2Y1AA

Crystal structure of achromobacter cycloclastes cu nitrite reductase with bound no
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monitoring and Validating Active Site Redox States in Protein Crystals.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 91
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2y1aA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2y1aA02
4DPBX 2JFCA 2ZWNA 4G70B 1AZNA 4HZ1A 1OCZB 1YLBB 5I6KA 3DTUB 5AZUA 2DYRB 4YSQA 3MX0B 4P5SA 3CVCA 2VM3A 1CC3A 2AFNA 2B3IA 1M57B 2AVFA 2AZAA 2A3TA 2XLLA 3CZUB 3UGEA 1VLXA 1IC0A 3RYMA 5D4HA 1JVLA 4Q8BA 4GY4A 4UAHA 1ETJA 1NZRA 1L9RA 3AZUA 1RKRA 1EZLA 2BW4A 2DWSA 2DV6A 2IWFA 3CDZB 1I53A 2GHZA 3PXLA 1NWOA 4GP5B 3D12B 2Q5BA 1OF0A 1B3IA 4E9QA 1GR7A 4A2FA 1FWXA 4TXVB 2BP0A 2UX7A 4A66A 3UAEA 3X1NA 4A2HA 5I6NA 3N2JA 7PAZA 2FTAA 4KO9A 3NSCA 1ET8A 1IKOP 3EH5B 4BWUA 4DP9X 3SBRA 5IY5B 1BXAA 2IH8A 5LDUA 4YSAA 2PLTA 3IN0A 5B7EA 1V10A 2YAHA 5FC9A 1AIZA 1J9SA 3PAVA 4WTQA 1DZ0A 3UABA 4G71B 1BXUA 1JOIA 1WAEA 4HCIA 1JXDA 1R1CA 2IWKA 3X1GA 2GI0A 2QDWA 2XYBA 4E9SA 4K9JA 4UF7C 3FU7B 1A8ZA 2Q9OA 1WA1X 5I5JA 2GIMA 4KNTA 3X1BA 1E67A 3WNJA 1OE2A 2NRDA 4NAJA 1MZYA 4YSDA 3QJSB 2HRGA 2PP8A 2J55A 1RZQA 1CYXA 2PPCA 2BP8A 1NIEA 2YXVA 2VSMB 1XB6A 2XV0A 1L9QA 2QT6A 3ASNB 1KBVA 2B08A 3CDZA 4DP4X 3S8FB 2VMJA 2R7EB 3QJRB 2BP8B 2TSBA 2BWDA 4HHGA 1SDDA 3GYRA 4AX3A 2DY2A 2HLEB 3NJKA 3ZIYA 4AKPA 1MG2C 3OM3B 5B1JC 1A3ZA 1NTDA 3NJIA 1NIDA 2PP7A 2XWZA 1GSKA 2BWIA 2OCCB 3S3BB 1GS8A 1T5KA 2IH9A 1X9UA 2XXGA 1PNCA 2GSMB 1OCCB 1KBWA 2WSDA 2H47C 2RACA 4BDVB 1OE1A 9PCYA 2W88A 3PPSA 2VW7A 1BQRA 2ZXWB 1GYCA 4HCFA 1TEGA 1L9TA 4E9XA 2E86A 3QJVB 3ASOB 4W1TA 5PAZA 4BWWA 2WO3B 1AOZA 2HX7A 5B1KA 1SHWA 3S3CB 1SF5A 5B3SB 3ABGA 1E65A 4QLWA 1ASPA 3BQVA 1CURA 1JXGA 1QNIA 1JXFA 3PAUA 1E5YA 1NPJA 4YSPA 2UXGA 1WA2X 1OE3A 3FSAA 3NJMA 4PCYA 1AR1B 4WKXA 3FT0A 4A2EA 5B7MA 1J9TA 1TU2A 2HZHA 4HALA 3X2QB 2J57A 3ABKB 2Y1AA 3WKPA 1KCBA 1OCOB 1UATA 1PZCA 1JZJA 2AANA 2BO0A 3QJQB 1CYWA 5B1BB 3DKHA 2XV3A 3NSFA 4HIPA 2VW6A 2QPEB 1A4BA 3TBCA 1KYAA 4N8UA 1V54B 1ZIBA 4YSEA 1HAUA 1AZCA 4CSZA 2IDUA 3NYKA 2XU9A 5I26A 3ZX1A 3UADA 3NJJA 2PP9A 1NINA 4KNUA 4A2GA 4JKNA 1J5CA 4AZUA 1F56A 1FA4A 4KO6A 4YSTA 2VN3A 3NT0A 3JT2A 1KDIA 1URIA 4M4RB 3X1EA 1NPNA 4KOCA 4BK5C 3CG8A 4E9WA 1AACA 1M56B 3BVDB 1BQ5A 3T6VA 1GW0A 4GXFA 2HRHA 3CVBA 2CALA 1PAZA 1QLEB 4UANA 1JZHA 4YSRA 3CVDA 1A4CA 3NJNA 4ZK8A 1ET7A 3FYIB 3FSVA 2XX0A 8PAZA 1A65A 2CJ3A 4YSOA 4BDVA 1L9OA 4YSCA 4NERA 4X4KA 1SFDA 2X88A 4AKQA 3S3DB 3KW7A 1BYOA 3IEAA 3IE9A 3OD3A 1BXVA 1PZAA 4E9RA 3QQXA 2IDTA 1SFHA 3H56A 1SF3A 3U25A 4MFHA 1MDAA 1ILSA 1AG6A 4M3HA 3UAAA 2CAKA 3T6XA 1E30A 3HB3B 3GDCA 1ASOA 3SBQA 3T71A 1AZUA 4KOBA 2YXWA 2BP0B 2PPFA 3TA4D 2IAAC 3ERXA 2FT8A 6PCYA 2XVBA 2EIMB 3V9CA 3AG3B 5AFAA 2DWTA 3MBWB 2YAPA 2YAMA 4NB7A 2Y69B 1AS6A 5D4JA 4E9VA 2IDSA 4FAAB 3WG7B 1BQKA 2LLNA 1OOWA 3QJTB 6PAZA 2HXAA 3FU9A 4EF3A 5TK2A 3TBBA 2FQDA 3EH3B 1W8EA 1ILUA 2P80A 2FQGA 3JTBA 2GC4C 1KDJA 1QHQA 1PY0A 3PAZA 2FT6A 3EH4B 1L9PA 1X9RA 4DP0X 5I6MA 1WA0X 4YSSA 1DYZA 3N55A 3FSZA 4L0PB 2PPAA 2J56A 1ID2A 1OV8A 2EILB 2IDFA 3PLYA 2MTAA 5B1AB 4P5RA 1MG3C 2OJ1A 2YQBA 4KO7A 4A68A 2CBPA 1ZPUA 3EHBB 5AKRA 1EHKB 5E9NA 3NJHA 2BZ7A 3C75A 3NP4A 3OMNB 2I85A 3FQ2A 1IBZA 4N4YB 2W8CA 2BW5A 2QDVA 2CCWA 2DYSB 1ZDSA 4F2EA 2X87A 1ASQA 1J9QA 2HX9A 2VM4A 4DP7X 2YAOA 1GS7A 1AAJA 4ENZA 4A2DA 2P80D 1FFTB 2EIKB 4HAKA 1AS7A 1AS8A 4W9ZA 2PPEA 4YVNA 3ABMB 5TK4A 3T6ZA 3IBOA 2J5WA 1GS6X 4BXSV 5A7EA 2TSAA 1PF3A 1E5ZA 3IN2A 2YAFA 1RZPA 3AG1B 2IWEA 2YAEA 3L45A 1IBYA 1PLBA 4YVUA 1AQ8A 1HAWA 5I5MA 3QPKA 2PCYA 2UXFA 5ANHA 4GYBA 1BAWA 1OCRB 2UX6A 2FWLB 1NIBA 4QKTA 4RH4A 2GBAA 4YSUA 2XXFA 5B7FA 1WS7A 3FSWA 3DIVA 1ET5A 3T6WA 4DP2X 4DP8X 4Q89A 4G7SB 2JKWA 1PLCA 1SJMA 3OMAB 1SDDB 2OV0A 3UACA 3ZDWA 1AZBA 2FT7A 2FQEA 1JZIA 2GC7C 2I7OA 1SNRA 3PCYA 5EHFA 4F2FA 4DP6X 1ZIAA 1KGYE 3AW5A 1CUOA 3OMIB 4DPCX 3WNIA 1BEXA 1JERA 2H3XC 4KO5A 1NICA 4A67A 3AG4B 1HFUA 1BYPA 3H4FA 4G7QB 2ZONA 1XB3A 3NSYA 7PCYA 1M9WA 2FQFA 1TKWA 1AZRA 1GY1A 1WS8A 1N68A 3NSDA 4PAZA 2PCFA 3S8GB 1KV7A 1ZDQA 4F7KA 3FU8A 5F7BA 2ZOOA 1PMYA 3GXUB 2VW4A 1JZGA 1NIAA 5I6OA 1AANA 2JXMA 2BZCA 3FQYA 5I6PA 3H4HA 3EF4A 3NP3A 3SQRA 1XMEB 1ADWA 3FPXA 1N70A 1XB8A 3FS9A 2I7SA 4E9TA 1AG0A 1V55B 2MRYA 4GP4B 3T9WA 2YAQA 4KNSA 4AKOA 3QJUB 2XV2A 3WI9A 1PLAA 3TU6A 1IUZA 3G5WA 3HEIB 5D4IA 2QPDB 4BWTA 1GY2A 4BXVA 1W6WA 2VSKB 1J5DA 2EIJB 3ZBMA 4CSPA 2IDQA 1PNDA 3FQ1A 1PCSA 4DP1X 5I6LA 1L9SA 1JVOA 2XUWA 4HHWA 2HX8A 3AG2B 1SHXA 2BHFA 4G7RB 1MZZA 2GB2A 3WKQA 2XX1A 3NJLA 2H5UA 2PPDA 1NWPA 4AI7A 5I5IA 1A4AA 3FU7A 1NDTA 4E9YA 3TASA 1JZEA 4G72B 4HCGA 4DP5X 3X1FA 1W6LA 4GP8B 4JHVA 5F7AA 3V9EA 1J9RA 1PZBA 3SBPA 3KW8A 3ABLB 2CUAA 3OQRA 5PCYA 3NJGA 4FA7B 1JZFA 2FNWA 3NJFA 5I28A 1RCYA 3AY2A 1KCWA 2EINB 2AZUA 2UXTA 2FJSA 4JHUA 2YARA 4DPAX 3FYEB 1TEFA 2WO2B 4YL4A 1ZV2A 3WIAA 2R7EA 5B1JA 2UXVA 3FPYA 2N0MA 1NIFA
chains in the Genus database with same CATH superfamily
