2Y1AA

Crystal structure of achromobacter cycloclastes cu nitrite reductase with bound no
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Monitoring and Validating Active Site Redox States in Protein Crystals.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 91
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2y1aA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2y1aA02
3QJSB 1CC3A 3IN0A 1AZNA 1A8ZA 4JHVA 5IY5B 1OE2A 2BZ7A 1WAEA 1HAWA 2JFCA 2UX6A 4AZUA 3KW8A 2JXMA 1SDDB 2XX1A 2QDWA 3EHBB 1PNCA 3TBCA 2CAKA 3FSZA 3MBWB 2YAPA 4BXVA 3FT0A 3SBPA 5B3SB 1CURA 1URIA 3AW5A 4YSEA 1PLAA 1BXAA 5TK4A 4YSCA 4YSUA 1GY1A 5LDUA 3QJQB 2IDUA 1PZAA 4HHWA 4WKXA 4DP0X 3TASA 4DP8X 2WO2B 4M3HA 2GC4C 1EHKB 2WO3B 3FU7A 3GXUB 2BO0A 2HX8A 3T6WA 3S3BB 1A3ZA 2UXFA 1WS7A 1BEXA 3NSYA 1GY2A 2BP8A 3QPKA 2PP8A 4G7QB 1A65A 2BWIA 3SQRA 2HXAA 2I85A 2PPAA 3ABMB 1AQ8A 3FQ1A 3X1BA 3WI9A 4G70B 4BXSV 2DYSB 4YL4A 1NWPA 2FQFA 2OV0A 4ENZA 4F2EA 1JZHA 4MFHA 2PPCA 2EINB 6PCYA 3WKPA 1J9SA 1TEGA 1NINA 4BK5C 2XV2A 2BZCA 1AS8A 8PAZA 1AANA 4GYBA 5TK2A 1SHWA 2W88A 3UAEA 1AZRA 1GYCA 2YAMA 3QJUB 1W6LA 2GI0A 1FWXA 1TEFA 1PZCA 2TSBA 2GHZA 1T5KA 1NIAA 1E5ZA 2FNWA 5B1JC 1FFTB 2IWEA 3NSFA 2HRGA 1PLCA 4A2EA 1BQRA 2TSAA 2J57A 3FU9A 3WKQA 4AKPA 1J5DA 4HZ1A 1OCCB 2DV6A 3X2QB 2Q9OA 1NIFA 3FU8A 3EH3B 5B1BB 5A7EA 3NSCA 4JKNA 4KO6A 4YSSA 2N0MA 1KCBA 2FTAA 2XXGA 4KNUA 1ASPA 4AKQA 4DP9X 4E9SA 4UANA 1W8EA 3AZUA 4DP4X 1AAJA 3N55A 3PAUA 2JKWA 4HHGA 4YSPA 2FQGA 3OD3A 2OCCB 2VSMB 3NSDA 3QJTB 3H56A 2CJ3A 3WG7B 3S8GB 1M57B 4P5SA 3N2JA 4HCFA 2IAAC 5I5MA 1JZJA 1ADWA 1XB8A 2FWLB 5I6MA 2Y69B 3ERXA 4A2GA 1B3IA 1DYZA 3OMAB 1PMYA 5E9NA 4A2FA 2I7OA 4KO5A 4NAJA 1E30A 3DIVA 4YSAA 1IUZA 3NJIA 2H3XC 3UABA 2QT6A 4JHUA 3KW7A 1L9PA 2QDVA 1ZPUA 1CYWA 1SNRA 2J5WA 4HCGA 1NDTA 1KDIA 1AZCA 3UAAA 4A2HA 5F7BA 3T6VA 1E65A 3X1NA 2ZOOA 3EH4B 3PLYA 3DTUB 4A2DA 4QLWA 4CSPA 1QHQA 4W1TA 3TBBA 1BXUA 2MTAA 2B3IA 1BQ5A 1OOWA 4DPCX 3NJKA 2CALA 2FQEA 3ABGA 4YSQA 3CVDA 3BQVA 1TU2A 1PCSA 5I6LA 3WIAA 4GP5B 1GR7A 1VLXA 5PAZA 2GIMA 3CDZB 1NPNA 5B7MA 1ZDQA 3WNJA 2IWKA 1IC0A 2PP7A 1XMEB 1ZIBA 2AVFA 2UXGA 2ZWNA 5AFAA 5ANHA 2EIKB 1OF0A 4BDVB 3NJJA 3QQXA 3OM3B 5I26A 2YARA 1WA1X 5B7EA 1BQKA 3U25A 2IDFA 1R1CA 1I53A 1ZV2A 3EF4A 2CBPA 2X87A 1AZUA 2HZHA 1JZFA 1E67A 5F7AA 4F7KA 3ABLB 1SF5A 1GS8A 2FT6A 2VM3A 2XV0A 4E9WA 3SBQA 1M9WA 5D4JA 5B1AB 5D4IA 3S3DB 1KV7A 1AG6A 3IBOA 3NJHA 1XB6A 1IBYA 1RZPA 3PAZA 1X9UA 4BWWA 1J9RA 2WSDA 3AG2B 5I5JA 4DP6X 1WS8A 4TXVB 4F2FA 1JOIA 2HRHA 4QKTA 2P80A 4YSRA 2DWTA 2XU9A 2EILB 3T71A 3PPSA 3IE9A 1JZIA 2DY2A 1NTDA 2OJ1A 4AKOA 3CG8A 4Q8BA 4ZK8A 1F56A 2XYBA 3AG1B 4KO7A 4NB7A 4UAHA 4HIPA 1EZLA 3FYIB 2AZUA 2VMJA 3SBRA 1NICA 4A68A 2ZXWB 1L9QA 4AX3A 2IDSA 2YAHA 1V55B 2PPFA 1BYPA 1MG2C 2AANA 1OCRB 3OMNB 4Q89A 1J5CA 1W6WA 4E9XA 1SJMA 2UXVA 1NIBA 3ASOB 1J9QA 2UXTA 1ET7A 2FT7A 3NYKA 3AY2A 1N68A 2YXVA 5I6PA 2LLNA 3NJLA 1JXFA 1NIEA 1PAZA 4PAZA 3FYEB 2PLTA 3X1FA 2VN3A 3CVCA 2IDQA 1YLBB 3TA4D 1KBVA 1AIZA 3BVDB 4GP8B 1M56B 2BP0B 2CCWA 4E9RA 3JT2A 1BAWA 5AZUA 4L0PB 3TU6A 1L9OA 1ET5A 3V9EA 2YAQA 2VSKB 2FT8A 1WA2X 1CUOA 4YVUA 4E9YA 2PP9A 3CDZA 2BHFA 3T6XA 5I5IA 2VW4A 4YSDA 2AZAA 3T6ZA 1KYAA 2PCYA 2EIMB 1AG0A 1MDAA 1ILUA 2XV3A 2VW6A 3NP3A 4BDVA 2NRDA 5PCYA 1AZBA 2GC7C 2XVBA 3OQRA 2XWZA 1GS6X 2H47C 1DZ0A 2VM4A 2QPDB 3QJVB 5I6NA 4DP7X 3IEAA 1PZBA 4CSZA 1L9RA 1RZQA 1JXDA 2YAOA 3NJFA 2PCFA 4HALA 4DP5X 4EF3A 2YXWA 4GP4B 2XLLA 2IH9A 2Y1AA 3FPYA 2GSMB 1E5YA 3HB3B 2HLEB 1IBZA 1NZRA 2CUAA 1V10A 3FPXA 3FS9A 4UF7C 4K9JA 3PAVA 4YSTA 1NPJA 7PAZA 3IN2A 1SF3A 1KDJA 1JZEA 2HX7A 1PLBA 2RACA 4BWTA 3NT0A 1JXGA 1HFUA 1PF3A 4WTQA 1CYXA 2B08A 3AG4B 3NP4A 3V9CA 4NERA 2YQBA 1GSKA 3T9WA 3FSAA 3UADA 2FJSA 4G71B 1ET8A 2GBAA 3FQYA 4DPBX 2FQDA 3H4FA 2DYRB 3ZIYA 1ILSA 4M4RB 2XX0A 1MG3C 2BWDA 2J56A 4P5RA 4G7SB 4GY4A 1MZZA 3EH5B 5EHFA 3S8FB 9PCYA 2H5UA 4FAAB 4HCIA 3HEIB 3CVBA 3FSWA 1RKRA 4KNSA 2PPEA 4X4KA 2A3TA 5FC9A 2DWSA 1HAUA 1QNIA 4E9QA 2PPDA 5B1KA 2BW5A 3QJRB 2YAFA 2BW4A 4E9TA 2HX9A 1GS7A 1JZGA 1KGYE 1RCYA 1A4BA 5B1JA 1N70A 1FA4A 2P80D 4KO9A 3CZUB 4YSOA 3ZBMA 2BP0A 4FA7B 1J9TA 3S3CB 1A4AA 3PCYA 1V54B 3NJNA 1BXVA 1OE1A 4HAKA 3FU7B 4DP1X 3ZDWA 1KBWA 3H4HA 3D12B 3NJMA 4KOBA 4A66A 2BP8B 1OV8A 5I6KA 1UATA 1ID2A 1L9TA 3FQ2A 4DP2X 1TKWA 4KNTA 2EIJB 3X1EA 3DKHA 3JTBA 1WA0X 2YAEA 1AOZA 3L45A 2AFNA 2XXFA 2E86A 5D4HA 3C75A 1KCWA 1PNDA 1AR1B 3UACA 3ABKB 1ASOA 3PXLA 2IWFA 4PCYA 3X1GA 4G7RB 3WNIA 4N8UA 1ZDSA 1SFHA 3FSVA 4G72B 2UX7A 1QLEB 2QPEB 3GYRA 1AACA 1BYOA 4W9ZA 1GW0A 1SFDA 2IDTA 1OE3A 4BWUA 1NWOA 2IH8A 4E9VA 3UGEA 1JVOA 1MZYA 2Q5BA 1JERA 2MRYA 4RH4A 2R7EA 1ASQA 1ZIAA 1XB3A 3NJGA 6PAZA 2VW7A 2X88A 3OMIB 1NIDA 3AG3B 1PY0A 7PCYA 1AS6A 1ETJA 1X9RA 4YVNA 3ZX1A 2ZONA 3MX0B 4KOCA 1SDDA 1A4CA 2W8CA 2GB2A 3G5WA 4A67A 2XUWA 4AI7A 3ASNB 1L9SA 5I28A 5AKRA 1JVLA 1OCOB 2I7SA 5B7FA 4DPAX 4GXFA 3GDCA 1IKOP 5I6OA 3RYMA 1AS7A 2J55A 1SHXA 4N4YB 2R7EB 1OCZB
chains in the Genus database with same CATH superfamily
