2Y1AA

Crystal structure of achromobacter cycloclastes cu nitrite reductase with bound no
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
332
structure length
332
Chain Sequence
b'DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
molecule tags Oxidoreductase
publication title Monitoring and Validating Active Site Redox States in Protein Crystals.
pubmed doi rcsb
total genus 91
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2y1aA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2y1aA02
4BWWA 3NJLA 2BO0A 2IH9A 1N70A 1VLXA 1SDDB 1WA1X 3PAZA 4TXVB 3UABA 7PCYA 5I6MA 1AS8A 2FQFA 2BW5A 1KCWA 3CG8A 4BDVB 1PZBA 3FSWA 1J5DA 4YSAA 1A65A 1JZIA 2EINB 3NJKA 1BXVA 4DP7X 3T9WA 1AQ8A 4AKPA 3AG4B 3DIVA 3AG2B 3RYMA 1AG0A 4G71B 1GW0A 2DV6A 2HX7A 2R7EB 1ZDSA 4GYBA 1SHWA 1J9RA 1GS6X 2IDFA 4KNTA 2FJSA 1PLAA 1RCYA 1JXFA 1CUOA 2FNWA 2I7SA 3S8FB 2J56A 1JZGA 2DWTA 4YSQA 1JOIA 2PPDA 1BAWA 1NIEA 1PZAA 2GC7C 3PAUA 3QJTB 3H56A 1ZPUA 2R7EA 3S3BB 1GY1A 1JXDA 1T5KA 1WAEA 1AACA 2I85A 3NJNA 2BHFA 2VW6A 1NWOA 2W88A 3NJJA 1NPNA 4GP8B 4K9JA 2UXTA 3NJHA 5D4JA 3KW7A 1PNCA 2EIMB 3WG7B 4NB7A 3UACA 3PAVA 1ASPA 4HIPA 3UGEA 3V9CA 2PPAA 4E9VA 4E9QA 3C75A 1XB6A 4A2HA 1JZJA 3EH3B 2CAKA 3NSCA 1BXAA 1AR1B 1SDDA 1JZHA 2TSAA 1BQRA 2XXFA 3TU6A 1IC0A 4E9YA 4AZUA 3GYRA 3UAEA 2UX6A 1FWXA 4W9ZA 1AZBA 1BYOA 2ZONA 3V9EA 1URIA 2AANA 2Q9OA 1AZCA 2JXMA 2IDTA 1MG2C 2VM3A 1NZRA 4JHVA 4DP4X 3FPYA 2AFNA 3ABKB 1MG3C 4G7SB 1CYXA 5FC9A 1SF3A 2AZUA 3TBBA 5I28A 2IWEA 1L9PA 2PLTA 2FT8A 4HAKA 2PCYA 3GXUB 1NIBA 2XX0A 2QT6A 2ZWNA 1R1CA 2HX9A 3X1FA 3CVDA 4CSPA 1CURA 3TBCA 3HB3B 3IEAA 1A4BA 1BQ5A 3TASA 2Q5BA 5B1JA 1RZPA 2YXWA 4E9XA 4FAAB 4HALA 3WNIA 4E9TA 2BP8B 1SF5A 1OE1A 3NSDA 2XUWA 3QJRB 3ZX1A 2IH8A 2IDUA 2EIKB 1OCCB 2FQDA 1KYAA 2YARA 4YSRA 2B3IA 2PCFA 4DP6X 6PCYA 