6FABL 2CRYA 1C7TA 1ERNA 5L6YL 1OM3L 1HSBB 2ZWNA 1FGNL 1J8HB 1RMFH 1CG9B 3K74B 5C97A 2KUTA 4XMVA 3LKOA 3WMQA 2NY0D 2YC1A 1AGFB 2Q8AH 3IFOB 4UM9D 4XVOA 2VO8A 3VSUA 2AFNA 1MVUB 4LQFH 3QIWA 3F7YB 5SX5H 2OAAA 3LKNB 3W57A 4IGBB 1R0AL 2L8AA 1CXFA 5CWSA 1NDGB 3MV7B 1QX1A 3QR0A 5E6SB 2VDML 4DGWC 2OJEB 1I85C 2IWFA 2WBWB 1X4ZA 3CDZB 3EO9L 3I9IA 4L8BB 3RA7H 2WBJD 2WP3O 3F12B 2BRRH 5D93B 1HU8A 1NWOA 3PU7A 3BDBA 3FJTA 3T65A 4K2UH 4P23A 3VYPA 4HUNB 1I1YB 2UX7A 4WNJA 3E1F1 2J5LC 3L3DA 3VD4A 3N2JA 3VDAA 2CUMA 3QEGH 1E9OB 4JRYB 5HI3D 4ADGA 1SDAB 4RQQB 1D6VH 2LW3A 3BW9B 5L88H 1TQVA 4XI5C 1BQHB 1MI5A 2J88H 3SGDI 4F33A 3NJXA 4HCRA 1ZK9A 1IGML 1H3WM 2NNAB 3M1OA 1H8NA 2IGFL 2OP4L 3QUZB 3DXAD 4NKQB 1S7SB 1VFOA 1DZ0A 2OL3L 4N0UA 3GQFA 4X9IA 4RESB 1UYWL 2HVKA 3P3SA 4CC0A 5JA9A 3N41B 2GI0A 3CFDB 4JFZH 3VXNB 1IKNA 4PJXF 4K9JA 2ENPA 1PCXA 2H26A 1QFUH 2Q87A 3FU7B 3W81A 4GQPH 2GIXA 3K2UL 1MCSA 32C2B 5F6IB 4EI0A 3PL6D 1OTUC 3BWSA 3FRPB 4HBQA 5JORB 4NAJA 1DQJA 4ZI8A 4C4UA 1AGEB 5J56B 1I82A 2VUYA 4LNRA 3Q01A 3CX5J 3IWUA 3NMEA 3QIWC 5FM5M 5LNEA 5J4MA 3U9PH 3PIQB 1QSFB 2CH8A 3FO1A 4LARL 5KYNA 1BBDL 1XCQB 1NCCL 3VG0H 2YPVH 3EUUA 1RH8A 5EIIB 1KV3A 3MLTA 3EDDA 4X9YA 4JKWA 3HNTH 4J3WA 4PJBF 2P24A 4KMLB 3TLRA 1L9MA 4C4BA 2GSGA 5GJSL 3OM3B 1DLFL 1UZGA 3JWNE 5FDYA 1DBMH 4KWUA 4MCNA 3CHQA 3G08A 4I3RL 4W9GC 5TE4L 3AFLA 5JQ6L 3PY9A 2XXGA 2CDFA 5GS0L 1F8TH 2OQJA 1INEL 1OCCB 3IB4A 3FMGL 1BZOA 1IGCL 4HKJB 3UGUA 3D3VB 3OVUB 3FRUB 3GSWB 2F1BA 3QUXA 5FYKL 4R2GD 5HD8D 4GH7B 3DX9B 1OPGL 2HLAB 3QJVB 5F0MB 4PJCA 3WUZA 2X10A 5EU7E 1AH1A 2P47B 4YAQB 3QW9A 1N0LB 4YBHA 3A5VA 3ABGA 2ZAGA 4Z1PA 1A66A 3MMEA 1DR9A 1J18A 4DIXA 4P57A 3TPKA 1JPGB 1UM4L 2P5PA 3MREB 3VDCA 1V3JA 2VISA 1E2WA 2GT9B 1MY7A 4PJDE 2V9RA 3SN6N 4OM0H 4XNUH 3ARGD 3FQTA 5E4AA 3VA6A 5IB1A 3OLDA 5EB9A 2VH5H 4DGVL 3QDJE 5E00B 1QQDB 4UOZA 1J9TA 1TU2A 4JCWA 5KOMC 1A6AB 4LCWE 4TNGA 5D1ZD 2YA1A 3L4VA 2Y5QA 4ZMVA 5LNDA 5CLYA 4YHZH 3R06A 2BO0A 1P7BA 2CIIA 4F7EB 4BQCA 3WLBB 1LJMA 1UD4A 4AGPA 3QUML 4LSDA 3DHPA 4GO6B 1YEHH 3K5SA 3LN5B 2FX8L 2DM4A 2DS4A 1R3KA 3L4CA 4AW7A 1AZCA 1KB3A 2DWEA 1XCTA 5FUCC 1MFUA 1NCOA 2EZ0C 3RVUC 3V4PB 4CSTA 4WW2A 4JG9A 5F3HA 3DX9A 5SX4I 1OHQA 1A6PA 3OGCA 5FFGA 5IVZB 2LAGB 5DK2B 1IC1A 1KCSH 1PW3A 5F7EL 3MLVH 5TF1L 2Y25A 4CVZA 4PEEA 1BQ5A 1DDHB 4LSPH 3VG9C 3UBXA 5HYIA 4GXFA 4OZIA 1EZVX 2Q7AA 2GVYA 2X6CA 3DMMC 4XPHH 3ILDA 3RI5F 3CLFL 2EO9A 4OV5B 1WPCA 3A24A 1Q72H 1UASA 5IMKA 2KMWA 3V4VH 4AQAB 3EJJX 2BFVH 2QGBA 2HT2D 3QORB 3T2OA 5DUBB 1CVRA 1HESA 2D31A 3BVVA 4LBEA 4M8UA 2XTLA 1IZJA 4H26B 3OSKA 4H0LC 2X7LB 3GSUA 1SHMA 4LVEA 3MLYL 2WJ5A 5DYOB 1NDMB 4FG2A 4JAMB 3AB0B 3EO1A 1ILSA 4Z3TA 3X12A 5JHDD 4TULH 3VU1A 3HB3B 2YR3A 2F7IA 4BE6A 1NMBH 4XWGL 5TH2A 5I24A 1UWGH 1FNEA 1YMHA 2Z31B 4FNUA 1M7DB 1OY3B 4KOBA 1RIVH 1FPTH 3MODH 2P42B 4PJ5B 3P2BA 3V4UL 2GTZB 2X4UA 1F3JB 1IL1A 4NZRH 4R3SB 2YSTA 3HG5A 2EEFA 3FCUB 3T2NH 3L5XL 3RY4A 2XSKA 1PZ2A 1P7QD 4PJAE 1G7LA 4OFYA 5BVJA 2CDFB 5AOKA 4FABL 4MKMA 4FC3E 3BKYL 5L4JA 5AW5B 4Z7OE 5I17A 3ULUE 3KLHD 4F7TA 2BMKA 4P5KA 1MI5B 3JSSA 3DIDA 4KROB 3ZE1B 1HOCA 4OI7A 5DJCA 1AXIB 2FT6A 3U79A 3ARQA 3IGAA 4MD5A 5AAMA 4Y4KD 3HFFA 3MNZB 2IG2L 4LCYB 4XPFL 4CRPA 3H9SB 1R4XA 2AP2A 3HAEH 4MB3A 4NO5A 4XN9A 1L6ZA 1JYXA 2YMXL 4NQTA 2DYPD 3N9GL 2P8LA 3BWAA 3U9WA 3VXRB 3EGDB 4CW1B 2O5YL 3RKPA 2WXIA 1PD6A 2JI3A 3I6SA 1UA6H 3HC4L 1CR9L 1FL6A 2V17L 3CFDA 3VXNA 1I8LC 4PRNB 3KL5A 4OI9A 2EE2A 2UY7B 1YNLL 1AGFA 2DBLL 4HOZA 5DRNA 1GAFL 5T1MA 4TRPL 2XQBH 3O8XA 4K3DL 4DERA 1DZBA 4XNXH 3OKKB 2XWTB 4KH2A 2DICA 4A39A 2P80D 1WHPA 3RA7L 4R4BA 3FZUD 7FABH 4IMLA 1OARH 4ZYKA 3QYCA 5E2JA 4H88H 1AS8A 1IT9L 1QI3A 2CHWA 3ABMB 4I0KA 4Z7WE 1SVCP 2ATAA 3DJ9A 4DW2H 1WBYB 2YJQA 2E6JA 4LOVA 5F7KC 1T5WB 1QPKA 2C3XA 3ETBF 4X80H 4AEIH 5CMAB 1CL7L 1SUJA 6CGTA 2ZOWA 2HB0A 4WEBL 4FADA 2MOVA 1HWHB 3GXDA 4GQZA 2EUVA 1IL1B 2OMTB 3O6LH 2IBGA 4NUGH 4CDGC 3U30B 2QZQA 1ZPLA 4Y19D 3KPMA 4DGIH 2WUBH 1VFMA 3LKSB 4FQ1L 4UV7L 4H20H 4H0HB 4J3VA 1I8MA 1JK9B 4IRZH 1NGYA 4WI0A 2WLMA 5TQ0L 2A83A 1T3FB 2VAAB 3KLAB 4POUB 4QYOB 3GGWA 1GGCL 2YD8A 3ZDWA 2RMNA 4BFRA 4UZGA 4DVBB 1P4BH 2GC7C 4HWZB 3FT4B 3HG1E 2DIEA 4ERSH 4K3EH 1RP8A 3U9UB 1ZOXA 5G5DA 1F58H 5SWSE 4ZUSB 2XG5B 4NI3A 3EYVB 2AQPA 5KSAC 3ELQA 4ENED 1KIUA 4JFWA 3GSRB 1XB3A 1MJ8L 3EFOA 2Z8RA 4ZMQA 4TSAH 4N2IA 3CZFB 4G6FB 3T0XA 4CBZA 1UKTA 3QC6X 3PWPE 5MP6H 3MJGX 4Y4KB 2XWRA 1W2KT 3FC8A 3LD8C 4JRXA 4KDWA 1KZYA 4F7KA 1K4DB 1NIAA 1YJDL 3JV6A 4HK0A 4MX7B 3L9RB 4DEPC 2Y36L 2JQMA 2QGEA 4O4YL 4UTBA 1LVEA 3ZDYF 4MRCA 4KROD 4XP4L 5JOFA 3RZCD 1CDHA 2JLPA 4ZSOA 3B3BA 3VFTB 3IGKA 3FW6A 1SXAA 2EDEA 3IDMA 3CFUA 1RUPL 2FNBA 1A1NB 1TJXA 1A4JB 3WSQH 5I2IA 4WDIB 1G43A 2ESVE 2OMZA 3OXRB 5DS1A 4L3ED 5BQDA 3TCTA 1E28B 2AJ3B 3GC3A 4C56E 2DQFA 1ZGLA 1Q8MA 5EO0B 4FNLH 4CSPA 1PNDA 4K3JH 1PCSA 1X44A 1EFXA 4QOKD 4TULL 5D8JH 5D7LA 3WFCH 1X5FA 2GT9A 3X14A 2BHFA 4RMSA 4X6EB 4NXSA 3C5ZD 4MZRA 4ZFZB 2PXYA 4BUHA 3NJLA 4NHCL 1BMZA 1A2YA 4YNYA 1XR9A 2P45B 2XZZA 2N1TE 2VLLA 4JZJA 1MIML 4PJDA 2W60B 2E7MA 4N2EA 3APDA 1BZDA 1JPSL 4ZW6A 1RZ8B 1NLDL 2DAVA 1I1AC 5CFHA 