4B9JA 4OIFA 3QORD 4LIQL 4X0KB 4XC3L 5C2BL 1NOAA 1UXLA 4HWNA 3BUPA 3IF1B 2FDBP 5KWYC 2VCOA 1OQXA 5GGTA 1TJMA 5E8EA 4ZPTB 3ZZ1A 3GMRB 4CC4A 1EDQA 1YAIA 1EDYA 2GSIB 4OJFH 4U1LA 3FB6B 3CU7A 3SDDA 4Q9CA 3PWVB 4HEPG 1UB5A 2OSLB 4D0DB 1DANU 5A3ID 3CFIC 2Y7LA 1I9RL 3AWFA 4BXVA 1X5AA 1FFNB 4K2UL 2APSA 4HS8L 3TWCL 2F5AH 3GKWH 4BK4A 3ZE0E 2E74C 1UH2A 3JWOL 3FQTB 5TDNA 2IBBA 1J05A 1PKQB 3QDJD 4K7PY 1YMME 1MN4A 1UACH 2HLAA 2FATL 5EZIH 1BX2B 5ENWA 5ICUA 2B8OT 3BUYB 1BJMA 2OL3L 2JB6B 4FNLH 4WHYG 5K93A 1N6UA 3X12A 1J8RA 1LWRA 3UBHA 1GY2A 3VQLA 1OD7A 4OZ4A 1ZLVK 4DKDC 3HPLA 3JQOB 5DO2C 5AVXB 2I85A 3O3EB 5I1EL 4R83A 3ZDZF 2A6KA 2Q8BL 5IQ9B 4HAGA 3ZDZB 4R8WL 3V6BR 5MI0B 3LNGA 4L8SC 4AIZA 1T6WA 2K6WA 4Y16D 3D39E 2WBJC 1VEOA 3QUZB 2XNAA 5H37G 5JOFB 1MNUL 3HZ3A 1IAII 4XMLL 4XBEH 1U3ZA 4JZJA 2XV2A 1ZD6A 2B0SH 4OI8A 5HD8D 3O0RL 4Q0XH 1ZKAA 4NKDA 1NJ9B 1Y18B 4Z78A 2F8IA 2APFA 5DI8A 4Y4HB 1T03H 3X3GH 1V3LA 2A73B 4APQD 1E5ZA 4UBDC 5IFJA 3HHRB 4A2EA 5LGJB 2VC2H 3C6LB 4YHIB 4BELD 2AKRA 3B56A 1KULA 2X42A 2HLFD 3V9FA 3MCG1 4GIOA 2N4IA 3MNWA 1ES0A 4KH9A 3OKLA 5B1BB 1OAKH 1KF9B 3L2LA 4IOFD 4P2OC 4Z95H 2MCG1 1UD6A 5BZWB 1KGJA 4JRXB 3CHSA 3SKMB 1E5UI 1YJDC 4GRMB 1VFOA 2F2HA 3MO1B 2WVVA 1ZGLM 1CG9A 3TO4D 4Y5XB 4ALAC 5EIVA 3SE8L 3VFOB 2NZ9D 4AY0A 5HJ3A 1HESA 5F0JB 1QRNE 2VC2B 1L6PA 2NTFB 3M1BA 3NFPB 4OSUL 3UTSE 3VGEA 4DOHB 1A7OH 4O4YL 3NSDA 3PXJA 4UWQB 1MRCH 4KZCA 1G6RH 5I18L 3L95A 5C0DA 2VDNH 2EVGA 3LH8A 4Z7QF 3SCMC 3MBWA 4B53A 4HEMA 1N6VA 3VJ6B 4HT1L 2WP3T 4Z7QB 4DPRA 3TBSB 4KKLD 2AQSA 4DO4A 4MB3A 2QSVA 4ZTEA 4K7PH 3KPSE 3UABA 3QUXC 4PMEA 5AYTA 1QBBA 2NPLX 4UILH 1CGXA 2FEDD 1ZT7A 3MNVB 2AJVH 3HNSL 5I0XA 3ES6A 3NQIA 1AI1L 2E9BA 1V3JA 2XQYA 4J3VA 4OCRL 1T21A 5LJYH 4J1UA 3J2PA 3UTTE 3FH8A 1GHFH 4L8CB 3FN9A 1G6RB 3CZSA 4CC0A 3Q1SH 4RCAA 2XC8A 2D7TH 3EHBC 5CLXA 2VDNB 2EZ0D 2LGNA 1J0KA 4UM9B 1OOWA 3O2DL 4ETYA 4FMFA 3GO1L 1KG0A 2Y25A 1WEJH 4CMHC 1Q1JH 1WCBB 2CLRA 5F89A 1QTSA 4MBOA 4TSCH 3V6OE 2OMBA 2NW2B 4NKOB 3WIAA 3VU1A 2EQDA 4XMKL 2BFGA 3MRGB 1SJHA 3AITA 5LGHL 3WTVA 3Q48A 3U9PH 5PAZA 1JPGA 1G4RA 1XBDA 2DKMA 2PCXA 3FL7A 4NQSB 5JXEA 2BSRA 2CBOA 4I7ZC 4L37A 1T1WA 4AT6B 3N50A 4UV7H 4TVSa 1EQWA 3BP5A 4Z9KB 2F8VA 1G7HA 1KN4L 1TPXC 5GRZA 1IGCL 4TUOB 1C5DB 1U58B 3T1WA 1A0QL 5TE7L 3IETA 2WQVA 3QI9D 4UNIA 1I3RA 1JZFA 5JHMA 4PGDA 4HUVB 1E6OH 3T2NH 3EOYG 1U93A 3D87B 4LXFA 4NNYB 1T5XB 3KLKA 5CZVH 4PJ5B 5D1ZD 1T3FA 5EEXA 1FO0A 3VFMA 3ETBF 1XIWD 2M2DA 5DJAB 4ZW8A 3LVEA 1DFBH 3EZJB 4G6KL 4IW4C 1OLLA 2DLFL 3CU1A 4XAWL 1RZPA 1SDYA 3F7RA 4JY5H 5ECGA 2CBTA 4I3SH 2EH8H 5EU3B 4L9LA 4ONGL 3K71B 3KPQA 1HHJB 2JELL 3I3DA 4NQCE 4IGBD 2BC4B 2P80A 4JCWA 4C8XA 5EDXA 2WXMA 1PTZA 4NOFA 1IRAY 3PPSA 4PJ7F 1QLFB 3DARA 3VTMA 3RWFB 1JZIA 4E2OA 1JYNA 4Q8BA 5TPWL 3CSFA 4ZOBA 4HIPA 2R1WB 3QIUC 4MMYB 4FQCL 4WI7A 5C0AB 5FF6A 4OUOA 5EEYA 1V55B 3MKGA 4FEMA 3JWOC 5EFIA 1GC1H 5DFVC 2DIJA 2ENJA 5DJDB 3GRBA 4PJIF 3GSOB 2H32A 1M53A 2IPTH 2OX5A 2Y5TA 4UIKH 5IUSA 4E9XA 4PJIB 1KTKE 1XF3A 5DLMH 2L04A 3T0EA 1CGTA 3L7EA 1WITA 4YQXL 2WLHA 2DI9A 5JIIA 4MXQD 4ZMOA 5E1AB 5JPMC 2QTEA 4U49A 3MQIA 4ZDHB 4U4IA 1Q72H 4J6RL 1TCMA 5CILH 4YDNA 4DWHA 4OLWH 1YLBB 3STLB 3GRGA 1AIZA 4NO2B 2V9TA 3D05A 4P23C 2JJSA 3ZZLA 5E4AA 3OR6B 4PR5B 2P5EE 2ZOUA 5A6MA 1EGJL 3LH2L 2RH0A 3HMXL 1HEHC 1A3QA 2EUZA 3N9GH 2PYFB 4EUPG 4DGIH 4ICXA 5IVXE 5EZPA 4P2OB 3U2JA 1NOFA 2ORBH 3BWSA 4M6OL 3IJYB 1AGBA 1CFVH 4K5OA 2PP9A 3EFFB 5I2IB 3J7HA 2R2BA 4MS8D 5GSRA 3CVIH 4V2BA 5FUCE 5BO0D 2J1XA 5I8CB 1JPTH 4JY6B 2PCYA 2BP3A 4Y4FD 1WGVA 4JZNB 3DURA 4OV6F 1IAOB 4Y2DA 1FZMB 3RVWC 2X9XA 2NRDA 3KBHE 1BBDH 2XVBA 2C9PA 1O9VA 4AVKA 1SOKA 3Q0HA 4KKRA 4RLDA 1GS6X 2H47C 4WCYH 3BW9A 3OG6B 4G9DA 3BO8A 5H2BA 3TT1L 3GIZL 3MFFB 2Q7YA 4LU5H 4PJEA 4MX7A 3RKDD 1RJLA 2P8MB 2WQUA 3G08B 2I9LA 1G84A 4FFYA 2LTQC 3ZE2B 5F7DA 4TVPE 3R4DA 1UYWL 4GP4B 5MENA 4HXAH 3BPOC 4GH7B 4YHYB 1KBKA 2CIKA 2X7LA 3UROR 4OLEA 2CKBH 3QFJD 2CO3A 3TTYA 3FQWB 2XQ0A 3AQDA 2BVYA 4R5TA 2P48B 3K0WA 4O2CA 1ID5I 3I6GA 2BS8A 1AGDA 4KGLA 2BMKA 1Z1WA 5D1XA 3VXTB 3SYQA 1HOEA 2J8HA 2GCYB 1MJJA 3FTGA 4JKPL 2DBJA 3RRQA 3MVSA 3MLRH 4YHPA 4CMHB 2R2HB 4BGLA 1A6TA 5G4MA 2EO9A 4BBWA 1OAUH 1E28A 5KYUA 4AVIA 3GRWL 1PX4A 4DUXA 1CD9B 2CKBB 3MFGB 4GAAA 5MHSE 3MV9E 1G7PB 1S9YA 5CJ8A 4JN2A 1MZZA 2VQ1A 2YD2A 3GTNA 1BEYH 5H94B 5KOMC 3GSNB 2MWCA 4P46A 1TPXB 1KZQA 1QFUH 1VIWA 2VMCA 2IBGA 1X5JA 1BVLA 1MLCB 1XZ0B 2K6YA 1JV2A 2OCFD 4FFZA 1U0QA 1ZEAH 3REVA 3B7TA 3RA7L 2IQAB 2DL2A 4HBCH 1TVHB 4HVBA 2YSTA 4HUXB 1VZGA 1ML0A 4J3XA 1SVCP 4PRHB 3WMSA 1KPRB 4E36A 4N0UE 4OZHA 3L17A 4WI6A 1FA4A 3VQ2C 5FW7A 2GIXA 3FUMA 4WW1A 3QZNA 3UAJA 2Y9RT 3GZKA 1FVDA 3O6FA 2HVJB 3NJNA 1KPVB 4NNXA 2YGVA 1HH9A 4ODTH 1K2DA 1WO2A 1KBWA 3HMWL 5D5MF 4PBVC 4A66A 2YS4A 3FB7B 4B9ZA 3I9PA 5DHVH 2LVCA 5C0FA 1UD2A 3FQ2A 1JGVH 5KS9E 5C0BB 1UOWA 3RUGF 4DGYH 1OSZA 4JFZL 1S7SB 4M1DL 4OIBA 4UOW0 1SJEB 3JTBA 5ANMB 5GISH 3UC0H 4PV8B 2D7MA 4NZFA 2ZD0A 1DN0B 4XC1L 2C3HA 3ARFD 3BUTA 3AAZA 3CGTA 2WSPA 2F15A 4PJGE 4D3CL 4GKSA 3A67H 4CJ1A 2DI7A 2VUKA 1NOLA 3QIUB 4G3YL 1U3NA 3FTWA 4F8QA 3T0DA 1U3YA 4N8UA 5DHVB 1AACA 