2Y0OA

The structure of a d-lyxose isomerase from the sigmab regulon of bacillus subtilis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
171
structure length
171
Chain Sequence
GITKEEVNSYYQKAGIVLTDEEVDQIQLMDYGLGKERKVGLQLFVYVNTDRYCSKELVLFPGQTCPEHRHPPVDGQEGKQETFRCRYGKVYLYVEGEKTPLPKVLPPQEDREHYTVWHEIELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHDIFTDPRILEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a D-Lyxose Isomerase from the Sigmab Regulon of Bacillus Subtilis
pubmed doi rcsb
molecule keywords PROBABLE D-LYXOSE KETOL-ISOMERASE
molecule tags Isomerase
source organism Bacillus subtilis subsp. subtilis
total genus 51
structure length 171
sequence length 171
ec nomenclature ec 5.3.1.15: D-lyxose ketol-isomerase.
pdb deposition date 2010-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2y0oA00
1O5LA 2HJIA 2FMYA 3MZHA 4E2QA 3E6DA 3IDCB 1TQ5A 4XF9A 2IXHA 4IERA 4HZFA 2HKXA 2GC0A 4N9HA 2OA2A 2IXIA 3CJXA 3USSA 1ZZ6A 3GYDA 1GQGA 3I59A 1EP0A 1LKNA 4LULA 1SQ4A 2ZKLA 5LRSA 3E6CC 3C3VA 2EA7A 5I0TA 4IEWA 2MPFA 4A2UA 1NE6A 1H1IA 4GULA 3WW3A 3NW4A 2PQQA 4LA3A 1OD5A 5KHIA 1L3JA 1LB2A 3LA3A 3G7DA 2VPVA 1ZRCA 2K0GA 5I0SA 1DZRA 4WVZA 4JVAA 1OMIA 1CGPA 2XKPA 1VJ2A 4JV4A 1V70A 2ATFA 4PIYA 2PHDA 5JAXA 5C8WA 4LLOA 1RC6A 5K8SA 1X8MA 3H7JA 3TNQA 3I7DA 4LA2A 4OLLA 4XF1A 1OI6A 5FLHA 4KWKA 1Y9QA 2XL7A 4AXOA 3S0MA 3PVBB 2ETEA 3U10A 1PMIA 1ZVFA 1WGPA 4IEYA 4XFIA 3NJZA 1CAWA 3UKVA 1ZRRA 4E2GA 5KHJA 2QJVA 2BNOA 5KHGA 2IXJA 3IBMA 2ZCWA 3MYXA 1YFUA 3SCFA 3BU7A 5J7MA 2ET1A 3D0SA 3DL3A 5LRRA 2QDRA 3SHRA 5I91A 3ES1A 4LTAA 2UY9A 4I02A 4BIFA 4XFHA 2BGCA 5I93A 5D1IA 5JSPA 2GC2A 2PFWA 4IEOA 2XLGA 4B29A 2IXLA 4XF0A 5BUVA 4HLTA 2XLAA 3KSCA 4XFCA 3HQXA 5FPZA 3ES4A 4X6RB 2IXCA 2DCTA 2OZ6A 4I3PA 3H3UA 4UXAA 4Q0VA 3OF1A 1O3TA 1UW8A 2UYBA 4AQ2A 4IEPA 1WLTA 3D82A 4I2OA 2OZJA 1NXMA 4HVQA 3LWCA 5FQ0A 4ZU7A 1EYBA 4XETA 3RYPA 3E5UA 2QCSB 4META 4ONUA 2FQPA 4AVAA 1IPKA 3RPQA 4J1WA 3IIAA 2BNNA 4HN0A 4Z07A 5CVRA 4JTOA 5I0UA 4N9IA 2N7GA 2GAUA 5LEKA 4F7ZA 2PAEA 2VQAA 1YFWA 1RTVA 4ORFA 4Z82A 2Z69A 3LA7A 1QXJA 2B9UA 3FHIB 4KU8A 5FQ0B 3RNSA 1UIJA 5BPXA 2WC2A 4YRDA 1J3RA 5JR7B 3ROUA 2OPKA 4YARA 1ZRFA 2H0VA 2XL9A 1ZREA 1I6XA 1J1LA 1LR5A 5FCCA 1QWRA 3E5QA 2Q4SA 3BPZA 1X7NA 1ZX5A 3EBRA 3IWZA 4KU7A 1X82A 1YUDA 4QM9A 1CAXB 4HN1A 4EROA 5BXXA 2CV6A 4E2SA 1O3RA 4UBGA 4QMAA 5HI0A 5J48A 1Q43A 1VR3A 1YFYA 1YLLA 3SCHA 3U11A 1X8EA 3HT1A 4BH9A 5I8TA 1ZZBA 4PIXA 2GZWA 4MGZE 4WZCA 5KHKA 3CF6E 3E6BA 1NZCA 3H9AA 2UYAA 4I01A 2D40A 4D7TA 1RUNA 4P9GA 3OTFA 4I09A 4L2NA 2KXLA 1EPZA 4H7LA 1OFNA 4XF3A 3FE5A 2B8MA 1Q5OA 1HW5A 4RD7A 4CYDA 2PAKA 4YYOA 1UPIA 1J3PA 4XEZA 4ZU4A 2MNGA 1CAVB 3OGJA 4MZUA 2GC3A 1RGSA 3OCPA 4LEJA 1J3QA 2PHLA 3UKTA 5I8SA 1RL3A 4D7SA 1NE4A 4I0AA 5LEJA 3FWEA 1J58A 3KGZA 1FI2A 3KMHA 5FDBA 4NVPA 3D0JA 4X6QB 3PLQA 2P17A 1QY4A 2E9QA 2B5HA 1XE8A 3QOPA 2VECA 2BEOA 4DINB 3IDBB 3LOIA 1J59A 1EY2A 4MGKE 1O3QA 3E5XA 1DGWA 3JZVA 3RYKA 3NVCA 3RZZA 2XGXA 4EWDA 3ST7A 3CL1A 3S7IA 4UBHA 3U0ZA 5JSRA 1FT9A 4AVBA 2ET7A 4HBNA 4MH0E 4AQ6A 5T3NA 5BV6A 4EWAA 2CAVA 1ZZ9A 3NSTA 4Q0QA 2CGPA 1O7FA 3EHKA 1SFNA 2WFPA 3NKTA 4L11A 1LRHA 2F4PA 1I5ZA 2EVXA 2UY8A 4R8HA 4EV0A 5BY5A 3WW1A 3DV8A 4IETA 1CAXA 5JSOA 5KBFA 1QXRA 3EO6A 4HMZA 3BALA 3FFQA 4MUVA 4IEQA 2MHFA 3H7YA 3S7EA 4EWEA 2Q0AA 1UCXA 3ACLA 1CAUB 3O14A 4LUKA 5E1RA 1UD1A 4J1XA 3H1YA 1VP6A 4O9GA 1CX4A 1GQHA 2IXKA 2XKOA 5JCTA 2Q1ZB 4IEXA 1YFXA 3L2HA 3B02A 3KGLA 4QXKA 4Q0SA 3M3IA 3TNPB 5J3UA 3NL1A 1XE7A 2GH2A 1G6NA 5EZWA 4R52A 3I54A 3LZZA 1DZTA 3UKNA 3CLPA 1ZNPA 4BHPA 4XFAA 3LA2A 4XFBA 3SMHA 1CAVA 3MPBA 1Y3TA 3FX3A 5EFUA 1SEFA 5FLIA 2PAMA 4I0BA 3N4MA 2EAAA 2H6CA 1Q3EA 2O1QA 3H8UA 4IEUA 4FAHA 2Z2SB 2QVSB 3WW4A 3H1MA 2K9ZA 1FXZA 3HIFA 3PNAA 2OYZA 5FPXA 5CU1A 4KWJA 5FLJA 4HSLA 2PA7A 4WBBA 3VHRA 2PTMA 2BYVE 4Q0UA 3I59B 3H1WA 3SCGA 4TLFA 2O8QA 3CEWA 2D93A 4JTNA 3RDIA 5F1RA 2XLFA 4FBFA 1U12A 4XFFA 3RYRA 5KHHA 3BCWA 2GC1A 2BNMA 4PJYA 4QM8A 3E97A 3SXWA 5I0RA 3ELNA 2H6BA 4IESA 1XRUA 3GBFA 5C6CA 3H50A 3WW2A 3BB6A 1ZZCA 4IEVA 4XFGA 2D5FA 4AVCA 3CO2A 4HVOA 3R6SA 1O4TA 4XF4A 5I8YA 4YSFA 2Q30A 1YWKA 1NYWA 5E16A 3KCCA 5AVPA 4HVRA 3FJSA 1CAWB 2D5HA 1DGRA 2PYTA 2CAUA 1H1MA 1CAUA 4FAGA 2XHKA 4FT8A 3OD0A 3H3ZA 3LAGA 1IPJA 1JUHA 2IC1A 4IEZA 1ZRDA 4YNIA 1O5UA 3ETQA 4MGYE 3QACA 1RUOA 1PM7A 2Y0OA 1WA4A 4PIZA 2C0ZA 1ZZ8A 4OFGA 4QGMA 4MX3A 2GU9A 3DN7A 1ZZ7A 3FZ3A 2I45A 4BYYA 3M70A 4KL1A 4Q29A 4KWLA 3ZDSA 5CADA 3MDPA 4HSJA 4LUMA 4K8FA 3DKWA 4QX5A 3EQEA 1UIKA 1O3SA 4ZU5A 4MV2A 4O9EA 4Q0PA 4QGNA 2V09A 1YHFA 4F8AA 3EJKA 3HT2A 4QGLA 2QNKA 4MGIE
chains in the Genus database with same CATH superfamily
