2Y0SP

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
45
structure length
45
Chain Sequence
YRCGKCWKTFTDEQLKVLPGVRCPYCGYKIIFMVRKPTIKIVKAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
total genus 2
structure length 45
sequence length 45
chains with identical sequence X
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF03604 DNA_RNApol_7kD DNA directed RNA polymerase, 7 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.30 Mainly Beta Single Sheet Rubrerythrin, domain 2 RNA polymerase ii, chain L 2y0sP00
5IP7L 1TWFL 3S1QL 5C4JL 2R7ZL 4A3CL 2WAQP 5C44L 4BBRL 2NVQL 1I6HL 4BY7L 5FLML 3S15L 3S1RL 3S16L 4A93L 3M3YL 3FKIL 3S14L 4C3IL 5FJ8L 4A3KL 4A3FL 3S2HL 3PO2L 4A3ML 5C3EL 3M4OL 3HOVL 1K83L 4C3HL 5C4XL 4A3IL 3CQZL 5M5WL 1Y1VL 2NVYL 3HOUL 4X6AL 2NVXL 2R93L 2R92L 3GTQL 3HOXL 4C2M1 1WCML 4Y7NL 4BY1L 3H0GL 2PMZP 2E2JL 1TWAL 2JA7L 3S17L 4A3DL 3I4ML 3I4NL 4QIWP 3GTKL 2Y0SP 3RZOL 3PO3L 2YU9L 3RZDL 5M3FL 1Y1WL 2NVTL 3GTPL 3K7AL 4BXXL 2VUML 3HOWL 5IYBL 5IP9L 1TWHL 1I3QL 3S1ML 5IYDL 4A3BL 4C3JL 3HOZL 1TWGL 3GTGL 2B63L 4AYBP 4A3JL 3H3VM 1R9TL 5M3ML 2JA8L 3S2DL 1TWCL 5M5YL 4BBSL 3GTOL 5M5XL 4A3GL 1SFOL 4A3EL 3GTML 3GTLL 1I50L 5IYCL 3GTJL 2E2IL 3S1NL 4A3LL 2JA6L 2E2HL 2WB1P 4Y52L 2JA5L 3HOYL 3HKZP
chains in the Genus database with same CATH superfamily
1B2JA 5IP7L 1BQ9A 5IY0A 3RZTA 2LCQA 1R0GA 3WWLA 5C4JL 5AI2A 1SMUA 2WAQP 2QL0A 4BBRL 5C44L 1Z92B 2PSMC 3M3YL 3PL5A 5EINC 4POFA 3PKJA 1QCVA 2ERJA 2ZIXA 4JADA 3HOVL 2AQCA 1BRFA 4A3IL 4JAGA 2M6PA 1B71A 2XJVA 2V0FA 5EIOC 1B2OA 3LWVB 8RXNA 4WFN1 1BQ8A 1FHMA 4AHWA 4BY1L 2PVEA 2XJSA 2JI2A 3HJYB 3MPSA 3HJWB 1RYTA 7RXNA 3KYYA 1NXEA 4U671 3PO3L 4JAEA 2J9UB 5M3FL 3K7AL 3HOWL 2DSXA 2V3BB 2PVXA 3S1ML 4A3BL 4AR5A 4C3JL 3GTGL 4AYBP 1E8JA 4A3JL 2O5JD 1YK4A 3S2DL 2JA8L 1F4LA 5M5YL 1LTLA 1IRNA 5MLC3 5M5XL 1PFWA 4A3EL 3GTML 3GTLL 1RWDA 5MFZA 5IYCL 1PFVA 2M6OA 4GS7D 3P2AA 2A6HD 2XJQA 1VZGA 3HKZP 3B08B 1S2ZA 4JAFA 1R0IA 4AR4A 3S1QL 4YWMA 3A44A 1LKMA 5FLML 5GADc 1LKPA 4RXNA 3S14L 2B5ID 3JR7A 1RDGA 