1G7LB 5F7AA 4X7TB 3V9EA 3Q5TA 3CBKB 5CCKH 4HIHB 1S9VA 3UDWC 5I1AB 1IJNA 2GTZA 1DANT 2AK4E 5JUEH 3HHRB 1R3JB 2KS0A 3DHUA 4DFHA 2FNWA 3FUEA 1OGAD 3W56A 2FJSA 1F8TL 2JSFA 3P0YH 3GMMA 4P4KA 1Q9LB 5EULV 1S7UA 3WNKA 4S1RH 2NQDA 2VXQL 1ZV2A 5B1JA 5LQBL 1CLZH 3MTXA 2V33A 3O6KL 2IGTA 4WI7A 5BNXD 5A3ID 5F7YC 1QA9A 2X05A 1MCJA 4GG8A 2PW1B 4YBLC 2BJML 2WZ6A 2F15A 2MOGA 4KY1H 3DV6B 1J1PL 2A74B 2R69L 4PBXA 3WDJA 1M7IB 3SDXA 4HG4K 2K6ZA 2DF3A 5I19H 3DNKA 5ADPH 1CC3A 3K2MC 4NZUL 1UKQA 4PSPA 2ZICA 4JFHE 1L0QA 4WUUA 2VH5L 3PJSB 5GGQL 1T89A 4Q2ZB 3FFCD 3JZYA 1EEZB 2VL4A 1UWGL 3B9EA 2ZZUT 1J05A 3AZUA 1G94A 3H9HA 1CE6A 3I6GB 1UXSB 3WEAA 4JKPL 3IJ7A 3H53A 1WD8A 4OKVA 4Y16C 1BJ8A 3JVGA 4ZTEA 2F8XC 3UBXI 4CADB 1HNFA 2BP0A 4A2HA 2Z1PA 2GJZA 4P5TA 4ZAKD 3WJLA 5DJ2A 1EEZA 5D7KD 2NYYC 5EZJB 4P4KB 4RQQA 2J6EA 5EUOA 3UJIH 4L8SA 5E1QA 2QBWA 4QXTA 1JI1A 3M45A 3E6HB 4ZDHB 2PLTA 4XB3A 3D4GA 4OQ1A 2VMEA 5IP4A 1KF9B 3SOBL 2X44D 3N43F 1SYSB 2DMCA 3FO9A 4Y16B 5BMFL 3IBEA 3T0ED 2JV6A 5CJBA 4OCRL 2P26A 1HCYA 3K8LA 5C2BH 4FYTA 2AMUA 4QTFA 2ADFL 4DAGH 1U3HD 3KEHA 4JNXA 5GSVA 3VE0B 1PZ3A 3NZHH 1S9YA 4HUKB 2XQ0A 4KNTA 4Z0XA 3ZZSA 1O9VA 4ZUTA 5F7UA 1D5MA 2W65B 1BMGA 1RZQA 1AGCB 3BMWA 4X6EA 3BO8B 1RJLA 3IXAB 5KUMA 5J0BA 5EOCJ 5FM4A 1B0IA 1AE6H 1P84K 2HT2C 3ILPA 4NPYB 4QOKE 3ZLQC 1IQDB 1ZLEA 2PN5A 1KBVA 3MXVL 5SWZB 1Z5YD 5DYFA 3BHBB 5BO1H 2H0PA 4X6DB 2BP8B 2FSEA 1YY9C 2F7OA 1M53A 2ZWKA 2ID5A 3KPRA 4NFCA 3E38A 1FLTX 1RMFL 5AYTA 1JAEA 3K81A 3DVIA 1A7NL 1NCAL 4PU2A 1IBGH 1SDDA 5D7JA 1U92A 2AW2A 4K7FB 2MJWA 4NN5C 1H15B 1TT6A 3GMRA 4YFLF 3HE6C 1OAQH 3UPRA 4WU7B 3QCVL 3IDXH 5DUPL 1ZA6B 3H85A 4Q6IA 4MHHG 5CEXB 3OKEB 5E6IC 4PYGA 2IPKB 5FK9A 2KZBA 3U48A 3ULVC 2D2OA 5DS8A 4FXLA 5IK3A 3GRGA 4YR6A 4L8DA 1YPZF 3OXSA 1AO7B 4YHLH 1M9SA 1Y18A 3IGUA 2AJYL 4UIMB 1CLOL 4NQUA 3O3UN 4OLEA 4XP9H 2JVUA 3QIUB 5JQHC 2GY5A 4JRXB 4B0MB 4IQHA 1ZWIB 4DVRH 5HI5D 4EI5B 1SF5A 4HUMB 1S7QB 3BYYA 3E6FB 5ENWA 4HHAB 5I71B 1QNZH 1U9KA 4LPYA 1HYSD 3IPFA 4NO0B 3NSJA 1CURA 4KKAC 1KTRL 1QNIA 2Z3FA 2X4QB 1NUDA 1PTZA 4ZFOA 1FCGA 4WKXA 1F00I 4C83A 3D85D 5CIPA 4KX8A 3DROA 4PJ7A 4JLRB 1C16A 2WM0A 3S34H 4K5NA 2IF7A 4NKIH 2XBTA 4R7DB 3QJQB 4PD4J 2YKLH 4CN4A 2XN1A 3OC8A 5J13B 4JFHD 3RY6C 4H5SA 2NY0B 4FQIH 4EVNB 1ITCA 4N2LA 4Y2LA 4HIPA 3W2DH 4W9IC 4HU8A 1Z5HA 5EEWA 4N8UA 1ACZA 4GSDH 2QKIB 2CGRH 3WL9A 1AGDB 4Z3EA 1NC2B 4ZFGL 5IQ9A 4BSJA 5E4OA 2O6DA 2ZE0A 4NQVA 1BIHA 3QFDA 3Q1SL 4KNUA 5HHOE 3D7PA 4X8GA 1TMCB 2VN3A 1A6ZA 2BVQB 4RMQA 4JDEA 3O3EB 1EANA 3VTAA 1ADQH 3CDCA 4IHOA 4XNZC 5F9AC 4LSUL 5D7IE 5I2IB 4OZGE 4L4TD 5FO9B 3O6FD 2GYSA 1L6PA 2DQIH 1ECZA 3CBRA 2XWEA 1G0DA 2P49B 1KULA 1JZHA 2IQAB 5I16B 5GRJH 2LU4A 1BAGA 2GJ6B 3UROR 5BZWA 1J8HE 4I3RH 2PWHA 2CGYA 3FT3A 1J12A 1A65A 2FO4B 4FDWA 3HI5L 1KWKA 2QSCH 5AVTB 3UAFA 1WBZA 3HB3C 4U0RC 4ZMWA 1VFBA 3BD4A 3CAFA 4LLYA 4FQ1H 4D7BA 1TVBB 1R5VA 4WFFD 3HUJB 5B8CB 4KBPA 5I0ZA 5GRVK 1MLCA 4TNWK 3PE9A 4XMTA 2ED7A 2OTUA 3WIFA 2ZOLB 3T0DA 3QCTH 4XWOC 2E0PA 5JQIB 3BUIA 4J3OD 3HIZA 1QP1A 3QUYC 3L1OH 4X7SL 4AGOA 5HYSA 2UWEA 3SDAB 2AJZA 4EI5A 1C5CL 2Q86A 4HMCA 5ICXA 2ZXEB 4GSXA 1F1AA 4L3CA 3NZSA 4NDMA 4M1CC 1E6JH 1R5VB 5B8CA 4BKLB 1D5IL 2ZSVA 2APWA 3ULAB 1I75A 3OKKA 5CZKA 5ECJE 1I3GL 3JBG7 4JHWH 4N1HB 3CZNA 4FAAB 3L5WA 3ZQWA 3GMLA 4TSAL 1CL7I 4WEMB 1I7ZB 2F53B 2FGWL 4P2CG 5C0JA 4FTVD 4JFEE 2YZ1A 1ETB1 1RL1A 3U0PA 1BQSA 2R39A 2A1WH 2IQAA 5DD3L 3SBWA 3BP7B 2XQBL 1IGYA 1XXFC 3GK8L 4IBZA 4D2NA 4F7TB 1OAUL 1PX8A 3FU9A 4S0TD 4LHUB 4IKLA 1UEYA 4KRMB 3TVMB 4OZHF 1GGIH 1MWAB 4MZ2A 1K4CA 2R1WB 1CR9H 3FN0L 2AXWA 3D2UB 1WA0X 5IJKC 3MACL 1B4RA 3KPRB 3MGTB 2H9GB 4YDJA 2ROXA 4S1QH 3IJEB 1AQKL 1CGUA 3F00A 4MXVE 5LBSA 1ZANL 2BSRA 4Q6YA 3C6LA 5H37A 5K9QI 3ZW3A 1MJUL 2APXA 3KHOA 1H3PL 5CS7A 3HI6H 4PGDB 3ZVVA 5ESVA 3EOYG 1ZV9A 2VLKA 4JDZA 2C3GA 4MAYC 2FJFB 5D7EA 1JZ5A 3KMDA 2I9LB 3A0OA 5F7WC 1EJOL 5I17B 5C2UB 3C5JA 5ACMA 1X5ZA 3KPNA 2E7LA 2QL1A 2G0KA 3MQIA 5E23A 2EVGA 1PX3A 5LBSH 1CU4L 3FF7A 5HVFB 3F6JA 3IJYB 3QRGL 4WRLA 1P5UC 3FTWA 4F8PA 2G2NA 2NLJA 2NXYC 4N8CH 2EIZA 1GGTA 5IQOA 4NQXB 4R96B 1Q1JL 2OMNA 4OZFB 4JM0A 1J7VR 5KYYA 2XWJB 4YO0A 3AITA 1XWVA 4ABQA 4O2FB 2IFFH 1GH7A 3EJPA 3N41F 1ZS8A 1HNGA 1D5XA 1MFVA 3O2DL 4KJYA 4XMZA 5A7EA 1M7DA 5KBNC 2Q1EA 3CH1A 3CZSA 4Y9GA 4A1RA 5C6PB 1OTTC 3L3GB 3RWGB 2JKIS 4Z7WF 2YWZA 4ZOEA 3MNZA 3PGCA 1YDPA 3QPKA 1PZUB 1A6WH 1Y18B 1N4XH 1Q0XH 4YE4H 2YUWA 1E9PA 4Z5RA 1OLLA 2D31B 1PBYA 2WIIB 3F6LA 1FAIL 1G1YA 1OCWL 3RGVB 3DYPA 2B15A 2CU9A 1CDIA 4JM2D 3IDGA 4DP8X 2BVYA 2ZKHH 1P2CB 5GQBA 2HRPL 4OQTL 3FOMB 3RWCA 1OT2A 4LCWB 3WY1A 1IBBA 3CX5K 4JO3H 3B2UD 5KG9B 3QNZA 4A2LA 4PHXA 4N0YL 4XNXL 4N6RB 1SNRA 5DO2D 4JMXA 3WNPA 1GZHA 3BVXA 1USQA 4HUUA 1OB1A 3Q2LA 3UPCA 1BLNA 4O4YH 4BCXA 4PJBB 1AXSB 3BAKA 2EH8H 1NICA 1HFUA 2X6MA 4CAGA 1GCFA 4S1DD 1M1XA 4JFFD 2WKOF 3DIFB 3ZDZB 2B7DT 4KXAA 3CHSA 5CUSL 4BCYA 2R0ZH 1RURL 1VEPA 3VSQA 3KYMB 4PLNC 4UNTA 2N7AA 4PAZA 4BZ1L 2E8ZA 2HG5B 4WKZB 2KL6A 3HI6L 3WS3A 4UIMA 4PJ9A 4Z7OF 1OD7A 4G6FD 1JJUA 1LMIA 3KLSA 5IQ7L 1DQQA 4Y1AB 1OP4A 2G3NA 4MCYB 