4W9IC 5EOQH 1NAML 1RU9L 1AGFB 3PPEA 2IH8A 2YEVB 3SODB 1ZLUK 4LGSB 2Q5BA 5E95B 5T3XH 4EOWL 5EBMB 3U6RA 3ME0B 3G6JF 1E4XH 1XSKA 1FFOA 3NJGA 3V4PA 1FE8L 1WTLA 3OMIB 3BXNA 3QXDB 4YBLB 2AJ3A 1A6VH 3TEZA 3U1SH 1HZLA 2Q87A 3EOBB 4HGWB 4JQIH 4M5TA 2DMKA 4P23B 3R7QA 4I0PB 3ZYZA 3CNKA 2MKWA 1TQCB 4L4TB 3QIBA 3ULVD 1GYAA 3VVVA 4NZTL 1OT4A 5CS7A 1NCAL 3SDYH 3CV5A 2YD9A 3KBPA 1I85C 3W9EA 2YPKB 4YUEH 2ZCKH 4DVRL 1H3TA 2DM3A 5JHDD 1C16A 4PRPD 2W60B 2E0PA 2Z6FA 4CRPA 3NCFB 4GG6F 3HFML 1SDDB 4MD0B 1MIEH 5I19L 5JW4R 1JTTA 3ECVA 4WI9A 3WIIL 4JM4L 2CAKA 5I76A 2QVFB 5DDHB 4WEBH 5DJZB 3PWJA 4NQXA 1RIUL 1PIFA 2LTQB 4YDVB 1O75A 1MCSA 1U2CA 3T77A 3D33A 2FX8L 1KC5H 3P30L 1ZXQA 1PZAA 1WZKA 2WWMC 2ZSVB 3LN9A 3HE7B 4G8GD 2WZPA 3EFOA 3TOPA 1EUUA 1MY5A 4X7SL 3WLBA 5C6PB 2OTUA 1F1AA 4GEIA 2WKOF 2WUBH 1U33A 1XH3A 3BVNA 2NY0D 4MA3A 1BG1A 2BP8A 1I1CA 4QOKD 5AAPA 1AQ8A 1LNUA 2HH0L 4PCSA 5FFGA 1K8IB 5FLUA 4YXHH 2Y1VA 5T1LA 5G55A 5J57B 4BKLA 3B2VL 3QUKB 4HJGA 4P3DA 1Q9KB 4UTBL 1F11B 4ENZA 4WFGE 1BWWA 2XQYG 4PJ7E 4S0TD 1MFUA 3HCVB 4BQCA 3H7BA 3FT3B 4LO9A 3VAEA 4FZ8H 3ULAB 4DAGL 1VADB 1BAFL 4GYBA 5CMAA 1JMXA 1MJ7L 1W72A 4FP8L 4AM0A 1UZ8B 4HDIB 4OCLC 3BFQG 5SWQB 4LLYB 3GM8A 2V2WA 4C55A 2J4WL 3SZKC 4DTGL 1J1PL 1RK1A 2DQHL 2ICWB 4MJ4A 3DHJA 3NK3A 1FHGA 5J11C 1JHKH 2IOOA 2V7NA 3GXFA 4NX0A 5BRZB 3NVQA 2FO8A 2ITFA 1PEWA 2XZQL 3FTYA 4PY8I 4PTTA 3G5VB 2JIXA 1EJ8A 2C9RA 4JFED 1CO1A 5E9AA 5C0RL 3K80A 1MF2H 3B34A 5FO9A 5EF2A 2D03L 4EXKA 3O8XD 3SKOB 3C8KB 1EFQA 1IGFL 3LSOB 3BWUC 4QRRD 3FTZA 1ASPA 2NXZB 3DJTA 3FQUB 3W3BA 3ZKXC 4OJDH 1ED3B 2PR4L 4Z8FL 4IRJC 4FQJH 1B6UA 4G7VL 1A9BA 2RCSH 2DL9A 4X6CA 5E00B 3PAUA 1KFGA 2DDQH 3OD3A 4S11A 2L8AA 2OCCB 4NZRH 1NL0L 2VE6A 4OLXL 4ZW6A 3GJFA 3WEBA 3PGFL 1KYOK 4GKZA 2J6EH 3FH7A 3WG7B 4N2EA 4BQ9A 4P5SA 3N2JA 3LNDA 2CR6A 3IXTB 2HKHH 1QBLH 4ZMYA 4KJPC 3GI8H 3P0YH 5CZRA 4DFHA 3FT4B 4PJHF 4K4KA 1EEYA 5D9SB 3RHWF 2BIIA 2ZG2A 4YHZL 2IVFC 4PJHB 3APFA 4PWIA 4QRTB 5F88A 6FABH 2IADB 5L4FA 4G6ML 1FNGA 3SO5A 3HB3C 4XP6H 5DR5L 2EDNA 4R7DB 5DS2A 4ZUWA 2GJRA 5AYUL 4HEME 4WGWB 5TTRA 4DKAA 2IAMA 3K0YA 1I9IH 3WUWB 4AYFB 2IFFL 3OC8A 4U31A 5F1IA 3T6VA 3D0AA 5F96H 2V2XB 5FIEA 2ID5A 2R0KH 3U4AA 4LSSH 5TE4H 4QTHA 1EPFA 5CJQL 2ZCLH 3SYAA 2CMRL 1TETL 4WWKD 1I8IB 1WBXA 2X05A 4FLRA 5CJXA 4FQ1H 3SKUD 4HWZA 4P4KC 1BMWA 2FK9A 5IB2B 2J3SA 1OGSA 4L8BB 2OMUB 1I1AB 1MQ8A 4ZAKA 3ZQ9A 1B2WH 4BM7A 4DO5A 2WWKT 2WXKA 1M05A 4K73A 4TTGA 2FJUB 2VLJA 2R69A 4PRDA 3OKOB 1A3LL 2OXGA 4FI6A 3PGCA 3VB9A 2XN9B 4UYQA 5DK3A 5L4JA 4KKCC 5DFWH 5B7EA 4FJYA 4Y88A 4F57H 1UFGA 5FKAB 1I53A 1TYEB 3VD3A 2QJDA 4OY9A 4RNRA 2HZHA 3UJJH 4L3AA 3IWVA 2X4OA 3GXNA 4FTVD 3B9KD 2XPZA 3HG4A 1IAIL 4RGOL 4XBMA 5EUKA 3EIFA 3KPMB 3VD9A 1HNGA 1MCDA 2H1PL 4LSTL 1R75A 3BISA 4U1SA 1QTPA 1RZGB 1U3HD 2DMGA 1XX9C 1XF4B 5I8EB 3TO2B 3QS2A 4MB4A 4LPUA 3UO8B 1RUAH 3H2PA 5T3ZE 4KQ4L 4KKPA 1AXSB 4HJSA 1SN5A 4P4RA 4AYGA 2YK1L 3Q6GH 2DWTA 5LBSA 2R1XB 1ACXA 4L5FL 4U1GC 4WEMB 4ZTOL 2HT3C 1GGBL 5C08B 4OF6A 5L2KB 2AJSL 2FX7L 3THML 4LVOC 1S3RA 1OAZH 4ZK8A 2W9EH 2XYBA 1U8QA 1F4YL 4D9LL 3MC0A 3OAUH 4ELMF 5LXGL 2JI2A 3V5KB 1MCKA 4ELMB 1NBQA 4N0FB 2WCGA 2OSYA 2Q6WB 4XNAA 2XWEA 5JIKA 3IGAB 4QT5B 1ETZA 5DYFA 2BOBA 4JG1L 5F3BB 4AZ8A 4LASH 4YBQC 1PS3A 3PP4H 1J9QA 3C6SA 4H8VA 1YEFH 4U6YB 1EH9A 1OW0A 1W0VB 1N68A 3U2IA 4Z7UA 5I6PA 4BFNA 3DIFB 2C5DC 3MRPA 4E42B 1OB0A 1PY9A 2GQHA 3QHFL 4BJLA 3CHQA 2AXFB 3IU4H 3L5WB 4J3BA 5E4IA 4N6QA 1WV7T 2FUQA 1CFMA 3T0EE 4ZFGH 2ZYIA 1G4MA 4XCEB 5CM1A 1JK9A 2I5YL 2JH2A 1L9OA 2QR0B 5AG9A 1JNJA 1DVFC 2Z3FA 4C57C 4F7MB 3GFUA 5E8PB 1E90A 3UH8A 4LCWB 3K8KA 4NJAH 3VXUD 4R97B 4WJ5B 5LXVA 1OSPH 3OXSA 3ZKXB 2BX5A 4XI5D 3T6ZA 1KXQA 3D85A 1RZ7L 1AG0A 3MJ7B 3OR7A 4HFWB 2G5BB 3NSXA 2NYYD 3LXCA 1MUJA 3MRFB 2PCPB 3EDDA 3A6CH 4Q6IC 3TNNA 1I1FA 3K2UL 5I17B 3T6QC 5DGRA 5F8RC 1F45A 1MCFA 4GQZA 2CDGA 3O9WD 2FO1A 4CSZA 2E6PA 1MQKH 2YAOA 5DZ9A 3MV8B 3CH8A 1CLZL 4WDIB 5IB3A 4GRLC 4XE5B 3O4LD 1NLDL 2OS7A 5C8JA 3VGDA 3HB3B 4KMTL 4TQIA 1MFEH 4WV1B 4OQTL 5LHDA 2YUXA 4Y1AA 3KLLA 4KUZH 5B8CA 2AAAA 3MUGB 4MLSA 4YMPA 3OJDA 8FABA 2KBGA 3C9NA 1VENA 7PAZA 3ULUE 5MENE 1EEUA 4KY1L 1JZEA 3IT8D 3QNYB 3OJVC 4JG0H 3U46B 4K15A 3E0GA 1WIPA 4KJQC 1T80A 5T1KB 1D2PA 4WTQA 2NYKA 1F8TH 1OEZW 2E59A 2XYCA 3DUUA 3N3EA 3SZ6A 1TENA 3EH2A 1HHGB 4AEIH 1MW0A 2J2ZB 1RULH 1RZJH 1IZJA 4Z7WF 4TNWF 5L7XL 2WNGA 5D1XE 3MLVL 3WUWG 1U8CA 4Z7WB 1R3LB 3RNQA 1AGEA 1AY1L 5EF3A 3UCRA 2HJFB 3P54A 2ZSWB 4XCNB 1OGAD 3FCTA 3FO9A 2W9DH 3VQMA 3TF4A 3ARVA 1BDYA 4QO1A 2GSGB 2JQMA 4DKTA 4X4KA 3HR5A 3FUKA 3WIHA 2BW5A 4ERSL 3TA3C 3H9SB 2PTVA 5AD0B 5ACZA 3EYVA 4ZMNA 2ADGA 3MN8A 1WZ1L 3VXOA 1LYQA 2Q76B 1QFOA 5CWSB 1EJOH 2FX9H 2DLHA 5B39A 1N70A 2SODB 4S2SA 4XVJL 2UZIH 2XBTA 4X6EA 5D96C 1ONQB 1KXVC 4KO9A 4N2KA 1ADQA 4IBLT 1B6DA 3WNOA 1J9TA 4QEGA 2X4SB 4JM2A 3WO3B 1UB6A 1P7KA 1IAIM 1RFDL 2XICA 2CO1A 4M56A 2G4EA 1WQVT 4OZHE 1FN4B 3O3UN 2YJLA 2QVTA 4LHUG 1QLEH 4PRAB 5D7LA 3CFEB 3WEXB 2NR6A 4HK0A 4OM1L 1Q9WA 4DGWC 5JORB 3BRFA 3KPPA 5AVZB 2HUEA 3NRQA 3HUJA 4GBXD 4U1IA 2XXFA 5INCB 3AU0A 