XHNA 4RQPB 4CDWB 1J3PA 5CFCC 4Q4X2 2ZZQA 4P9JA 3ELNA 5EWSA 1RUNA 3OSDA 3NV1A 5C3RA 3PUQA 3EQEA 2DVBA 1JYCA 5A7PA 3OBAA 2HWF1 4LTAA 5LEJA 4EWEA 4B4PA 1M4WA 3AP7A 3LF7A 2PAEA 3LSDA 1AYM1 4HKLA 1QJY3 2DFCA 1VBA3 4N7IA 4KG8A 1AXKA 1S0FA 1SMVA 2G19A 2VCBA 4IUGA 3ZFFB 1ST8A 5FZ3A 2P3IA 1W8UA 4H7MA 1D4M1 1YJLA 4AYUA 2WQ8A 2XBO1 3GBFA 4GWNA 5JR7B 4GQ7A 4S2FA 1UOFA 2DCYA 5HCHA 1X36A 4P5HA 4AXOA 1DZTA 3K2OA 3FHQA 1DZRA 1ODNA 3S5QA 1PZ9A 3NQHA 3VV1A 3WD5A 1YQ5A 3ZFGB 4DY5A 2CYFA 2VE1A 3JUUA 3H1WA 1NLRA 5JOXA 1BMV2 4QPIB 2WNEA 1HN0A 3I2IA 2F17A 3C7GA 4XFIA 4Y24A 3ZXKA 3RWKX 2FDGA 1YJKA 3IDBB 3POSA 3A0NA 1O5UA 1CPNA 4XUPA 5J48A 4XDOA 1TE1B 4HVQA 2HLEA 4RS5B 3OEAA 1RMU2 2UWBA 1KFXL 2WUHA 3MYXA 5L9VA 1O8SA 5C9AC 1V00A 3RZMA 2A3YA 5I0SA 2VL4A 2IVJA 3UL2A 2NLRA 4P9GA 3WR0A 2W5FA 2ZGKA 5I0TA 5BNOB 5IK4A 3O1UA 4ASKA 2HWE1 4AI8A 5DQ0A 4R9DA 4YWAA 5HCBA 5F6LB 5DDJ2 3R4SA 5JXGA 2XKOA 2UURA 1OH3A 1YI9A 2MHFA 2WJSA 1V9U3 1UNBA 2BQPA 4BPZA 4ES9A 1NLQA 3A4UA 2YC0A 3B9CA 3B93A 4DNYA 4Y22A 1ND2A 2RS33 1PGL2 1I5ZA 4ONUA 3ZKUA 1PGL1 5FBJA 1ZX5A 2QUOA 3P3NA 3JD71 1LGNA 1KJLA 5A7WB 2GN7A 5JOYA 3K4DA 3E5QA 5FZCA 4B29A 5I0DA 3WW2A 5K4LA 4GD4A 2BRTA 1VBD2 2CL2A 3VDDC 3TB0A 1SLBA 1TMF3 1UU4A 3PVBB 1OA2A 4P14A 1W2AX 3CF6E 5FYBA 4A45A 3HJRA 4NHLA 4COZA 1EPZA 1W39A 1YHFA 4XETA 4DY3A 2V4VA 2VVDA 3AL5A 1DDLA 1WW7A 1ACCA 5FMBA 3GZTB 4N90A 3AC0A 2JDPA 4Y4YA 1OLQA 5FLJA 4XFAA 1N1SA 1B35C 3NV2A 4GJZA 4L0PA 5LBFA 2VQUA 3K4ZA 4LHLA 5FZ4A 5CA6A 1MACA 1RXGA 3KT4A 4XJZA 4QD2A 4YVWC 2NP0A 4NHKA 2XDVA 1A78A 2ZCWA 4GA9A 3SCHA 1IG0A 1UWWA 3ZFEC 1DQ6A 2XG3A 3ACGA 4HL0A 3MW2A 1KDKA 1SEFA 3HN1A 5KC6A 2Q30A 3ACFA 1U5ZA 2YU2A 4KGGA 4XURA 1PK6A 2XB6C 1Q43A 1EAH2 5FR3A 2NMOA 3V0AB 2BOJA 3LOIA 1X33A 5F3IA 2DV9A 3WHTA 4UFLA 1ASJ2 2QE3A 4RYDA 3WQ7A 4O9GA 4LXLA 2ZJCA 1GZ9A 3RZJA 5F6KA 1X82A 3I3EA 1LOGA 1ND3A 4DEVA 1WMFA 3AM2A 4FPYA 2F4LA 4EROA 1JZ5A 3J7NA 4NAOA 3ZYFA 4Z2AA 3D4KA 3UJOA 2EXIA 1DQ0A 5F5QA 3VD9A 4YW3A 5H9SA 4QHZA 3KVBA 2IXJA 3NJYA 4GH4B 1UPSA 4UI9L 3V0BA 1O3TA 3ETPA 4MX3A 2VZSA 3BPZA 3J8F3 4QWNA 3BKZA 3ILFA 4JGYC 3MIGA 1UY3A 2I45A 1SLAA 4KGQA 3M70A 3RFRA 1LOFA 3VKMA 5IVBA 1PIV3 2DUQA 3OOXA 1W2NA 3CJIB 1VBB2 1W90A 4OUSA 1H6XA 2EIDA 2WWUA 4DPNA 4QB6A 1QJZA 5AC92 2IUWA 5LZ6A 4R8HA 1OA3A 2ZPXA 2PLV2 4CCMA 1HRV1 2DCJA 4FCAA 4PLOA 5BNNB 2OQ7A 4C0HA 2GMEA 1WGPA 2QQOA 1JZ7A 2BYVE 2ZX1A 4Y1YA 5I8YA 2VD7A 1UOGA 1NAEA 2W2IA 3WDUA 4JQRA 4RR3A 4ZS3A 3BUCA 1OD3A 1Z7S1 2P3YA 4PBPA 1QJU1 1PVXA 5A32B 4CDWC 2O8QA 3VD3A 3LWCA 4RQPC 3RVHA 3G6JB 3GZEA 4DRRA 3VHOA 3I49A 3K75B 4CUGA 2WQZC 3I2JA 5FZAA 2VZUA 4BK5A 5FV3A 1H6YA 1ZNPA 4FPCA 4FPLA 4JTOA 4LBQB 4YZ3A 1WBLA 3ES4A 4E8DA 5C9AA 5JIAA 1UCXA 1N1TA 2K2SA 3BOWA 3R05A 4Q4Y1 4Z82A 4CXYA 2P6HA 1R093 2P34A 2YFZA 5DUWA 1UOBA 3I2KA 2SBAA 1J83A 1LECA 3ILRA 2B45X 4DIQA 3ZFFC 1REEA 1YUDA 2Q1FA 2D97A 1WW4A 1RUJ2 1WD3A 1JYNA 1YIFA 3AYCA 3AVSA 2W0XA 1JZ8A 5FYSA 3ZLIA 1WCQA 4BMBA 3NRUA 5F3CA 4XW3A 2CGPA 2B42B 5T55A 1E5RA 1DQ4A 2O1QA 4XBLA 2XUEA 1HJGA 4Y1VA 5FAXA 2D3SA 3FFZA 1BXHA 3ZFGC 2GAUA 