1O5LA 2VNVA 2XPJA 3AP7A 1ZYBA 3HNYM 3OEBA 5IJRA 4D6QA 1GNHA 2HEVF 5FZFA 5FMCA 4AAPA 3AL5A 5FYVA 1PIV2 4XW3A 1AHSA 4IERA 2WL1A 2C9AA 2JG9C 5EYXA 1OPOA 4DO0A 2GC0A 2DCZA 4XPVA 3DGTA 4YGEA 3CJXA 4NHLA 4GKXA 4RGKA 3N9PA 2JD4A 2Q8OA 2R1BA 3H3LA 4LKSA 3ZVXA 4ES8A 3HD8B 3E6CC 2IVIB 3C3VA 3KCXA 1XYPA 5I0TA 4K8RB 2RMU2 2R49A 3WX5A 2ZBJA 1H2LA 4RFT0 2C1FA 4Y5TA 1HV1A 4FXGB 1NE6A 2NLRA 4BCUA 4LORA 2GNDA 3M8LA 1RUI3 3PDQA 3SKVA 1JYIA 1VRH1 3CBNA 2PQQA 4W8JA 3EYPA 1OD5A 4DEVA 5LZ6A 2ZGUA 5F3GA 1FATA 4IE7A 1KD7A 2VPVA 3C7OA 3UGGA 2J1VA 1W04A 1E5SA 1KS4A 1LGNA 3MHZA 4E8DA 1Z0HA 4YPJA 4PI2A 3ZMNA 4M4PA 5A70A 4AK3A 4A42A 3JCIA 1VJ2A 3PIJA 3JD71 1SLTA 4IDZA 4DEQA 4YM0A 5FPVA 5JXGA 3MBWA 4C0BA 2OUHA 4LOSA 4CDUB 4AEKA 4LLOA 2A71A 4CXYA 4HKOA 4J6GA 3WDXA 3POWA 4BXFA 1SBEA 4Q4Y2 1C57A 3TNQA 1FX5A 4L99A 4CPBA 3AB0A 2VL4A 3VKLA 1G7YA 2K2SA 1OI6A 4FOWA 4QDSA 1QH7A 5FLHA 4CP9B 3HN3A 4EN6B 1Y9QA 3A21A 3ZFFB 1RIRA 4XVHA 5F32A 4Y5SA 5AVAA 3U10A 1PMIA 5F39A 1HRV1 3CMGA 4AAXA 2CL2A 2IFWA 1UMIA 1Y4WA 4UF0B 1QXPA 4Q1PA 5EIYB 2ZMNA 4BQ2A 3ZFFC 1BJQA 5KHJA 1SCSA 2BNOA 1WLCA 2IXJA 4Z92B 2UU8A 5B4NA 2BBVA 3MYXA 2BPA2 1FV2A 4Q1RA 4AOCA 4BLJA 5ACA3 4R9DA 3GZAA 2WJSA 2XDVA 2AEYA 4YG3A 3PL0A 4M3CB 3KF5A 2BGCA 2VH9A 4AI0A 3TOJA 1JZ4A 1PHMA 2ZOEB 3MLKA 4CCDA 2DV9A 1QDCA 1WCSA 4JAAA 2IXLA 4C0HA 1FPN3 5BUVA 1F5JA 1C8NA 3INAA 1QJY1 1NQJA 5DUVA 3HQXA 1MQTA 4Y5Z0 1UF2C 3ES4A 1JI6A 4ASKA 2RS52 2IXCA 3AKSA 3JQXA 4NUBA 4JZRA 5T50A 2PMWB 4DB5A 4NIDA 1UL9A 1OURA 1SDWA 3OF1A 4Q0VA 5LY2A 5IVVA 2ZGNA 4AQ2A 4IEPA 5C3PA 3PHMA 3POIA 3BOWA 4QX0A 5H9PA 2BW8A 2R072 5A3NA 2VQ0A 4I2OA 1UYPA 1RUD2 4GH4A 4G3YC 4LHSA 4FPLA 3MO4A 2WDBA 1CVNA 4UFIA 2WWSA 4AVCA 1TZOA 2JG8A 1DLLA 2D43A 1WBLA 1RVF2 1V6OA 2WT1A 1W2AX 3AZVA 3VD5A 2D98A 4AVAA 1OQ1A 1R093 4B1LA 5CFDB 3U75A 4J1WA 4DUXA 4K21A 2BNNA 5CVRA 3GM8A 2LROA 5I0UA 4F83A 2VZSA 4Z1VA 1O4YA 2N7GA 5KC6A 5FYSA 5IK8A 4F7ZA 4YFZA 2CNAA 1ZBE3 3MW4A 5FK7A 4DPNA 2F4LA 4Z82A 3P3NA 4YW1A 5JOWA 1IS4A 2JE7A 5FQ0B 4V2VA 1V9U1 1TVGA 1PZ8A 1UIJA 1WZXA 4Q5OA 4YRDA 4QPYA 1PO12 3LSDA 5JR7B 1H4HA 1SLAA 2EXHA 3AP5A 4AQTA 1H2NA 3I49A 4CEYB 3N9MA 4N90A 5JMCA 2WS92 2R063 4QPIB 2ZX2A 4WVWA 1ZBA3 2Q4SA 3KD4A 4GWNA 4NWVA 5FYCA 1JYCA 2YBKA 4WZFA 5D8AB 5FZ4A 5F5AA 5DDJ1 2W1UA 4AHZA 1X82A 3NO8A 2VZ1A 4P08A 4HN1A 4AGRA 5C8CC 2YU2A 4IGPA 4JGZB 3HJRA 4FAGA 4GZ9A 3BOPA 4UBGA 4XJZA 5D8AC 5HI0A 2ZABA 1VR3A 2WRAA 2DCKA 1VBD2 1OH4A 4XQ4A 3J8F1 3WY6A 1QJX2 1W9TA 4N8MA 4PLNA 1Q8QA 3FL7A 1TNFA 3WP6A 4WZCA 4W6WA 3CF6E 3K4DA 4TSVA 3Q9OA 1U0AA 2XUMA 3I2OA 1DCSA 1JYVA 3BIEA 2D40A 4F3JA 4FPCA 4COZA 2QQKA 1I5PA 2WNUA 1K3IA 2YDEA 2KXLA 4XJ8A 3TRSB 4AG4A 2AUYA 1V00A 2D6NA 3KQRA 3VBUA 3T2QA 3VBHA 3O1RA 4RS5B 3T4VA 4XF3A 5LK5A 1RHI2 2DDUA 1AF9A 2B8MA 3FE5A 2BDRA 4Q4W2 4LBQB 4WVVA 3U78A 3GZEA 1AR92 4KMQA 4N53B 2CDPA 5EXOA 4CEWB 1IS5A 3AXEA 3O1PA 4YYOA 3EMRA 2ZTNA 3WG4A 2DCYA 1GP6A 2W08A 3FUOA 4RS5C 2D3PA 4CDWB 5A7OA 3JU9A 1LHNA 4QQHA 1BK1A 3UESA 2WN3A 4QXHA 1DHKB 2MNGA 4KBZA 4CEWC 4N53C 3V56A 1PIV1 2XHNA 4J25A 4A6OA 1NA1B 1PO23 2QQNA 3ZFEC 5GLUA 4CCOA 4FP2A 2I07B 4LEJA 1SG3A 4FOVA 3UKTA 3WLUA 4AR2A 4NAMA 4I0AA 5LEJA 3FWEA 4FQZA 1J58A 4NRMA 3RI9A 5FY9A 2Y33A 1NA1C 3WINE 1IKQA 3LQCA 4WM7A 2RMU1 3WDYA 4E4SA 2WZR1 4XCBA 4OI1A 4AEDA 1MEC2 2P17A 1F5FA 3UETA 4IL7A 5L73A 3K2OA 3ZFGB 5GZCA 4BDVB 2VOVA 4CP0A 3OUIA 4CSWA 1CR7A 1DYOA 2KA3A 2WO7A 3I2HA 2Y26A 5CKMA 3ZKYA 5JIAA 4DINB 3LOIA 4TTGA 3IPVA 2JDNA 1EY2A 3T0BA 2R0HA 4JRLA 3ZFGC 1IKPA 2D44A 1DGWA 1Q8VA 1W2NA 2J22A 3JZVA 3RYKA 3PMEA 5L9VA 4EWDA 3MIBA 3TBDA 2FDIA 5DXDA 1VRH3 3K3NA 4UT5A 3ZYHA 2WT2A 3I4IA 5JXIA 1FT9A 4AVBA 4LJHA 4MXWB 1S0CA 3OBRA 4MH0E 5FZ7A 1LECA 4EWAA 5FO9B 2JDZA 2JECA 3C2UA 3JD73 3MIEA 3GJBA 4GMP0 1WW6A 1JOJA 3OD4A 4KQ7A 3WOGA 2WBKA 1TNRA 4S2GA 3NSTA 3OSDA 2LRPA 4XHBA 1EUTA 5KR7A 1O7FA 4LKDA 4P9LA 1X33A 3RS6A 1SFNA 2I74A 4IV3A 4UAPA 4UFMA 3WG3A 5IFTA 2XWBB 5FYUA 1YQ2A 2W92A 2JDMA 4QX7A 1MZ6A 1VBA2 1UN1A 4EV0A 1QOSA 1W90A 4P00B 2A75A 5DPNA 1UZWA 3SH5A 4NIGA 4BJ0A 2DU0A 2Y64A 4YWAA 1EV13 1BQPA 1QXRA 3EO6A 4GAZA 3P3PA 4A4AA 1HRV3 3BALA 3LDRA 3GCWA 2E7AA 4TYSA 3OJBA 1E5RA 1T2XA 2MHFA 1N3PA 2QDNA 4KI5M 4XXAA 4Y20A 4EWEA 2FDHA 1W9YA 4O61A 3Q8AA 3KVBA 1UCXA 1W2OA 5FZOB 3USUB 4Q8LA 1RUE2 3VDDA 4J1XA 3T4HB 3H1YA 3NAPC 1UOJA 3ETPA 1HQLA 4NHMA 4QDRA 4XOGA 4UOJA 4O9GA 1CX4A 4RHV2 5B2GB 2HYKA 4AYUA 2BJSA 1H9WA 2RS51 4YM2A 2OT7A 4ZY9A 2AZ5A 3KM5A 3WDUA 1AX0A 4HFSA 5HCBA 3L2HA 3R4DB 1NAEA 1K12A 1BBT2 2QE3A 4JHZA 3T08A 4HG6B 3O1SA 1POV0 1F15A 1W99A 3CDZB 3TNPB 4XE9A 2R071 3HNBM 1KRIA 1RUD1 4ZHNA 3IZOA 1VMFA 1W6MB 2GH2A 1QJY3 5FBJA 1SACA 3I2JA 5A3TA 4A7KA 4ZKTB 1OC1A 2G9ZA 2VMIA 1K5MA 1RVF1 1MVEA 2HBUA 4GB33 1DZTA 2CY6A 2ZA9A 3CLPA 3LEGA 3OOXA 1ND3B 2RM21 1W6NA 4XFBA 2JXAA 3MLJA 4LKFA 3MPBA 4GKYA 3AXDA 4MHUA 5C5UA 3O1VA 3U1XA 1SEFA 3POGA 3UJQA 2A6WA 3PVNA 2P4EA 2PAMA 1W9FA 1RUC3 1HV0A 3WNKA 3T0DA 1H6YA 1VBC2 1S0IA 2NMOA 2O14A 5DMYA 3T3YA 1H2KA 1PX4A 4IEUA 3T2OA 5DUWA 4GWJA 4XZPA 2QVSB 2Y0IA 2ZX0A 2ZGQA 3WW4A 5F7UA 2OYZA 4CCMA 1DGLA 1PZ7A 5EWSA 2B42B 1PO11 4K1YA 4IV1A 3VBSC 4HSLA 4CUAA 1R64A 1NT0A 1N1SA 5FUIA 4FPGA 2WS91 1XC6A 5FXXA 2AH2A 4HKLA 4A3ZA 4OHYA 4XC9A 4Q0UA 2D6OX 5JMOA 3ON7A 5C3SA 2GP5A 4EZHA 1LHWA 1H8TA 4E4HA 5FBZA 4YW7A 4JDNA 1ASJ2 1KXGA 5JLVA 2ZX3A 1VBD1 2JDKA 4NO4A 1BCXA 3RDIA 4URAA 2A3XA 2XLFA 2WA4A 2BQPA 4G9SB 1QJX1 1W2UA 2QKDA 3S30A 2XWJB 1Y7BA 3V0AA 3PUIA 5DDJ3 3VBRA 2ZGMA 5F37A 1NCQA 5EJ3A 5KHHA 2FMDA 1CZSA 1UZZA 1X9PA 3JB8A 3UT0A 3BCWA 3VZNA 2ARBA 4ITCA 5A7PA 1UX7A 3J8F3 3A7QA 5DG2A 1W05A 2R7EB 4AQSA 5KXEA 