3GS4A 3Q6FA 1QA9A 4AXWA 2HWZH 3OKEB 4JJ5A 1YDPA 4HQQL 3QAQA 4FQHB 3ZIMA 3CUPA 4TPRH 3C8DA 4G7RB 2LFEA 4XWGH 2J5LC 4XMWA 4QXUL 5GS0D 3OLDA 3RPIB 3IJEA 5LCVL 1QLEB 4W9ZA 3QCTL 3IMSA 4B60A 5ALBL 5ID1A 2NLJB 3WSQH 1KXTA 4UAOB 1Y1DA 4JVPA 3VVWA 1GCFA 1JWUB 2WTRA 5I71B 1LM8V 1CI3M 2GJPA 2NSQA 1NIDA 2R0WH 4J3OD 4L3EA 1I4FB 2P8PA 3IVKB 3HBGA 4NFDA 4WUUB 1JK8B 2P7TA 1HH6A 2NNFA 3BEWB 4AWJC 5B38G 3LQMA 3DX8A 4Q2ZB 2BHYA 5A2IH 4U1JA 3FO2A 1C5CH 1T0NB 3MYZA 5K39A 2XZCL 7FABL 3RGVB 2Z91A 2A9NL 1TMQA 4D9RD 1IGYB 3ARDB 1C8PA 3MLTB 5E0QA 3EJPA 5I6OA 5H35A 4UUJB 2EDBA 3RURA 5LKNA 1NAKL 4A38A 3LV3B 1E4KC 4R4FH 4XPGL 2DTML 4AENB 3SJVA 4PG2A 1JTOA 3BKCL 3VG9C 3SYPA 1XGUA 4FQIL 4AZUA 3D48R 2E3VA 5T1MB 3DHPA 3WUZA 4R5VA 4MAUH 4JFWA 1LDPL 4MQTB 3TBCA 3WJJA 1GGTA 4I85A 2D0FA 3FONA 4Q6IB 2YAPA 4OJAA 3N0AA 4QRPA 1AIFB 4DGUA 3C12A 4OM0H 1OANA 4J4PD 4H26A 5FW8A 4M7JH 1GJUA 1URIA 1I3GH 3BP7A 4NJ9L 4EI5B 4LLVA 3UCQA 1OCWH 2KS0A 4YSUA 3LXAA 5EU6A 2WUCH 1W91A 5MEQB 4WU5B 1S7UA 1EJFA 3GLZA 4LLDB 1AGCA 5KW9L 1AHMA 1ZVSA 2OJZL 3KNBB 5JHLA 3TN0B 4OFKA 2XA3A 3NOIA 4UNUA 2DJ4A 5F7HA 3ZE1B 5DT1H 4YS4A 1Z9MA 3PV6B 4ODVL 3VXRD 1OXYA 4OIIL 3PL6A 2Q1EA 3FZUD 3P3SA 2G5UA 3TESA 1QSZA 2VDPL 2DKSA 3B7SA 2DQUH 3U7WL 2KKQA 4QRQA 5FYJH 2A6IA 2O5ZL 3CC1A 4BIKA 4AH2A 2YMTA 2OV0A 3WD5H 5IK3B 1G7MA 3LX9A 1J5HA 1ITCA 5GZOA 2FB4L 3CLEL 3FRUA 3CFCL 4H8QA 4N2DA 3NFSL 3VFUB 5HPMB 1CL7H 5ICYA 4U7SA 5DQJB 3RL2B 2CRYA 4JK0D 5L4IA 3ZLQC 3R0MA 2W88A 1JPSL 4B5ZA 1AZVA 1FWXA 3QR1A 2E9JA 1AQMA 4QLRA 1J88A 1F2XK 1EDHA 1OPGL 3K72A 5HYJD 1N7MH 2OMYB 4Q9QH 1UM4H 1IILE 1FFTB 3NCYP 4NWTH 5C0GA 2VITB 5EZJB 1PLCA 3S34H 4FQQB 4AL8H 3F7VB 5F9JB 3VI3F 4P9MH 3PWUA 1P4LB 2KLRA 1A1MA 3FU9A 5LO7A 1HDMB 5CEZE 1YY8B 3KPRE 1OLZA 2LVEA 2XVLA 2IPKA 2G0LA 2QMKA 4KWUA 1DBMH 2AITA 5E9DB 1NGPL 1QFWH 5IW6B 4BCYA 1YQVH 4JG5A 4LOVA 1CT8B 3WFHA 2DEYX 2HMIC 3CLFH 1F4XH 3ISRA 3ZKNC 1A1NB 4ZUTB 2B77A 2MIZA 3BEVA 5AL0A 1J11A 1W8EA 3I6LD 1GIGH 1K6QH 3AT0A 2NY4D 3UZEA 4NO0B 3QWQB 4X0KA 5F71A 4AQ1A 2F7OA 4P59L 2FH8A 3IF1A 4TSAH 3V0VB 3T2PA 5KSAC 3KXFD 4RAHA 1MRDH 4ZPTA 4X6CE 4MKMA 5IW1A 1P4BH 2V5YA 3FB6A 3SOBL 3PWVA 4HETA 4PHZA 3D5OF 2OSLA 1MI5D 1NCOA 2J20A 3RI5K 2WIIA 4J23A 1QWUA 2J5LB 2W80C 5K9KB 1U8MA 1U42A 3RJDA 1KTJA 2HFFB 1IBBA 4WJKB 4JGMA 5F1OB 4JHUA 2BVPB 3FQTA 4RZCB 2D7QA 3WV0A 3H3BC 4PRNB 1MSPA 4XVTL 5IOPB 5IREA 3M8OH 1BX2A 3DK2A 4Y2OB 3MRMB 3CFDA 3BUYA 1A1OA 4M1CC 3B5HA 1U8NB 1DQJB 2CDFA 1DBJH 1RURH 2JB6A 3LPOA 2YMXH 2TAAA 3FNKA 4P5TC 4XOAA 5F3FA 3MZTA 2CALA 2FQEA 5FPIA 1DQKA 4QHKI 5AAMC 1R3HB 2NY5L 2MOGA 3L81A 1PCSA 3P4LA 5E99L 5E6IC 4NSKB 3CZNA 3MRLB 3O3EA 4GP5B 2QMJA 4TM9A 2ZUYA 4LLMA 3A6BH 3C09B 2K9FB 1VLXA 2QV4A 5IQ9A 3VWJB 5AB9A 1FCCA 3HJ0A 1F4AA 2WYHA 4Z76A 5ICZA 1UM6H 4FQXC 3F84A 3UAFA 4M93C 3V0FA 4CVZB 4L4VB 4MA7H 5AFAA 1DLFL 5ANHA 3CZJA 3IDYC 3QISA 4NQDB 3NJJA 4XCYA 4XVSH 15C8L 1YEHH 3B9DA 1NJ9A 5JOPE 4GAGH 4Y4HA 3QXTA 1I8LC 2QSCL 1T7VA 1C12B 1WFTA 2A73A 2VLJE 2ZG3A 1CLYH 1GMEA 2F74A 4ZQKB 3BZDA 3QEHB 4E9WA 2R15A 2YA2A 1QVOB 1B4JH 1OK8A 5LGJA 3SE9H 5I1GL 2Y07H 4QTIH 4ZZKA 1KJ2A 4OZFH 1AG6A 3BFOA 2JJUA 4M9PA 1NMCC 3QH3A 5E56A 3VG0H 5MP6L 1IGML 3FHQA 1TMCB 3DXAB 4JE4B 3NA9H 5AWNH 5ADOH 1K72A 2OM5A 1RJZB 5F6IC 4N8VA 3SKMA 1BZEA 4WHTA 2ZAHA 3X13A 1HYSC 5F44A 5HHOA 2VXQH 3KD4A 3OKNA 4ZS6D 1L7IH 4YZWA 1NCGA 1KB5H 1RD6A 4BQBA 2NTFA 3NFPA 4ZUUA 2ILLA 1RI8A 2GEQA 4PLKC 4OZFB 2FJGB 5AKSA 5AYQA 2ZCHL 3G5XB 2WZ0A 3B83A 4JRLA 4NGHH 1MH5B 3B7RL 3JV5A 4HC1A 1XT5A 4ZFOA 1QKZL 2ENSA 4H25A 3TBSA 4WWPA 4Z7NF 1RK7A 1IJNA 3ZL4H 2VDQL 4H5SB 4Z7NB 4QXTA 2P47B 2VM9A 1KB5B 2ZP8A 4HCRH 4BA8A 4FI7A 3MNVA 3JV4B 2V5MA 1ZVNA 3R0NA 2H1LM 3NCBB 3DJ9A 1ZS2A 3ILEA 3K3QA 4H7VA 3P3UA 3DIDA 4L8CA 2RB8A 4LAQL 2YD0A 2D9CA 3SE4A 4GP8B 2AQPA 4MVBD 4XHJC 1USQA 2YR3A 4Z7UE 4OBRA 1YYLH 3IKKA 1SUJA 1WCBA 3ATEA 2NW2A 5BS0B 1G7IB 2WP3O 4XBGB 4N8CH 1A4JB 5D1QA 3P77B 2YN3A 4NQSA 2FSEB 4B9IA 3HG3A 3BX7C 3J8F7 3N0PB 3QQ9D 1QFPA 4JGNA 1OARL 4BA0A 1E50A 1ZAGA 4LSRL 3QK0A 1ZLSL 2A6DB 3G5YA 3MUHL 5B39G 4MMXB 4AT6A 1MDAA 2N1KA 3G3LA 3JT0A 3U1QA 3P11H 4EIUA 3N1MC 3DX4A 1NSNL 3ALPA 4TL5A 5E7BA 4XO9A 4TUOA 1HZHL 2F8OA 4MDJA 4HWUA 4ZFFA 5KSAB 2FAUA 5DZNA 1P2CA 1RZ8B 1ZHBB 2FBRA 4JRYD 4HUVA 2F54D 4EN2A 5E6UB 1OM3L 4ECNA 1IVTA 4KTEH 4RMBA 3JUYA 3IYLW 4OLYL 4PJ5A 2XPGA 3ZHFA 3BAWA 2OMTB 4I89A 5DJAA 2XLLA 5I1DA 3VGAB 4UB0H 1R46A 4M62L 3ZJAA 4LEXL 2APWA 1P1ZA 4YHOL 5DD0L 3GMPB 4HW6A 2CSPA 3K71A 1SUHA 1PIGA 1EZVY 4KI5D 1HHJA 2YD4A 1MWAH 4B97A 4FNRA 1G9EA 5C09D 2OJEB 4ZOEA 4EBQL 4FFWD 2ITEA 1NPUA 3TX4A 2JE8A 3ILDA 4ZRGA 3UZVB 2X70B 5ILTL 1OQOA 3NABH 1YNKL 2FGWH 3F6LA 2VMDA 3PDOB 4FA6A 1BWMA 4R7VA 1WWBX 1ZHKB 3NN8A 3NGBB 4AMKH 1EX0A 4NFCA 2R1WA 1SBSL 3MLZH 5GRJL 4L8SA 1Q9OB 2JWYA 5T5FL 2WLJA 4MMYA 3D50A 4FMKA 4TL4A 2WBJA 4M93B 1N6QL 1MWAB 3HG1D 4R84A 4PW4A 3IFOA 3WLWC 2EE3A 2H5UA 5CINH 4HCIA 4NC0B 4OF7A 5I74C 3GSOA 2BLFA 4FQPA 2A3TA 3IDYB 1NEZB 3IU3A 3P0VL 2DMBA 4H2AA 4NZJA 5DF0A 5ACMA 3RDTC 3UBXA 1YHPA 1S78C 2YHGA 5B1KA 4Z7VB 3KE0A 3W0WB 3EBAA 4D8PB 