4NIIA 2JIJA 2QVSB 1COV1 3GBGA 2WA4A 1U5YA 3VL8A 2QZ3A 5HPOA 5A1FA 1G9FA 4MG2A 2KXLA 1CZVA 1V6JA 4JRAA 3J4UH 2P3KA 1DFQA 1N1YA 5FYCA 2ZGSA 1TG7A 4QKDA 2RS12 3POBA 4DQAA 2WSVA 4F8AA 1XYNA 2PELA 2XVGA 3KCYA 5DAQA 2JDMA 1QIQA 3CO2A 1LOEA 3DV8A 4XDPA 4XF9A 1XNAA 4CCCA 1B35A 4B4RA 4YW7A 4L99A 2TNFA 3RZGA 1VAVA 1W6NB 3KLSA 4JDNA 1F2NA 1XXNA 4XCBA 3VZNA 5AFEA 4AR2A 5DZEA 1ZRDA 1HW5A 4YFZA 1ZZ9A 2BVBA 2GP5A 2XJUA 5BNOC 5A7QA 3WNLA 1CX4A 1K45A 4ZXKA 1IKQA 4P9XA 5JXIA 5KXEA 5T52A 3ZFEA 3AMHA 5FMCA 3I2HA 2ADEA 2WT0A 1POV0 3CKHA 4LO7A 4QPGC 5J37A 1XSQA 3KV5A 1SLCA 1GQPA 3AFGA 3LA7A 1YWKA 3LKJA 4ZU5A 3SKJE 3PVEA 3O1SA 4HANA 5FZGA 2YC2A 3MBWA 2JG8C 4FPJA 4HN0A 1Q56A 3O7OA 4WVVA 5LY1A 5DDJ1 5G04L 4XQWA 1PGW1 2Y6KA 2X09A 2XJSA 4GMP1 2Y6JA 5KC5A 1W8TA 3M7AA 4HETA 4N43C 1BEV3 3LEGA 1GZWB 3OUHA 5JI7A 3POEA 5KHGA 3W5NA 1SZBA 2J1UA 4QT6A 1VBC2 4WM7C 3HEIA 2VOVA 2VMHA 4YVSA 3LE0A 4YW2A 1LOBA 2ZGUA 3QD6A 5EJZB 3UGHA 1DYKA 2J1SA 1W6QA 2VZVA 4G4FA 4ZU7A 5LATA 1OHFA 1W9YA 1XRUA 1IHMA 1PMHX 2VR4A 4KNCA 4MGYE 2AH2A 2DWRA 4OZOA 4IE7A 3ZX7A 5LA2A 5FBZA 4META 2ZGRA 4N9HA 3WF1A 4JCKA 2XH6A 1T2XA 2VOWA 1VJ2A 3JCIA 2H6CA 3N9NA 1ZBA1 4CEYA 2YV8A 3BB6A 4GAZA 5CYYA 3TN92 3DXUA 2W92A 4JGYA 4A7KA 4BYYA 2ZGMA 5FWEA 4C91A 2QQPA 4LT5A 1VBD3 1JBCA 3WP4A 4ORFA 1A8DA 1UZYA 3WP3A 5F3EA 4QU2A 4IV1B 3POYA 2GDFA 1MEC2 1S2BA 2HYXA 4XVHA 3VBRC 3E6DA 3O1VA 3WEZA 4CP1A 4XYXA 3OBZA 3ASIA 1GWMA 1GLHA 2OUJA 3A0KA 4XF0A 1Y3TA 1C8NA 5DUXA 3QLQA 4H2AA 5F2WA 2VW2A 4YW1A 2X5IC 5CZKA 3OPTA 4JGZC 4HONA 2RS51 4XOGA 3Q8EA 1ASJ1 3BGAA 4COYA 1AR91 2WNVC 1JHNA 4BCUA 4DINB 3PIGA 1CPMA 3MIFA 5C3SA 1YCIA 4W50A 2WO7A 1AJKA 4JRLA 2E7AA 2WBKA 4K6BA 3MGUA 2XJQA 2JDKA 4NOTA 2Q0AA 3DF0A 4Q26A 5C70A 4UW6A 1O6UA 5FZ7A 4DXTA 3VKLA 5JDBA 3LA2A 1QHDA 4ARXA 4V1PA 1EV11 2P37A 1W8WA 4Y4RA 4ZZ8A 3MO4A 3LB9A 4Y22B 1ND2B 5I91A 5JPMB 3ALQA 4LKEA 4N8MA 3RI9A 3AZXA 2B46X 3DPRC 5FZHA 2UY8A 3WHUA 1OUSA 4EE2A 1RHI2 3I3BA 2VMCA 4OHYA 3VN4A 1ZBE3 2QQVA 4IERA 3GM8A 3NV3A 4FOVA 4D0QA 3CZJA 3VBUB 4D7YA 1PO11 5AC91 4MGQA 4EQVA 5FWJA 1BHGA 1GYKA 3OGSA 2CSGA 5BNPA 3L9JT 2PQSA 1RIRA 4M01A 4LK7A 4QXKA 3UNPA 3JBG1 3WG1A 4BXSV 3ZSJA 3AB0A 2FD8A 2VW0A 2HYKA 1OT5A 2VY0A 3KQ4B 4A6OA 1YO8A 2VMEA 4RHV2 4BXFA 1HRI2 1EP0A 4AI9A 2BW8A 1XU2A 3T1MA 4BQ3A 2QNKA 1XNBA 2ET7A 2HWC1 2W94A 4XJAA 3WQBA 1APNA 5T5JA 1OLRA 1RUOA 1RVF3 2XLFA 3MIEA 3MPPG 3ZOIA 1H8TC 1DQ2A 1TZOA 1CX1A 4ITCA 1AR71 4UT5A 3EHKA 1WA4A 3SHRA 1AL22 1VALA 2C1FA 1IS6A 5LA1A 4FTBA 1PK6B 1VE0A 1GP6A 5CFDA 4CRQA 3Q8BA 2V5YA 2JG8A 3U1XA 4QAWA 4KBZA 3AKPA 1RUH2 4CP2A 4QGMA 3WDWA 4CUBA 1QXRA 4M4RA 2OPWA 1OOPA 2HWF2 2AYHA 4N43A 3ZSLA 4AK3A 2YMZA 1MZ6A 1JOBA 1W6PA 4R9CA 1JW6A 3USUA 5CFCB 1W8FA 1ND3B 5D21A 1AYM2 5IHRA 1HV0A 1SBEA 3ZDVA 1FMD1 3IMMA 3PJYA 2D98A 1RUJ3 1D4VB 4O7XA 4EWAA 4XF1A 5ABJC 1GSLA 2ID4A 2D93A 3AYDA 3DGTA 1D4M2 5FP9A 4ASMB 1UZZA 5FKCA 3V0BB 4UBHA 2D6PA 2XBO2 1SHWB 1UL9A 2EXKA 3KV4A 4B4QA 5HI0A 2ETEA 4XBNA 2DYCA 4LBJA 4FFIA 2R061 2YPJA 1NQDA 1QQP1 1LOCA 1NYWA 1R64A 4XILA 2V5DA 5K8SA 4N7UA 3R0RA 4FPOB 