4C3IL 3LNLA 1RDVA 2M4YA 3S2HL 3PO2L 2BE5D 3LWRB 4POGA 3LWPB 4ZN1B 2AUSB 1K83L 4V196 1BFYA 1Y1VL 1IROA 4X6AL 3QQCE 3RYGA 1FHHA 2KKDA 1S24A 1WCML 3LPEB 2JA7L 3MSUA 5K2ME 2HR5A 1QYBA 3H9BA 4QIWP 3J7Z1 3RZOL 4AHXA 2EY4E 5MF6A 1NXGA 2NYDA 2VUML 1C09A 5IP9L 3K35A 5GAEc 1VZHA 5IYDL 3QVDA 5JVH1 3HOZL 2A6ED 3B0AB 2B63L 3H3VM 1R9TL 5M3ML 4UY81 2H12A 1RB9A 3GTOL 3KYVA 2CR8A 1ODHA 2E2HL 1PFYA 2ERSA 5GAHc 1OWCA 2M4VA 3LWOB 4LHNA 4XXBB 1TWFL 2Z3RB 4K9FA 5AI3A 2NVQL 5GAGc 3FDJA 4BY7L 2PYAA 3VPBE 2RDVA 1R0JA 1R0HA 1DVBA 4A3KL 1IU6A 1CADA 2KN9A 4ZN3B 2XJPA 5DM71 5AN9H 5MFPA 4C3HL 1T9QA 3H9CA 2JI1A 2Z3QB 1VCXA 3HOUL 1T9OA 2NVXL 3GTQL 3HOXL 5H1Sc 3PIO1 1RYQA 4C2M1 3PKIA 2A69D 2CKCA 2AYJA 4Y7NL 2RFKB 2K2DA 1P7PA 1TWAL 3SS2A 1DX8A 3ZG6A 4TVMA 3J7Y1 2V0EA 3I4ML 3I4NL 3HAXC 2Y0SP 4AHZA 3PZAA 3WWNB 2XJTA 2HVYC 2NVTL 4XGHA 3PIP1 1I3QL 5RXNA 3KYXA 2CKAA 1TWGL 4LHLA 3MQKB 1JYBA 4BBSL 4A3GL 4G6BA 2PPTA 3GTJL 1QQTA 2E2IL 3S1NL 4A3LL 1SMMA 2WB1P 4AR6A 4Y52L 1SMWA 1YUZA 2VL6A 3KYWA 5JVG1 4A3CL 2R7ZL 1YK5A 1I6HL 4YWLA 1IW7D 3S15L 3S1RL 1VZIA 3S16L 4A93L 1NNQA 3FKIL 5FJ8L 2XJRA 4A3FL 4AI0A 4AR3A 4B8CD 4A3ML 1S30A 5C3EL 2C6AA 3M4OL 1IU5A 4E6YA 5DM61 5C4XL 3CQZL 5M5WL 2NVYL 4ME3A 4AI3A 2A68D 2R93L 2R92L 3IU3I 1B13A 1LKOA 4AHYA 3H0GL 2PMZP 1OWBA 2E2JL 2L0ZA 3KYUA 3S17L 3RZ6A 1YV1A 1YUXA 1PZXA 6RXNA 4AI2A 4A3DL 1ZRPA 3GTKL 3P8BA 2XJUA 2YU9L 3RZDL 1Y1WL 2JI3A 3GTPL 4BXXL 4TPUA 5MGNA 2GMGA 5IYBL 1TWHL 1T9PA 1R0FA 3NFPI 1CAAA 1PFUA 3PWFA 1BE7A 4AI1A 1TWCL 3LWQB 2APOB 1SFOL 1H7VA 1WJVA 1I50L 2JA6L 2C6BA 3H99A 2MS3A 2JA5L 3H97A 3HOYL
chains in the Genus database with same CATH topology
5IP7L 1TWFL 3S1QL 5C4JL 2R7ZL 4A3CL 2WAQP 5C44L 4BBRL 2NVQL 1I6HL 4BY7L 5FLML 3S15L 3S1RL 3S16L 4A93L 3M3YL 3FKIL 3S14L 4C3IL 5FJ8L 4A3KL 4A3FL 3S2HL 3PO2L 4A3ML 5C3EL 3M4OL 3HOVL 1K83L 4C3HL 5C4XL 4A3IL 3CQZL 5M5WL 1Y1VL 2NVYL 3HOUL 4X6AL 2NVXL 2R93L 2R92L 3GTQL 3HOXL 4C2M1 1WCML 4Y7NL 4BY1L 3H0GL 2PMZP 2E2JL 1TWAL 2JA7L 3S17L 4A3DL 3I4ML 3I4NL 4QIWP 3GTKL 2Y0SP 3RZOL 3PO3L 2YU9L 3RZDL 