2EIDA 1RHI1 1N1TA 3HVDA 2OW4A 2PHXA 2R32A 2VCCA 2XJUA 3ELNA 3SXWA 5F2SA 3ZYRA 2VTXA 1AR91 3AL6A 3GBFA 5IK4A 4LT5A 3WW2A 3BB6A 5FZMA 1RINA 3KS7A 4HOOA 1AR71 5CB7A 4ARXA 2WWJA 3UJOA 4EN0A 1O4TA 2WQ8A 4GMP1 5ABJA 3W5NA 1C8M2 2ZGLA 1LAJA 1SZBA 4N7IA 1UNBA 1UOGA 4MXVA 5AVPA 1DP0A 2JDHA 4HVRA 2WNVA 1ODNA 3UK9A 4OYUA 5KC5A 2D5HA 4E8CA 3VZKA 3VHPA 4BOWA 1CAUA 1EPWA 4FT8A 4QPGA 2P3JA 3K46A 4XXPA 3OEAA 5IAXA 1O5UA 1DYPA 3SH3A 3RZGA 1RUOA 1PM7A 1PIV3 2E32A 3IMMA 1MEC1 2QQPA 4PIZA 4M3CF 2J1SA 3IDAA 3VN4A 1QGLA 2PELA 3W59A 3HAGA 1DQ5A 3BUCA 5H9QA 1K45A 4CCKA 3B9IA 1CIYA 1VBE2 4MX3A 4LE3A 5SV5A 3GALA 1YCIA 3FZ3A 2VGDA 1SBFA 1UZ0A 2RMU3 1MQTB 4YZ1A 2WZR3 5A3LA 1AX1A 4DXTA 4Y4YA 4OUSA 5A7SA 3UV9A 4EN7B 4U36A 3WG1A 3J7NA 5CFCA 5FZEA 3J4UH 1BK0A 4MADA 1GOFA 5SV8A 3HPNA 3EB7A 2PHFA 4QQLA 3KT7A 1POV1 5J1XA 2VUDA 4MGQA 3IAPA 4GH4B 5GZGA 2JIJA 5HV0A 1US3A 4M0NA 2P2KA 3ZXAC 1REDA 2JG8B 5F9TA 4PDWA 4XIOA 1BYHA 1GLHA 2QNKA 5A6XA 1OLME 4GH4C 4BK5A 2JDAA 2HJIA 4BB3A 2BV4A 3MZHA 3Q8BA 4CDXA 2X53S 1UMZA 2H0BA 2JG8C 3TEWA 5FKBA 4E4DX 2JDYA 4LIUA 1C28A 1J1TA 4N9HA 4Q4Y3 2IXIA 4YGBA 2C9KA 3WD5A 4CCJA 3R0RA 5HCAA 1DQ6A 1VBA1 1DGRN 1GQGA 1WUVA 1ZZ6A 3GYDA 3I59A 3JXSA 1SQ4A 2ZKLA 2DTWA 3WP4A 2XJVA 1GZTA 2XXZA 4OMDA 3WEZA 1L7LA 3WNMA 2Q1FA 2W0XA 1QJU2 3WQ0A 3WUCA 3AZYA 2NYYA 1QMJA 3VDAA 2MPFA 1GKBA 3FLTA 1UAIA 2BZDA 1L7QA 4MGTA 4LK7A 3ZO0B 2FCUA 2BVVA 3NW4A 1RUE1 1N1VA 1Y9MA 3O0WA 3WW3A 1XJAA 3LA3A 2EAKA 3O5SA 3ILFA 4RHV1 4DNYA 5I0SA 4CXXA 5L19A 1QJEA 1OMIA 3PIGA 1W39A 4JV4A 1BBT1 2BTVC 2BGOA 5G05L 1V70A 3WQ1A 3T2TA 3IAQA 4IE5A 1JYNA 5JXHA 2KR2A 3UNPA 2YC4A 4PIYA 2W94A 4XUNA 3IMNA 4NHYA 1RC6A 3MEPA 2ID4A 2O0OA 2RVAA 2RS53 3H7JA 3N9OA 5K8SA 5LCWL 4QAWA 4TLGA 1DBNA 1LU2A 2Y6GA 1OBNA 2J1EA 3LB9A 4Y22A 1ZBE1 4AF9A 1PX3A 5LASA 2R073 2WNUB 3ACHA 5JZGA 2VCMA 4MHRA 1RUD3 2XL7A 3S0MA 2ETEA 1AXKA 4PHZA 3VBUB 1F9KA 1PVC2 3LFIA 4IEYA 3VBHB 4BQ1A 1AR82 1JN2P 2VBBA 3NJZA 3VBOC 1VBC1 3KWVA 4NPMA 3UKVA 2HBTA 1RVF3 4XACA 3I3QA 1DU3D 2WNUC 1S0BA 2CDOA 1YIPA 4KG0A 3VBUC 4P9WA 3VBHC 3WP5A 4XUTA 3K51A 4OUMA 4LO5B 5FV3A 2JD9A 4ASLA 2ET1A 3D0SA 1MZFA 3DL3A 2QDRA 5DAPA 5LRRA 5CG8A 3FN9A 4LTAA 2UY9A 5FZAA 4I02A 4OHWA 1F4AA 3I2FA 1AX2A 2W47A 1UKRA 3D8CA 4AFAA 2BU9A 5I93A 2GC2A 3AMNA 2PFWA 2XLGA 1CD3G 1GZCA 1W9WA 1CJPA 3HBKA 3VZMA 4WV8A 2MEV2 4LBQD 3KSCA 1DGWX 4WM7B 2BFUL 2ADEA 2JJ6A 3GXUA 3OGRA 1PO13 5A3PA 2XJTA 4AEDB 4I3PA 5GM0A 1MS0A 5J37A 1O3TA 2UYBA 2WS93 3MW3A 4GJZA 5KXCA 1WLTA 1REEA 3QH6A 4BXSV 2BUKA 2ZEXA 4SLIA 2OZJA 1DQ0A 1RUG2 3FC0A 3ILRA 3NV2A 3ENRA 5K0UC 1B35A 2C6SA 1GOGA 3IPVB 3RG0A 4UW6A 3RWKX 1UOFA 2YC0A 3K75B 2YMZA 1EYBA 1FOD2 2FDJA 4FOQA 4OI0A 2G9FA 5C33A 3L2YA 1G9AA 2VVEA 4Q27A 1VBD3 2VW0A 3VLBB 5FY5A 4IGQA 1GWLA 1QJX3 2YY1A 2NZ9A 4FO9A 1GFF2 4WM8A 4RSUA 1I9RA 4JTOA 1W8HA 2VM9A 3NRUA 3SQOA 2OPWA 1CESA 1K42A 1W8NA 4AWDA 2VCBA 2YGMA 1OF3A 1RTVA 2EIEA 2WZ8A 3M2MA 4C1XA 2W1WA 1JZ5A 3S57A 4XCAA 2LALA 5FP7A 3LA7A 4D6SA 2TUNA 4AFDA 4CUGA 4KU8A 5FWJA 5F3EA 1LULA 5FY4A 5C4WA 1C8M1 2RDQA 5FMDA 2YG0A 3AZXA 3I8TA 3LEMA 3KV4A 1RHI3 4BZ4A 4Q4W3 3VDBA 2OPKA 4YARA 1AR93 4IV3B 4ATEA 5FCCA 1J1LA 1J84A 3TAYA 1QWRA 4BPZA 3NV1A 3POYA 2BVBA 5DAVA 5BNQA 3BPZA 2HLEA 4EZ4A 1AR73 2PN5A 3ZSJA 2GMMA 3WHTA 1XNAA 1IGOA 2CSGA 4IV3C 2WO1A 4GMP3 4M00A 4QM9A 2BOIA 4EROA 2J1AA 1LOBA 3B69A 2CV6A 4LO6B 4XBLA 5FMOS 2OIIA 2XUEA 4E2SA 5BNNA 4R9BA 5EPAA 1G8WA 4CUCA 4MG2A 1OF4A 2EIGA 1UOBA 2HWB2 3H0OA 4Y20B 1XNCA 3SCHA 3NJXA 5IATA 4Q2FA 5CKQA 3U11A 1F8VA 5F8PA 2DUQA 4JDOA 4BISA 4M3CE 2LUWA 3CU7A 1OH3A 3VDDB 3POSA 3D5OA 3LE0A 2RDNA 1MS1A 2GZWA 3UL2A 3VBFA 4K6BA 5ERLA 1E57A 1ULFA 1UKGA 3WG2A 3WR0A 1MEC3 4Y1YA 3WF4A 3H9AA 3I3EA 3VDDC 2ZACA 2L9LA 4B4RA 4D7TA 3KHBA 1GANA 2ZEZA 2ZMLA 4P9GA 3B94A 1RUNA 2RS12 5T55A 1OD3A 2B45X 2OS2A 1JZ6A 4DXZA 4LBNA 4Q4X2 2XOMA 1EPZA 2BP6A 4LKEA 4L8QA 2VMHA 1Q5OA 3MFCA 3PUQA 5A7QA 4P9JA 5JOXA 1I3HA 3AP6A 5FYZA 1K5MB 2PAKA 4AI2A 2E51A 3I3MA 3K3OA 3WSOA 3FHQA 4ISRA 3RWNA 5C3OA 3W9AA 4XEZA 5L7OA 4ZU4A 1W6NB 2OQ7A 2EXJA 2VO5A 1HJFA 1C5HA 4CDUC 1K5MC 1POV3 3FMGA 4RGGA 2XR4A 1XU1A 2GN3A 4V2WA 3OCPA 3VD3A 5CAZA 5IFPA 4ATFA 2DYCA 2ORXA 1EV11 1QNWA 2CU5A 5I8SA 1JH5A 2DCJA 3BTAA 5DG1A 5AC92 3VKOA 2YXSA 2W68A 3T09A 1XSQA 2JENA 4XIKA 1UU4A 3OUHA 5FYIA 3KMHA 2A73B 1QJU1 1AL0G 1AYN2 1C5IA 3D0JA 2QUOA 1LGCA 4TZDA 4IV1B 3PLQA 1W6PB 1QY4A 3W21A 1WMXA 1YC61 3WDVA 1UO9A 2HWF2 3TWIA 2A6XA 3AFKA 1F2NA 2ZMKA 2B5HA 2ZHNA 1VBA3 3ZR6A 2ADDA 2VECA 1DDLA 1MR5A 1D4M2 3IDBB 4QB6A 4RA0A 3ZPOA 1TG7A 1S1AA 5FK8A 5JOYA 1ACCA 1O3QA 3PUAA 4B7KA 2B4KA 1H8TB 1LEMA 3WNPA 3LOBA 1LTEA 1C3HA 5FZ6A 3NVCA 1AJKA 3VDCA 4ARYA 5DZGA 1QOOA 3MI8A 4GB31 5K7PA 3Q8CA 3P5BA 1RUE3 4UBHA 2ZGPA 1O4ZA 5ANNA 2CGOA 3U0ZA 4DXRA 3V0AB 4RHV3 3KZ4C 1G9DA 2ET7A 5F6LB 4A7ZA 1HRI2 1NCQB 4P9IA 3WNNA 2BWAA 1HDKA 1GSLA 1W03A 2R16A 1BBT3 1ULPA 1RUC1 5EJZB 1ZZ9A 4AL9A 4CUBA 1KFUL 4Q0QA 2DWRA 2CGPA 1PVC1 3EHKA 3T1MA 3IDEA 3POJA 2WYFA 2W2IA 4CP1A 3NMBA 2VC9A 3O1UA 3W5MA 3N7LA 3BU0A 1I5ZA 3DCQA 2EVXA 4DRVA 1CIWA 2XJRA 2Z42A 5BY5A 3DV8A 5CFDC 3O7OA 3QH7A 4Z2WA 2ZJCA 3R05A 4MLOA 4B4PA 5ABJB 1BEV2 2DBIA 3Q8EA 