4OUMA 2MEV1 2VUDA 2AENA 4PQ9A 2HEVF 1V6MA 1ENQA 1NE6A 1OFNA 4IEZA 4R4XA 3TYJA 1NUKA 1KFUL 2MNGA 5BXXA 2V72A 1TNRA 2ZX4A 1QJX1 1POV3 2RS13 1CAWA 3NSTA 4CU9A 4DOUA 2DTYA 1XSRA 4WBBA 1WLCA 2CV6A 2VQTA 2YFUA 4JTNA 1D7PM 3D0JA 1V6OA 3HPNA 2CY6A 4H3WA 1JTZX 1LB2A 3UKNA 2X5IA 2JDZA 2UY9A 2UYAA 4TZDA 2TEPA 4JGZA 2ARXA 5A3NA 1K5MC 2YGMA 3A22A 4JC1A 2HWE2 1WBFA 2X8KA 1AYN1 4UW3A 2Q8EA 3DEMA 2D40A 3O12A 2Y0OA 2ES3A 2WNVA 1Q5OA 4ZPIA 5C9AB 5KHIA 4KH9A 3N9LA 5A33A 4LOTA 5FXWA 2ZMLA 2I74A 5C8WA 3A21A 3KQRA 4FPHA 3OY8A 2Z5WA 3C7EA 4XAEA 1LAJA 3MI8A 2YB7A 2O8OA 1US3A 2ARCA 3MPBA 3VHPA 3DCQA 5HV0A 1MVQA 3RS6A 2DVFA 1OD5A 3JD72 5JLVA 1HXS1 4JKLA 2YHJA 4RFRB 4FP3A 1Q8SA 4W4ZA 5LA9A 4F7ZA 1SFNA 1YFXA 2VMFA 3ROUA 3FHIB 5A6ZA 3H8RA 3T2PA 1CWPA 1X50A 2WINB 3DPRA 1WMXA 2Y6LA 4TSVA 1LU2A 4GKXA 4EYUA 2D3RA 4JDOA 2YDEA 3TEYA 1MS1A 1LJ7A 2DDUA 5A3TA 2QQUA 4AVSA 5L9RA 3MLJA 3RWNA 5FZBA 4H14A 2Y60A 1NE4A 4XQ4A 1NCQA 2WT1A 1SFPA 2BTVC 3TN93 3GDBA 1JN2P 2OUHA 2LS6A 5FZEA 1W6MA 1W0NA 5CB7A 1F35A 5C3PA 3WF3A 3FWEA 3J7LA 3LIGA 4K40A 1B35B 3D6EA 2W1QA 4LUKA 4C90A 4Y20B 2WZR3 5FY0A 3BPSA 3M1HA 4N53C 1GQHA 4AZZA 5GZGA 3T0BA 4BLJA 2JKBA 2NPIA 2XR4A 3RG0A 2PHLA 3ZFEB 5FZKA 4YW5A 2ZABA 1H8TA 4QX7A 1UKGA 1NOVA 2JECA 1AR81 5EP9A 2WAAA 5E8AA 5JUVA 3I2DA 2VZOA 4J1WA 5GKAC 2VC9A 4Q0PA 2JDYA 1UIKA 1FV3A 3LFIA 4KWKA 4BQXA 1C5HA 1ZRCA 2W91A 3IDAA 1GP5A 1WCDJ 1SCRA 4BISA 5FZ0A 1VB2A 3UV9A 5D2AA 2WZEA 3WT3A 1BKZA 2GALA 4XUQA 5FP3A 5FO9B 1EY2A 4YVSB 3ZYHA 4AFBA 1PHMA 1SDWA 5KWRA 2VUJA 4LMFA 3WG4A 1GOHA 1W6QB 1IPJA 4NHXA 5FTTC 1UY1A 1S0EA 3N9MA 1CVNA 4M00A 4BA6A 1K3IA 2Y34A 5FZ6A 4AFDA 4CCJA 1Y7BA 1BBT1 4XQDA 2VOXA 1RUG2 1OKQA 4Q4V1 5CVRA 5JZGC 3LDKA 4OI2A 2O14A 1OQDA 2FHRA 4XUOA 3VDAA 5ABJA 4D69A 3WV6A 4X6RB 5FZIA 4FO9A 3USSA 2PMWB 2D7FA 2R49A 4C1WA 3PU3A 4EV0A 1O7FA 1N1VA 1RHI3 2VQAA 5IVYA 4CEYB 1HRV2 2QKDA 4JGYB 2DU1A 3UGGA 1PM4A 3OD0A 3ZDSA 2AZ5A 1WKYA 3N9QA 1YQCA 4MADA 3AJZA 3D8CA 3WUCA 1DGWA 3H42B 1XB9A 1C5IA 3AKQA 3GJBA 4RFT0 4AAXA 2JDAA 1HRI1 1N3PA 1Z7S2 4CCEA 1QJU2 5DN2A 1CZSA 3K46A 5FZFA 3OPZA 3PTRB 1PVC1 4Y3OA 1PK6C 3GF6A 2P4EA 2BERA 3DECA 5KHHA 5EQUA 2E33A 5IVJA 4CDQA 1RUE3 1FI2A 3B94A 3JQWA 5KHJA 2DF7A 4COWA 2CDPA 2GNDA 2GSYA 3VHNA 4LNVA 4B8EA 4DXZA 5FREA 5FQ0A 4K1YA 4Q4Y2 1ND3C 2WAOA 1X7NA 1RUI1 2YYOA 3VZJA 2XLGA 4NAMA 3AJYA 1RUH1 2WN3A 4PF5A 1K5MA 1DIWA 2WYFA 5FMDA 4K8RB 5JIUA 4GWIA 5KXCA 1F4HA 3N7MA 4JKMA 4XXAA 3WNXA 4IE5A 1YIPA 4LIVA 3UK9A 1YNAA 3B02A 3S5AA 4Y5TA 4GWMA 4URTA 2J1EA 5DAVA 5K7PA 2R30A 1QMJA 2DVGA 5JWPA 2P5BA 4W65A 3RJRA 5EJ3A 3WP6A 3DXTA 5A80A 1X9TA 1CAXA 4DFSA 3EB7A 3OBTA 1DP0A 1HX6A 1Q3EA 5FPBA 2HWF3 1LOFC 2VZ1A 4AHWA 4FOYA 2FMYA 1JMUB 2XKPA 3E1F1 3J7HA 5IJRA 5EPAA 3THDA 5FUNA 4RD7A 1AYM3 4M0HA 3U0ZA 1COV2 1KQRA 2GC1A 3IN9A 4P02B 4ZKTB 3W9AA 3PUIA 2RV9A 4MSVA 1NXD1 3FUOA 5F39A 5DZFA 4B3NA 1ZRRA 1S2KA 4S2GA 1MQTC 2ADDA 2DTWA 4KMQA 3QACA 4KG0A 1D4M3 4RR3C 4AL9A 2LALA 1XE7A 3U14A 1RUC1 1UZ0A 2XBO3 1G7YA 1SDDB 3IWZA 1Q8VA 1WLDA 2ZGQA 1OPOA 1YC61 4FAHA 1FNZA 1JYWA 1KS4A 2ZXQA 3OGJA 