5M3FL 1Y1WL 2NVTL 3GTPL 3K7AL 4BXXL 2VUML 3HOWL 5IYBL 5IP9L 1TWHL 1I3QL 3S1ML 5IYDL 4A3BL 4C3JL 3HOZL 1TWGL 3GTGL 2B63L 4AYBP 4A3JL 3H3VM 1R9TL 5M3ML 2JA8L 3S2DL 1TWCL 5M5YL 4BBSL 3GTOL 5M5XL 4A3GL 1SFOL 4A3EL 3GTML 3GTLL 1I50L 5IYCL 3GTJL 2E2IL 3S1NL 4A3LL 2JA6L 2E2HL 2WB1P 4Y52L 2JA5L 3HOYL 3HKZP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 L;  1TWF L;  3S1Q L;  5C4J L;  2R7Z L;  4A3C L;  2WAQ P;  5C44 L;  4BBR L;  2NVQ L;  1I6H L;  4BY7 L;  5FLM L;  3S15 L;  3S1R L;  3S16 L;  4A93 L;  3M3Y L;  3FKI L;  3S14 L;  4C3I L;  5FJ8 L;  4A3K L;  4A3F L;  3S2H L;  3PO2 L;  4A3M L;  5C3E L;  3M4O L;  3HOV L;  1K83 L;  4C3H L;  5C4X L;  4A3I L;  3CQZ L;  5M5W L;  1Y1V L;  2NVY L;  3HOU L;  4X6A L;  2NVX L;  2R93 L;  2R92 L;  3GTQ L;  3HOX L;  4C2M 1;  1WCM L;  4Y7N L;  4BY1 L;  3H0G L;  2PMZ P;  2E2J L;  1TWA L;  2JA7 L;  3S17 L;  4A3D L;  3I4M L;  3I4N L;  4QIW P;  3GTK L;  2Y0S P;  3RZO L;  3PO3 L;  2YU9 L;  3RZD L;  5M3F L;  1Y1W L;  2NVT L;  3GTP L;  3K7A L;  4BXX L;  2VUM L;  3HOW L;  5IYB L;  5IP9 L;  1TWH L;  1I3Q L;  3S1M L;  5IYD L;  4A3B L;  4C3J L;  3HOZ L;  1TWG L;  3GTG L;  2B63 L;  4AYB P;  4A3J L;  3H3V M;  1R9T L;  5M3M L;  2JA8 L;  3S2D L;  1TWC L;  5M5Y L;  4BBS L;  3GTO L;  5M5X L;  4A3G L;  1SFO L;  4A3E L;  3GTM L;  3GTL L;  1I50 L;  5IYC L;  3GTJ L;  2E2I L;  3S1N L;  4A3L L;  2JA6 L;  2E2H L;  2WB1 P;  4Y52 L;  2JA5 L;  3HOY L;  3HKZ P; 
#chains in the Genus database with same CATH topology
 1B2J A;  5IP7 L;  1BQ9 A;  5IY0 A;  3RZT A;  2LCQ A;  1R0G A;  3WWL A;  5C4J L;  5AI2 A;  1SMU A;  2WAQ P;  2QL0 A;  4BBR L;  5C44 L;  1Z92 B;  2PSM C;  3M3Y L;  3PL5 A;  5EIN C;  4POF A;  3PKJ A;  1QCV A;  2ERJ A;  2ZIX A;  4JAD A;  3HOV L;  2AQC A;  1BRF A;  4A3I L;  4JAG A;  2M6P A;  1B71 A;  2XJV A;  2V0F A;  5EIO C;  1B2O A;  3LWV B;  8RXN A;  4WFN 1;  1BQ8 A;  1FHM A;  4AHW A;  4BY1 L;  2PVE A;  2XJS A;  2JI2 A;  3HJY B;  3MPS A;  3HJW B;  1RYT A;  7RXN A;  3KYY A;  1NXE A;  4U67 1;  3PO3 L;  4JAE A;  2J9U B;  