1JTZX 3ZMOA 4K40A 4HMZA 4E4ZA 4QQPA 2TBVA 4IEQA 4D94A 1VBC3 2WNVB 3S7EA 3ACLA 1V0AA 1CAUB 5E1RA 1UD1A 4QPGB 1VBB2 3POEA 5CYYA 1YQ8A 5H9SA 1GQHA 2VE1A 1GMMA 2XKOA 2V4VA 2WNVC 4M4RA 4IGOA 4OUEA 3P1IA 2Q1ZB 4XBQA 5JCTA 4LIVA 4CPBD 5GLVA 2WAAA 1NCRA 4CEYC 4EYUA 2BWCA 4QPGC 4QXKA 4Q0SA 4CVUA 1XSRA 2QQLA 2RHPA 2CWMA 4LO4B 4PQQA 4QPIC 5IVBA 1H30A 5IW0A 5KXDA 1GOHA 1RUG1 3NL1A 4RL7A 1PK6A 4AVSA 2ZGOA 1W8UA 2ZX1A 5DAXA 2G19A 3GDBA 4H14A 3WF3A 5GZDA 3WCRA 4R52A 4JGZC 1FOD1 1NUKA 3V0BA 3LZZA 1ASJ3 3HEIA 4C8DA 3A23A 5CFCB 1UQXA 4XFAA 2XG3A 5A6ZA 2XBO1 1CAVA 2RJKA 2QZ2A 3ZXFA 3OB8A 4FFFA 4DMIA 4A41A 4M0HA 4FSJA 5FLIA 3J7MA 4BLIA 1WCUA 3OPWA 3N4MA 1I1EA 5T5JA 2EAAA 2H6CA 4CCCA 4YZ3A 1O91A 3WF2A 2R1DA 4PDWB 2ZZQA 3SNMA 4CXWA 5FIXA 4YM3A 2P5BA 1WMEA 3DEMA 3H1MA 1FXZA 4CDXB 1HX6A 1PNFA 1F4HA 2HYXA 2RR12 4KWJA 2AREA 3P6BA 3ZYJB 2PA7A 5FYYA 3URFA 4PDWC 3VD7A 3WVJA 3VUOA 4RQPA 3SEEA 4FTSA 2J1RA 4JRAA 4FFHA 4QDQA 4CDXC 1LCLA 2VU9A 1LHVA 3I59B 5LBBA 4CU8A 4PT6A 5IVEA 3D4KA 4CDWC 1XNKA 2OVUA 2NN8A 2VNGA 1C8M3 1UZVA 4N43A 3IN9A 1S0DA 3OUJA 5HV4A 5FKCA 2BGPA 1O59A 2VMEA 2A5ZA 2HWB1 4JC1A 2HWC2 4JTNA 5H9RA 1N3QA 2P1BA 1D7PM 4NIIA 4AE2A 4NIHA 1RUF2 5A33A 2GSYA 4FBFA 3ZSKA 1ULDA 1UYYA 2J1UA 5BNOA 3N36A 1BVVA 4PLOA 3U07A 3BIWE 2GALA 3KB5A 1PNGA 2Q1MA 2HWD2 2ZAHA 4XFFA 5GLZA 3MUY1 5CZKA 5J98B 3WF0A 1U5IA 2DURA 2VCAA 2W1QA 5IVFA 1RB8G 2YFUA 2OUJA 1UY4A 5LK7B 1HN0A 2RS11 3AZWA 3WHUA 1H6XA 1VBE3 5EHDA 4PJYA 4U2AA 1F35A 1URXA 4Q4X1 3F95A 4ZZ8A 5I0RA 3AZZA 3KV6A 4DIQA 2H6BA 1X36A 3OBAA 2R042 2JDUA 2ES3A 5C6CA 2DUOA 2V72A 3LIHA 2OX0A 5DAQA 3PTYA 3AMPA 3R4SA 4YLZA 1OOPA 3CJIA 4HVOA 3R6SA 1IG0A 2ARCA 5FFOC 4Q4Y1 4Y22B 3ZXEA 1YO8A 2GN7A 2P3KA 2BRTA 3B9CA 4UFLA 2Z79A 3RJ2X 1YWKA 5JZGB 1NYWA 2VZ3A 4AGVA 1AYM2 2TNFA 4XYXA 5D2AA 2YU1A 3RMYA 1ZA4A 3VD9A 3FJSA 2PYTA 5LW9A 1H1MA 1LOEA 5AC91 1NLQA 2XHKA 4R9CA 4XQWA 4KGGA 3LDKA 3A22A 4ZS2A 3FLRA 4XZUG 2Y60A 4HK8A 5L9BA 1TEIA 2DTYA 2QBXA 3QD6A 2EIBA 1AYN1 1WD4A 4PLMA 5BNPA 1WA4A 2VMGA 5C71A 3NJYA 2DF7A 2WLPA 1W6OA 3CKHA 2HWF1 2Y38A 1C1FA 1W8WA 3C7HA 3BTYA 1ZRIA 2A3WA 1GQPA 2IWGB 2ZHLA 3GNEA 5EJ1B 1D4M1 5IT6A 5JIUA 1CWPA 4X8PA 2A6VA 4Q4V2 4MSVA 2WABA 3M70A 4KL1A 3KCYA 4KWLA 1J83A 1QJU3 4YM1A 3ZDSA 1NLSA 4QWNA 4CCNA 3JUUA 4HSJA 1HN1A 1UX6A 2X5IA 5FZHA 1ENQA 1IG3A 4QX5A 1XB9A 3BGAA 4PI0A 5FREA 1KEXA 5LA9A 4QQ2A 4OZXA 2EALA 1UIKA 1UWWA 1IZ3A 2WA3A 3HBZA 4XAEA 2G9GA 1VRBA 4XUQA 4JKKA 1YQCA 4CDQA 1MS5A 1RMU2 1SMVA 4O9EA 1GUIA 4Q0PA 1YHFA 1B35B 4Y4RA 1IS6A 3K48A 1QQP2 4DFSA 1JOBA 1UU6A 4QGLA 2JEMA 2YBPA 1DLCA 3DECA 4MGIE 2PHWA 1ZA7A 4OQ8A 2ZEWA 2ZGKA 5APAA 1S2BA 2VULA 4AEJA 3A4UA 3IDCB 1TQ5A 3R4UA 4WM8B 4XF9A 4AI9A 1K5JA 3ZXGA 4B3NA 3ZYBA 1R1A2 4BQ3A 2WQZC 1RUH2 1W2TA 3OY8A 2FDFA 1EP0A 1LKNA 1PGW2 1WA6X 1ND3C 3QBQA 1QEXA 3LCPA 3PUSA 2EA7A 4IE6A 1BEV1 2ORZA 3NWKA 4YVWA 5C4WB 4AVTA 4ZPIA 5FZ9A 1PVC3 2VMDA 1AR83 3DPRA 4LXLA 1OXCA 3MICA 3SKJE 1NQDA 4AW7A 1RUJ2 2C24A 3IB3A 1H1IA 3JQWA 4YGDA 4YVSA 4GULA 1CX1A 1XPWA 3ZLIA 1WW5A 5C4WC 1LB2A 4ES9A 5KHIA 1L3JA 1VBB1 5FMBA 4D8MA 1ZRCA 4ZXEA 3ZM8A 4PQ9A 1C4RA 1OT5A 3G6JB 4XILA 2WO3A 1YXWA 3F2ZA 3GCXA 1US2A 4WVZA 4JVAA 4XQDA 1LOGA 4FPEA 5FAXA 5BNNB 1GWMA 1G9CA 1SBDA 4FCAA 3T2PA 3ZSLA 2VNRA 1AR62 2LS6A 2A70A 3LIGA 5FPBA 1W0NA 1A8MA 3ZXLA 1V6LA 5LBEA 4K20A 2MEV3 3ILNA 4JQRA 5C8WA 3LF7A 2VQUA 4N7UA 3VBFB 1X9TA 2W46A 2D97A 2VOKA 2W52A 2WNOA 2X09A 4OULA 4OLLA 4E27A 3I2IA 2YC2A 3FHAA 5E6HA 1RUG3 5HXMA 2E6VA 2DU1A 4FP3A 4H55A 2VY0A 1UXXX 1ZVFA 4XFIA 5CISA 4XDQA 1BLZA 1D2SA 3WNXA 2P37A 1CAWA 1ZRRA 2WIIB 1FOD3 1OPMA 3AKRA 4FPOB 4Q4W1 2GMEA 3LDBA 4R4ZA 4DQAA 4FPJA 2ZCWA 1WW7A 5C7GA 1EAH2 1S55A 2XBO3 3SCFA 5J7MA 4P5HA 4YZ5A 1DF0A 1CZTA 3M1HA 5L7OB 3HNMA 5I91A 5HBAA 2CGNA 3DXTA 4QB2A 3ES1A 4BWOA 4FFIA 4AFMA 4AHYA 1GWKA 5F5IA 4BIFA 4XFHA 1Q56A 1HB1A 4YZ4A 5KXBA 1LENA 3KHCA 4BQ4A 1W3XA 2D6PA 3AJZA 4XF0A 1WMFA 1XOYA 4HLTA 2XLAA 5FZKA 2FCTA 3OYWA 5FPZA 3ACFA 3FBMA 1Q8OA 1RJ8A 4L92A 2OZ6A 2DVAA 4QU1A 3TEZA 4JCKA 2W91A 1NXD1 1M4WA 3DYOA 1PO22 2HEYF 4QKFA 5IAVA 3GJAA 1RUF1 4HT1T 1QF3A 1W6QA 2XQXA 5T54A 4DY3A 4HVQA 5K4LA 4LO8A 2XVKA 3LWCA 5FOBB 1YJKA 1YQ6A 5FQ0A 2HWD1 4XETA 5A3OA 4OHVA 3RYPA 1NOVA 3HQRA 1WWYA 2VZQA 2HWB3 4M01A 2QCSB 4META 3AKQA 4QKBA 4XJAA 2J42A 5C8CA 3M3CA 3IIAA 4HN0A 1JOPA 2TEPA 2WN2A 4WVMA 4N9IA 4R4XA 4ZZ5A 2VOXA 3AMMA 5T52A 2GAUA 2JIGA 2W39A 4AZZA 1MQTC 1QIQA 2VXRA 2D6KA 1X50A 4G4FA 4ORFA 1BMV2 2Z69A 2RS13 4BU2A 4JDMA 2B9UA 3FHIB 1S2KA 3RNSA 1V6JA 2XVLA 5BPXA 3BTXA 2WC2A 4Q4X3 4ZONA 3WNOA 4NR1A 1J3RA 1AYM1 2JKXA 2P6CA 3ROUA 2KD7A 3MIFA 1A8DA 3MGUA 1ZRFA 2E7TA 2ZKNA 3AYEA 3RJRA 2H0VA 2XL9A 2J7MA 4EE2A 1XNBA 5FY8A 1MS8A 1OKOA 3E5QA 5FYTA 4CA9A 3JBG2 3LPGA 5LA2A 2VOTA 1X7NA 4LOTA 4XJUA 3RQ0A 4LPLA 3IWZA 4KU7A 1KJRA 1V6KA 4DS0A 1YI9A 3N7JA 1YUDA 1AZDA 4L97A 4LBKA 5BXXA 2VZRA 1UYXA 3RRDA 2Q8EA 2ZPXA 1O3RA 5C9AA 5J48A 1LODA 1Q43A 1YFYA 1YLLA 1GZ9A 2VVFA 2YB7A 5AFBA 4CEWA 5AC93 5FY1A 5DQ0A 4O65A 3DKQA 1ZZBA 4Q4V1 3ZFEA 2RE9A 1AXZA 1KS5A 5KHKA 4UFJA 1POQA 3E6BA 1AYN3 4XMIA 1JXNA 5IVJA 2DUPA 2UYAA 4QHZA 2GDFA 2PLV2 1JZ2A 5FPAA 1NCRB 3LGRA 2XQRA 