5E70A 1U8JA 2NY4B 4W81A 4XWOD 4F37F 4JREB 5FGBC 5KVFE 3S4SG 2J1ZA 1ADWA 4KJQC 3MRFA 3GRWL 3HFML 1LD9A 1TQSA 2J8UA 3BUDA 5F7DB 3G6AB 2RALA 3H0TA 5ACLA 3BUYB 4Y5VA 5AL8A 1K72A 3MXWL 1BFOB 1IAIL 3JXAA 4F24A 4Q9CA 1DVXA 4O02L 5HXMA 1FE8L 4GBXD 2M8XA 5J13C 1INDH 1IB5A 4NRXA 2AEOA 1AXSA 4WW2B 4TVUA 4LLDA 3VCLB 1EFXB 2FE0A 1QSFA 3HE7C 4EN2A 3BN9C 4PW4A 1ZHBB 3F7VA 3MBEB 3OHMB 3QNZB 1LHZA 1BFOA 1F4HA 3ARBD 5D6DA 5LBVA 3DRTA 4R4NC 2GB2A 3CFJA 1BD2E 1GYUA 3EJYD 4A6YA 1KLUB 1ZVYA 4NQDD 5TFSL 1LO2H 1UZ6E 2J71A 4JEGB 5D2LA 5C0AA 1K2DB 4JCMA 5I73B 15C8L 3FU7A 1L5GB 4UTBH 3C09C 4OLUL 4KMTH 3EDKA 5GZOD 3QULB 1INQB 2HRPH 4G8GB 4ANUA 1TZAA 4DHLA 4EMZA 3CXHK 3QG7L 1KOAA 2JXMB 3TO4D 4XMLH 4XPTH 3LTVA 1B6UA 1JRHI 1OGSA 1PDKB 3OWRA 3SDCD 3CSYA 2EKSB 2UZYB 3EGXA 1T20B 5FFOA 2HJKA 4K55A 4MA7L 1T21B 4NM8H 1FGVH 4QHUA 3F7LA 3NA9L 5I30L 1UH4A 3VD5A 1A22B 3L3DB 2N0MA 1H3XA 1PKQA 2B0SL 4ELDA 5C6TL 1B4JH 1OAXL 4BZ1H 1J05B 4G70B 5TGBA 3TT1L 1IBHA 2ZYSA 3H9SD 2NDFA 3VD1A 3ARYA 1DJHA 1JI2A 3QIWD 3IU3A 4XNMA 3RWCB 3TJHD 4TMPA 2WD0A 2DYRB 4YDNA 3BXNB 1TCRB 2VKXA 4PGEB 4D9QD 3BCFA 3B7UX 5M95B 4D8PB 1ANUA 3S3SA 3G9AB 3VTMA 1MCNA 4TSBH 3L3OC 3WKNA 5DK0B 5CINL 1A3RL 5A2KH 4KX9A 3AGWA 2H3NA 4RAVA 4PUBL 5IQNA 3ZJAA 1I1YA 2HVJB 3P9MB 3VFMB 2BDNL 2IIJA 1X5GA 4M6NH 3SDDC 3PJNA 3FCSB 4NO3A 3D8MA 3VXMA 3BZDA 1XX9C 4OZHA 5SWZE 3QIBB 1KGWA 2QADD 2ZOKA 1AIFA 5T5NG 2WUCL 3I9GH 5CM1A 1PEWA 3M88A 2XPGB 1E4WL 2YD4A 1E4XL 4XNDA 1WWBX 1T5WA 5I1KH 2IH8A 5JHLA 5LDUA 4NHUA 1XFPA 1ZD6A 4G6AC 4W9JC 5IUCA 1WLHA 1DVFB 2Q3AA 1AI1L 4AITA 1BOYA 1GGIL 3DSNB 4PJBE 4EZKA 1RZ8A 1T22B 3NH7L 2ZX9A 2TRHA 4APQD 2VLJE 4QGTA 2NMSA 4MLSA 1SJEA 2PYFA 1W0VA 4MWFA 5I1IL 4HC1H 1VZGA 3HZVB 5EU5B 3Q05A 2NY4D 1HIMH 3BZ4A 3GLEA 2BSDA 4UB0H 4UQBA 2I9LA 4CMMA 3X1BA 1A3LH 1YQVH 2XDHA 5DZVA 3QDJD 3U30C 4YSDA 5HHVL 1KB9J 3WNJA 2CZNA 1X5HA 4M7KH 5FLVA 2PYEE 2EIBA 2F58L 4O02B 1AGBA 1N3NA 2X4PB 3T1FB 4W9KC 4L1HA 1T2JA 2IPTH 4RZKA 5EIVA 4M9OA 4RMUA 3VXMB 4WJKB 5B3JE 5HJ3A 4DP4X 4UBDC 4IIQC 1DQTA 4Y2OB 5IBLD 1KB5A 1RK1B 4G7YH 4FLQA 4DKEH 1I7TB 3TJEH 4KQ3H 3QRLA 4AX3A 4PIRF 1TJHL 1KJ2B 4P07A 1JVKA 1JPFB 3WL9B 4FQXA 3SJVE 5C0CA 2HAZA 3AM8A 3MRNB 1I8MB 4L9LA 5I9QB 2CKBH 4LK4A 1F2XK 3QUMH 4P9HH 4MQXD 1KLFA 1J86A 2DJSA 4HX1A 4JFDB 4Y7OC 3MZTA 1CLCA 1E3XA 1BBDH 1IFGA 1ZA3A 1VESA 1HSBA 2OI9C 2UVEA 5HDBE 5CEYA 3E8UL 4C83B 2LTQB 2ARJQ 4RFNC 2YOAA 3QJOA 1UOVA 3BZFA 3K71B 2P43B 3GO1H 2H0EA 4HP5A 1GIGL 3T0EC 3HCVB 1EAOA 3TNNA 3O4LD 2J25A 3BDYH 3QFGA 4U05A 4AQ1C 4F8OA 3MRLA 1XAUA 2UXGA 3BP6B 3BE1H 2AK1H 1NGPH 5K5YA 3WAJA 2AV1B 4A2EA 5BOPA 3TM6A 2BCKB 4LVHB 2WNXA 3IDJB 5D1XD 1A7NH 2XV6B 3D0LA 1NFKA 3WKPA 3KLAA 5DFWH 3ZYOA 3DSNA 1TENA 1JZJA 5DK0A 5DJ8B 2MCPL 3G04A 2PYEB 5KSAD 4AQ1B 4ADJA 4ZFFA 5GJTH 1HILA 1PSKH 3IJ9A 1BPVA 5EU6A 3RG1C 4P2OB 1CU4H 1G84A 4QRSA 4WGKA 1F4XH 5GGSA 5JTWA 2X12A 5LWYL 3IKCA 3IJSB 3SE9H 5IKCB 3H3PH 4MD0B 4DKAA 1IEAA 3TA3C 4UQ3B 3NJJA 1T1XB 1IT9H 1UB5B 4AZUA 2XRAL 3WUWG 1N3NB 2X4PA 3CZEA 4ZS7H 3C60C 1KDIA 1OQXA 3WMPA 3T2NL 2L3BA 3MYJB 1IC7L 3OJDA 3KPSA 2QGCA 1UGKA 4XP4H 5F7HA 1OXYA 3WE6B 4P8QA 2EIDA 4OCRH 1TJMA 3NA9H 3U7YH 1NCAH 1S7TA 2HRHA 3CX2A 1XH0A 1ZA6A 2W94A 5FUZH 4R4BB 4RMBA 3CN3A 3T3MF 1B90A 1OF2A 5FYKE 5KS9E 2CA3A 2DMBA 5F3BA 1RXLA 2HG0A 1SFDA 2ADIB 3HG3A 1EFQA 4H20L 3CVHB 1PG7H 3BVNB 4IJ3C 1ND0A 4HDIA 2X2YA 3PWLB 2L7EA 4QXGH 5C70A 4PIBA 2QVTA 3ILPB 1YEDA 4FQIL 4NCC1 5EZIL 3QQ9C 1OGTA 3UAAA 1A9BA 4HPYH 2CAKA 1CGWA 4PJ5A 1ZVSB 2J20A 3SBQA 1ASOA 4G8EB 3T71A 4M61A 2G5RA 3RDTC 3TA4D 4IRSB 1EEYA 5AAMC 3MLVL 5TF1H 2EIMB 1A9EB 1YEEL 3EAKA 1JHKH 3V9CA 1K85A 3P9MA 2DWDB 5KVMC 5DDHA 5H94B 4UM9A 2IBBA 1EVTC 3QR2A 1JE6A 4NUPA 4E41E 1DN0A 5JLZB 2F5AL 2NX5B 2FIKB 4UZUA 3EDFA 3QORA 1Q72L 3ULVL 4OFKA 3ATEA 4AXWB 4ODTL 4NENA 3WUWA 4BH8A 4JG0L 3L3JA 3GEWB 3G08B 1NAMA 1SJXA 5L2KB 1DQDH 1IAMA 5D5MA 4IBYA 2FQDA 3BQUB 1W8EA 1U3HA 3HI5H 3NIFB 4I1NB 2P24B 1FIEA 1PY0A 1KC5L 5JOPD 1DYZA 1Z66A 3Q9PA 2R0WL 4L0PB 1BECA 1FNFA 1PS3A 3NFPA 1IARB 1UXSA 4ZT1A 4DQOH 2B9AA 2DWEB 2W0FA 2FBOJ 1CE1H 1GHFH 4LLVB 2AF2A 5F96H 3FUNA 3QJZA 1JDAA 3CK0L 3GHBL 4G59C 4Z7UA 5F7NC 1HT6A 2RJMA 2W95A 1BJ1J 2VQ1B 1NC2D 2Z4QA 2AKRA 3NP4A 5TQ2H 4GRLB 2I85A 3V9FA 3SD5A 2R1YB 1S9VB 4QIRA 1R3HB 2VERN 2W8CA 3FNKA 4ZOCA 4ELKB 2Z8SA 1ZDSA 4HKBB 5D1XE 1KLGA 1IM3D 2F19L 3MUJA 8FABB 4K7PY 3LKRB 3I6KA 3CHRA 4GAJL 2NY2C 3WS6A 4Y4FD 2VZSA 3II1A 5F3BB 4GEJA 1TQWA 1FYTA 2Z4QB 1UFGA 1KNOB 4K0OA 5L7XH 1AS7A 3O0LA 5C0FA 4W9ZA 5TK4A 4RCAA 1MH5A 2MH4A 3KYMA 4E5XB 2H1PH 4N1CA 1HSAB 1A2YB 4YNYB 5AUMA 1OSZA 3TCLA 2DQDL 4JN1L 3P2DA 3WFHA 4A6YH 3DVFA 1B6DA 4AJ0A 2OM5A 5T1LA 1JZ8A 5DUJA 3DUUB 2A0LD 4GAGH 2BSRB 4WWNA 4M3KB 4N0YH 4LP5A 1AC0A 1T66D 2B2XL 5FGCE 5T5FL 3EGSB 2UX6A 1CBJA 4Y4HA 2LTQC 1FORH 3DBXB 1NFAA 4KHTH 3BJLA 4PMFA 1Q9WA 2GBAA 4E42B 3MLYH 1GC1C 3RURA 4L3EE 3JWNC 3HMXH 5E2TL 5B7FA 4OB5H 3RB7A 5C3IA 3BE1L 3DSFH 3S3JA 1XD0A 1XIWD 1SJMA 3C60A 4P2YA 4ZBJA 1TDQA 4I85A 1WIPA 5AW3B 4JY6A 1SEQH 1FO0A 3L6FB 1DEEA 2OMUA 1AZBA 1OARL 2FQEA 3VJ6A 3MYJA 3D0LB 