2P1BA 2EIEA 3WNMA 3PNAA 2IXCA 4QX2A 2AGSA 4AVVA 1Z78A 3AMNA 2WWJA 2XMLA 3NL1A 3X29B 3JXSA 4ISRA 2E9QA 4BQWA 1D2QA 2VNGA 3ZXJA 3SXWA 5FK8A 3JQXA 4R4ZA 1WCKA 3I8TA 1X8EA 1W9WA 1DLCA 3C8XA 4N53A 1YFYA 3TBDA 3ZN5A 3ZYBA 3I3MA 2IFWA 2XL7A 1C57A 1CJDA 1NZCA 1PGW2 1RUD1 1RUF3 2DUOA 3HBKA 4LHNA 1FOD1 2QQKA 3OYWA 4QMAA 5DMYA 2Q1ZB 1JYXA 3WF4A 5CEHA 1D0HA 2VCMA 4QPGB 5CFDB 3KM5A 1A34A 5C71A 1GU3A 1HB1A 3TOJA 5FZDA 2JG8B 1W6OA 2WLQA 5C33A 2HWE3 3ST7A 2YBSA 3VBSC 1YQ8A 3CEWA 4NE9A 2J1VA 4N43B 2FZ1A 1W6PB 1F5JA 3KF5A 4Z1VA 2GP3A 3PHMA 4WM7B 4EN7B 1LHVA 1VMHA 2P17A 5C3OA 1LTEA 1UXZA 1DBNA 2DVDA 2ZX3A 3JD73 1H4GA 3MIBA 5FLIA 1ZBA2 3W20A 1UY2A 5J36A 2LRPA 5FO7B 3CJXA 5K0UA 3WSOA 4OHXA 3SH3A 1JU4A 1KRIA 5JZGA 5LWBA 1TMF1 4IE6A 3N7JA 3RPQA 4EN6B 1UZWA 3S57A 1QJFA 1TNFA 5C5UA 1NA1C 2B8MA 4FBFA 1RTVA 4J25A 4X8PA 4NVPA 1FNYA 2Q8CA 3ON7A 4CXXA 5I0UA 1DLLA 3ZPYA 1SACA 2EALA 2K9ZA 4ISQA 2FCTA 4X8NA 1U0AA 1GICA 3IDEA 4YRDA 3MUZ1 3TNPB 4Y5SA 1YI7A 1XC6A 2JB4A 3RDIA 2OPKA 3U75A 2Y8KA 3WCSA 1QOTA 2Z42A 4FOWA 3LSEA 1CAWB 3CL1A 3VBRB 2BWCA 4LULA 4S2HA 4UAPA 3WQ1A 4CU8A 3FBYA 3UESA 4ZZ5A 5L19A 2RS52 5LW9A 3RZKA 2W08A 3IPVB 3I7DA 3OUIA 3PUHA 1AR92 1KEXA 3BTAA 3I59A 3WNNA 5CG8A 2IFRA 3NWKA 5DXDA 2X5IB 1W0OA 1CQ9A 1GNHA 4JGZB 3HVDA 4YVSC 1SPPA 1LHWA 4Z2WA 1NZIA 4ARYA 4ZONA 3ZPOA 2DU0A 2WNVB 4GULA 4IEUA 5GLTA 1GV9A 4QDQA 3OGGA 4NROA 4AEKA 5A33B 4YPJA 5B4NA 2BU9A 4HSJA 2ZKLA 5EYYA 1EV12 2Y0IA 2C26A 3W5MA 3OY8B 2EXJA 2RM21 1PO21 2P6CA 3ES1A 2VG9A 5FRAA 4CEYC 4DO0A 5LEKA 1OF3A 1YQ2A 4IEYA 3FC0A 2EF6A 2NYYA 1C8M2 1RUG1 4CCOA 2WC2A 1FPN1 1U12A 3POFA 4ASLA 2R071 3HQUA 3OF1A 4KQ7A 4JX0A 4IEPA 1PO12 3J8F1 3AP9A 4BU2A 4LR4A 5FY7A 4CP9A 3DPRB 4IGOA 5FP4A 4CXWA 4TYSA 5J1XA 3POGA 5GALA 1UN1A 1ZZBA 4KI5M 3JBG2 2BGCA 4JQTA 4U2AA 3EMRA 1MQTA 3T08A 2BP6A 4M3CE 4CCLA 4QKNA 2HWB1 2Z69A 2HWD1 1ULDA 1FV2A 4EN9B 1BVP1 1HRV3 1ZRIA 1W6MB 1XYOA 2HWC2 3IMNA 1OXCA 2E7TA 2XWBB 3O14A 4RN5A 3RRDA 4JAAA 4QX1A 2VULA 3SNMA 1Z7S3 5F8PA 4NIGA 2A5ZA 2QDNA 2VAUA 2EIGA 4GZ9A 1PGSA 1S0IA 1AR72 4BQYA 3H0OA 1LODA 2WABA 4YZ2A 1ODMA 5FPZA 1IS4A 5LRRA 1YQ6A 1HB4A 3ZXLA 3POJA 3ZMNA 4AFCA 2ATFA 3HWJA 1JZ4A 1BJQA 2A75A 5FZ1A 2QQIA 5I8SA 1H8TB 5LK5A 3O0WA 4E2QA 3LZZA 3O0VA 4AWDA 4Q4X3 3AP4A 1R091 2A6ZA 2WZPP 2AACA 5JSOA 3PJQA 3W58A 1NQJA 4UYBA 2JG9A 3W21A 4NO4A 2ZAHA 4JHZA 3VZLA 4HXCA 4WVWA 3O0XA 3T09A 1FMD2 3LD8A 3VBSA 4NIAA 1X8MA 4GXLA 4XFGA 1H9PA 3IB3A 1W3XA 3Q8AA 4OVEA 3H1YA 4XEZA 1I3HA 1UIJA 4LO5B 4NHMA 5E1RA 2E31A 4IEWA 5BNPC 1A8MA 3KMHA 4LO8A 4QPYA 1AR61 3VBOC 2XPJA 3WDYA 3FJSA 5BNQA 3KD4A 3OBRA 5FUPA 2V73A 4XC9A 4E4ZA 1P8JA 2R062 4EWDA 5FIXA 1H2LA 1QQP2 4YM3A 1J84A 4INDA 5ABJB 4BZ4A 3PTYA 1ZA4A 1HQLA 3ZR6A 4Q8KA 4NRQA 2MEV2 1YFUA 4C0BA 4EN0A 1NA1A 2XQXA 2W52A 2RMU1 4IEXA 3AP6A 2EIBA 5A7NA 1MS0A 3GNEA 4M3CA 2PQQA 2WFF1 2HH9A 3CDZB 4A44A 1QJX2 4LK6A 5A6QA 2R16A 1ZREA 2GNTA 2C4XA 3AX4A 1OSGA 2ZMNA 4MZUA 1CONA 2W3JA 2F4PA 2ZA9A 3FBMA 3S30A 3BODA 4XJUA 2FDJA 3CZUA 4H7LA 4JKKA 5FPVA 5C4WA 2DCKA 5KBFA 3KT1A 1QKQA 2VZ3A 5F5IA 3SCFA 4XUTA 