3AYDA 5FPLA 3OTFA 2Y6FA 5FZDA 1BVP1 2HWF3 4BMEA 4PBPA 4Y24A 5JUVA 3U4XA 4I09A 1HRV2 4XBNA 1CPNA 4P9XA 3H8OA 1D4M3 1PK6B 2AC1A 4XDPA 2R30A 4YFWA 4COVA 1HW5A 4RD7A 5FJHA 4O7XA 1IQAA 4LNVA 1CZVA 1QQP1 1UY3A 3ZDVA 3V0BB 1UPIA 1QHDA 5DN2A 3H8RA 2JICA 4XTPA 5A32A 1SPPA 1UMHA 3J7HA 3C7GA 2DFBA 2YZ4A 1WW4A 5A3MA 1CAVB 4MZUA 4UWDA 4HL0A 3H42B 3OBTA 1R1A1 4LHKA 4UFKA 4LITA 4D7SA 5T5LA 1SLLA 1DQ1A 1IS3A 4XHXA 3PURA 1PGW1 2WFF2 1KJLA 2VMCA 4D0QA 1G9FA 1HQWA 2HH9A 3IM0A 5JWPA 1TME2 4B1MA 1JYWA 1HLCA 1RUJ1 1T6GC 2ZHKA 4QX1A 4Q8KA 2R0FA 4RQPB 1COV2 3MUZ1 1DIWA 1FAYA 5G04L 1A6CA 1ENRA 2BEOA 1W8OA 3LFMA 4NPRA 1J59A 4MGKE 1BEV3 1VALA 4RQPC 4N43B 2VNOA 3E5XA 1S0GA 4MGSA 2P6HA 4FTBA 4Q26A 1AR61 5IVCA 4Y1UA 3ST7A 3N7KA 4DXSA 5DZEA 4LBMA 1ASJ1 2DVBA 5A33B 1N1YA 2IUWA 3M3QA 1VBB3 4W6XA 5FYBA 5BNOB 4A44A 4WM7C 3NQHA 3ZXJA 1JU3A 2E7QA 5EV7A 4HBNA 3QLQA 1IOAA 1V9U2 3OGGA 4HPKA 4AEDC 2QZ3A 5A7WA 2CAVA 1OVPA 5A80A 3K4AA 3NAPA 3MF9A 3NNGA 5BNOC 4OI4A 4TWTA 1R1ZA 1D0HA 5ANQA 4YW4A 1G86A 4V1PA 4L11A 3NKTA 1LRHA 4OVEA 2IZWA 3ALQA 5LB6A 1VMHA 4Y26A 2YYOA 2RG4A 3KV9A 2F4PA 2ZZJA 4NROA 1LHOA 4W6YA 3LPFA 1XQNA 5JR2A 4R8HA 1OOPB 2LTNA 3CJIB 5FOJB 3WW1A 3CIHA 1ND2A 1CAXA 1PGSA 3UYJA 1W06A 1D0GA 3J9SA 5KBFA 4D69A 4QT6A 1OQDA 1U5XA 5L9RA 3ZSEA 4CU6A 1QJFA 1E5HA 3J8F2 3POBA 3FFQA 3VD4A 5FP4A 1OOPC 4BK4A 3H7YA 2YV8A 1S0FA 2C4XA 1MS9A 2ERFA 2VUCA 3H8XA 1W8ZA 3NNLA 4NWWA 3O14A 4LUKA 4DOUA 5EYYA 5CG9A 3J26N 4X8NA 3U4SA 2VZUA 5FY7A 5GJ6A 3BI3A 2OKXA 4D3WA 1KQRA 5BNPB 4FQ4A 1YFXA 3I3BA 1W0PA 5JPNB 3B02A 3KGLA 4LLFA 4NE9A 4OCTA 3ZIWA 1W6OB 3M3IA 4I3GA 2OXBA 1GV9A 4AI8A 1XE7A 3VBSA 1G6NA 1VBE1 4IQPA 5EZWA 1OKQA 2CYFA 3ASIA 4JGYA 3VGIA 1JS9A 1JW6A 3I54A 2RS32 3GZTB 4Y1XA 1V6NA 2VUAA 3UKNA 1V6MA 5A6QA 3RZHA 2HWC3 4H3WA 2WKKA 2X5IB 3KF3A 3ZN6A 4AHXA 4BHPA 4CU7A 1JZ7A 4NHXA 3SMHA 2XJPA 1RUF3 1Y3TA 3FX3A 5A3WA 4CDQB 3RGBA 2VQTA 1OSGA 2X5IC 3HMYA 2JKBA 2AENA 1MS3A 1PZ9A 2EXIA 2HWD3 2IFRA 5JPMB 1S2EA 1BMV1 3O12A 2W5FA 2ARXA 5J36A 2WZR2 2O1QA 3M7AA 4CDQC 5FP3A 1Q8SA 1PVXA 2WQ4A 2Z2SB 1AL22 1O8PA 2YBSA 2E63A 2K9ZA 3PNAA 3FFZA 3GBGA 3RZKA 2R043 3DYPA 2E53A 5LBFA 3PJYA 3AK0A 1RITA 3JBG1 3VHRA 3PJQA 2B46X 2PTMA 2BYVE 5FZCA 5CA6A 3OY8B 3PU3A 1RYYA 3THDA 1GZWA 3SCGA 4Z8BA 1G9BA 1HIXA 3DXUA 4HKWA 4TLFA 4QPWA 3SH4A 4YVWB 1AYM3 4HK9A 1YIFA 2UURA 3GZUC 1CJDA 3N9LA 2QQJA 3CEWA 3DPRB 2W95A 1LJ7A 1YEWA 4IXLA 1KGYA 1QOTA 2FHRA 2UWAA 4OI2A 4PBOA 4QQOA 1MPXA 4YVSB 1U5YA 2ZGSA 3ACIA 3WQ7A 3KV5A 4YVWC 4YW6A 2A7AA 4JQTA 2WR9A 3DPRC 4L0PA 4RYDA 5GALA 2VD7A 2P3IA 5K9YA 4YVSC 3HWJA 1UY2A 2WNEA 1ONAA 4LE4A 4IV1C 2PLV1 1FMD2 1W28A 4JX0A 3I2KA 5A1LA 1PMHX 2GC1A 4JKLA 4UW3A 2BNMA 3LSEA 3POFA 1HJGA 2QQOA 2DBNA 5FJKA 4NPLA 3M3OA 4QM8A 3RMXA 3WT3A 4Q4V3 4XTMA 2ENRA 1CN1A 5I0DA 4IESA 1IPSA 3W58A 3I97A 5FO7B 1H8TC 1HXS2 3H50A 3QCWA 1AXYA 3LEIA 1Z7S2 3CHXA 4IEVA 4XFGA 3ZIXA 2D5FA 4XUPA 3CO2A 3O0VA 1WD3A 4XUOA 3VBRB 1SFPA 4GIQA 3ZXDA 1C1LA 4XF4A 5I8YA 1ENXA 1LOFA 2Q30A 1RMU3 5FUPA 1OQEA 5E16A 4FVVA 4LO7A 3O1MA 3ACGA 3KCCA 3OBZA 1R082 1VLNA 2EXKA 4HONA 5FZ1A 3VBRC 3X29B 1RJ7A 2V5YA 1NCQC 1CAWB 3WDTA 1QQP3 4LHNA 4A3XA 5CKNA 2FD8A 2WFF1 1AR81 4KWUA 1VB4A 1XYOA 3H3ZA 4QKDA 3VL9A 4K1ZA 4BQWA 1IPJA 1QH6A 2IC1A 3NV4A 4IEZA 1ZRDA 2AGSA 4YNIA 4MGYE 3ETQA 3QACA 4UW4A 1ULCA 3MIGA 3VKNA 1TME1 4AHWA 3RZMA 1R1A3 4OFGA 2RJLA 1BKZA 1LOAA 3WP3A 1RUH3 1COV1 3AMQA 3WQBA 4MO3M 3ZN5A 2GU9A 3DN7A 1ZZ7A 4AEMA 3A0NA 4H2AA 4QX8A 4FI9A 4BYYA 1WMDA 2D6LX 5FP9A 4FFGA 3OYWB 5FXWA 2XONA 2PHRA 3SC7X 3TN92 1SDDB 5ABJC 5HPOA 2MEV1 2RM22 3KQ4B 3MDPA 2BBAA 4LUMA 4K8FA 2VUJA 4XJWA 1FV3A 1RUJ3 2QQWA 3DKWA 4BM8A 4AVVA 5LY1A 1O3SA 2JWPA 5CIRA 4ZU5A 1IHMA 2FBEA 1JHNA 1W6QB 4MV2A 3BN6A 4OHZA 2V09A 3OPZA 1N47A 5BYNA 4QXCA 3B3QE 1SCRA 2D3RA 4F8AA 4RGAA 3AP4A 1A34A 2VTFA 1QDOA 5FZIA 4Z2AA 1AR63 1JUIA 4LBOA 4B29A 1NY72 4K3UA 3AFGA 2FMYA 3VL8A 4GWIA 4BE3A 4P5YA 4XAAA 5GZFA 2RJ2A 4E2QA 4YGCA 3E6DA 1AVBA 1TMF2 5C8CB 3OGSA 3S5QA 2IXHA 4D7YA 1LNSA 2B9VA 4WVMB 4E9KA 4HZFA 2HKXA 2XJQA 2Y8KA 5FZ8A 3WZ1A 5LWBA 2OA2A 2FCVA 4A6SA 2J1TA 2JDPA 1OLQA 2Q8DA 3USSA 2ARAA 2WT0A 4LBJA 4BMBA 5F5CA 1PGL2 5CFCC 4LULA 2ZGRA 5LRSA 3ZYPA 1LESA 2FDKA 4IEWA 2V73A 2WWUA 1GP4A 4A2UA 3JB4C 2GNMA 2JB4A 2W1SA 3MPPG 2ILMA 5EQUA 1W0OA 1JMUB 1O8SA 2X10A 1DG6A 5FXVA 4LA3A 2UWBA 4QHOA 1DYKA 3ZOIA 1EAH3 3G7DA 4A7YA 2K0GA 3B01A 4S2FA 3UGFA 1XBFA 3VBOA 1JZ8A 3ZN4A 4DUWA 4GA9A 1DZRA 1FNZA 3ATGA 1CGPA 2XKPA 5E88A 1LOCA 5FZLA 3LKJA 3MFAA 5C9AB 5FMOL 4AFCA 1CONA 2HWE2 2ATFA 2WSUA 4KBBA 5J09A 5FZ3A 4KH9A 5C3QA 1Q8PA 2JE9A 2UWCA 2PHDA 5JAXA 4LMFA 3ZFEB 4JHTA 2DVFA 1PMJX 3AX4A 1U5ZA 1X8MA 4LR4A 1AR72 2RS31 4URTA 4C91A 2A1XA 1XYNA 4NAOA 1REFA 1Z78A 3HOBA 3I7DA 4LA2A 4XF1A 2G4IA 4OZOA 2VW1A 3CZJA 1OA2A 5FP8A 1OLMA 4RR3A 2NMNA 4KWKA 1TE1B 4QHBA 4I30A 5F6KA 4AXOA 3PVBB 3AKTA 5IK5A 5FYHA 4PCRA 1WGPA 2KM2A 3SEPA 1KDKA 2D7FA 2VTXJ 4B7EA 3BPSA 3MF6A 3N35A 3O0XA 4MVTA 1MZ5A 1QU0A 4E2GA 1RUI2 4PF1A 1OFSA 1W3VA 2NQYA 4QX3A 2QJVA 5K0UA 3NNMA 1GR3A 3AYAA 3IBMA 3DYMA 5KHGA 1AL21 2AACA 1SPPB 1YFUA 4FOYA 5A32B 2DVGA 3APBA 3BU7A 3ZR5A 4KNCA 3WXPA 4CCEA 3GHNA 5C9AC 3NJVA 