1AVAA 1RFDH 1G7QA 4NBXB 5I1EH 1GYWA 4M8RA 3V4LA 1YDPB 4K7PX 3KLHC 3KYAA 1D5ZB 4H8PA 4FXKB 4XO8A 2H3XC 1KCKA 4XP6L 1VPOH 5H2BA 3UJTL 5DU7A 4GI6A 4I18A 5BS0D 1KXVC 4JB9L 4ZTPH 4RIRB 4FFTA 1PD1A 2OSLB 5DJ0A 5EU6B 5GIRA 1WS8A 1N68A 4PS4H 1B9ZA 3IS1X 3JWNH 1E4JA 4QNPF 1USZA 1HH9B 5DWPA 4JFXB 4HLZH 3G7TA 4ICWA 5HDBB 5F9JB 4YK4C 2X1QA 3J2PA 1YEWA 2RCSL 1JGDA 4GKSB 3QG6B 4S1SH 3U2SA 2NLJB 1T0MB 1SOSA 4L0ZA 2WCGA 4MMYA 5I1JL 3OKDB 5E8PA 3WNNA 4OLUH 3T0EA 4Z7WA 2QPSA 4AV5A 2DI7A 1KB9K 1TZIB 3RX8A 1P2CA 1GKOA 1CGTA 4KPHH 4L3EA 3GBLA 4Y16D 2YXFA 3QJUB 2OMWB 1GRWA 2ARWA 3QDGA 3ZYJA 1DQLH 4I87A 4Y19E 1BOGA 3C9NA 5KTEL 2FWOA 5J8OA 4YPJA 3OV6A 1HE8A 2YFOA 3PV6A 5FKPB 5K9KA 5GXBB 4HVBA 1VHPA 2YQGA 1MOEA 3APFA 2KYIA 4U1GC 4OCWH 1QLEL 3ARWA 5EA0H 1IAKB 5BV7H 2AJ3A 5CGBA 6FABH 2NCMA 1BM3L 3HG1A 1KIPB 1L3WA 4FQXC 4Y9FA 3OLGA 4XI5D 1VGKB 2B4CH 4GI8A 5FCUH 4Z7UF 1E3FA 2D73A 4J6RL 1IIKA 3W9EA 1WBYA 2XTJD 1DBAH 5MENB 3CV5A 2Y9RT 4E36A 3FFCB 4AIZA 4X4XB 1MVUA 4IIQA 4N3UA 1PZ5B 4M7JH 4Y9BA 3NIDB 5EU5A 5IR1B 5L4FA 3V4VA 4AEIL 3NIGB 5E8PB 3SGDH 4C54A 1PZBA 3K6NA 2VXQA 1NCBL 1ROCA 4F8NA 2OXHA 4M43L 5IVOA 4ZS6D 5PCYA 4HJGB 4PI2A 4DKDC 2M2DA 2HMIC 3LQMA 2Y7NA 5KBPA 2VDRB 1YO4A 2E6PA 3WN6A 1IGCH 3EOBB 3SPVB 1MFMA 4KU1A 3A4AA 4KKCD 4NO2A 3HNSH 2OL3B 4U6XA 2WQUA 4HHAA 2G5UA 1GTFA 1MVFA 3QC5X 3QXVA 1JP5A 3KLLA 4HZLA 2IQ9H 3VXPB 4UNVA 5F0LB 4GUCA 3QXTA 4DPBX 4EIUA 5EFIB 4LHQB 4N0RA 4LDOB 1HINL 3A21A 5AW7B 4HZ1A 4B9GA 5F97E 3GHBH 1EMTH 1T4KA 5KANG 4GFXA 1V7ML 2OMUB 4P5SA 4QT5A 3BYTA 3A67H 4FQLH 3GD1C 3FFCA 3BT2H 5JHMA 1X5JA 2FX7L 3CZUB 4LLAA 4OZIE 2VZOA 3TYFA 5ISZD 3PQYE 4YHYC 1RZJC 2AQTA 3F64A 1TZHA 2BNRD 4KGJA 3TA3D 1UD8A 3BGMA 4NKIL 5KVFH 2P48B 1PIFA 1OWWA 4BKTC 2CDEA 2Q86B 3V0IA 2C4FT 4Y89A 4XT1C 4PG9A 3KLDA 2GFBB 4KO9A 4XPFH 2Y7QB 4JMNA 4F37K 5B38G 3HAEA 3ZKMD 2QQLH 3ZQ9A 3V8OA 5IBTH 4OSUH 2BMKB 2BJMH 2AK4D 2Z93B 4BFGA 1IM3B 4OFPA 1W80A 1TZIA 3K0WA 2VZTA 4OUUA 3NPSC 1P7KB 4Y8AA 3IFPB 3G9VA 1AIZA 3O3BB 1U42A 3BH4A 3QPQD 3VFVA 1FN4A 3LD8B 3HMXL 3ECQA 5C07A 4UNUA 3I02A 4FCHA 1HHJB 4KFZC 3UGXA 2CLZB 4HD9A 3RFZB 1QSVA 3I50H 4NN5B 3V5DB 1H6FA 2AEPH 5IMKB 4GRLA 2YPVA 3H2QA 3LZOA 5I5JA 3EFFA 4YHNB 1E40A 4DCQA 5T5FA 1ZSHA 1OP3H 1T21A 4XNBA 1GYAA 2L4OA 1DE4B 1X4XA 1T04A 1S5HA 2ZOUA 1YNTB 2WVSA 4Y4HB 3P73B 4FMFA 4FOMA 3B3IB 1ICTA 4APQC 1M2VA 4I3SH 4OJFL 1MIMH 1GA2A 1PZDA 4KUZH 4MNQB 5DMKA 1G7QB 4XMPH 1ADQA 4YHMH 1H6TA 3QFDB 4KZDL 1ACCA 4RRPG 4JB9H 2CBTA 3UTSE 3IF1B 3TT1H 2DMHA 4CGUB 5IJVA 1HOCB 5KN5A 3GJEB 4CDHA 4B9KC 1Q9OB 3O3AA 4D8PA 4U2ZA 3LPPA 1Z9SB 3BQUA 3RGHA 4OLZL 2RTTA 1A7QH 4F8TA 4PN6A 2VT0A 4FFWD 1QHOA 4B5EA 3CH8A 1ZT1B 1A21A 3HR5B 1T1ZA 2IH9A 4FULA 4KZEH 1FZJB 4ZOBA 5FFLA 1PNCA 4L37B 2I32A 4X6DE 3NACL 2WW8A 1J8KA 2FATL 4ZW8A 4PRPE 3QG6A 4HMEA 1CI3M 3IFNH 4OGXH 1U2CA 4XNZB 3PWPD 5JZ7D 4PY8J 4N0CD 3O6KH 4NHCH 2IAND 2DQCH 3VH8B 4IRJB 5ID0A 3FK3A 4UOJA 1IV8A 4UQ2B 5BRZD 1JGLL 1KTJA 1AP2B 1FYTE 2XACC 3E6HA 5K9JH 1S7UB 3NRQA 3H7LA 5ITFA 3B4NA 5CILL 3RVVC 5CEZH 5FR3A 2X6VA 2GSIB 1ZT7A 3GMQB 4M1CD 1D6VL 2EVJA 3CFCL 1R3JA 3VXOA 1F4XL 5LWYH 4U1NA 1AMXA 4BEIA 4FZ8L 4PJ9C 2NNCA 2KLSA 4Y9EA 3B2VH 3ZTNH 4XVTL 2VDPH 2MFNA 1LO5A 4UCFA 1OGPA 2IXQA 2XVGA 2Y72A 1UH2A 2A99A 3GMQA 4A6YB 2VW6A 1ZJAA 2C26A 2X4RB 4YHOH 3RVXD 5K1JA 5C0RL 1YUKB 2EUZA 3OR6A 5C0BD 3LS4H 1CLOH 2XY2A 3MJ7B 4MAYB 4C55A 5I74B 1NFDF 3LXCA 4FJZA 3UADA 3WYRA 4OKVB 3WFBH 4HJTA 4U1JB 5BS0A 5C9KA 2G5BB 3D4CA 5EORH 4EAEA 5BVPH 4JANA 1JIBA 4KROC 4QXVA 2V2XB 5GGQH 1C08B 5E2WH 5DD6A 1VEOA 4TL5A 5HGDA 3LN5A 4QRUA 4HJUA 4GKOA 2XQYK 1O6TA 1RV6X 5ERWA 3QQ4A 1QLEB 2RD0A 1JV5A 2X6BA 3FYIB 2H6PA 3NZUA 3FSVA 1LP9F 3QZBA 2A74A 2VDLL 3KBPA 4IU2B 5FO8B 2Q7YB 4YSOA 4HGWB 4BDVA 4YSCA 4GKNB 4PJGE 2DWDA 1IM9A 3C6SA 3D39D 4G11A 4E9RA 2HVBA 3V0FA 4S1QL 3B3IA 2GJ6E 1K4DA 3Q6GL 3HN3A 3US9A 4HXAH 3ZKSD 3FRPA 1C5BL 3UG5A 4I0PC 2VDLB 1P5UA 3RPIB 4M5ZL 4DEWA 6PCYA 4PJFE 3BRGC 3VFSB 3P3TA 3AXIA 1MAML 3HB3D 3KDPB 3MOAH 2VE6A 2V17H 5GGTA 1O6SB 2E7LC 2Y69B 2JF1A 5HHOB 5TQ2L 1RZKL 4ODUB 1FZJA 3OG6B 3BIKA 4WU5B 4K94C 1WAAF 2X2IA 5GS1C 3UJIL 3TVMA 3NCWA 2BHZA 3L3JB 4ZFFB 5FYJD 5JDSB 4NIKB 3C6LC 1C5CH 3TBBA 4J23A 2P80A 4ZUWB 3JTBA 1SOKA 4HKXB 1W16A 3X14B 2X9ZA 5E6ID 3AS0A 2BPBA 4FCAA 3CUPA 2ZQKA 4RFOH 3UC0H 1YMMA 4LF3B 4D9LL 3RGVD 4MHHI 1TTFA 1YA5A 1U8HA 3BLKA 2OJEA 3SBWC 1CF8H 1IC7H 4JPIA 5BJTB 1TZHB 3Q3GB 2OJ1A 4L1SA 4Z9KB 3OR7B 1XGYL 2YMOA 2BOBB 3GSNL 4JUSA 5CSGA 5CSZA 1KXTA 3VD3A 5T1KA 4LARH 3H2WA 4ABWA 4M3JA 4JPKL 3J07A 3L4UA 5C0ND 3L3HB 4QRQA 4F2EA 1IBDA 4EBQH 1DQVA 2VM4A 4JKKA 4O00A 4C47A 2F54B 1J9CT 2JNZA 1F3RB 1GS7A 1P4BL 5B39G 4D0BB 4Z7NB 2C4XA 1QABA 2Q76B 5ABZA 3BP6A 4TF4A 5KVEH 1S78D 3FB7A 3D18B 1NUGA 1PLGH 2QADB 2NY7H 3QIBD 5C0CB 3SDAA 3BW9A 1B0GB 2OL3A 4PGJA 1I31A 2VDQB 3HBPA 4LCIL 3FQNB 3VWJD 5L6YH 2A7BA 3IN2A 2IWEA 2JCCE 2YAEA 4FFYL 2WC7A 4YVUA 3HG1B 1X6LA 5T3ZL 5I5MA 4TUUA 2BNQD 3PNRB 2VR7A 2UXFA 3QAZB 2QVIA 5I8OL 3MBXL 3AQDA 3T2QA 1JV2A 4ETQB 1CGSH 4QRSB 1EXUA 1L6XA 5J12C 1KBPA 2WPGA 1IGTB 4JFPB 1R9FA 3V6FB 1NGYB 