5G4NA 4C4BA 3OQ3B 4N87A 4KK6D 1T04A 1WAAF 3AM8C 1I9JL 1KIQB 4NN7C 2VXSH 3DHMA 4HMEA 2GJ6B 4OFQA 4HIIB 1HILA 3FQXB 4DEUA 3STLA 4BSJA 1OPOA 1G43A 3GBNL 4MRBA 4NO2A 4FA7B 3G6DL 1A4AA 3TYGH 4PR5A 1NCUA 2NSMA 3PCYA 1NCDH 5HDOA 5ERWB 1V54B 5DHYA 3VI3E 3HZKA 1NMCB 2PYFA 3Q5OA 2EDWA 5EN3A 5CCJA 4NT6B 4P2OA 4ZO6A 2W0LA 1UADC 4K94H 3S88H 2OZ4L 2Q7NA 3KYKL 1HINH 1J8HB 4X9IA 5BZDB 4JY6A 1FL5B 1I7RA 4PJFB 1RERA 3PF2A 3VGFA 4P9HL 2BNRB 1KIPB 1JHTB 2E86A 3OAZK 1IAOA 4JZNA 4AUYA 1FZMA 1PL3A 3C75A 3MOQA 5C0ND 5D7LE 1Z5YD 4R5XA 2HTLD 2X3AA 3ARPA 3PXLA 4GO9A 2X5PA 4KFMA 4X5RA 1AO7B 2IPUK 4NBXB 3HUJE 4HJJL 3QQNA 4JO8A 4Z7OB 1CDIA 5FYKH 1KEMH 4QHMB 4TMPA 1QSEB 2P8MA 3G08A 5EF1A 4KMQA 3ZMNA 4MA8H 5CR1A 5D7IF 1N19A 3HHMA 2WLZA 2DWDA 4NM8L 5D7IB 1MW2A 1UJTA 3O11B 1AOHA 5IESH 2GW5A 1QOKA 2A74B 1IFRA 3ISYA 3H0TA 3IJHA 4DEWA 1D7BA 3EG9B 1CXLA 5E2WH 4BFGA 1X9RA 1SHMA 5FHBL 2P42B 3VWKC 2RIKA 2R2EB 1LK3L 4UT6L 4NI6A 3VXTA 5L8KB 5DCCA 4XPTL 1CGSL 5I9QC 2J1YA 2GCYA 4YX2H 3INUL 5HDBE 5GRVK 4L3EE 1RUMH 2DQJL 3WAKA 1T0MA 1P7QA 3GTVA 3QCVH 1F90L 1I3VA 1T7YA 1FG9C 2HKFL 4PM1A 4RAUB 1MIML 3HE6C 2CLZA 1JYWA 3ECUA 1U6AL 4JO4H 1XGYH 1FZKB 2JKLA 2VXUL 3RTQD 4WFEE 1A66A 3P73A 5KVMC 3O3BB 1G7PA 1XL6A 5ISZA 5IR1A 3VX0A 4U0RC 1M1XB 5DUPH 4HMDA 5H94A 1MCPH 3GSNA 3KW8A 1E7UA 1PDKA 3DBSA 3QORC 4LARH 1OZTG 1Q1PA 4AQAB 2VLRB 1X5ZA 2VERN 4W68A 1MLCA 1BJ1J 1ZJAA 4FXLA 1PZ5B 3MRCA 5EH1A 4E41A 4OLZL 3NZHH 5TF1H 3SJVE 1S3KH 4EDXA 2X09A 4KZDH 3TVMB 3DETD 4QIRA 3NCJL 1RP8A 1U8LB 4NZUL 4BZ2H 2DLEA 4PRHA 1D5XA 2AXJA 1E27A 5A3IC 3R1GL 4LPVA 1KPRA 2FWOB 1VGEH 2ZX8A 1U91B 1KCVL 2CA4A 3L3DA 1GZHC 2ZKHL 3GHPA 4K8RD 4PJ6A 2VL5B 4QRPE 4W4NA 4Y19B 4YC2C 5GZND 5GS2D 2HVJA 4YDLB 3OZLA 1KPVA 5K33A 2DIAA 2PWGA 1Q4NX 3I9GH 1IC7H 1BEXA 3EO0B 3VD7A 3FB7A 4NQCD 3MACH 5EU6E 1DL7L 4P2RD 3IDNB 2W0PA 4N26A 5C0BA 4DZBB 3I85A 3X1BA 2FBJL 2A9ML 1HOCB 1N0XL 4G70B 1SJEA 4R7NA 4WY7L 2CR0A 5ANMA 3US9A 2ZQKA 1R3KB 4PV8A 1Z9LA 4JPKH 3FW6A 3NCCB 4JFDB 4BFOA 1KV3A 3H3PH 2DM7A 2BNQB 3BAIA 5E6RB 3CE1A 3EYQD 5HGDB 3QIUA 4AYDC 4B41A 1CICB 3WXVH 4HISA 1CI5A 2H4EA 5EWIL 4N2MA 4I3RH 1VZIA 5TK2A 2B1AH 5DHVA 1HEZB 1WGOA 4YDKL 2Z34A 2C1PB 5J1TC 5AOLA 1NIAA 3B37A 4ZMZA 4CA4A 5HD8C 2PXYB 3SPIA 5EBMA 5B3JE 3ME0A 4ANWA 2B59B 4EE2A 4LGPB 4XNBA 3WNLA 2F7IA 1Z3GH 4V11A 1OAQL 5JPMA 2X1OA 3QNFA 4FLQA 2FHFA 4X6DF 1H15B 4HGWA 2DV6A 3TIEB 4X6DB 5ALCH 4PW3A 5DS8A 1U36A 3D4YA 3HNVL 1DCEA 2YC1B 4P23A 2FD6L 2KLSA 3S3PA 4WW2C 1X5XA 4PSRA 3FMGL 3N04A 4XTRC 5HDWA 2UY7B 1KCBA 1QEWB 4L4TA 4KROD 4H88L 3L9RA 1HTYA 3MRHB 2PYEA 1DBBL 3MJGX 4NLHA 2HN7B 4AVHA 5GJTL 1F86A 1WBYB 2YPKA 2LAGB 1OGPA 1SXZA 3CVHA 4RGMB 2MKLC 4Y9BA 2VL4A 5KVGE 2CJ3A 5JA8B 2NZ9C 2W60A 2EIBA 4N2BA 3IDIA 3ARZA 3H9HB 1OT2A 4JRFA 4MD0A 3QHZL 2VIRA 2ITDB 3LS5H 5TDPB 4N8VG 2H6UA 1CFNA 2DJSA 4MJIB 3VH8G 3K6SB 5DDHA 2I7OA 1BQLL 4Z0BH 4TUKH 3U0TA 1U92B 2JKNA 3KW7A 5F6HJ 4YDVA 1JDAA 2B9AA 2FBOJ 4KKLC 1SNRA 4TVPD 3IXAA 1MCOH 2Y3NA 5C0IB 4HCGA 1LHZA 1NGYA 1BFTA 1FLTX 2CQVA 2IALA 1V7MH 2ZOOA 5K59E 5INDA 2A77L 3O2VL 4WKZB 4P9HC 1HSBB 4M7KH 2VWEE 4ATTA 2DQGH 4FL4B 3HBZA 2PABA 2VXTL 1P5UC 1LO0H 3BE1H 2EZ0C 2N01B 5EZOH 1KIUA 1K8IA 1CD1B 2FIKB 2KERA 2OI9C 1WH0A 1ZTXH 4M9OA 2VUOA 1SXBA 4XPBL 4RX4D 5LG1A 1UGKA 4BQ8A 3QUKA 1K3ZA 1Q9KA 3CXDL 3PIQA 4UT9H 1SYSB 3HCVA 1CS6A 1TLKA 3HE6B 2JKJA 2KT6A 4ZO8A 4RFOL 5DTFB 1KN2H 1KUMA 2NQ3A 3DVFA 1R5IB 1DE4B 1HU8A 5C07A 3HS0C 1VADA 3D9AL 5BOJA 4AYID 1QSFA 4AYMC 2E27H 4O02L 3FQNB 4O5LH 2RMNA 2X87A 1XCQB 1GW6A 4WJG3 5SWQA 4LLYA 3S8FB 4OFYD 3ROLA 3VFPB 3D25A 1PD6A 4E0RB 5L6YH 1T4WA 3EUUA 3LH9A 3HNTH 2ICWA 2B20A 3QJFB 3QR2A 4LIQH 5A2JH 4IKLA 4W4OC 4PMFA 1VGKA 4G6AD 3HZYA 1CB4A 4Z18A 5BRZA 3RIAF 5D4IA 3S3DB 4DKFH 3G5VA 5B21A 3SGEI 5DMKB 3NJHA 3VYNA 4JGJA 4YC2B 1XIWC 3QWOB 3BSGA 3SPCA 2WJ5A 5AAWC 4ZMVA 1I9RH 3LIZL 1DQML 1R5WB 1OP3H 4K2UH 3C6LD 3FT9A 4HS8H 4WI0A 2AI0L 1IKFL 3QDJB 4DESA 3NPSC 1Y0LB 2O4EA 2CHXA 1BQSA 4CL7A 1ED3A 2EC9U 4IGBC 2Z7WA 4OCWL 5E00A 2OTWB 1XD0A 2BSCA 1VAHA 2XWTB 3UEQA 1Q0YL 3KLQA 1LE9A 4ES8A 3NFNB 1HIMH 1R3JB 4KO7A 4OFVA 1AH1A 3ZTEA 5HHOE 3IXTA 3OXRB 4K07A 1E8XA 1UWGH 5AW5B 3GM0A 4YDZA 2Z65C 2PPFA 3FT4A 3L8QA 3LCYA 4ZTPH 1OCRB 5D9SA 2Y36L 3O81A 2W1NA 1VPOL 2VR5A 2OZNA 4IBSA 5I1EH 4Y16B 1IO4C 2KYIA 4GQ9L 1N64H 1KTCA 5LAXB 2IADA 5TDOB 2Q8BH 4HMCA 1V27A 2PF6A 2PWDA 4XX1E 4JO1L 3EH1A 1NCCL 3CBJB 4EKXA 3ARRA 2PLTA 5F9OL 4RETB 3QXUA 2VN3A 3CVCA 2QSQA 4JX0A 4N2OA 4APQB 2WB1A 3VFTB 2P3YA 2ATAA 2CCWA 3GMNB 4NCDA 4U4BA 5EBLB 4B9CA 1PLGL 2QQQA 4JFQA 2EKSA 2EDQA 2JV6A 3I9IA 5IM7B 3L4TA 3UBXG 3CX2A 3K1DA 1JF1B 2WGNB 3EGSB 3BPNB 4DJMA 5IB2A 1IIKA 5IFAH 5D6CB 5E8NB 5GGTL 1DUZB 2BIQA 1GKEA 4L8BA 4B3EA 1I1AA 1TSHA 2IH1B 5JW3L 1RHHB 1I85A 2CD0A 3OGCB 3NACL 4XN5A 3ZDYB 4XP5H 4MS8C 2H3KA 2O6DA 4MNGB 3TO4B 3VXMA 5F1NB 3B5GA 3EADA 4QCIB 5D1QE 2CLVA 5DZJA 4PJXF 1G9ML 3P2TA 2KL6A 4YFLF 2HRLA 2X2YA 3QXAB 3LRSB 4AQEB 4B95C 4C47A 5I6NA 2MNJB 5JUEL 2DQCL 3DMMD 4XN9A 4F2MB 4XOCA 1GGCL 3SO3C 1K85A 3MUJA 4XO5A 1X4YA 4XNMB 3BP4A 4O4YH 5MEOB 2IWGA 5SWZA 3HMXA 