5M3F L;  3K7A L;  3HOW L;  2DSX A;  2V3B B;  2PVX A;  3S1M L;  4A3B L;  4AR5 A;  4C3J L;  3GTG L;  4AYB P;  1E8J A;  4A3J L;  2O5J D;  1YK4 A;  3S2D L;  2JA8 L;  1F4L A;  5M5Y L;  1LTL A;  1IRN A;  5MLC 3;  5M5X L;  1PFW A;  4A3E L;  3GTM L;  3GTL L;  1RWD A;  5MFZ A;  5IYC L;  1PFV A;  2M6O A;  4GS7 D;  3P2A A;  2A6H D;  2XJQ A;  1VZG A;  3HKZ P;  3B08 B;  1S2Z A;  4JAF A;  1R0I A;  4AR4 A;  3S1Q L;  4YWM A;  3A44 A;  1LKM A;  5FLM L;  5GAD c;  1LKP A;  4RXN A;  3S14 L;  2B5I D;  3JR7 A;  1RDG A;  4C3I L;  3LNL A;  1RDV A;  2M4Y A;  3S2H L;  3PO2 L;  2BE5 D;  3LWR B;  4POG A;  3LWP B;  4ZN1 B;  2AUS B;  1K83 L;  4V19 6;  1BFY A;  1Y1V L;  1IRO A;  4X6A L;  3QQC E;  3RYG A;  1FHH A;  2KKD A;  1S24 A;  1WCM L;  3LPE B;  2JA7 L;  3MSU A;  5K2M E;  2HR5 A;  1QYB A;  3H9B A;  4QIW P;  3J7Z 1;  3RZO L;  4AHX A;  2EY4 E;  5MF6 A;  1NXG A;  2NYD A;  2VUM L;  1C09 A;  5IP9 L;  3K35 A;  5GAE c;  1VZH A;  5IYD L;  3QVD A;  5JVH 1;  3HOZ L;  2A6E D;  3B0A B;  2B63 L;  3H3V M;  1R9T L;  5M3M L;  4UY8 1;  2H12 A;  1RB9 A;  3GTO L;  3KYV A;  2CR8 A;  1ODH A;  2E2H L;  1PFY A;  2ERS A;  5GAH c;  1OWC A;  2M4V A;  3LWO B;  4LHN A;  4XXB B;  1TWF L;  2Z3R B;  4K9F A;  5AI3 A;  2NVQ L;  5GAG c;  3FDJ A;  4BY7 L;  2PYA A;  3VPB E;  2RDV A;  1R0J A;  1R0H A;  1DVB A;  4A3K L;  1IU6 A;  1CAD A;  2KN9 A;  4ZN3 B;  2XJP A;  5DM7 1;  5AN9 H;  5MFP A;  4C3H L;  1T9Q A;  3H9C A;  2JI1 A;  2Z3Q B;  1VCX A;  3HOU L;  1T9O A;  2NVX L;  3GTQ L;  3HOX L;  5H1S c;  3PIO 1;  1RYQ A;  4C2M 1;  3PKI A;  2A69 D;  2CKC A;  2AYJ A;  4Y7N L;  2RFK B;  2K2D A;  1P7P A;  1TWA L;  3SS2 A;  1DX8 A;  3ZG6 A;  4TVM A;  3J7Y 1;  2V0E A;  3I4M L;  3I4N L;  3HAX C;  2Y0S P;  4AHZ A;  3PZA A;  3WWN B;  2XJT A;  2HVY C;  2NVT L;  4XGH A;  3PIP 1;  1I3Q L;  5RXN A;  3KYX A;  2CKA A;  1TWG L;  4LHL A;  3MQK B;  1JYB A;  4BBS L;  4A3G L;  4G6B A;  2PPT A;  3GTJ L;  1QQT A;  2E2I L;  3S1N L;  4A3L L;  1SMM A;  2WB1 P;  4AR6 A;  4Y52 L;  1SMW A;  1YUZ A;  2VL6 A;  3KYW A;  5JVG 1;  