2JKWA 4ZO7A 4M03A 4AQ8C 3MRPB 3S36X 2IH1A 3DDGA 4U1IB 3SO5A 4YDKH 2HTKC 2H4EA 2PO6A 1YEIL 1WFUA 4LGSB 5IVXF 1G4MA 2VN4A 3NK3A 4KAQL 2YGNA 3T4AA 2WKGA 1EV2E 4O02H 3FXIC 3CXDH 3TV3H 1YN6B 2O61A 3TO4C 4GKSA 2NPLX 1KBGH 5DZ9A 3T1FA 1DVFA 3HRPA 5F1KC 1FH5L 2HKAA 4UQCA 2VO5A 4V1DA 4W6WB 4WI5A 3D48R 3MV9A 1F02I 2WSPA 5DWUL 1ZTXE 1TG8A 3MRIA 4AOFA 3GXUB 4OLXL 1JNNL 2D2CC 5GRZA 1HHKA 2QFRA 1A6VH 2XIDA 1S7WA 5I1LA 1RUML 4ZXBB 3FQYA 4YR6B 4MMZA 3IFNL 1T22A 4Q14A 3EKCA 3GI9H 2FATH 3R19A 1SQ2N 2VDQH 2FO8A 2ODIA 3FPXA 1L7TL 5HP5A 5IEHB 5E2VL 2YAQA 3QDMD 3VI3E 4OH2A 4ANVA 4Z7WB 3MFGB 1U91B 1IUZA 5B4MD 4KKQA 4P46A 2FHFA 4NN7C 5L8JB 2BNQA 2VDMB 3GMNA 5ADOH 2F18A 1DJGA 2X4NB 2VSDA 3JWDL 4PB0L 4GBXB 1D5ZA 2WOBA 2YK1L 4FHKA 3ARBA 3D5OF 4Q6IC 5CUSH 5C0DA 3O9WD 1QUNA 4MXQC 3PV6B 2GCYA 1UJ3B 4WSGA 1DLFH 1F3JA 5CBAB 5SX4H 1ML0A 5AALA 1EO7A 3AG2B 2W9EH 3UO8B 2OSLA 4G7RB 2CPUA 4TQHA 2WLIB 4HUXB 4X50A 1GJUA 3SGKC 4X8JB 2DQJH 2X3AA 3NEOA 4MDJA 4OD3L 4QJ5B 1IQWL 5C0CD 5TE6L 3RGBA 5FS5A 3GJFB 2XA8L 4GP8B 3EYUH 4WUUD 2VM9A 2CNZA 4WO4A 5FDWA 1IAOA 2Y6SD 4PJ7E 4A6YL 3MRHB 3F58L 2QSCL 4JRFA 1QWUA 5C0BA 3VFOA 2R1YA 4JKPH 1T6BX 1OP5H 2K4AA 5GGTL 3SYCA 1F13A 5DHXB 3SKJH 5E2UL 1P4LB 4KZEL 1JGUH 1OTSD 5E4EC 4Z7OB 2D7NA 1BM7A 2Q10A 3C09B 1UVQB 2K9FB 2DDQL 2OR7A 4DPAX 4OZHB 3EO1B 3MRGB 4FTVE 1KTLB 5AB1A 2VL5B 5E2TH 3KM2A 4F92B 4UILH 1B4LA 3RDJA 2ICWJ 4QXUH 2DLTA 4N2CA 2XYCA 2AI0H 2GG1A 2XETA 1F4WH 4NKOB 5DLLA 5KJ7E 2EO7A 3GM8A 5K1NA 3QS2A 2JJTA 1DEEB 4HAFA 5EZPA 1OCZB 2CSPA 2R8SL 3L5IA 3CDYA 4X6FA 5AZUA 3QZWB 4KI5E 2E74C 3BUBA 2H6PB 3LNHA 2WXMA 3DPBB 4UBDD 3V52L 1B3JA 5K39B 3MGOA 2PMZA 4X0NA 2XLLA 4DSYA 3KLKA 2IALB 3UBXB 4N9GA 4BK4A 1TTUA 5D2LE 4LU5H 4OF5A 5D4HA 5C0AE 1JVLA 3JV0A 4Q8BA 4YBQC 1RUPH 2C34A 1TZGL 2EEDA 4AW4A 3WNOA 3MJ8A 4XHJC 4J39A 5JHLL 3IF1A 3QJHA 4GP5B 1T89C 1KEGL 3MUGA 2IPTL 3L3OB 5I1CL 3BKML 3FSOA 1F2QA 1NANH 5J3HC 1IFRA 3VSVA 1VCBC 5I6NA 4ZPTA 2NY4C 2VISB 1ZANH 3EO0A 2Y06H 4PRAA 2VUKA 1XEDA 4FQCH 5GSRB 4PJIA 5BOJA 2A9AA 3X12B 4BELD 3UYRH 2ZUUA 4PJEF 5BXFA 3Q9QA 1TQBC 2I07B 3M8OL 4EDWH 4LMQI 1P6WA 1SZNA 2J7LA 1H3TA 1IAIH 2EDHA 1U6AL 4WTQA 1U8JB 1XF3A 2HFTA 3X3FH 1JNLL 5JR1L 4XX1E 3VMPA 1XV8A 4P4KC 4GG8B 2IWKA 1UA3A 1CVSC 2WINB 3JZ7A 3PWVB 2YJLA 5C9JB 4HZAA 3S37H 5BXFB 2ICES 2O26U 3LQZB 4X5PA 2JQAA 3ZMRA 1WISA 1RIHL 3B9VA 4E0RB 5D7SL 4GW5A 1FHGA 3H8NA 5HHPA 1LWRA 1N0LA 3ESVF 4JRXE 4LSRL 1LWJA 3SGEH 1HL8A 2GJPA 4H8QA 4PGBB 2YXVA 4CGTA 3ZTDC 1TJIH 3BVUA 1KJMB 2C9PA 2CBMA 2E9GA 3S36H 4LEOA 2OX5B 4JZJC 1OVZA 3ULVE 2DQGL 3BVNA 4FNPA 1EHXA 1NCIA 1OALA 1T1XA 1WZMA 1HINH 2JJTC 4HKJA 1XCXA 5T1KD 3GTTA 2ZXQA 2MHAA 2WTOA 1XGUB 1OANA 3K4AA 1CPUA 5DHVA 1U91A 4B9YA 4AKPA 1QSEA 1ZVSA 3MGAA 3TYFB 3QNYA 4HT1L 3TH3T 5DGQA 2YUVA 5LAXA 5C0BB 3HE7B 5CKAA 3FT1A 4WJ5A 4APQB 1D2PA 1QEWA 3QUXD 5DJ8A 1NCCH 3IDIB 2YGQA 3ATAA 3ARDD 5HDRA 5DUPH 1GJWA 4NQQA 4DZ8B 1BQRA 1QZ1A 3VFRA 1GYCA 5EUOF 5D71L 1I8KA 4WO4C 4M7KL 5C0GB 2XG4B 4NYLA 5IVXA 1PFCA 3VXQA 5IKCA 1SOXA 3FTXA 3HAEB 4M7JL 3UEQA 2JI2A 3ARDC 2XBZA 4UQ2A 4MJIE 3WNMA 1GCYA 5DFVD 2H26B 2VXVH 2X9XA 2RAMA 2VLJB 3IJ8A 4WO4B 3S97C 2EXYD 1QFWL 2HZHA 1YAIA 1FN4B 1LO0H 5AWNL 2YSSA 1YNKL 2EDOA 4DN3L 3K6FA 3QUYB 1PG7X 3O11B 3QUZA 1YC7A 1PZCA 1ACYH 3SQBB 1NDGA 2AV1A 3ARBC 3MV7A 1MFNA 1UM4H 4G5ZH 4JJHA 4U1GB 5EORL 4ETYA 4MX7A 2K1MA 2C8NA 2PO6B 4NN6C 4E68A 1F42A 5F0PB 2PWDA 3BH9B 3OBAA 4Q9RH 2BVPB 4NJAH 3K4DA 4AIZB 3QWOB 1D5BB 1VADA 4B53A 1WDAA 3RKDD 2Z92B 2KPNA 1T4KB 2H2PD 2GEEA 4UYPA 4YHKH 2W0KA 3K71A 3OX8B 1JGEB 1UWXH 5F6HJ 3M17A 4YHYB 5DEJA 1RQ5A 1XBDA 4C57C 4BKLA 3EDJA 5EN3A 4MMZC 4JFOB 1MAKA 6TAAA 3BGMB 2B59B 1ZTMA 1BA9A 2HPOA 2DB8A 4FEIA 4PW9A 3TZVD 3CFCH 3V5DA 1NMAL 2IOIA 1Z0MA 4HOWA 1A7OH 4N8PA 1BYNA 2ZCKL 3CFKB 4I2XE 1QOKA 3MR9B 1AR1D 3KPMB 3DK2A 2FO1A 2JB6B 1T4WA 3V4VB 3EH2A 3L9RA 1IM3A 3QQXA 4G1MA 1HKLL 4NUQA 5T33H 2YEZB 1EJFA 1F97A 4L9LB 3U25A 3NUKA 5DLML 1FL6B 3CZJA 3T4AC 5DUML 5HYJD 2AJZB 3MV8D 1A7OL 3GTVA 1JPFA 4XMPL 2BOBA 5DD5L 3O2VH 1I9RL 2D7PA 3KPOB 4XHJD 1Z1WA 1BEYL 4N8VA 3FTGB 3SDXF 1XF1A 3C5SA 2X53A 4R0LA 4UM8B 1EXGA 2GTWB 3K8KA 3RIAK 3V4PH 2EXWC 2XVBA 2XTSA 3TF7C 2EXTA 5B3NA 2X1PA 3UBXG 1T2QH 3O9WC 4TQEL 3QEQE 3T4AB 3BJ91 2Z8VC 3SCMD 3ZE1E 4BSVA 4ANXA 4O02A 4HIXL 4WFED 1V3MA 1N18A 2YUZA 2LLNA 3T0AA 4U1IA 4KKPA 3H9YA 3P77A 2QVKA 3MRNA 5DGRA 2GEQA 5DR5H 2XWBB 1NKGA 1AD0B 2VDRH 2YGOA 6PAZA 2WTRA 1LO3H 3GHEL 5BRQA 5HDQH 2Q8BH 3AQXA 1SXNA 1BF8A 1ILUA 3BAYA 1BGXL 4OJEH 3INOA 3TBSA 5GGUB 1W0VB 4MWFB 4BSVB 4TPRL 3VFWB 1KIPA 3U0WL 1JMZA 1X9RA 4OBSA 5BVJB 3W38A 4PJ7B 3ZUNC 4YSSA 5AB0A 3AJ7A 3K72A 5GS0D 2J56A 1LEIB 4HC1L 2E4TA 1NUNB 3NABH 4XE0A 1NAML 5J7CC 2O5XL 4M5YH 4NPJA 1ZGLM 1VB9A 1DVUA 3GSXB 2AERT 1OAUH 3BAEH 3NCYS 4ABUA 4XH2B 1LE5B 1E27A 1NC4B 2QPFA 1X5XA 5BW7A 4U7SA 5FGRA 4AGMA 1XL4A 4RSYA 1SPDA 2F9BT 5A3IC 4IM8A 3CSGA 1EHKB 1GPOH 3GUTB 1E4XH 1EERB 1YYLL 3AAZB 3HPJA 3IAQA 3QT2A 3O8XD 3L2LA 4BQ6A 5IROA 3SY6A 2H3NB 2DLHA 1CQKA 2P8MB 4RAVB 1ASQA 1GSMA 5HVGB 4AZ8B 4NQCB 1JGDB 3NCFB 3QVAA 4U1LB 4JM2B 