1PZ8A 1DF0A 1RMU3 1Y43B 4FFHA 4CDQB 2WZ8A 1S4CA 3DN7A 1JYTA 1W99A 1AYN2 2R7EB 1NT0A 1OOPC 1ULPA 5J96B 4CUCA 1BCXA 3T4VA 2BBAA 5FQ0B 5JPNB 3D3AA 4DXRA 3JB4C 5DUVA 1Y9QA 2JE9A 1HDKA 2LW8A 4QKBA 1K5MB 5DDJ3 1ZYBA 4LEJA 4YM0A 5GLZA 4AOCA 1BEV1 2ERFA 2ZX2A 4GMP3 4URAA 3BN6A 5I0RA 4HPKA 1L7RA 5AVPA 1HXS2 2A1XA 1LENA 5F32A 4D6RA 2WYSA 1DG6A 1CAXB 3MIHA 5F5AA 4Y5Z0 2D43A 2QDRA 5ERLA 3VDCA 4LJHA 5FFOC 4AHXA 5JSPA 3T0DA 1N3OA 3APBA 4NRPA 5EV7A 2HEYF 2OYZA 3IIIA 4QDSA 1DZQA 4IE4A 3WW1A 5JR2A 4CEWC 2GNMA 5FYVA 3U07A 3W59A 4F3JA 1QEXA 2YXSA 1Z0HA 3I2FA 3MV11 4Q0VA 4JZRA 1JOJA 4MGKE 3NNJA 5TSWA 2QFEA 3HQRA 4AI1A 4L2NA 3GALA 2G9FA 3NAPA 4MXWA 4Q27A 5CNAA 1SBFA 2L9LA 4NWVA 4PIYA 5FZLA 1KGYA 4QHBA 2RHPA 5ACA1 3ABZA 4PIZA 4SBVA 3WW4A 4LOSA 1LU1A 1UX6A 1YRZA 5EIYB 2W87A 1R1A1 2FCUA 2XONA 3F95A 1VRH1 4XJ8A 2PHFA 3DYPA 4AAPA 3I2GA 1PNGA 4MXVA 5A3OA 1RGSA 1AR82 3Q8FA 3N7LA 1AF9A 3NVCA 1EAH3 3OGVA 1T6BX 5HV4A 4N53B 4N9IA 5AVAA 1VAMA 1IS3A 4HVRA 3J26N 4YM1A 2RS53 4E4DX 5FXZA 1ASJ3 1AR93 2IXLA 4UW4A 2A6YA 3D0SA 3M3QA 3OYWB 2WO2A 2ORXA 3OD4A 4W8JA 1WZXA 2Y6FA 4I02A 5D8AC 5IWFA 5M0TA 5CKMA 1W6OB 4XXPA 3J9SA 1OMIA 3SH5A 2D5HA 2HJIA 2Y38A 3HNBM 5J3UA 4HKWA 4NR1A 1C8M1 1QXJA 5C6CA 3WDTA 3MDPA 2XOMA 1RJ8A 1BBT2 1SG3A 1EV13 4Q4V2 4CZSA 5A6YA 1XQNA 2QQMA 1MS8A 5IVEA 1NCQC 2JDUA 3GCWA 2PHRA 2VU9A 1ZBE1 4B7EA 2JD9A 3VBOA 5C5TA 3VD4A 2WDBA 3BIWE 4AGVA 1SLIA 5K0UB 3VKNA 4WVZA 5CKNA 2N7GA 3UYJA 5JZGB 1VBB3 2ZHKA 3GYDA 4AGGA 1V0AA 5AC93 1PO13 5IW0A 4ZXEA 1IPSA 4I3GA 3POIA 4IGQA 2PLV3 4YZ1A 3VDBA 3WY6A 1NCRC 3ZXFA 1UY0A 2ZAAA 5H9RA 5A3WA 5IVFA 2CTVA 3AZYA 3IT8A 3JBG3 4KU8A 1PVC2 2ZEXA 4P9IA 2R041 4QQOA 3ZIXA 2C24A 2XHKA 1UU6A 5A1LA 4XTMA 2HKXA 4BK4A 3ITQA 2OQ6A 3AKTA 3BTYA 4ZHNA 2F6BA 2VTXA 1AJOA 2WNUC 2A71A 2D6OX 2PHXA 4OMDA 2WS91 4YLZA 3M8LA 2R32A 2WN2A 1HQWA 3RYKA 5CU1A 1CAUA 1RVF1 1RUI2 4W6XA 2XJRA 4DS0A 2B39A 4YGDA 1GNZA 3K3NA 4Y20A 3OUJA 3I59B 5JMCA 3WP5A 1CN1A 3LEKA 4W6WA 4ATEA 2D44A 3WG3A 4COUA 1IPKA 2I07B 1SPPB 3OPWA 2O0OA 1GOFA 3ENRA 1CJPA 3ZSKA 5C7GA 4TLFA 4Q5OA 1W04A
chains in the Genus database with same CATH topology
2GN3A 4GIQA 2D3PA 2A6XA 3MFAA 5C8CA 2H0BA 4YZ4A 4Q2FA 1I9RA 4RSUA 3ZO0B 4XIOA 1AZDA 4HMZA 2BUKA 4YFWA 2YUEA 4GALA 3GHNA 2LTNA 4FXKB 1DGWX 1AHSA 1H1AA 2G9GA 1J1LA 3THPA 2BPA2 1S0DA 4CEWA 1RUC2 3POWA 3ZYRA 2JJ6A 1VBE1 2FQPA 3VBHA 2R063 1G9DA 1RC6A 4GB31 1QQP3 5DUUA 4PCRA 2BVVA 3WDVA 4KU7A 3WINE 1MQTB 5JI9A 1XNDA 3AZWA 1WMDA 4AEDC 4CDQC 1J1TA 1ULEA 4RR3B 1UU5A 1R081 4HK9A 1FT9A 1H1IA 1N47A 2BNOA 3MF9A 4AVAA 3KCCA 2ZACA 4Q4W1 4HVOA 1QJX3 1KS5A 4YM2A 4Z07A 2XWJB 4XBQA 3RI8A 4Z92B 3N7KA 2OZJA 2R6QA 1MS5A 4RA0A 1RUD2 2EXHA 3KSCA 1FOD2 1DGLA 4R9AA 5IK7A 1AUYA 2ZZJA 4CYDA 1LEDA 1LKNA 1PM7A 2XL9A 2VH9A 4Q29A 1GZCA 2XJVA 4Q0UA 1AYN3 4LBNA 3I4IA 4NWWA 3SISA 1F9KA 1LHOA 1SQ4A 1AX0A 2R1DA 3ZYJB 2EAKA 1VBC3 2G4IA 5D8AA 4FT8A 2A3XA 1YYNA 4WZFA 4YGCA 3M3CA 4Q8LA 4LHKA 4YW4A 5FDBA 4FXGB 1FATA 3VBSB 2DCZA 3WVJA 4NPRA 2GH8A 5FOBB 1PZ7A 2R0HA 1BQPA 1TMF2 3U10A 5L36A 4KBBA 2WSUA 1AX2A 1IQAA 1O4YA 