4A3C L;  2R7Z L;  1YK5 A;  1I6H L;  4YWL A;  1IW7 D;  3S15 L;  3S1R L;  1VZI A;  3S16 L;  4A93 L;  1NNQ A;  3FKI L;  5FJ8 L;  2XJR A;  4A3F L;  4AI0 A;  4AR3 A;  4B8C D;  4A3M L;  1S30 A;  5C3E L;  2C6A A;  3M4O L;  1IU5 A;  4E6Y A;  5DM6 1;  5C4X L;  3CQZ L;  5M5W L;  2NVY L;  4ME3 A;  4AI3 A;  2A68 D;  2R93 L;  2R92 L;  3IU3 I;  1B13 A;  1LKO A;  4AHY A;  3H0G L;  2PMZ P;  1OWB A;  2E2J L;  2L0Z A;  3KYU A;  3S17 L;  3RZ6 A;  1YV1 A;  1YUX A;  1PZX A;  6RXN A;  4AI2 A;  4A3D L;  1ZRP A;  3GTK L;  3P8B A;  2XJU A;  2YU9 L;  3RZD L;  1Y1W L;  2JI3 A;  3GTP L;  4BXX L;  4TPU A;  5MGN A;  2GMG A;  5IYB L;  1TWH L;  1T9P A;  1R0F A;  3NFP I;  1CAA A;  1PFU A;  3PWF A;  1BE7 A;  4AI1 A;  1TWC L;  3LWQ B;  2APO B;  1SFO L;  1H7V A;  1WJV A;  1I50 L;  2JA6 L;  2C6B A;  3H99 A;  2MS3 A;  2JA5 L;  3H97 A;  3HOY L; 
#chains in the Genus database with same CATH homology
 5IP7 L;  1TWF L;  3S1Q L;  5C4J L;  2R7Z L;  4A3C L;  2WAQ P;  5C44 L;  4BBR L;  2NVQ L;  1I6H L;  4BY7 L;  5FLM L;  3S15 L;  3S1R L;  3S16 L;  4A93 L;  3M3Y L;  3FKI L;  3S14 L;  4C3I L;  5FJ8 L;  4A3K L;  4A3F L;  3S2H L;  3PO2 L;  4A3M L;  5C3E L;  3M4O L;  3HOV L;  1K83 L;  4C3H L;  5C4X L;  4A3I L;  3CQZ L;  5M5W L;  1Y1V L;  2NVY L;  3HOU L;  4X6A L;  2NVX L;  2R93 L;  2R92 L;  3GTQ L;  3HOX L;  4C2M 1;  1WCM L;  4Y7N L;  4BY1 L;  3H0G L;  2PMZ P;  2E2J L;  1TWA L;  2JA7 L;  3S17 L;  4A3D L;  3I4M L;  3I4N L;  4QIW P;  3GTK L;  2Y0S P;  3RZO L;  3PO3 L;  2YU9 L;  3RZD L;  5M3F L;  1Y1W L;  2NVT L;  3GTP L;  3K7A L;  4BXX L;  2VUM L;  3HOW L;  5IYB L;  5IP9 L;  1TWH L;  1I3Q L;  3S1M L;  5IYD L;  4A3B L;  4C3J L;  3HOZ L;  1TWG L;  3GTG L;  2B63 L;  4AYB P;  4A3J L;  3H3V M;  1R9T L;  5M3M L;  2JA8 L;  3S2D L;  1TWC L;  5M5Y L;  4BBS L;  3GTO L;  5M5X L;  4A3G L;  1SFO L;  4A3E L;  3GTM L;  3GTL L;  1I50 L;  5IYC L;  3GTJ L;  2E2I L;  3S1N L;  4A3L L;  2JA6 L;  2E2H L;  2WB1 P;  4Y52 L;  2JA5 L;  3HOY L;  3HKZ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...