4PVNA 5F88A 3L9EA 4WV1B 5B22A 1NFIB 3RVTD 1P1VA 4ZSOE 1BVKB 5F7LB 1VGKA 1I9IH 4ELME 2BRQA 3Q6GH 4P9HL 4JPWH 2IANA 4QXTB 4ZDHA 3QH3A 1U92B 4K7FA 3QAZC 4WFHD 4CVXB 5HGDB 2G60H 2YAFA 3ARED 3QG7H 2NW3A 3QDGD 4HH9A 4AV0A 5MEND 4BFNA 3C08L 2YPLA 3PREA 1NH6A 1BF5A 4M1DL 4AQOA 3GIVB 3L4TA 1CE6B 1ZCRA 3I6GA 5IW6A 3VXME 3L5XH 1NKRA 3POHA 4FXGA 3SYOA 5CEZE 2D0GA 4W4OC 1QBML 1VFAB 1Z9PA 2ADFH 4ZUVA 4KFMA 5JDSA 4YHIB 3L3IA 4HSQA 5I6XC 4HJEA 2IQ9L 4LB8A 3F04A 4Y5XA 1ODAA 4B6ZA 2A9DA 2PWEA 1Q0XL 1SDDB 4YE4L 2WINA 5D7JB 2QQKL 4BK8A 1FFPA 3D34A 5IMMB 4FMVA 1M7IA 3SDXB 1ACYL 1RY7B 2OZNA 1F86A 1HNYA 4DUVA 4PB9L 1EHLH 3V0DA 5D7LE 3GBNH 4MXWH 3QZMA 3N04A 1PZSA 4KGLA 4MGXA 5DQ9B 5GIRB 4ELMB 2NY0C 5C0EA 4AM0B 3PGFL 2A74C 3B83A 4YIQA 4X6CA 1GY1A 1GC1H 2B1HH 2X41A 1N0XL 2PCFA 1A9BB 1DJSA 5HGGS 3VFRB 3WIHA 4NCDA 1EDHA 5FCUL 3GSUB 5BS0B 1U36A 4UAOC 5IK3B 4ATTA 4WI6A 5FV1L 5FM5O 2EH7H 1LNUA 4J3OH 1HOEA 2R2EA 3SQRA 4GT7A 2XNAA 1E4KA 4YGAB 5ALBH 3PJSA 3C5ZB 5D2LB 5C0AB 3WGUB 1LD9B 5LN4A 4ZFOL 3HNVL 3QQ4B 4OZIB 3BAXA 2MRYA 5F8RC 5IEKB 4DH2A 1NOFA 3WI9A 3BZ5A 2F68X 4HFWA 4NLAA 5D4IA 3RIFF 4U3SB 1FL5B 2GK2A 2R2EB 2DQHL 4HF5H 3HFMH 1FRGL 4EZMA 1W6WA 3HNSL 5ACZB 5FW6A 1J5DA 4UV4L 4GIPD 1MCWW 1AQDA 2C3VA 2UZXA 3BKCL 3BP5A 4UOQA 5ECGA 1OWRM 2K8MA 5ESQB 5CN3A 3M86A 3LYRA 2PXYD 1B4JL 1OAXH 3EJTA 2F8VA 1HL5A 3IDXL 4JFEA 4UILL 5F7FA 5FYKD 5AWNH 4L48A 2YD2A 5D72H 2BVOA 4QDGA 4E5XA 5KYUB 3ULUC 2WAQA 4IEFA 4P2QA 2NQCA 4MA3B 2R0WH 2PW2B 1A4AA 1DQIA 1J0IA 1EHAA 1SVBA 3HBQA 3FU5A 1JZEA 3D25A 2GITB 3L8QA 2Y23A 5F44A 1QPXA 4PVBA 2ZCZA 2PF6A 4JHVA 4LMQE 5E5UB 4LCWA 3KJ6L 1V05A 1WG3A 4PJFB 2CUAA 1YEGL 4GRWH 2EDKA 4PJIB 5HI4D 2W0LA 4UTBL 4AYBA 3KE0A 4M61B 1IKNC 2B14A 2GJZB 4KK9C 4HQQH 4PG2C 5KN5B 3KG5A 1FYHB 5BRZA 4ELMA 1LLAA 5C0EB 3QDHA 2XKUA 2R0LH 3FYEB 3EFOB 3BQUC 2J3SA 3RWFA 4LSSH 3BLBA 3FPYA 4HULB 3ZKND 3EDEA 5C0DB 3DTDA 2XIBA 4B27A 2VQTA 3JUYA 1UT1A 3GZKA 3PGCB 4PCTA 5TD4A 4XO9A 2W91A 3S2AA 3EJQA 1N64L 3GEFA 1T5XB 2NUTB 3EFDL 4L2YA 2J43A 1KJVB 4U6HA 4XVUD 1RZJL 3ZE0E 3DX6B 2FYYB 4M6OL 4B9IA 1WZAA 4PP2B 3BPCA 2VM3A 4Y19B 2J2ZB 2L0DA 4JPVH 4EDXB 4QRRD 1JFHA 1MHPH 2H2PC 2G30A 2ZF8A 1B2WL 2MNJB 3UTZA 4PS4L 2PR4H 1EZLA 3FCGA 3RAJH 2ZSWA 1IC5H 2EIEA 3B2UC 3OKMA 3ARBB 4KJWD 4XCYB 1MWOA 1DVQA 2CCVA 1GR7A 5KBLA 2Y5TA 4L8BA 4UM8A 5LBGA 4B0MM 2EVFA 2P5WA 1TQTA 5DI8A 3TYGH 4OF7A 4DESA 4LOUD 5SWQB 4AYGA 3FQNA 1EBAA 4PG9B 4PV9B 4LNVA 2ZWYA 4HIHA 2V0AA 1A6UH 4XTRD 3B8YA 3ZTCC 4H0IA 3MUHL 4PRIE 4ZYKB 2VZ1A 3VW3L 3GHEH 4J8QA 5EEUA 4PRHD 4G71B 4J3TA 3P3RA 1BXXA 2C3HA 4FLOA 1JXDA 3L48A 1NAMH 1QSZA 1AOHA 5CAYB 1AXTH 5GZOA 5BZWB 3DGGB 4CN1A 3L08A 2WXLA 4YHZL 1MELA 3ZMEA 4DK6A 2UWEE 5IHWA 2J8UF 2JCWA 5ESVB 1EHNA 3MA7A 4PD4K 4QO1B 4P99A 3O41B 3BVTA 3N1GC 3EZJB 1CFSB 2Q20A 3VNYA 2Y24A 3KGRA 3UC2A 2H6OA 3DMMD 3NFNB 2FGWH 2MNUA 3MLUL 5AQ0A 1XGZA 4ZO8A 4G2AA 2GUOA 4ZW5A 1SXSA 2ERJC 3MV9D 4PRPB 4UNIA 4YFLI 1P4IH 2QQLL 4F7PB 1HIML 3I3DA 4P46B 4F9PC 1D2OA 4QYOA 4JE4B 1DL7H 3DETC 2AQ2A 3HA0A 1YYML 4MMXB 2VDNH 1YEEH 2XN2A 1JPEA 3V6FA 4H5SB 4EVNA 2BC4B 1GS8A 4P2OD 2EDRA 3CCHA 3NCJH 3EADA 4L4VD 4YDVA 3WTUA 3L5WB 4FFZL 2P44B 1VFBB 4G1EA 3KJ4C 3T0EB 3D50A 1JTPA 3NCYP 1DBJL 4AL8H 3RGVA 2V7NA 1S7RB 2YD1A 3ARXA 3RVWC 3QHTC 2O5ZH 5K1VA 4KQ3L 5DR5L 4P4KD 4FYSA 5PAZA 1IM9D 1F6FB 1WGVA 3D39A 4ZAKB 2UWEB 5JHDB 1DCEA 1TQCC 3S3CB 2WNGA 4ATWA 1YEFL 4D7PA 4JPIB 1L0XA 3BQVA 4FQQA 1MFDH 2CKNA 4S10A 5F3FA 2A6KB 3B43A 1E5YA 1TVBA 4QCIA 5LXVA 2ITDA 3NJMA 1UWXK 4IRJC 4NCC2 3FAXA 4KXCA 1EO8L 1K6QH 4N5UA 5DYOA 4HALA 5DVNA 3OX8A 4HIJB 2JELL 1BVLB 2LQRA 2BIIA 3CGTA 3JWNG 3LB6C 2A83B 1M3IA 3IDNA 2FRGP 2V5YA 5CJQH 3U1SL 3HN8A 4JFZL 4GRMB 4DEUA 4LEXH 4KH9A 3BH9A 4BINA 4QRRE 2ZOTA 2NY5H 2OW6A 5K33A 3BWAB 3ZZ1A 5HYSG 4JRYE 4OCSL 1ORSA 5FX3A 3NYKA 1Z9MA 4ZG1A 2WZPD 4ETQA 5LDSA 1GXEA 3PV7A 1M3JA 2F1EA 5EC1B 3HHSA 3VFMA 2DQEL 3G5VB 2Y2WA 3BCDA 1OAQL 3X3FL 2EDYA 4R26L 1KN2L 1K5NB 3RB5A 3TO2B 1MCWM 3CN2A 3BZEB 4A63A 4KKCC 4LCCA 5DC4B 3HC3L 4WAFA 3H0TB 2CQVA 3MA9L 1A4CA 5DJAA 2FHBA 2N4IA 4RX4A 3EO9H 4BA0A 1IC4L 5T5FH 1XMWA 4IOSA 4PRID 3UP6A 3VE0A 1MFAH 3L3KA 4HBCH 4KNQA 5GGRB 5I76A 4I18C 5I75C 2DQHH 4QKXB 1B0RB 2CO1A 1E5CA 3COOA 1D7CA 2F53D 3U7YL 2XN9D 2VXSL 1I8IA 3FT2A 3UTTB 4CVWA 5FO8A 3GS4A 1LO4L 3TGXA 4YHLL 1PKQB 4ZMLA 4WK0B 5MEQB 1I7UA 2GUYA 4LEBA 4M6AA 5ITBH 1IC4H 7TAAA 1CCZA 3PQYB 3S36L 3RNKA 1A1MB 1ZT7B 4Z76A 5E1AB 4L5FE 4WZ9A 1FNEB 1EO5A 2RHEA 3O9WB 1ZWIA 2YXWA 3QIBA 3SDAD 1FZOB 3SPJA 4NNYA 3I2CH 4YPGB 3VWJA 1WFNA 2A73B 3OKMB 1JGVH 5AZEL 3IGAB 2DKUA 4Y4HC 3GRWH 3AROA 5D4JA 2A6IB 4E9VA 1UA6L 2FLBT 4R90H 1O9ZA 3F6IA 2E9JA 2VC2H 3GDBA 2CMRH 3B37A 1PYWB 4EBQL 2WQWA 2ICEB 3MLRL 3QJTB 2NR6A 1A6VL 2WQRA 1J5HA 2BNQE 1ES0A 1JNNH 2CNYA 2DLEA 2R23B 3DUSB 1FFNB 4P5MA 3VU2A 3STBA 4M5SA 5E6YA 4ZXBD 2P8PA 5JO5B 4JDTL 1MFCH 1MCCA 5CP3A 8FABA 3EOTL 2X42A 4OCYH 4WTWA 3U36B 4JANB 4L4TB 3IETA 5DURD 4UB0L 2YFNA 2FX9H 2R4RL 2QQQA 5IOPA 3W37A 4ZW3A 2NXYB 4LDLB 1CL7H 3UCRA 4G42A 1DQLL 1QW9A 4XN4A 4YZWA 3WS6C 4FA6A 2WHVA 1XGQB 5GPRA 