1FAYA 4AG4A 4AHZA 4D3WA 5DG2A 2RR11 2LUWA 4YGBA 1YFWA 4MVTA 3UKTA 1QDCA 4U36A 2IXHA 2QCSB 5J7MA 2CNAA 1NA1B 3MLLA 4LE3A 1V6LA 1NCRA 1O3SA 1MEC3 4M3CB 3RMYA 2D6NA 4JV4A 2YZ4A 2ZGNA 3N36A 4OULA 3TWIA 2BNMA 3ZXAC 1MR5A 5A32A 3FZ3A 2XJPA 5D1IA 3ZSMA 4G9SB 3KT7A 2AUYA 2WKKA 2WNUA 4XTPA 5HXVA 4OI1A 4S2DA 2WFPA 4QGLA 1PMIA 4HN1A 2E6VA 2XUMA 1KITA 1AR83 2FBEA 2B9UA 4AI0A 1I1EA 1RB8G 2MPFA 3QBQA 1IKPA 4EJRA 1JUIA 1J3QA 1TEIA 3E5XA 2RM22 3RYPA 1PO22 4HFSA 1A6CA 1IGOA 5K0UC 1CGPA 3B00A 3N3HA 1FPN2 2R072 4L11A 2BWAA 4J6GA 1MZEA 2VVFA 4PDWC 4SLIA 3C3VA 3VKOA 3J8F2 4QQHA 3N35A 2ILMA 4OLLA 5KHKA 3JU9A 1LGCA 2KM2A 1C1FA 1NLSA 1PIV2 1O3QA 3INAA 1BBT3 1TME1 3L2YA 4BIFA 3ACLA 3ATGA 5GZFA 1WUVA 3EXUA 3MLKA 3ZSEA 1S0GA 4COVA 2HWB2 3AP5A 4IV3A 2HWD2 1RINA 2BBVA 1CR7A 2UYBA 3WUDA 3D5OA 3IIAA 4YARA 1ALYA 2A6VA 2IZWA 2WL1A 4FTEA 4AEDA 5HCFA 3NAPB 4I0BA 4MXWB 3VZOA 4K9SA 3AZZA 4RHV3 4NN0A 1HRI3 3VZKA 4XF4A 1ULGA 2JENA 4OZXA 1C1LA 4IETA 5H9QA 1MVEA 4AQ6A 3LOBA 4Y1UA 1CIWA 2E51A 1AL23 3VBFC 2JICA 1R092 1N3QA 3IKWA 3ZXGA 4A7ZA 4K7JA 1RUI3 4Q1PA 1RUH3 4CDUC 3ZIWA 2NZ9A 3GHMA 2VQ0A 2Z2SB 5E88A 3WDXA 3V56A 3WZ1A 3TRSB 1V6IA 1ONAA 1EYBA 2BFUS 1QJY1 1SBDA 1VBA1 1WD4A 1S0CA 1XE8A 4FAGA 2GC2A 1AR62 4AFAA 4KWLA 2GC0A 3IDCB 3E97A 5BNPB 4LBLA 3ZYGA 3VBOB 1V6KA 2B5HA 4BQ1A 2RMU2 5L7OA 2WFF2 4AW7A 2ARBA 5IT6A 2XVLA 2ZHNA 3AYAA 4FPKA 3ME2A 2BNNA 2WA3A 1RUC3 1ZRFA 1QGLA 1Q8OA 2HEWF 2ZGTA 4IV1A 5IUQA 2D5FA 5FCCA 2V09A 1V6NA 2DUPA 2CWMA 2RE9A 5DG1A 4D7TA 5BPXA 2BEOA 5JSRA 1R1ZA 4E9KA 3KB5A 4CDXC 1LHUA 2E7QA 4PBOA 1FX5A 3HIFA 4K3UA 1UF2C 4IESA 3FE5A 5F1RA 2JG9C 4L97A 1LGBA 1CAUB 3THTA 3WOGA 4BMEA 1RUF1 1S0JA 2Q8OA 2B7YA 3WG2A 3M2MA 4Y20B 1RUD3 1BEV2 1RITA 1V9U1 3NKTA 2ZBJA 1FOD3 1OOPB 3EBRA 3SCGA 4MV2A 5FMOS 3USUB 1QY4A 4F83A 5E89A 1JXNA 2RS31 4Y1XA 1HIXA 1MS4A 4GMP0 1HKDA 5J98B 1QOOA 4MGZE 4AQSA 1MZFA 1RL3A 3B9IA 4RGAA 4G3YC 3MW3A 4CP0A 5C8CB 2TBVA 3AXDA 4BH9A 2ZGPA 4MLOA 4LE4A 4JDMA 1BZWA 4ZU4A 1BYHA 2CAVA 4LBKA 4PDWA 4BM8A 2CWSA 3BCWA 1SCSA 2PHTA 2VPVA 4XHBA 1VAKA 4HZFA 3VBUA 5T3NA 5JOWA 1KD7A 2XJTA 4CEWB 1O3RA 3UJQA 1REDA 4QQLA 3VBHB 1AVBA 2DCTA 3RYRA 5C4WC 4E2SA 1FYUA 4XDQA 3SITA 5ACA2 1S0BA 5GLVA 3RNSA 2X29A 2EA7A 1R1A2 3SLIA 1VRH2 1WLTA 4XFFA 3H8UA 5GZEA 3CU7A 4FQZA 1G86A 1LR5A 1MS9A 1O4TA 2DFBA 1YXWA 3H3ZA 4YNIA 3MIDA 3FLTA 3G7DA 2YY1A 4HLTA 3R4UA 3VBFA 3CNAA 1O5LA 2PHWA 1MS3A 2ZTNA 3AKSA 4FPFA 4YG3A 4HSLA 5E16A 3K48A 4CDUA 5AFBA 3JZVA 2YROA 5CFCA 1NY71 2DVAA 4FPGA 2A3WA 5L73A 4YZ5A 2QZ2A 2H6BA 5K9YA 1WLWA 3MFCA 5D8AB 4MYEA 1QWRA 3D82A 4P9WA 2RM23 4PIXA 1PO23 5H9PA 3M3IA 4H55A 1JH5A 1QXPA 1ZBE2 1PIV1 2ZGOA 4P9YA 4BHPA 1RUG3 2C5DA 2H0VA 1O4ZA 1FPN3 2W39A 4WM8C 4AI2A 5SV8A 2R073 3NAPC 4E2GA 2IXKA 1NCQB 1UMZA 4FTSA 5BV6A 1UKRA 3E6BA 1ULCA 1H2MA 2C9AA 2R042 2HWB3 4WVMA 3ZYIB 2HWD3 2FZ2A 1CAVA 1QDOA 1U5XA 4O9EA 1QJU3 4QQPA 5GM0A 4KWJA 1NCRB 4Q1RA 1ENSA 3LGRA 3PMEA 4YSFA 4L92A 1VIWB 3T2TA 2WS92 1DGRA 4P9LA 3HMYA 1RVF2 3ZMOA 4I2OA 3B5LB 5KXBA 4CDXA 1J3RA 4Q4Y3 4A2UA 2WNUB 1BK1A 2WT2A 1ZM1A 5KXDA 3QCWA 