3SHRA 2WINB 3VKFC 1PM4A 2XMLA 4YW3A 2QTWB 2LM3A 4R9AA 2DFCA 4YG6A 5DABA 3WNLA 1E5IA 1WCDJ 1EUUA 1L7RA 2Z5WA 3GHMA 5D1IA 4KG8A 2VR4A 1BHGA 5DZFA 3VHNA 5JSPA 1ULOA 4IEOA 2JE8A 4XFCA 4XJ9A 4FPFA 1OHFA 5A1AA 3O1TA 4X6RB 1ULEA 3PUHA 5JZGC 2DCTA 2GP3A 1H0BA 1H2MA 1VPHA 3H3UA 4HANA 4UXAA 1ENSA 2A6ZA 1KFXL 1YJLA 2VBPA 1UW8A 5JI9A 1JODA 3N7MA 2W3JA 4K9SA 4QKNA 4JKMA 2A3YA 3D82A 3JBG3 5GZEA 1N3OA 3WCSA 4IW3A 5LBCA 5ISLA 3PTRB 3ZYFA 1WLWA 4ZU7A 4I0WB 4EJRA 4QU2A 1FMD1 2JG9A 2WAOA 3E5UA 4ONUA 2VBDA 2FQPA 3T0AA 4W50A 5IHRA 1IPKA 3RPQA 2ZS6B 3ZX7A 3U37A 5ACA2 1BXHA 4Z07A 4XABA 2VAUA 2VZVA 5DUXA 1W8FA 1OA4A 5LEKA 2PAEA 2VQAA 1HXS1 1YFWA 1HQNA 3ZYGA 5JVVA 4RN5A 1Z7S1 4B4QA 1W9SA 2EICA 1A3KA 2PLV3 4HPKB 3V65A 5A7WB 1D2QA 1HRI1 3I3DA 3NAPB 2R6QA 1FPN2 1LU1A 1QXJA 4L9BA 4NHKA 4ZXKA 3TEYA 5IK7A 1HB3A 1UY1A 2E33A 2VZOA 1R081 5LATA 2QFEA 1B35C 1H1AA 3KLSA 1YI7A 2RDSA 1GP5A 4FTEA 2Y6KA 1WCKA 1ZREA 1I6XA 1LR5A 3ABZA 2EF6A 3HR9A 3WDWA 1UYZA 4Y1VA 2GNBA 2FZ2A 4OMCA 1ZX5A 5FTTC 3EBRA 5FR3A 1XU2A 3BODA 3MV11 1SLCA 4COWA 1ND2B 1CAXB 2JX9A 3VHOA 3ZPYA 4WM8C 4PF5A 4YW5A 5FXZA 1QKQA 1APNA 1SLIA 2I2SA 5IWFA 3B00A 5TSWA 1P8JA 4GXLA 5A7NA 2Y6HA 4QMAA 5GKAC 3SITA 1R092 1X8EA 4W4ZA 5T5PA 5F3CA 1ND2C 1UU5A 2WFF3 5J96B 4AGGA 4CDUA 3AVRA 3HT1A 4BH9A 5I8TA 3A0KA 4PIXA 5JXJA 1H9PA 4MGZE 3K4ZA 1OLRA 3TN91 3I2DA 3VZJA 4NMIA 1NZCA 1ZBE2 1TME3 2QQIA 2VOWA 3MLLA 2VG9A 4I01A 4BQYA 2VW2A 2ZGTA 3EXUA 1BZWA 1COV3 4CP9A 5E89A 4L2NA 3ZFFA 3AVSA 3OG2A 2YHJA 1IQDC 3RVHA 4H7LA 1OFNA 3VBSB 1UZYA 2XJSA 4UF0A 2ZHMA 4JGYB 1GBGA 3AJYA 2CHHA 5BNNC 4CYDA 2VVDA 2R062 3B93A 5B4XA 1NLRA 3GBWA 4C1WA 1ZBA2 3I2GA 4CP2A 1NY71 3VZLA 3ZN6B 1W6PA 1J3PA 4AI1A 4JGYC 4YW2A 1TMF1 4CTEA 4DY5A 2FZ1A 3OGJA 4TN7A 1RXGA 1VE0A 3ZKUA 5KWRA 2F17A 1DFQA 1RGSA 2GC3A 4M3CA 3VBFC 1Y43B 3LEKA 1SFYA 1T6BX 2BERA 4ZS3A 1J3QA 2D3SA 2PHLA 1V9U3 2YFZA 1ALYA 1RL3A 3KVAA 1NE4A 3L9JT 4Y1ZA 1H4GA 5C3RA 1PGL1 2BFUS 1GYKA 3KGZA 3ITQA 2ZAAA 3D3AA 4DUVA 1FI2A 2P3YA 1KITA 1V6IA 2FDGA 5FDBA 4NVPA 5JI7A 4X6QB 5FPUA 2YPDA 5FWEA 2RR11 1QJZA 2Y6JA 5FZBA 2E9QA 3TEXA 1XE8A 3QOPA 3VV1A 3AKPA 3CQOA 3S6PA 1STMA 5HXVA 3CNAA 1GZWB 5L7OC 2NP0A 4UFHA 3RZLA 1OUSA 4YZ2A 1GNZA 1UPSA 2HWE1 3RZZA 2XGXA 5CFDA 1WLDA 4UI9L 1JU4A 2SLIA 3OPTA 2AR6A 3CL1A 3AP9A 1F31A 4NRQA 3S7IA 3MW2A 5A3UA 2HWC1 4UW5A 5JSRA 5HCFA 1JYXA 5HCHA 4P14A 1VAKA 1WKYA 1YYNA 2VJXA 3D6EA 1DQ4A 3Q8FA 3BTZA 4AQ6A 4YG0A 5T3NA 5BV6A 4P02B 3NV3A 1AJOA 5CNAA 4OHXA 3C7EA 2YROA 4INDA 4GWMA 3V64A 4H7MA 3WF1A 2G1MA 4CEYA 3FUQA 1VAVA 2WFPA 5FZ0A 1ULGA 2W9XA 2RS33 4XURA 1RUI1 4QPIA 4SBVA 2Q8CA 1WCQA 2A6YA 4GJYA 3N3HA 2R041 5D8AA 2UY8A 1M06G 3IKWA 1UY0A 2RDRA 2WUHA 4CU9A 2Z4FA 4IETA 4NJ4A 2YGLA 5JSOA 1JHJA 5FO8B 2F6BA 4JGZA 3C7FA 5IVYA 3TB0A 3HQUA 3GGLA 3PU8A 1FNYA 4KGQA 4MUVA 3SISA 2B39A 4XDOA 3AC0A 1JBCA 3PVEA 1CQ9A 2Q0AA 4MOAA 1XNTA 4LBLA 2V5DA 1VRH2 4Y33A 1LOFC 4D6RA 4ET7A 3PVOA 4CCLA 1AL23 1VP6A 2C26A 2IXKA 3THTA 4ISQA 3T30A 4BQ5A 4LHLA 3RFRA 1MVQA 4IEXA 1CPMA 1MACA 1NZIA 2NPIA 1LEDA 3TYJA 3JD72 3NKGA 4EQVA 2Y6LA 1VB2A 1XXNA 1LHUA 1Y9GA 3LD8A 4K7JA 3M4FA 5J3UA 3ME2A 3BYWA 3RZJA 4GALA 3NNFA 2AYHA 4RS5A 3E1F1 4LBQA 1JZ3A 4N53A 1FYUA 4S2HA 1W8TA 5C5TA 2ZXQA 4NIAA 3AYCA 2B7YA 2RV9A 4CDWA 1ZNPA 3IT8A 3UGHA 1A78A 2SBAA 3LA2A 4NOTA 3C8XA 5A6YA 5ACA1 4EN9B 5EFUA 3N9QA 1EV12 1NA1A 1QNYA 5FYMA 5E8AA 1LGBA 4I0BA 4IE4A 3BKZA 4NN0A 4P9YA 2NM1A 1RMU1 1GU3A 1FMD3 3DUIA 2VMFA 1Q3EA 1NCRC 3VB9A 5LA0A 3H8UA 1FPN1 4CZSA 2YPJA 4AI3A 2P34A 4QB1A 4FAHA 4RFRB 1YNAA 2IVJA 2JB8A 3HIFA 2Q5TA 2O8OA 5FPXA 4LK6A 1PK6C 5CU1A 2PQSA 2GH8A 4DZGA 1GICA 5FLJA 2PHUA 4A45A 3ZFGA 4EN8B 4TXWA 1HXS3 3W20A 2X29A 5L36A 1Z7S3 4WBBA 3KT1A 1DQ2A 3HN1A 1NX9A 1HRI3 1KDMA 3M3EA 4GD4A 2WZPP 3ZXKA 1RUH1 2AEZA 4S2DA 3U14A 3O1OA 3H1WA 1QJY2 1YRZA 3ZYIB 2CWSA 5FRAA 5C70A 1R083 2O8QA 4GB32 2C5DA 1VMJA 2XB6C 5FZGA 3VKMA 4DRRA 4FXKB 4OQ9A 2D93A 1R091 4FPKA 5F1RA 1HB4A 3DF0A 5DUUA 2W87A 3S5AA 2QQVA 3IIIA 1OVSA 1ZM1A 3NNJA 5D21A 5GLTA 5CEHA 2PHTA 1GNYA 1U12A 1AUYA 2HEWF 4MXWA 4MYEA 2GMPA 5FUNA 3THPA 3VBOB 1RUC2 3GF6A 3RYRA 2CTVA 2D6MA 1MS4A 1D4VB 5IUQA 5IYYA 5EP9A 4HETA 3B5LB 2LW8A 3N9NA 1B09A 1UXZA 2YUEA 2VZPA 4QD2A 5AFEA 3E97A 4BQXA 2WYSA 2QQMA 4GQ7A 1XRUA 3TN93 4BIOA 4CRQA 5JDBA 4N43C 2RM23 2R061 1ZBA1 1ZZCA 5DAWA 2Y34A 2ZX4A 2OQ6A 1HB2A 4XMAA 2GNTA 1XNDA 3MV01 4RR3B 4YSFA 3VZOA 4W65A 2VXJA 4FPHA 2WSVA 2XH6A 2X05A 3THCA 2QQUA 2E31A 2E26A 4CE8A 1VIWB 5F3IA 1ODMA 4AFBA 3ECQA 2X8KA 4RR3C 1DGRA 5FZOA 3USUA 2CAUA 1NG0A 1HKDA 1OA3A 1WBFA 3FLPA 4NRPA 4C90A 2V4AA 3OD0A 3WUDA 4Y3OA 4FPYA 3AM2A 3LAGA 5K0UB 1JUHA 5DDJ2 1SHWB 1TMF3 4BA6A 2K46A 2VZTA 4LQRA 1RXFA 1SLBA 2Y0OA 4UYBA 2PXJA 3KT4A 2C0ZA 1EAH1 2XVGA 5CBLA 1ZZ8A 1ST8A 1S0EA 4QGMA 3WV6A 3RSJA 2BOJA 1W6MA 3CJIC 3SLIA 2I45A 2WO2A 4ASMB 4Q29A 3T1LA 1YQ5A 1S0JA 2DVDA 1O6UA 3B7MA 3ORJA 5CADA 1MZEA 2WZEA 3CZUA 2XBO2 3FBYA 5GLWA 4QX2A 3OGVA 1NKGA 3MIHA 1DZQA 3PMSA 5FY0A 1S4CA 1ND3A 4HXCA 2RR13 1XE0A 3EQEA 5F5QA 1JYTA 2ZEYA 4COUA 4QXBA 4IUGA 5JOZA 5LA1A 3J7LA 4COYA 4IE0A 5A1FA 3K77A 1PO21 4QGNA 3ZSMA 1VAMA 5T5OA 5M0TA 4B8EA 2WLQA 3EJKA 3AMHA 5F2WA 1OUXA 3HT2A 3BVCA 3RI8A 3MIDA 5BNPC 2JG9B 1NXMA 2HWE3 1H8VA