1FVEB 1FYHB 1RZGA 2BSDA 4YXKH 3RKDC 4GLRI 1XF4A 5I8EA 2J71A 2MQ0A 4NAQA 5I18H 2Z7UA 4JHWL 2WWKO 3K5SA 2PNDA 1AP2B 2X0VA 3RGHA 4ODUA 4HPYH 4HT1H 1AXSA 4PJ5E 1WC7B 3BYYA 3SE3C 5CP7A 3QARA 1HYRC 2R1XA 3DI3B 4NCC1 5CU5A 3HNSH 3GTTA 5C08A 4G5ZL 1AI1H 5L2KA 2W91A 4XP9L 2JCCA 4FN0A 2QFPA 4AGLA 2EXWC 5H8DA 3L5IA 3PJSB 4ODHH 3DVNB 1LTXA 3F83A 3QDGA 4MNQE 5ACLA 1H3WM 3RWIA 5I1JL 5DRNB 3DVIA 3V5KA 4F15C 5DJXB 1S5IL 5AOJA 4F7CB 3D0VB 3IFNL 2VDRH 4N0FA 3EH5B 4JREC 1F3JB 5ELIA 2YGOA 3OKYA 4GJTB 4QT5A 3V7MA 1RKRA 1T7ZA 3O45A 4DO6A 3HS0B 5F3BA 1HAUA 1XGPB 5IQMA 1E8ZA 2E47A 3KJ4C 2HP4A 4RWYL 3MA9L 3LHPH 5C0AD 1W0VA 2DWEB 4O2FA 4E42A 4OLUL 1A4BA 1KFAL 3KYMA 5HI3D 2H0PA 1X5MA 1E9QA 4NNPL 3IGFA 1JZ8A 5IB4A 2XJLA 4WSKA 2YXMA 2AXFA 3D2UA 3L5WA 1XFPA 1IGCH 1KB3A 3QI9B 2VDRB 4XNXL 3IKCB 3O3AB 4XCEA 3VYPA 4XO8A 1CWVA 2X4TA 4ZS7L 1OF2B 5D1ZB 5HHMB 5KJ4A 1BXVA 1XIWB 2NZIA 2F8XC 4F7MA 5FECB 3H4HA 4ZMWA 1CDUA 1B9ZA 3QRLA 3E1ZA 4YGVA 2WVSA 2W59A 1Z6JT 1DSWA 3AC0A 3MJ9A 3MMEA 3WDIA 4IGBB 5MEPB 4ODWB 2FR4B 1F02I 3MJ7A 4S1SH 3VSVA 1RPQA 2APVA 5HI5D 1PYWA 4Q7DA 2AERT 2PCPA 1A2YB 1R24B 3L3IA 4G80B 1U9KA 5D2NC 2MCPL 4G8FB 2B14A 1TDQA 2DAVA 3ZT6A 4MHHG 3WIFB 3EYFB 3ARFC 1E40A 1ZDSA 4YN3A 2N7BA 5FUZH 1J1XH 4GS7B 1WZAA 4J3WA 1HNFA 3V4VA 1FNEB 3B1TA 5IBTL 3EBGA 3T4AB 4WDIA 2DEWX 4N5ED 5KVFE 3UTQB 2F1AA 1UOVA 4FQCH 1E6JL 3CAFA 2J8UF 4WV1A 1LMIA 3POCA 3BZ5A 2J8UB 1BJ1H 3MUGA 3SQBB 1A9VA 5F97E 5D7KE 2P9RA 2JB5L 3ZE2E 4IHOB 1U41A 3QNYA 3SB3A 1XCXA 3U46A 3RAJH 2XUWA 3VD2A 3PFUA 3SKJH 1JHLL 2HRPH 1UCBH 2Y0SA 1OT1A 2DJMA 1PVHA 4XP4L 5B7FA 3IGUA 1Y6NR 2H2SD 1NMBL 3BP6B 4HSAC 4LVHB 4YZFF 1R3LA 2AXWA 4N4YB 4Z77A 3BC9A 2I25N 3ULVC 2HJFA 1EGJH 3LH2H 2Z93B 1RMFH 2ZSWA 4O51A 4K55A 4M6OH 2BZDA 1FO0L 3VW3L 2D0GA 4PQXA 2I9TA 2Y6SD 5IROD 4Y4FB 3H9SA 4XB8A 5ISZE 1F1GA 3SQOL 5CWSA 4N9GA 4JPIB 5BO1L 2FEJA 4MMZB 4OGXH 4U2ZA 1HX0A 1I8MB 5K9JL 5KVDH 1OALA 4E41E 3UFIA 3L3HB 4GSDH 4NPJA 3WNNA 4AYEC 3QQ3B 1T20A 2X4SA 4P3CH 4DP0X 1HCVA 1MRFH 4KUCF 5C0CD 3TT1H 3GIZH 4RIRB 2WO3B 3GXUB 2X12A 5T3ZD 2AK4A 1WS7A 2AJZB 4G7QB 4DVBA 1WTGT 3QFJB 1X4ZA 3CFEA 5AG8A 4NN5B 5IHLB 3HBPA 1PD0A 2NY0C 5DZPA 2MHAB 4GO8A 35C8L 1IC5L 5INCA 4EN3D 4JLRA 4AG4H 4DFIA 3ZYJA 3OKEA 5EZLB 4TQEL 4RFNC 4AC4A 3OC5A 2BSBA 1IQDB 2IFGA 3MUZ1 5C0BE 2R23A 3UG4A 2Q10A 4KK5C 2WXLA 4UYPA 1AC0A 2NUPA 3FH5A 1WBZB 5ANME 1PG7H 1JYVA 1KB9K 3WN5B 2XTLA 4CC1A 2NW3A 1DVQA 2HFGL 4JW3A 3BWAB 1QI5A 1PZCA 1DBAL 3UZQB 2NLJA 2JCWA 1MEXL 1VJSA 3MAWA 1FQ9C 4S1QL 1ZSHA 2FNWA 4HF5H 4YHLH 5LBGA 4TRPH 2V7HA 1JWUA 5BVJB 3MUY1 4WGVB 1TNMA 5IJVB 4Q6KA 1I4FA 3ZPDA 1E5AA 3IVKA 1CFBA 4OF3A 4X5XB 3V5HB 4WUUA 4AKPA 4OGZA 1JK8A 1G9NL 1OCCB 4KX9A 1P84K 2AGJL 3NEOA 3II3A 4Q2ZA 3CMOL 2VMFA 5HYEA 3RA7H 5KN5B 2O5NA 4PUBL 3RGVA 2YWYA 3FUIA 4KO6A 5F7KC 3ARSA 1IGYA 2KLTA 1DVFA 2BY2A 3QPXH 2ZE0A 4JL2A 1CXEA 1U3JA 3F7LA 4UUJA 4K5LA 4JDZB 2K3HA 2XFGB 4PJCF 4YXLH 4I0PD 2NDGA 5DC9B 2A7BA 4PJCB 2OPCA 4AENA 4JFFA 4L4TE 4WFHE 4TV3A 2PYEE 5T3XE 2IAAC 3LZRA 3V7AG 4FFYL 3LPGA 3HMWH 1E0OB 1UQSA 5T1MA 1BHGA 5DJ6B 3T8XB 3ULUL 1OVZA 4C58B 2AXGB 1W8NA 4L0YA 4FCHA 3N43F 3TJHD 2EO7A 5D2NB 2Z4QA 4OTXL 4Q6IA 2D4DA 4MZRA 4H8WL 1AIFA 3VFSB 4JFZH 5T33L 5DZLA 1DQQA 3WFDL 4X7CC 4X2UA 4PJXE 3UPAA 3F04A 4H8UA 4AMXA 2AW2A 3JV0A 3FAWA 4J5VA 4FXKC 3VRLE 4GRLA 2J5WA 1OL0A 2DLTA 4HIQA 5MEQA 4WU5A 4JUSA 4XN8A 5JTWA 1E65A 3MXWH 3DPBB 4CSPA 4H40A 4CN4A 3KNBA 4ADJA 3WHXB 1NAMH 1TR7A 4AMWA 2UYLB 3BFWA 1NC2A 1T1YB 1CU4H 4FLHA 3VTAA 4CU7A 2PO6B 5MEND 3K4AA 1RZIB 4LPWA 4X98A 1CXKA 3PV6A 3PAYA 3OB0H 1GR7A 4R4ND 1FE8H 3HE7D 3HI5L 3F7PC 3W1ZA 4WWKC 2VYRE 3VFWB 3ENEA 2OK0L 5CEXB 2OMZB 4ZW3A 4KX7A 1SEBA 3EGXB 4ZSOA 3HLAB 5D1XD 4FFZL 3LNFA 1ZSDB 4NKIL 1OOAA 3WEOA 3KYNB 2CGYA 5GS3A 3FRPB 5DQJA 2QGCA 4AEEA 1C08B 1NAMB 3QQXA 4BQ6A 4XO4A 5IMLB 4YLBA 4OLVL 2WN3A 5JHDB 4NZTH 1NCAH 5M7QA 4PRPB 2ZF9A 4XRCA 1JGEA 1T5WB 2OMYA 3LS4L 3ABLB 4DVRH 3ZL2A 1NH6A 5EZJA 2FT6A 1S7WB 4FQQA 5C07E 3F7VA 5F9JA 3SDAB 1OAYL 1MJ8L 2IG2L 1QSFE 1M9WA 3N44F 3B9KC 4LFHD 4KXZI 2R83A 1HDMA 5ESVA 3BAXA 3N44B 3V5DB 1J87A 2APXA 1CLOH 1KXVA 3WIIH 4JM4H 3GSRB 2IPUG 5LGKA 1DQVA 1WS8A 1CT8A 1IEBB 1RVFL 3AXLB 3DTXB 4DW2L 1FNSL 1IM3D 1RIUH 1UH4A 4PJAF 1CDJA 1A1NA 1NBCA 2EILB 4X5WA 4ZUTA 2KMWA 5JHAA 1M2OA 4PJAB 4G8GB 3HS8A 3IE9A 4UTAH 2DY2A 4M4PA 4AKOA 3HKFA 1JNLL 5DMGD 2NY0B 2MQ3A 4W93A 2NT0A 4ORGB 5DA4A 1YYCA 3V0VA 3NIGF 4MD4B 1H9VA 4AX3A 1QASA 3NIGB 4I48A 1LWJA 5GGQH 1BYPA 5J56B 4RVBA 4LL1A 4RFNB 2EVIA 2HT4D 4Q89A 5DUBB 3V4PL 1J5CA 2CO2A 2HH0H 1BW8A 3DSFL 5E4OA 2VZSA 5E4EC 4DKEL 3B2VH 1KBBA 4ONOA 5IFHL 3SPHA 1V3KA 2BVPA 4RZCA 3REWB 1PAZA 4M1GH 4DN4L 2NUTB 4Y2OA 4UT7L 4JPWL 4ANUA 2XWCA 1PAMA 3MRMA 1U8NA 2YBRA 3HAEG 1E2WA 1S9WA 4RZKA 5TQ2L 1DO5A 4PG9B 5FYLD 43C9B 4WZ9A 1T2XA 1FRGH 3LKSB 2Y4SA 1K4CB 3DYMA 2OMVB 4U7KA 2G60L 4NSKA 4O58L 5F7YC 3MRLA 5KYNA 1ACZA 1NC4D 1ACYH 5C7ZA 4JFEB 3ZT5A 4YVUA 2O1AA 3LAFA 5HGHB 1RZFL 5TE6H 1TKWB 1YPZF 3O8XB 4GINA 3WFBL 2CK0L 4IBYA 4M7LH 4OGAD 3N42B 2Z31C 4TOYL 3Q8FA 3W5NA 1KCRL 4QRRB 1E4KA 2D03H 1G5GA 