1MY5A 1RJZB 3UL4A 3UJJH 1FORL 3D39E 1M6OA 2AVGA 2BOCB 2W81C 3IMBA 2C1OA 4OCYL 5DRZA 4JQXC 1ZPUA 3EHBB 3FMGH 5JMRA 1GGBL 3K0YA 3NJHA 1CBVL 2BZ7A 2IPUK 3RFRA 1D9KC 4NP9A 5DHYA 4IBTA 4OGAC 2QDVA 1EWHA 4LBEB 1XF4B 4N0FB 4HAGA 1N12A 4PJHE 4LLUA 5H8DA 1QUPA 2V3DA 2R1XA 4G6JL 4LLQB 4FFYA 4IDJL 5I1CH 3VXOB 4TUJA 3C8KB 2BDNH 2V8LA 2AQ3A 2WXKA 1XH1A 3N1FC 2ALAA 3VX1A 1O9WA 4BRVA 1H9VA 3ALWA 4U6YA 1ZTXL 5TE7L 2ZXGA 1MKFA 3EXJA 4CVZB 1VDGA 1OKEA 3NVQA 4W6XB 3V0WL 2WBJB 3WN5B 4ZX4A 1XD1A 2QSQA 3BP5B 3L45A 4JRYA 4CADA 3QP3A 3QPXL 3VVWA 2WZPA 3GSWA 3QORC 5E2UH 1DBBL 1NMAH 1EZVY 3VWJB 3NPZB 4Q6KA 1EEYB 1BJMA 1AQMA 4I48A 3STZB 5KG9A 3BKJH 5CZXC 4MVBC 1IFHH 4QKTA 4YC2B 4TOYH 3ZDXE 2CJUH 4XAKD 4YSUA 4XNAA 1ORSB 1ET5A 3G3LA 5EWIL 3QXWA 2K8QA 1Z0NA 3BUQA 5I0WA 3WIIH 5KJRH 4UIKH 3RDTA 3GXNA 3QQDB 4KPHL 3LKNA 4FLHA 1J8HD 4AXWA 5A2IH 2VR9A 2Y3NA 4JG1H 5JIIA 4EI6A 1MWAL 3QQ3A 5C8JA 4AZ8A 2VITB 1TU2B 4R8WL 3ZHNA 4PRIA 1JZIA 4TPRH 4WNSA 3ZTNL 1QWNA 2XN9E 1BVLA 1XAKA 3G6JB 5IMLA 4A7UA 4YK4B 4GSUA 4KO5A 4F33B 3AG4B 1NBVL 2DTML 3VXUE 2ZONA 1AQKH 4CN6A 3H42H 3V6OA 1OAYL 1G6RH 2WXJA 4C56D 4HIEA 1U8NA 1X4YA 3OJDB 2WNKA 1C12A 3DV4A 1KV7A 2CO2A 3H2PA 3RFZA 5H35B 1IE5A 4AGNA 5FYJH 1WD9A 1EPFA 4MDRA 1YQ2A 3MZGB 4X7TA 3WFDL 4BSWB 5J6HA 3H4HA 1U4EA 3IJSA 2OJZH 3EYOB 4ZX6A 1G6RL 2VDKH 4N20A 2WZ0A 4UU9B 3L4XA 2AJSH 1P6FA 1Z3RA 2X3BA 2YA0A 1N70A 3DI3B 4YBQD 1QD0A 1AY1L 5A16A 4LCCB 1PZ5A 2DH3A 3FKUS 3B1TA 3WE6A 5LCVH 2NOYA 3LEYH 3TEXA 4HFUH 3T3PF 4OUOA 5TE7H 1QUNB 4G3YL 3TS8A 3IT8D 1G87A 4LRIC 4LIQE 1Y0LA 3MKGA 1JV2B 1N6VA 3OHXA 4PRPA 3U9UA 4P4RA 4R5TA 4WFGE 2Q0ZX 2FHCA 5J6SA 4QHNB 1JVOA 4HEMA 3MCKA 1SHXA 1CB4A 5C0AD 2IEPA 5HDQL 5JW4M 1MNUL 2C9VA 4YS4A 3VQLA 3ARSA 3B56A 5IHLB 1BOGB 3WKML 4AQ1A 5I1GL 3B5HA 1WIOA 2N0KA 3ARVA 1N6QH 1MCOL 3CQFA 2AS5M 3AREB 4MYPA 2EYRA 4BFKA 1MJ7H 3LXAA 3N6YA 5HYFA 3HUJA 2ADJB 3QEQB 4Z3JA 4UQEA 3WEBA 4YHKL 3EYSL 3SDCC 2NUPA 1MNNA 3ZL1A 3GUTA 1MLBA 1WCQA 4I7ZC 2OS7A 4PRNA 4G8GE 2DBJA 2ZUXA 3MLZH 3OAWA 5I16A 4XGZA 4JFPA 1GPOL 1I1FA 4TV3A 1L0PA 3SPVA 4FFZH 4GKZB 5AL0A 5ETUB 1OM3H 1XF2B 4NYLB 2XPGA 3WJJA 1ZT4A 1GAFH 1NCBH 5KVDL 4J1UA 3FTVA 1CXKA 4QTIL 2JFCA 5FYJE 1CFTB 5KBDA 4PLKC 1CFQA 3SQOL 1A4KB 1AHWA 1F45A 4DZ8A 1AO7A 5T3ZD 1RHFA 1KN4L 5I6KA 2DMKA 4XAKE 3WTTA 3V5KA 3CE1A 4GUPB 3AUWB 3OKEA 1S2EA 3ESMA 2A9NL 4U6TA 1KBGL 5BV7C 2D03H 4L3AA 4X80L 2VLMD 4FZ8H 2J5LB 3IFLL 3HBZA 1NA8A 1ZEAL 2SEBB 3FUFA 4PP2A 4D0BA 1ED3B 3AY4A 4XHQA 5JNYB 2O1AA 4UAHA 3OKYA 3HUJE 1NZRA 4G5ZL 3TNMA 3IU3B 4M1DH 4XNMB 3TP4A 4ACTA 2DV6A 2JIXA 1GVIA 1T0MA 2FSEB 5D9SB 1WWCA 4WTZG 1FE8H 1O6SA 4WO0A 4MBRA 4R0LB 2J8HA 5H37G 1M2OA 1THAA 5HGBB 3DUUA 1BD2A 5FCSH 3V0VB 1IAII 4PP1C 2LR4A 1MQKH 2VJ0A 3HUJF 3QUHA 4XCEA 2APTA 3VQMA 5BRZB 1OK0A 3LNIA 1XT5A 4ONFL 5I8EB 1BXAA 3T2LA 4FN0A 1KPRA 2RH0A 4JO3L 3UYPA 1W8NA 3V5HB 3DURB 2DYPA 1MH5B 4NS0A 1PDKA 2NY3D 4C4KT 1NBYA 3TIDA 2QMKA 3BPNC 2HKFL 2GW5A 1ZVNA 2MQCA 3LHPL 1VAHA 4LFHD 2J12B 4HJJL 3PYCA 1S4IA 3UTZB 1WAEA 1XVSA 3H7BA 3U2SB 1NLDH 2WIMA 1MRFH 4NJ9H 3LVEA 1U8LB 1K5WA 4GAFB 2FWUA 2QDWA 2QVFB 1ZHKA 4ELKA 3U2IA 5KVEE 2HLFC 1KXHA 4UV4H 4LVOB 2EZ0D 1WA1X 3LH8A 4P49A 3WXVH 5FO9A 1TZ8A 3MLXH 1H15A 2NRDA 1PQZA 4ZXBC 5GZNC 1GJIA 3RNQA 2V9QA 4OD1H 1I1FB 3P30L 4YEEA 5I15H 4JDEB 1U6AH 3QDJA 1RUAH 4PREB 1Q4NX 2F54E 2WWMC 1DJWA 1CBVH 1KGJA 5ALBL 1P9MA 5FXCH 2P1YA 3CN4A 2OXGA 3QARA 3H1ZA 1UCBH 2X1OA 4HWBL 3GYRA 5CCGE 4LDCA 2HLEB 4NQDE 2HRLA 1A3ZA 4Z77A 4L1BA 4XMXA 2OZ4L 2K4WA 1G1CA 1EIBA 1KG0A 1T1WB 2PNDA 2OCCB 3BXNA 5K9QG 2W80C 1XZWA 2CWRA 2FYVA 3LXUX 2EXSA 3O11A 4FX5A 3S98A 4OF3A 3SQBA 3WBDA 4F7EA 4BH8B 1H6UA 2H47C 4ZQTA 1YUHA 1Q90A 2EABA 4BDVB 1LNUB 3OJ2C 4TSBL 5MEOB 3LQAL 4KVNH 1QI5A 4P3CL 4HCFA 2OCFD 4ZD3L 1AR1C 2Y6SC 3AXLB 2HN7B 3FCTA 3MLRH 2RA1A 4QAWA 1KIRA 3ATFA 5BVPL 3LZFL 1A7PH 4IRSA 4S11A 1JYWA 1L0YA 1CF1A 2FB4L 2ZX6A 3HS0C 5DSCA 1J8RA 3EJSA 4FXKA 2R4SH 4R7LA 4P05A 4MJ6B 3EOAA 5IROD 2EACA 4N6QA 8CGTA 1WA2X 2G5BA 2WMPA 3DYOA 1AR1B 1AKPA 3FT0A 1DUYA 3AT8A 5D6DC 5B7MA 5BUPA 2WZAA 4KKAD 2OI9B 4K9EC 1ONQA 3PXJA 5IB2B 1D7FA 4LPXA 5IFJB 3HE7A 3TZVB 4M7ZB 43CAB 3GSNH 1QQDA 2AANA 3QQDA 5IMMA 2OQJB 1TQCB 1AO7D 1SEBB 1FFNA 3FOMA 2LU7A 3RAJL 2DM2A 3F3HA 1CYWA 2XJLA 2VLME 2P4AB 4X8XA 1KG0B 4XNYL 3U83A 5IW3A 4Y4FA 3RBGA 3TBCA 5DQJB 3OAUH 4UTAL 1HAUA 4C58B 1U93B 3N50A 4Y5VC 3RPKA 4TTGA 1DN0B 3VXRD 1N0XH 4MCYA 2OX5A 5KANI 3KGUA 4HBCL 4X7SH 3R4RA 2J1XA 1KYFA 4J3BA 1ITBB 5LGKA 2CGZA 3IAGC 1EBPA 2YPLB 4B5ZA 2J8OA 2NXYD 4JFVA 3X1EA 4BGLA 4BBWA 1V27A 4JY4A 4J28A 3AVEA 3OAUL 4TNVF 4LNRB 4MBOA 4K9EH 3T6VA 1BV8A 3QJFB 3L7FA 4ONGH 4U1SB 2N01B 1AP2A 4KUCD 1D5XB 1UCBL 2AJSL 3AXLA 3NJNA 5E9AA 5H4YA 5J11B 1I1RA 1ET7A 1EEUA 2FSDA 1N4XL 3I6KB 5F0JB 4WO4D 3ESPA 3N0AA 2CJ3A 3FFDA 4QHKI 4OFVA 1H6EA 2VLJD 3ZDXF 4X4KA 4X4YA 1FDLL 4MJID 4PJ8B 1B0RA 3UJTH 3VFVB 1TSRA 4LSVH 5ELIA 4MQ7B 1DDTA 1A9EA 1QO3A 1MHCB 2QELA 1P7QB 4OGXL 3KBFA 3MREA 3SDDD 1CICB 2H32H 1VEMA 2DD8H 1BFTA 1HDMA 2BINA 1AZUA 3V4VL 3EJUA 2K3TA 3EUDA 4L29B 4AGLA 1WRFA 3RVTC 3ZE1F 1UB6B 1H8SA