chains in the Genus database with same CATH topology
1O5LA 2XPJA 3AP7A 1ZYBA 1GNHA 2HEVF 1PIV2 4XW3A 1AHSA 4IERA 2WL1A 2C9AA 2JG9C 5EYXA 1OPOA 2GC0A 2DCZA 4XPVA 3DGTA 4YGEA 3CJXA 4NHLA 4GKXA 2Q8OA 2JD4A 2R1BA 3ZVXA 4ES8A 3HD8B 3E6CC 3C3VA 3KCXA 1XYPA 5I0TA 2RMU2 2R49A 3WX5A 2ZBJA 1H2LA 4RFT0 2C1FA 1HV1A 4FXGB 1NE6A 2NLRA 4BCUA 2GNDA 3M8LA 1RUI3 1JYIA 1VRH1 2PQQA 1OD5A 2ZGUA 1FATA 1KD7A 2VPVA 1KS4A 1LGNA 1Z0HA 3ZMNA 4AK3A 3JCIA 1VJ2A 3JD71 1SLTA 4YM0A 4C0BA 2OUHA 4CDUB 4AEKA 4LLOA 2A71A 4HKOA 4J6GA 3WDXA 3POWA 1SBEA 4Q4Y2 1C57A 3TNQA 1FX5A 4L99A 3AB0A 3VKLA 1G7YA 2K2SA 1OI6A 4FOWA 1QH7A 5FLHA 4EN6B 1Y9QA 3ZFFB 1RIRA 3U10A 5AVAA 1PMIA 1HRV1 2CL2A 2IFWA 1QXPA 4Q1PA 2ZMNA 3ZFFC 1BJQA 5KHJA 1SCSA 2BNOA 1WLCA 2IXJA 4Z92B 2UU8A 2BBVA 3MYXA 2BPA2 1FV2A 4Q1RA 4BLJA 5ACA3 4R9DA 3GZAA 2WJSA 4YG3A 4M3CB 2BGCA 2VH9A 4AI0A 3TOJA 1PHMA 2ZOEB 3MLKA 2DV9A 1QDCA 1WCSA 4JAAA 2IXLA 4C0HA 1FPN3 5BUVA 1F5JA 1C8NA 3INAA 1QJY1 1NQJA 5DUVA 3HQXA 1MQTA 4Y5Z0 1UF2C 3ES4A 2RS52 2IXCA 3AKSA 3JQXA 5T50A 4DB5A 1UL9A 4Q0VA 1SDWA 3OF1A 2ZGNA 4AQ2A 4IEPA 3PHMA 5H9PA 3BOWA 2BW8A 2R072 4I2OA 2VQ0A 1RUD2 4GH4A 4G3YC 4FPLA 1CVNA 2WWSA 2JG8A 1DLLA 2D43A 1WBLA 1RVF2 1V6OA 2WT1A 3AZVA 2D98A 4AVAA 1OQ1A 1R093 5CFDB 4J1WA 4K21A 2BNNA 5CVRA 5I0UA 4F83A 4Z1VA 1O4YA 2N7GA 5KC6A 5IK8A 4F7ZA 4YFZA 2CNAA 1ZBE3 3MW4A 4DPNA 4YW1A 4Z82A 3P3NA 5JOWA 1IS4A 2JE7A 5FQ0B 1V9U1 1PZ8A 1UIJA 4YRDA 4QPYA 1PO12 3LSDA 5JR7B 1H4HA 1SLAA 2EXHA 3AP5A 4AQTA 1H2NA 4CEYB 4N90A 5JMCA 2WS92 2R063 4QPIB 2ZX2A 4WVWA 1ZBA3 2Q4SA 3KD4A 4GWNA 4NWVA 1JYCA 4WZFA 5D8AB 5DDJ1 4AHZA 1X82A 3NO8A 4HN1A 4AGRA 5C8CC 4JGZB 3BOPA 4UBGA 4XJZA 5D8AC 5HI0A 2ZABA 1VR3A 1VBD2 2DCKA 4XQ4A 3J8F1 3WY6A 1QJX2 4PLNA 1Q8QA 1TNFA 3WP6A 4WZCA 4W6WA 3CF6E 4TSVA 3Q9OA 1U0AA 2XUMA 2D40A 4F3JA 4FPCA 4COZA 2WNUA 2YDEA 4XJ8A 3TRSB 2KXLA 4AG4A 2AUYA 1V00A 2D6NA 3KQRA 3VBUA 3VBHA 4RS5B 4XF3A 5LK5A 1RHI2 3FE5A 1AF9A 2B8MA 4Q4W2 4LBQB 4WVVA 1AR92 5EXOA 4N53B 4CEWB 1IS5A 3AXEA 4YYOA 2ZTNA 3WG4A 2DCYA 2W08A 3FUOA 4RS5C 2D3PA 4CDWB 3JU9A 1LHNA 4QQHA 1BK1A 1DHKB 2MNGA 4CEWC 4N53C 3V56A 1PIV1 1NA1B 1PO23 3ZFEC 5GLUA 4FP2A 2I07B 4LEJA 4FOVA 3UKTA 3WLUA 4I0AA 5LEJA 3FWEA 4FQZA 1J58A 3RI9A 1NA1C 3WINE 1IKQA 4WM7A 2RMU1 3WDYA 4E4SA 2WZR1 4OI1A 4AEDA 1MEC2 2P17A 1F5FA 4IL7A 5L73A 3ZFGB 5GZCA 2VOVA 4CP0A 1CR7A 2KA3A 2Y26A 4DINB 5JIAA 3LOIA 3IPVA 1EY2A 2R0HA 4JRLA 3ZFGC 1IKPA 2D44A 1DGWA 1Q8VA 3JZVA 3RYKA 3PMEA 4EWDA 3MIBA 3TBDA 5DXDA 1VRH3 2WT2A 3I4IA 1FT9A 4AVBA 4MXWB 1S0CA 3OBRA 4MH0E 1LECA 4EWAA 5FO9B 2JECA 2JDZA 3C2UA 3JD73 3MIEA 4GMP0 1WW6A 1JOJA 3OD4A 4KQ7A 3WOGA 1TNRA 4S2GA 3NSTA 4XHBA 1O7FA 4P9LA 1X33A 3RS6A 1SFNA 2I74A 4IV3A 3WG3A 2XWBB 1MZ6A 1VBA2 1UN1A 4EV0A 1QOSA 2A75A 3SH5A 2DU0A 1EV13 1BQPA 1QXRA 3EO6A 3P3PA 1HRV3 3BALA 2E7AA 4TYSA 3OJBA 2MHFA 2QDNA 4XXAA 1N3PA 4Y20A 4EWEA 3USUB 1UCXA 3VDDA 4Q8LA 1RUE2 4J1XA 3H1YA 3NAPC 4NHMA 4XOGA 1HQLA 5B2GB 4O9GA 1CX4A 4RHV2 2HYKA 4AYUA 1H9WA 2RS51 4YM2A 2AZ5A 3KM5A 3WDUA 1AX0A 4HFSA 5HCBA 3L2HA 3R4DB 1BBT2 2QE3A 1POV0 3TNPB 4XE9A 2R071 1KRIA 1RUD1 2GH2A 1W6MB 1QJY3 1SACA 4A7KA 4ZKTB 2VMIA 1K5MA 1RVF1 1MVEA 4GB33 1DZTA 2CY6A 2ZA9A 3CLPA 1ND3B 2RM21 1W6NA 4XFBA 2JXAA 3MLJA 3MPBA 4GKYA 3AXDA 1SEFA 3UJQA 2A6WA 3PVNA 2PAMA 1RUC3 1HV0A 1VBC2 1S0IA 2NMOA 1H2KA 4IEUA 5DUWA 4XZPA 2QVSB 2Y0IA 2ZX0A 2ZGQA 3WW4A 2OYZA 1DGLA 1PZ7A 5EWSA 2B42B 1PO11 4K1YA 4IV1A 3VBSC 4HSLA 1N1SA 4FPGA 2WS91 2AH2A 4HKLA 4OHYA 4Q0UA 2D6OX 1LHWA 1H8TA 5FBZA 4JDNA 1ASJ2 1KXGA 5JLVA 2ZX3A 1VBD1 4NO4A 1BCXA 3RDIA 2A3XA 2XLFA 2WA4A 2BQPA 4G9SB 1QJX1 1W2UA 2QKDA 3S30A 2XWJB 1Y7BA 3V0AA 5DDJ3 3VBRA 2ZGMA 1NCQA 5EJ3A 5KHHA 1UZZA 2FMDA 3JB8A 3BCWA 3VZNA 2ARBA 4ITCA 3J8F3 5DG2A 4AQSA 5KXEA 1RHI1 1N1TA 3SXWA 2OW4A 2PHXA 2R32A 2XJUA 3ELNA 3ZYRA 3GBFA 1AR91 5IK4A 4LT5A 3WW2A 3BB6A 1RINA 3KS7A 1AR71 5CB7A 3UJOA 4EN0A 1O4TA 4GMP1 5ABJA 1C8M2 2ZGLA 4N7IA 4MXVA 5AVPA 3UK9A 4HVRA 2WNVA 5KC5A 2D5HA 3VZKA 3VHPA 4BOWA 1CAUA 1EPWA 4FT8A 4QPGA 2P3JA 4XXPA 1O5UA 1DYPA 3SH3A 1RUOA 1PM7A 1PIV3 2QQPA 1MEC1 4PIZA 4M3CF 3VN4A 1QGLA 2PELA 3W59A 3HAGA 1DQ5A 5H9QA 3B9IA 1VBE2 4MX3A 4LE3A 5SV5A 3GALA 1YCIA 3FZ3A 2VGDA 1SBFA 2RMU3 1MQTB 4YZ1A 2WZR3 5A3LA 1AX1A 4Y4YA 4OUSA 3UV9A 4EN7B 4U36A 3WG1A 5CFCA 3J4UH 5SV8A 2PHFA 4QQLA 3KT7A 1POV1 4GH4B 5GZGA 4M0NA 2P2KA 3ZXAC 1REDA 2JG8B 5F9TA 4PDWA 4XIOA 1BYHA 1GLHA 2QNKA 4GH4C 2HJIA 3MZHA 4CDXA 2X53S 1UMZA 2H0BA 2JG8C 4E4DX 1C28A 1J1TA 4N9HA 4Q4Y3 2IXIA 4YGBA 3WD5A 3R0RA 5HCAA 1DQ6A 1VBA1 1DGRN 1GQGA 1WUVA 1ZZ6A 3GYDA 3I59A 1SQ4A 2ZKLA 2DTWA 3WP4A 2XJVA 2W0XA 1QJU2 3WQ0A 3WUCA 3AZYA 2NYYA 1QMJA 2MPFA 1GKBA 3FLTA 1UAIA 3ZO0B 2BVVA 3NW4A 1RUE1 1N1VA 3O0WA 3WW3A 3LA3A 2EAKA 3O5SA 3ILFA 4RHV1 4DNYA 5I0SA 5L19A 1OMIA 1W39A 4JV4A 1BBT1 2BTVC 1V70A 3WQ1A 3T2TA 4PIYA 3IMNA 1RC6A 3MEPA 2O0OA 5K8SA 2RS53 3H7JA 1DBNA 1LU2A 3LB9A 4Y22A 1ZBE1 4AF9A 2R073 2WNUB 5JZGA 1RUD3 2XL7A 3S0MA 2ETEA 1AXKA 3VBUB 1F9KA 1PVC2 4IEYA 3VBHB 4BQ1A 1AR82 1JN2P 3VBOC 3NJZA 1VBC1 3UKVA 1RVF3 1DU3D 2WNUC 1S0BA 1YIPA 4KG0A 3VBUC 4P9WA 3VBHC 