3ARTA 1ILUA 4L4VA 4JO3H 4QI3A 4XI5C 1TF4A 3S36H 1KYFA 4FC3E 3FU5A 3JV6B 1M7DB 3I2CL 3CXFA 1HHHA 4QYOB 5DD1H 4K3EL 1BBJA 1YEGL 2VM4A 2NYYC 4Z8FH 4WNSA 1C12A 4PREB 1IKNC 5SWSA 2MFNA 4UI2A 4ZQKA 3WY4A 3VXME 4WSGA 4F91B 1NCJA 3D2TA 1QVOA 2EUWA 2XN9D 1X5LA 3CSBA 1AHWB 1XCTB 2YXWA 3B1UA 2BSEA 3VNYA 5IVOA 3O9WC 2ZWKA 1T6VN 3T3PF 4PWHA 2VDLL 4WK0B 4IRSD 4Y2DC 4MZ2A 3T3PB 4QNPF 3KH4A 4FXKB 2G2RA 4LHUD 4Z3TA 4YSTA 2Z92B 3ZHDA 3GXTA 4PB0H 5SWZE 3ZTJH 1L9MA 4HOWA 5E2JA 4UINH 1BLNB 3T4YB 5E1GA 5EIIG 4LKCA 3SSGA 1LP9F 2R39A 1MW3A 2V8LA 2BCKA 3RKPA 1CYXA 4ANXA 1XGQB 1LP9B 1HKLH 2A9CA 2CJUH 5J13B 3BVTA 2VISB 2DM2A 1Q94B 4F7EB 1ULVA 4CVWA 1H3UA 1IM9A 2G2NA 5CHNA 1ETA1 4RDQF 2A83B 4H8WC 1LO2L 2GBAA 4OZFA 1W72L 2DICA 2Y1ZA 1N5YL 4DPBX 2FQDA 2O5XL 3H4FA 4R90H 5E2UL 5CEZL 3C08H 1V3MA 2WZAA 1FPTH 4M4RB 2XX0A 3HFFA 2RFXB 5C08E 2HJKB 3Q9PA 5EHFA 5L2KE 4NYLB 1MHPH 2NX5E 2JCCE 2QZQA 1A3RL 3HEIB 5LNEA 2KC0A 5EU4B 1C9SA 3QDGE 3ARGB 1HXKA 4OZGF 1AXIB 2YGPA 1H5BB 3DRTB 1AHKA 4HUNB 4OZGB 4U3SB 2K45A 2CXKA 3NJXA 5EC1B 1HJCA 4L1HA 3PDGA 3HC4H 2BW4A 1AKJD 1HCYA 1X3DA 3JV4A 3LZLA 1RZKH 2QFRA 4APXA 3NMEA 4NOBA 5IHUH 1F3DJ 4QGYA 2EDOA 1A3LH 1TZOA 4FTDA 1MFMA 4N20A 5AB2A 3CZKA 1CD8A 2WBKA 1F4WH 4HKBB 3B9KB 3ZBMA 3QA3B 3D1MC 3GXMA 4I77L 3OGOE 2H0JA 3DUSB 3KPRD 4E68A 3EDFA 5K9OB 1NMAH 4RGOH 1OE1A 1U3HB 3N1QC 2AJUL 4DP1X 1U30A 2V0AA 5BS0A 1G7IA 1D5RA 4HS6B 1K4DB 4G6JH 4XBGA 2W5PA 4PJ9D 4LSTH 5I0YA 3C2AH 2YA0A 4KK9D 2HG5B 1JF5A 1DJXA 1RUPH 3RPKA 3V0WL 3RL1B 1EERB 1L6ZA 5KSUB 1BV8A 1WA0X 5DMIH 2BXYA 2CNZA 3EO9H 4LCWD 3CDYA 2FZ3B 4R4BB 1QATA 1DP0A 4FRWA 5E51A 2EEXA 5KSAA 3FCGA 3CD4A 4JHZA 3MNZB 4L5FH 5ESQB 4ZTOH 1RZ8A 1ZHBA 4L1SA 4OD1L 1BVKA 1NUDA 3BSZH 1GGBH 1NKOA 1NLBH 1YUKB 4EI6A 3IDXL 2JJVA 4WFFE 2JSFA 3LEXB 5HGAB 3HZVA 2Q86B 2ATKA 1XH2A 4D0CB 4R9HA 3MV7A 5BMFL 2M8XA 2Y2YA 3JWDL 2R7EA 5CZXC 4NHUB 1A6WH 5I1LB 4PGBB 4PW9A 2D9QB 4M29A 3N06B 2GEEA 4LEBA 4AE1A 1H3PL 7PCYA 1RK0A 4JG1H 5IBLD 3GLAA 3IFPB 2HVBA 3MV8D 1YEEL 1XR9B 3TBTB 4KRNA 4B6ZA 5JZ7D 4P5TA 1SQMA 2OJEA 1ETB1 2WOBA 4F7TA 4EIZC 3MR9B 4PY8J 2X70A 5FDWB 3UZVA 3BGMB 3BLBA 2HYMA 3VA6A 3QHFH 1ZHKA 2EXSA 1XAUA 2OSXA 4ENED 3EJYD 4CN6A 1MAJA 5LN4A 5HYFA 5KBDA 1VFBA 2DMHA 2IC2A 4OCMC 1CBVL 1A6ZA 1YECL 5GGSY 3VXUB 1AQDB 3QO1B 3BIBX 3RFZC 5EOTA 1N2RB 1HAWA 5FGCE 1P4IL 5C0JB 2VAJA 5KSBA 1NEZA 1YYML 2YFOA 1M7XA 1BGXL 2A9BA 2QDWA 3WKML 4YPJA 1QUNB 4Z7VA 2ARJB 3LPWA 4OH2A 3TBWB 4D8PA 4LP4A 1I8LA 4OGYH 3L3OC 1RZ7H 2RAMA 2VLJD 2P44B 2WQAA 4GKOA 3FQXA 4PI0A 4K3DH 3BQUB 1OHQA 5HJDA 3ZRFC 3N5AA 3H9SE 3FFDB 3KLAB 5LBSL 3O9WB 1GZPB 5KVEE 5ID0A 4BUGA 2OMXB 1HXYB 2IDUA 1NBYB 1XD1A 1B0RB 3I02A 3KCPB 5ERWA 2YPLA 1A02N 4ZUSB 4XMUA 4LOUC 5GS1C 3Q1EA 3O4LB 1WICA 1GMIA 3T6WA 1KGCD 2JXMB 4V1DA 4FNUA 4XCFL 1HWWA 1MFCH 4KDTA 5DK0B 3UBXI 3UTZA 1CLZH 5DQDL 4BH8B 1P53A 3T2QA 1NLDH 3M17B 4WEEA 3QZOA 1J8HA 1BVOA 2VQ4A 1WZLA 1TQUA 4OQTH 4NPKA 4PJFA 2IH3A 1NWPA 2BNRA 5G5DA 2MNWA 1JHTA 1KLFB 3VXQB 2AK4E 3MHZA 2B15A 4KKNA 4XPAL 1A4KB 2TRYA 1CTNA 1MCIA 2DZEA 3FZUC 1WZMA 3Q8CA 4CJ0A 4YLCA 2EINB 2HSIA 1JTPA 1TJXA 3S37L 3V2AR 4XXCC 1J9SA 2YD1A 1TEGA 4Y4KB 1IT9L 5HJBA 3TZVD 4QHMA 5J6HB 3D3VB 3BHBB 3OLEA 4YPGB 3BZ4B 2GHZA 1OGAB 4PPTA 1ZK5A 4HD9A 3W9DA 1SMOA 3S0PA 1YEWA 5I1AB 2HJLB 4G5AA 2A74A 1ZA6B 3B6SA 4UU9B 5J6GB 1OB1B 4X7EC 2F7RA 3EG9A 3LDBC 3S7GA 1EBAA 1ESOA 1XAKA 4XNUL 2R2EA 3UYRL 4L8DA 3LKOB 2XKNB 3UBGA 4PGJA 4CMMB 3VDCA 3CN2A 4NQQA 4B0MB 2ZUVA 2Y5EA 4WENB 3IAGC 5IMKB 3BH8A 3LQAC 4RAUA 3AZUA 4DP4X 3R8BB 4GNKB 3IDMB 1NCBL 3U2SB 4LCUB 2J1WA 2ZYRA 3GSVB 3O3BA 5GS0H 2E4FA 5F3HB 3OWRA 4JY4A 1U4EA 3S5LB 1YEDA 3VXSE 3P1VA 1M1XA 4FS0A 4HCFA 2NY4C 3MNDA 3WXWL 4I1NB 1YPZE 4AQAA 2MQGA 3SY0B 1R17A 2BFVH 2BH0A 4GBXB 4M3KB 4OM1H 4FHJA 1PZ5A 1Q9LA 3OV6A 4JFFE 3UERA 3TVMA 4J3OH 4IEFB 5GGSB 1WCQA 1DEEB 1JN6B 4MCZB 3OKKB 1U8LA 4NWUH 5HYIA 1A7NH 2VRAA 4MNHB 5AW4B 1U91A 3N40F 4Y19A 5JIMA 2VL5A 2WWNA 3VM5A 1MJUH 2PTTB 3CXHJ 3W38A 1JI1A 2ZYHA 3JYCA 4NBZB 3X1NA 1DANT 2X0UA 5LCVH 2FEEI 1N8ZB 3IAQA 5DEGB 1X7QB 3GSXB 1J7VR 5LBVA 4MQSB 3EO0A 1T2QL 3CVDA 4GB9A 3POHA 4KVCL 3KLHC 3QT2A 4JDTH 4DZBA 1DZBA 1IGJB 1NUFA 2FIRT 4DCQA 3BJ91 1HOCA 4RGNB 5GRXG 4LPXA 4IKJA 1N5AB 4PYHA 5BQ7A 4PCKA 3HRZB 3VA2C 1F42A 5I1CH 4TKWA 3UGXA 3TIDA 1G6VK 2BNQA 2PP7A 3WIHL 3ZE1E 4CW1B 2WQXA 3A21A 4BFIA 1JZ6A 4W6YB 4AEFA 1TQBC 2IJ0C 2R56L 4J3TA 5HGDA 2H26B 4KZ0A 1CICA 4HJ1A 4PS4H 2A9NH 2JQZA 3BN3B 2Y06L 2DQEL 3FFOA 1HEZA 4HWBA 2CBPA 2QVMA 5I30L 1TJIH 4ZSOE 2C1PA 3RDTA 3ZKQD 1ADQL 1NAKH 2Z0UA 3E38A 1DDHB 2C3VB 4QXGH 1TT6A 4PGEB 1EFXA 2WOYA 4XPGH 1Z0NA 2B59A 2XG4A 3KR3L 4KAQL 4HK3N 5D7JD 5FO8B 4B9FA 3BKCH 5FM5M 3SBQA 1KPUA 2A6JA 3MOBH 4FQIH 3RX5A 1BD2E 4JZOB 3TIEA 3EFDL 3MRQA 3PAZA 5I8KL 5FYJE 2YC1A 3JTTB 1JFQH 2WYTA 1IEAA 3ZTDC 1DQDH 2UY7A 1QEWA 1QBMH 1EZUA 1MLBA 3V0EA 3WEMA 3MRHA 2HN7A 3T71A 4NKMB 1LILA 4NJ9H 1WBYA 1AKPA 5E9DD 2ZP0T 1F56A 1TVDA 4U1HA 4ZS6C 5GGVL 4DZ8A 4GRWF 3VXRB 3H6JA 4I9WD 4EQ3A 1WD8A 5B1CA 2B5IC 3WDJA 2AANA 4OB5L 5DZAA 2OYMA 5A2AA 4Z3JA 5I75C 1XTMA 4XP1H 3DGCR 