3H7JA 3WLUA 3AYEA 1IOAA 4XJ9A 4CTEA 1ULFA 4Q4X1 2WIIB 2JX9A 2ZKNA 2VVEA 3ZYPA 4AQTA 1D2SA 4K8FA 3M3OA 1GANA 4YG6A 3ZXDA 3H9AA 4OI0A 1JYIA 2BFUL 3AMQA 3DL3A 5BY5A 2VUAA 1SLLA 2Z79A 4UXAA 3OCPA 3GZUC 3R6SA 5I93A 3U11A 3N4MA 1COV3 4K1ZA 3VGIA 3H50A 2JXAA 3B01A 5EYXA 2OW4A 2ENRA 1AR63 3PLQA 1C28A 1SFYA 4A7YA 1VBE2 3ZVXA 1GBGA 2A6WA 2NM1A 2X53S 3L2HA 4GB32 2GNBA 3O5SA 3HBZA 3TNQA 3VZMA 3VDDA 3OJBA 3OTFA 4LA3A 4QPIC 3PVOA 4IV3B 1R082 2AREA 4XHXA 3V65A 2RMU3 2LM3A 2ZHLA 4GKYA 2PAMA 2WFF3 4Q4W2 1DU3D 1G6NA 4RS5C 4AEDB 1F8VA 5T5LA 1BMV1 1W2UA 3DKWA 2PYTA 4W6YA 2VNRA 4FVVA 1WW5A 1EPWA 3RQ0A 1OPMA 4AF9A 3GBWA 3LA3A 1H1MA 3MICA 2ZS6B 1Q8QA 4YVWA 3NW4A 4D94A 3KGZA 4XZPA 4DZGA 4Z8BA 1RMU1 1AX1A 4IEQA 1QH6A 2CGNA 1DGRN 1V70A 1H8VA 1OQ1A 3T1LA 1AXZA 1ZZ8A 2NMNA 1REFA 2GMMA 1TQ5A 3S0MA 3MW4A 5GLWA 5C8CC 1ZVFA 1G9CA 3WX5A 5CADA 1UD1A 4YYOA 1XNCA 5FMOL 2PTMA 4LBOA 4RGGA 4OFGA 2I2SA 4XMIA 1HLCA 5GZDA 3FLPA 2PFWA 3HAGA 5T5OA 4HT1T 4RL7A 3B3QE 4OHVA 4DMIA 3QOPA 1LCLA 3VBHC 5GZCA 3M3EA 3MZHA 1ZBA3 1DQ1A 3NJZA 1VBD1 5DZGA 1G8WA 4WM8A 4QGNA 2RR12 4I01A 3P3PA 5BUVA 3IM0A 2PHUA 5L7OB 1RJ7A 3ZN6A 4YG0A 4I3PA 4XF3A 3MF6A 1W0PA 2IXIA 4IEVA 4AI3A 5JAXA 4J1XA 2WZR2 3TAYA 1LRHA 3RMXA 1H0BA 2Y26A 5ACA3 2VECA 2KA3A 1B09A 4OHZA 1A3KA 1J58A 1R1A3 1WMEA 4Q0SA 3S7IA 2PHDA 4LBQD 1VRH3 4CDWA 2JD4A 5IK5A 3KZ4C 2SLIA 4RQPA 2ZOEB 1EAH1 1M06G 3R4DB 5B2GB 3B7MA 4FSJA 3RJ2X 4K21A 3IBMA 1WW6A 4A3XA 4R52A 2UWAA 1GKBA 2QJVA 2VW1A 3H3UA 3HT2A 4GH4C 5CG9A 4L8QA 5FOJB 4BWOA 1XU1A 4IQPA 2JEMA 1F5FA 4UBGA 3ZFFA 1H2KA 3AZVA 1E57A 1C8M3 1OFSA 1OQEA 3CJIC 1WCSA 4X6QB 2WQ4A 1TME2 2DURA 1OA4A 5CIRA 3SH4A 1IS5A 4PDWB 5BNNC 2IC1A 3C2UA 2PN5A 4XMAA 1FXZA 5T50A 1VBB1 1H2NA 3ZFGA 4PJYA 1XYPA 4Y26A 2PLV1 4XFCA 4QPIA 2R0FA 4ATFA 3BOPA 1LESA 2HWC3 5IK8A 3LCPA 1PNFA 2R043 2Q4SA 4RS5A 1RUE2 2OA2A 3H7YA 2ZMKA 1MZ5A 4AEJA 4LBMA 3ZXEA 1AR73 3AXEA 3BU7A 2E63A 4FOQA 5BNOA 4AQ2A 3AMMA 2VGDA 2WS93 1IZ3A 1HV1A 5SV5A 2UU8A 4OHWA 5FLHA 3E6CC 1H30A 2OIIA 2Q5TA 2Q1MA 1SLTA 2GU9A 4JVAA 4ES8A 4QPGA 4WZCA 5I8TA 2A73B 3VBFB 4KL1A 1QJY2 4LLOA 5CAZA 1VBA2 1BVVA 3H1MA 1FMD3 4QQ2A 4DB5A 4CDUB 1RUJ1 1UAIA 3E5UA 4PLMA 1H4HA 1S1AA 3NKGA 5EFUA 5JCTA 4WM7A 2EAAA 3S6PA 2TUNA 2JE7A 4IV3C 1ZZ6A 2A7AA 3VL9A 3GZAA 3URFA 5F9TA 1YLLA 5GLUA 3VLBB 2FMDA 1J59A 2AR6A 4XFBA 4AVTA 1QF3A 1Q8PA 2ET1A 3ECQA 4HK8A 1VP6A 3FLRA 3NV4A 1H9WA 2MEV3 2PAKA 3AKRA 2YGLA 1VBE3 2GZWA 1POV1 2RS11 3AFKA 3KGLA 3SMHA 5JVVA 4GB33 3K51A 2VNOA 3FMGA 3PVNA 2K0GA 1DHKB 4WVMB 1QOSA 5LRSA 1CAVB 1R083 5FO8B 5EZWA 5LK7B 4AVCA 4FP2A 3FUQA 3VBRA 3ILNA 4I0WB 4Q4W3 3V0AA 4IEOA 4BOWA 2UWCA 4L9BA 2P2KA 1HQNA 1OI6A 2WLPA 4D7SA 1U5IA 1URXA 2ZGLA 3IPVA 1RUF2 2D6KA 4CDXB 4C1XA 1V9U2 4LA2A 3HR9A 2A70A 1JUHA 1D0GA 4Y1ZA 2JG9B 4UW5A 3UKVA 4AVBA 4R9BA 4E4SA 2R1BA 2RS32 4MGIE 1LOAA 2GMPA 4BE3A 2NN8A 1VR3A 4BLIA 2D6LX 4OI4A 4AGRA 1HXS3 1VBC1 4I30A 2GC3A 2OVUA 4GH4A 5FPXA 2NQYA 2ZX0A 3ZN4A 3QH6A 4MH0E 5BYNA 3B69A 2CAUA 4YGEA 5T5PA 1S55A 2XVKA 4AFMA 2E53A 5L7OC 4I0AA 2ZHMA 3EO6A 4XE9A 3CJIA 3I54A 2RJLA 2VOKA 