3WP5A 3K51A 4OUMA 4LO5B 4ASLA 2ET1A 3D0SA 1MZFA 3DL3A 2QDRA 5LRRA 5CG8A 4LTAA 2UY9A 4I02A 4OHWA 1AX2A 3D8CA 1UKRA 4AFAA 5I93A 2GC2A 3AMNA 2PFWA 2XLGA 1CD3G 1GZCA 1CJPA 3VZMA 4WV8A 2MEV2 4LBQD 3KSCA 1DGWX 4WM7B 2BFUL 2JJ6A 1PO13 2XJTA 4AEDB 4I3PA 5GM0A 1MS0A 5J37A 1O3TA 2UYBA 2WS93 3MW3A 5KXCA 1WLTA 1REEA 3QH6A 2BUKA 4SLIA 2OZJA 1DQ0A 1RUG2 3FC0A 3ILRA 3NV2A 3ENRA 5K0UC 1B35A 3IPVB 3RG0A 4UW6A 2YC0A 2YMZA 1EYBA 1FOD2 4FOQA 4OI0A 2G9FA 5C33A 3L2YA 1G9AA 2VVEA 4Q27A 1VBD3 2VW0A 3VLBB 1QJX3 2YY1A 2NZ9A 4FO9A 1GFF2 4WM8A 4RSUA 1I9RA 4JTOA 1CESA 4AWDA 2YGMA 1RTVA 3M2MA 4C1XA 2LALA 3LA7A 2TUNA 4AFDA 4KU8A 1LULA 5C4WA 1C8M1 3AZXA 3I8TA 1RHI3 4BZ4A 4Q4W3 2OPKA 4YARA 1AR93 4IV3B 4ATEA 5FCCA 1J1LA 3TAYA 4BPZA 1QWRA 3NV1A 3POYA 2BVBA 5BNQA 3BPZA 1AR73 2PN5A 3ZSJA 2GMMA 3WHTA 1IGOA 4IV3C 4M00A 4GMP3 4QM9A 4EROA 1LOBA 3B69A 2CV6A 4LO6B 4XBLA 5FMOS 2OIIA 4E2SA 5BNNA 4R9BA 1G8WA 2EIGA 3H0OA 2HWB2 4Y20B 1XNCA 3SCHA 1F8VA 4Q2FA 3U11A 2DUQA 4JDOA 4M3CE 2LUWA 3CU7A 3VDDB 3POSA 3D5OA 1MS1A 2GZWA 3UL2A 3VBFA 4K6BA 1E57A 1ULFA 1UKGA 3WG2A 3WR0A 1MEC3 4Y1YA 3H9AA 3VDDC 2ZACA 4B4RA 4D7TA 1GANA 2ZMLA 4P9GA 1RUNA 3B94A 2RS12 5T55A 2B45X 4DXZA 4LBNA 4Q4X2 1EPZA 4L8QA 2VMHA 1Q5OA 3MFCA 4P9JA 5JOXA 1I3HA 3AP6A 1K5MB 2PAKA 4AI2A 2E51A 4ISRA 3RWNA 3W9AA 4XEZA 5L7OA 4ZU4A 1W6NB 2EXJA 1C5HA 4CDUC 1K5MC 1POV3 3FMGA 4RGGA 1XU1A 2GN3A 3OCPA 5CAZA 4ATFA 2DYCA 1EV11 1QNWA 5I8SA 1JH5A 2DCJA 3BTAA 5DG1A 5AC92 3VKOA 2YXSA 2W68A 2JENA 4XIKA 1UU4A 3KMHA 2A73B 1QJU1 1AL0G 1AYN2 1C5IA 3D0JA 2QUOA 1LGCA 4TZDA 4IV1B 3PLQA 1W6PB 1QY4A 3WDVA 2HWF2 3TWIA 2A6XA 3AFKA 1F2NA 2ZMKA 2B5HA 2ZHNA 1VBA3 1DDLA 2VECA 1MR5A 1D4M2 3IDBB 4RA0A 1S1AA 5JOYA 1O3QA 4B7KA 1H8TB 1LEMA 3LOBA 1LTEA 1C3HA 3NVCA 1AJKA 5DZGA 1QOOA 3MI8A 4GB31 5K7PA 1RUE3 4UBHA 2ZGPA 1O4ZA 3U0ZA 2CGOA 3V0AB 4RHV3 3KZ4C 1G9DA 2ET7A 5F6LB 4A7ZA 1HRI2 1NCQB 4P9IA 2BWAA 1HDKA 1GSLA 2R16A 1BBT3 1RUC1 1ZZ9A 1KFUL 4Q0QA 2DWRA 2CGPA 1PVC1 3EHKA 3T1MA 3IDEA 4CP1A 3N7LA 1I5ZA 2EVXA 4DRVA 1CIWA 2XJRA 2Z42A 5BY5A 3DV8A 5CFDC 3O7OA 3QH7A 4Z2WA 2ZJCA 3R05A 4MLOA 5ABJB 1BEV2 1JTZX 3ZMOA 4K40A 4HMZA 4E4ZA 4QQPA 2TBVA 4IEQA 4D94A 1VBC3 2WNVB 3S7EA 3ACLA 1CAUB 5E1RA 1UD1A 4QPGB 1VBB2 5H9SA 1GQHA 2XKOA 2WNVC 5JCTA 4XBQA 2Q1ZB 5GLVA 1NCRA 4CEYC 2BWCA 4QPGC 4QXKA 4Q0SA 2RHPA 4LO4B 2CWMA 4QPIC 1H30A 3NL1A 1RUG1 4RL7A 1PK6A 4AVSA 2ZGOA 2ZX1A 4H14A 5GZDA 3WCRA 4R52A 4JGZC 1FOD1 3V0BA 3LZZA 1ASJ3 5CFCB 4XFAA 2XG3A 2XBO1 1CAVA 2RJKA 2QZ2A 3ZXFA 4DMIA 4M0HA 4FSJA 5FLIA 4BLIA 3N4MA 1I1EA 5T5JA 2EAAA 2H6CA 4YZ3A 1O91A 2R1DA 4PDWB 2ZZQA 3SNMA 4YM3A 1WMEA 3H1MA 1FXZA 4CDXB 1HX6A 1PNFA 2RR12 4KWJA 2AREA 3ZYJB 2PA7A 3URFA 4PDWC 3WVJA 3VUOA 4RQPA 4FTSA 4JRAA 4CDXC 1LCLA 2VU9A 1LHVA 3I59B 3D4KA 4CDWC 1XNKA 2OVUA 2NN8A 2VNGA 1C8M3 4N43A 3IN9A 1S0DA 2A5ZA 2HWB1 4JC1A 2HWC2 4JTNA 5H9RA 1N3QA 4AE2A 1RUF2 5A33A 2GSYA 4FBFA 3ZSKA 1ULDA 5BNOA 3N36A 1BVVA 4PLOA 3U07A 3BIWE 2GALA 3KB5A 1PNGA 2Q1MA 2HWD2 2ZAHA 4XFFA 5GLZA 5J98B 1U5IA 2DURA 1RB8G 2OUJA 5LK7B 2RS11 3AZWA 3WHUA 1VBE3 4PJYA 4U2AA 1URXA 4Q4X1 5I0RA 3AZZA 2H6BA 1X36A 2R042 2ES3A 5C6CA 2DUOA 3PTYA 3AMPA 3R4SA 4YLZA 1OOPA 3CJIA 4HVOA 3R6SA 5FFOC 4AVCA 4Q4Y1 4Y22B 3ZXEA 1YO8A 2GN7A 2P3KA 3B9CA 3RJ2X 2Z79A 1YWKA 5JZGB 1NYWA 4AGVA 1AYM2 2TNFA 4XYXA 3RMYA 1ZA4A 3FJSA 2PYTA 1H1MA 1LOEA 5AC91 2XHKA 4R9CA 4XQWA 4KGGA 3FLRA 4B4PA 4HK8A 1TEIA 2DTYA 3QD6A 1AYN1 1WD4A 4PLMA 5BNPA 1WA4A 2VMGA 2DF7A 2WLPA 1W6OA 2HWF1 2Y38A 1C1FA 2IWGB 2A3WA 3GNEA 2ZHLA 1D4M1 5IT6A 5JIUA 4X8PA 2A6VA 4Q4V2 4MSVA 3M70A 4KL1A 3KCYA 4KWLA 1QJU3 4YM1A 3ZDSA 1NLSA 3JUUA 4HSJA 1UX6A 2X5IA 1ENQA 4QX5A 5FREA 4QQ2A 4OZXA 2EALA 1UIKA 1IZ3A 2WA3A 3HBZA 2G9GA 4CDQA 1MS5A 1RMU2 1SMVA 4O9EA 4Q0PA 1YHFA 1B35B 1IS6A 3K48A 1QQP2 4DFSA 1UU6A 4QGLA 2JEMA 4MGIE 2PHWA 2ZGKA 1S2BA 2VULA 4AEJA 3A4UA 3IDCB 1TQ5A 3R4UA 4WM8B 4XF9A 3ZXGA 4B3NA 1R1A2 2WQZC 1RUH2 3OY8A 1EP0A 1LKNA 1PGW2 1ND3C 3QBQA 3LCPA 2EA7A 1BEV1 3NWKA 4YVWA 5C4WB 4AVTA 1PVC3 1AR83 3DPRA 3MICA 1NQDA 4AW7A 1RUJ2 3JQWA 1H1IA 4YGDA 4YVSA 4GULA 1WW5A 5C4WC 1LB2A 4ES9A 5KHIA 1L3JA 1VBB1 1ZRCA 4PQ9A 1C4RA 3G6JB 4XILA 1YXWA 4XQDA 4WVZA 4JVAA 1LOGA 4FPEA 5FAXA 5BNNB 1G9CA 1SBDA 4FCAA 3ZSLA 2VNRA 1AR62 2A70A 1A8MA 3ZXLA 1V6LA 4K20A 2MEV3 3ILNA 4JQRA 5C8WA 4N7UA 3VBFB 2D97A 2VOKA 2W52A 4OULA 4OLLA 4E27A 1RUG3 2E6VA 2DU1A 4FP3A 4H55A 2VY0A 1ZVFA 4XFIA 4XDQA 1D2SA 3WNXA 2P37A 1CAWA 1ZRRA 2WIIB 1FOD3 1OPMA 3AKRA 4FPOB 4Q4W1 2GMEA 4R4ZA 4DQAA 4FPJA 2ZCWA 1WW7A 1EAH2 1S55A 2XBO3 3SCFA 5J7MA 4P5HA 4YZ5A 1DF0A 5L7OB 3M1HA 5I91A 5HBAA 2CGNA 3ES1A 4BWOA 4AFMA 4AHYA 4BIFA 4XFHA 1Q56A 4YZ4A 5KXBA 1LENA 2D6PA 3AJZA 4XF0A 1WMFA 4HLTA 2XLAA 3OYWA 5FPZA 3FBMA 1Q8OA 1RJ8A 4L92A 2OZ6A 2DVAA 4JCKA 1NXD1 1M4WA 1PO22 2HEYF 1RUF1 4HT1T 1QF3A 1W6QA 5T54A 4DY3A 4HVQA 4LO8A 2XVKA 3LWCA 5FOBB 1YJKA 5FQ0A 2HWD1 4XETA 4OHVA 3RYPA 1NOVA 2HWB3 4M01A 2QCSB 4META 3AKQA 4XJAA 5C8CA 3M3CA 3IIAA 4HN0A 2TEPA 4WVMA 4N9IA 4R4XA 2VOXA 3AMMA 5T52A 2GAUA 2W39A 1MQTC 2VXRA 2D6KA 1X50A 4G4FA 4ORFA 1BMV2 2Z69A 2RS13 4JDMA 2B9UA 3FHIB 1S2KA 3RNSA 1V6JA 2XVLA 5BPXA 2WC2A 4Q4X3 4NR1A 1J3RA 1AYM1