3VFRA 2N59A 4NO0D 4D7PA 3TEXA 2MPAL 3K6SA 5CLZA 4FG6C 2VDPH 5EC2B 4PHXA 3U7WH 3CX5K 2GJJA 3HPJB 5CGMA 3IGLA 1CFSA 1RIHH 4KI1A 1KBGH 1B0IA 1YNLL 3NYKA 2AQNA 1E4XI 2ZF8A 4ZD3L 2P8LB 3CLEH 3C5XA 3CFCH 3NFSH 3LQAH 5C0IA 3IPBA 4IQHA 3U7YL 5KJRL 3P4NB 4AYBA 3TA4D 1KBVA 3QYCA 5HYJB 4XE0A 3U0WL 1C5BH 2N7AA 4FDWA 4DQOH 1HSBA 3LDBB 1ZY9A 3VWKA 1CDHA 3P2BA 3GIVA 4D2NA 4NAMA 5KG9B 2VDPB 3V9EA 2ZXQA 2COQA 4N2NA 2Q3ZA 3F7KA 4GFTB 4AUJA 2JVUA 1CD1A 2FIKA 1MFDL 5DRZB 4Y2NA 4QAWA 2ERJB 4Y1TA 1SYSA 3HE6A 2XZZA 3M7OA 3ATFA 3C87A 2BSSB 5I73B 1XSJA 2XV3A 4R0LC 5EUOB 1NGPH 3QQ9C 3EF7A 4WFED 1DE4A 4YK4C 3VWJD 1JZDC 2VJ0A 3MOAH 5LWYL 4QXWA 5I66B 1MAMH 4NP4L 3QORA 1XCQA 4KQ3L 3EBHA 4IRZH 4QHUA 5HVGB 4Y5YC 3VFPA 3FN0H 3IEAA 5C3LD 1TQSA 3RWEB 3Q7JA 4N6RB 3IMVA 4GW4A 2PW2B 4NQDD 4URTB 2ZX9A 3A6OA 2C9SA 5BPPA 5JHLL 3O4OC 1N26A 1MI5B 2ADIB 2ZOTA 1A5FH 2HLEB 1IBZA 1KCLA 4P5KB 5DMKA 1QACA 2EIEA 3JWNC 3L3KB 4LCYA 5SWSE 1GZHA 3SOBH 4XOEA 3GHBL 3QWOA 1S7RB 3QAZC 3H9ZA 3TWYA 1JWSA 3IN2A 1FIGL 1R5WA 4RQQB 4WHCA 1QI4A 4J2QA 3QDJA 5BUGA 3MCLH 3MRIB 1Y0LA 1HFUA 1NBVL 5HHPB 5DWUH 2ADFH 2YEQA 4KI5C 4YDIH 4PS8A 5EU6D 2YQBA 1W9XA 4OD2B 4OKVB 5IQ7L 3DXAD 2ICWI 4XH2B 2CIIB 2J1KA 3NFNA 1R3JA 2PCFB 4W9GC 5AZEL 4PWGA 3CFBB 3ZXAC 3ZIYA 2IXQB 2H6PB 2IAND 3OXRA 5IMOB 4P57A 1HSAB 3EJSA 2GBTA 2NY5H 1ZE3H 3P4MA 1BCIA 3I75B 3M86A 3P2DA 3UTPD 4BUHA 3CVBA 4K9EC 2WPGA 4Y16A 3CSYA 2W07A 3WN6A 4KRPD 5TDOA 4BFFA 5E0FA 1BZOA 4OFPA 1FVCA 4FNPA 1YMHB 2HX9A 1Z5LB 1X6NA 3A4FA 4CBZA 2ODIA 3BDYL 2Q3AA 1WFJA 2CM6A 5DVKA 2NNRA 5KVGL 4KK6C 3V8CA 1IEHA 3VFTA 3D0LA 3CZUB 2QPFA 4LPCA 4MBRA 2NXYC 3C5ZD 4NQUA 1HVXA 1KTBA 2UVEA 3CFNA 4TLTA 5IM7A 5DZVA 5JQIB 4LNRB 3P9WB 4WK4B 3P02A 4Q4IA 4GAYA 1VHPA 2JJTA 4CDGC 4K5NA 1OP5H 1L9TA 1UC6A 5D6CA 4G7YH 5E8NA 1DUZA 1S7TB 4WI3A 5IIEA 4JEGB 1RHHA 3OGCA 5LQBL 1T4KB 1EHNA 3HLKA 3APCA 5DJYA 5BS0E 3AACA 5FWRA 5I0VA 2V9QA 3LZFL 1MPAH 5F1NA 2IIJA 3TH2T 4NUJA 1ASOA 2WXIA 2GT9B 2WXNA 5KYXA 3LRSA 5CGYC 5EN2B 1MKFA 4G72B 3OB0K 2UX7A 2HTLC 2NR6C 3B9VA 1UURA 1X4XA 4F2MA 4EZJA 3F5WA 3VI4B 2A4ZA 1IX2A 3I6SA 4HFUL 5L8JB 2QSTA 4OJFL 2YPVH 2ZCHH 3BD4A 2XIBA 4P2QE 2WAQA 3OKMA 5BOPA 6PAZA 1ZV5A 3N40P 1NFIB 4XXWC 2XRAH 5KYWA 2RJMA 4LVNC 3V6ZB 1BA9A 1D5ZB 2XTJD 2F5AL 3GKWL 3TJEH 4ONHB 3DGGB 4KOCA 1MFAH 2JTYA 5J9PA 3MV7E 2GB2A 4HPOH 3TM6A 3CDCA 1OHZA 5EZIL 4NO3B 1L9SA 3WJLA 1TCRB 1A14L 4G43B 3CMGA 4Q9RH 1P5UA 2H0EA 4FNLL 5CFAA 1QO3A 5J06A 5K5YA 1SMAA 1HWHB 3DV4B 1BOGB 5DRNA 1RZQA 1SHXA 4ANKA 4F7CA 5DJ8B 4F33B 1YA5A 4UQAA 3V4UH 1JGLH 3T5WA 2DQMA 4OF5A 5G2NA 3P9MB 1Z0MA 1BYNA 2D7OA 3RTQC 5ADPH 2FO4B 4LEOB 1LMKA 3DWTA 3HS0A 2EE6A 1XGPA 2QQNL 2VLKB 4NC1C 4ACPA 5HYSB 2NY1D 4MDRA 3ELQA 5HI4D 4XBEL 3MCKB 4XZUB 1FZJB 1TZ8A 1N3NB 3EYUH 4MJ6B 3SBPA 1EEZB 4UT6A 2DQIH 3SKNB 1S7XA 5KSBE 3GMLA 3NCXA 3EDEA 3PP3K 1NSNH 3QI9A 4W4OA 1BXAA 4JRYB 2IMNA 2F54B 1A47A 3DETC 4Y4KC 5TK4A 3DX6A 2VR4A 4AV5A 3QJHA 5IHZB 1PZDA 2BIOA 2V5TA 3O3AA 5GGRY 1JGDB 3CC5B 1OF2A 5D1ZA 5JDJA 3BN9D 3HC2A 1OM3H 2ZG1A 3AROA 2CGRH 1XIWA 2GJ6D 3O6MH 1NFDA 1ZV9A 1Z7JA 4K8RC 5FECA 5JMOC 5J3HD 1BQHB 4PP2B 3ZE0B 1DSYA 1T2JA 5FFOA 3B5TA 2NDFA 2VO8A 2PP8A 5CKAA 3PJLA 1UXSB 4CKVX 4K9EH 2R0LL 4M7LT 5C6TH 1OAKL 3KPOA 5I8OH 1MHCB 2G3ZA 4HC1L 2J8OA 2RTTA 2YPLE 4LEXH 3CIAA 4ZFOL 4IGBA 1Y07A 4MWFB 5MEPA 4ODWA 4V1DE 5C09B 4QHKJ 1IV8A 1RY7B 1CFTB 4KK8C 3KDPB 1A2YA 4G80A 1MCBA 2EDKA 4G8FA 4X4YB 2FRGP 5HHOD 1KELH 1J8HE 1MVUB 3WIFA 3EYFA 1A7OL 3MRDB 4O2EB 1DEDA 4PJFE 1LEKB 2BNRE 4LLUA 3VDAA 1YNTB 3EYQC 3ULSA 2VGLM 3QEQD 2TSBA 3S97C 1EV2E 1JG9A 2ARJQ 2EEFA 3D39B 2VDNL 1FAIL 3KEDA 1T22A 3NCEB 1GTNA 3MRNB 4N2CA 3UTQA 1SJVA 5C0EB 5GRJH 4JKKA 1AO7D 5IBUG 2HRGA 4CGTA 3I3BA 3DPDA 3L2NA 1C7TA 1V8HA 5GZOC 3TEWA 5DK2A 3VXNB 3S35X 1QSED 3AQYA 3DK0A 2AQQA 4WO0A 5GSVA 3A0OA 1M4KA 1FLRL 3H53A 2Q9OA 1THCA 4IHOA 4IU3B 3QNXB 1DVUA 3GEFA 1VCAA 3BDBA 1VESA 3NSCA 3MGTB 1I9JH 3LMJL 4EPSA 4WW2F 5JLZB 2EIDA 3OHXC 5AOMA 4KZEH 4DP9X 5DUJA 3W39A 3L2MA 3BP6A 3W81A 4IJ3B 3P3RA 1WEJL 3WEAA 1Q1JL 4KROC 3O6LL 3GBNH 2GTQA 4HD5A 4TSCL 5E5MA 1PJ9A 1FV1A 2EEAA 3EJUA 2Z93A 3LKRB 3L1GA 3U9PL 4Z5RB 3LB6D 1WRFA 4Q9BA 2C1OB 2ZUTA 4OZIB 3FB5B 4PI2A 2OZ4H 3P69A 4A2GA 3KYKH 1TO5A 4LK4A 4UV7L 2R1YA 3BVWA 1EMTL 4BSVA 4WHYH 3ZO0A 2GTZA 2XBZA 3ETSA 5ESAB 1E30A 5D2LA 3IDJB 2XY1A 1X5YA 5DRWA 4MMZA 1L9PA 1I8MA 2VLRD 2QDVA 3J07A 4R96B 4ABVA 1H0DB 2X9WA 2P5WD 3L3HA 4IOSD 2WV3A 4AW7A 2G5RA 1NUGA 4AIEA 2WM0A 1P0SE 3UXFA 3UDWC 3SYCA 4A2HA 3S98A 5CZVL 3BUIA 1VZHA 1G1KA 3BCFA 4LSVH 1UXWA 4JFHD 4EJ1C 4RIRA 2MTAA 3BIKA 4FABL 3R18A 3L1FA 2FSDA 2AJZA 3PHAA 4M02A 3ABGA 3SE3A 4BINA 2JK5B 4Y19E 3QFJA 4NM8H 2ZUWA 4JY5L 4I3SL 4W9CC 2X41A 5HHQB 3IPFA 4NRYA 4IIZA 3GGWA 4Y8AA 1XF5B 1JFHA 4PJBA 4DGVH 3ISWA 1NPNA 2ADJA 5E2TH 3WNJA 1JMZA 5EZLA 4CKQA 3QZLA 5TH2B 5DD3H 1XMEB 1LK3H 1ZIBA 4MA1B 4MNQD 5LN8A 4ONFL 3TJPA 3GI9L 3VD0A 1E4JA 4BDVB 2WBWB 4X9FA 3PNWB 1GYUA 3BWAA 4X99A 3BUQA 4JFDD 3RTQB 2BNQE 1WAPA 5L8LB 2EADA 5TF0A 1MIMH 4PWJA 1GC1L 4K8RH 1UD3A 2E7LC 1U6AH 2CNYA 3DUHA 3TC9A 3U4BH 5MI0C 2VXUH 2XV0A