4TWTA 3VKFC 4BIOA 1GFF2 3KCXA 3KS7A 4IV1C 4IXLA 1QNWA 3TN91 3HT1A 5BNNA 1KJRA 1QH7A 1LEMA 1QNYA 3DUIA 2D6MA 5EXOA 4E27A 4XFHA 1F31A 2RR13 1KDMA 3VDDB 3LAGA 4XIKA 1GR3A 1ZZCA 2W68A 4AHYA 1MEC1 1ENXA 1GQGA 2WZR1 3FFQA 1UW8A 4XJWA 3VUOA 4LLFA 1VLNA 5J09A 5C4WB 3QH7A 4AEMA 4LBQA 3MEPA 1L3JA 1NXMA 2IWGB 1DYPA 4M0NA 5GJ6A 1AXYA 4LO4B 1T6GC 4PLNA 4IL7A 4YVWB 4B7KA 4Q0QA 3FX3A 1QU0A 1UPIA 3VHRA 4K20A 4EN8B 2VMGA 4AE2A 3EJKA 4MUVA 3RSJA 4HPKB 3RZZA 3WCRA 4HKOA 2EVXA 2VXRA 1NY72 4WV8A 1ND2C 5T54A 2CGOA 1O91A 4QX5A 1LULA 3CLPA 3M4FA 3U4XA 1I6XA 1XNKA 1LHNA 5JOZA 2XLAA 2P3JA 3BALA 3WQ0A 3WW3A 3VBUC 4Q4V3 4QM8A 5HBAA 1ENRA 3WXPA 1C4RA 1NG0A 1RHI1 3AMPA 1CD3G 3PMSA 4DRVA 1G9BA 1TME3 1VB4A 4LO6B 4WM8B 1DQ5A 3NO8A 4FQ4A 3V64A 1AL0G 1W6NA 4M3CF 3Q9OA 1PVC3 3AK0A 2VMIA 3HQXA 3ZN6B 5HCAA 1RUE1 4LUMA 3ETQA 1ZZ7A 2PA7A 1G9AA 4RHV1 4FPEA 3S7EA 4I09A 2GH2A 3JB8A 4HBNA 2C0ZA 5A3LA 2RJKA 2OZ6A 1KXGA 1C3HA 3HD8B 2WWSA 1CESA 4XPVA 2XGXA 1AL21 4QM9A 4CDWB 1GZWA 5CFCC 4RQPB 1J3PA 4Q4X2 2ZZQA 4P9JA 3ELNA 5EWSA 1RUNA 3NV1A 3EQEA 2DVBA 1JYCA 2HWF1 4LTAA 5LEJA 4EWEA 4B4PA 1M4WA 3AP7A 2PAEA 3LSDA 1AYM1 4HKLA 1QJY3 2DFCA 1VBA3 4N7IA 4KG8A 1AXKA 1S0FA 1SMVA 3ZFFB 2P3IA 4H7MA 1D4M1 1YJLA 4AYUA 2XBO1 3GBFA 4GWNA 5JR7B 4GQ7A 4S2FA 2DCYA 1X36A 4P5HA 4AXOA 1DZTA 1DZRA 1PZ9A 3VV1A 3WD5A 4DY5A 3ZFGB 2CYFA 3JUUA 3H1WA 1NLRA 5JOXA 1BMV2 4QPIB 2WNEA 4XFIA 4Y24A 3ZXKA 1YJKA 3IDBB 3POSA 3A0NA 1O5UA 1CPNA 5J48A 1TE1B 4HVQA 4RS5B 1RMU2 2UWBA 1KFXL 3MYXA 5C9AC 1V00A 2A3YA 5I0SA 3UL2A 2NLRA 4P9GA 3WR0A 5I0TA 2ZGKA 5BNOB 5IK4A 2HWE1 4AI8A 4R9DA 5HCBA 5F6LB 5DDJ2 3R4SA 2XKOA 2UURA 2MHFA 1YI9A 2WJSA 1V9U3 2BQPA 4BPZA 4ES9A 3A4UA 2YC0A 3B9CA 3B93A 4DNYA 4Y22A 1ND2A 2RS33 1I5ZA 4ONUA 1PGL1 1ZX5A 2QUOA 3P3NA 3JD71 1LGNA 1KJLA 2GN7A 5JOYA 3E5QA 4B29A 3WW2A 1VBD2 2CL2A 3VDDC 3TB0A 1SLBA 1TMF3 1UU4A 3PVBB 1OA2A 4P14A 3CF6E 4NHLA 4COZA 1EPZA 1W39A 1YHFA 4XETA 4DY3A 2VVDA 1DDLA 1WW7A 3GZTB 4N90A 4Y4YA 1OLQA 5FLJA 4XFAA 1N1SA 1B35C 3NV2A 4LHLA 5CA6A 1MACA 3KT4A 4XJZA 4QD2A 4YVWC 2NP0A 4NHKA 1A78A 2ZCWA 4GA9A 3SCHA 3ZFEC 1DQ6A 2XG3A 4HL0A 3MW2A 1KDKA 1SEFA 3HN1A 5KC6A 2Q30A 1U5ZA 4KGGA 1PK6A 2XB6C 1Q43A 1EAH2 2NMOA 3V0AB 3LOIA 1X33A 3WHTA 2DV9A 1ASJ2 2QE3A 3WQ7A 4O9GA 2ZJCA 1GZ9A 5F6KA 1X82A 1LOGA 1ND3A 1WMFA 3AM2A 4FPYA 4EROA 3D4KA 3UJOA 2EXIA 1DQ0A 5F5QA 4YW3A 5H9SA 2IXJA 4GH4B 1UPSA 3V0BA 1O3TA 4MX3A 3BPZA 3J8F3 3ILFA 4JGYC 3MIGA 4KGQA 2I45A 1SLAA 3VKMA 3M70A 1LOFA 1PIV3 2DUQA 3CJIB 1VBB2 4OUSA 4DPNA 5AC92 1QJZA 4R8HA 1OA3A 2ZPXA 2PLV2 1HRV1 2DCJA 4FCAA 4PLOA 5BNNB 4C0HA 2GMEA 1WGPA 2BYVE 2ZX1A 4Y1YA 5I8YA 3WDUA 4JQRA 4RR3A 1Z7S1 4PBPA 1QJU1 1PVXA 5A32B 4CDWC 2O8QA 3LWCA 4RQPC 3G6JB 4DRRA 3VHOA 2WQZC 1ZNPA 4FPCA 4FPLA 4JTOA 4LBQB 4YZ3A 1WBLA 3ES4A 5C9AA 5JIAA 1UCXA 1N1TA 2K2SA 3BOWA 3R05A 4Q4Y1 4Z82A 1R093 2P34A 5DUWA 2SBAA 1LECA 3ILRA 2B45X 3ZFFC 1REEA 1YUDA 2D97A 1WW4A 1RUJ2 1WD3A 1YIFA 3AYCA 2W0XA 4BMBA 4XW3A 2CGPA 2B42B 5T55A 4Y1VA 1DQ4A 2O1QA 4XBLA 5FAXA 2D3SA 3FFZA 1BXHA 3ZFGC 2GAUA 2QVSB 1COV1 3GBGA 2WA4A 1U5YA