1J5CA 3FU9A 5B7MA 2FQEA 3AG3B 3FS9A 3NYKA 1ASQA 3CVCA 4DP8X 2NRDA 3ZIYA 5I5IA 4WTQA 3FYIB 4FA7B 1JXGA 5A7EA 4GXFA 1DZ0A 5I5MA 1RZQA 1V54B 2VW4A 2BWDA 2YAPA 5B1BB 4A68A 4DP9X 4P5RA 1ZDQA 1AANA 1ET8A 3DKHA 1JERA 2OCCB 3MX0B 1TU2A 2QDWA 1AZUA 1SJMA 2BWIA 3PXLA 3X1EA 1WS7A 4YL4A 1E5ZA 1J9TA 3UAAA 1EHKB 1ILSA 2YXVA 3T6VA 2YAFA 1GS8A 1B3IA 3NJGA 2DWSA 2WO2B 1FFTB 1PNDA 1TKWA 2BZ7A 5I6NA 2GB2A 2FWLB 4N8UA 1NIFA 4DP1X 3H4HA 1E5YA 2CJ3A 2GSMB 1ZV2A 3PPSA 2BZCA 2CBPA 1TEFA 3QQXA 1ZIAA 1NTDA 3FSAA 1PY0A 3DTUB 1A8ZA 3IBOA 5D4HA 3FU8A 2JKWA 2VM4A 3X2QB 5D4IA 1ILUA 1J9SA 1EZLA 4A2GA 3ZDWA 4DP5X 3ZBMA 2FQGA 4GP5B 4DPCX 3AY2A 1KBVA 2J5WA 6PAZA 2A3TA 2XXGA 1F56A 2XYBA 1AAJA 2IWKA 4Q89A 2IWFA 2EILB 4BWTA 1OE2A 5I6PA 3SBPA 5TK2A 4YSTA 4A2FA 2UXVA 2XVBA 1BQKA 3FPXA 2VN3A 2HLEB 1JVOA 2XV2A 3OMIB 4X4KA 4NAJA 1PLBA 1ETJA 1GR7A 2BP0A 1YLBB 1GY2A 1JZFA 4F7KA 3H4FA 2GC4C 4DP0X 1SFHA 3X1NA 3WKQA 4N4YB 3SBRA 8PAZA 1ZIBA 4BXSV 2TSBA 2QPEB 1NIDA 4G72B 4P5SA 4QLWA 1HFUA 4AX3A 1ET7A 1GSKA 2IAAC 4A2DA 3FQYA 3JT2A 3QJUB 1ASOA 1TEGA 2ZOOA 2ZXWB 3T71A 5B3SB 1AIZA 2X87A 9PCYA 4WKXA 1I53A 1QNIA 5I6LA 5AFAA 1PZCA 4HZ1A 4KO5A 1L9QA 3FU7A 1E65A 3OQRA 3FQ1A 1RKRA 4PCYA 4EF3A 3SQRA 4BXVA 2DYSB 4YSSA 2GIMA 4YSPA 3HEIB 4UAHA 3WNJA 1AG6A 1OOWA 5AZUA 3SBQA 2W8CA 5EHFA 4BK5C 3NT0A 4M3HA 4HHGA 1JVLA 4UF7C 3EHBB 4YSOA 2PP7A 2Y69B 2XWZA 4PAZA 1DYZA 3WKPA 4KNUA 3FU7B 2QPDB 5TK4A 1X9RA 1L9TA 4YVUA 1IBYA 5E9NA 4M4RB 2H5UA 2VMJA 1L9SA 3S8GB 3NSFA 1NDTA 2AVFA 3BQVA 4YVNA 4G7RB 1V55B 1WS8A 2DYRB 2BP0B 3ASNB 2IDSA 1CC3A 1AZRA 5ANHA 1X9UA 2J55A 2EIJB 5F7BA 3X1BA 4AI7A 1NIAA 4UANA 3MBWB 3D12B 3ERXA 1NINA 1L9OA 1M9WA 1ET5A 3TA4D 1A4AA 4DPBX 1GYCA 1OCRB 2JFCA 3NP4A 3ABGA 1WA2X 1OE3A 2VSMB 1J9QA 1PLCA 3CVBA 1UATA 2HRGA 3EF4A 3T6WA 2XX1A 3ASOB 1PAZA 2VW7A 2XLLA 4E9WA 4A2EA 1PF3A 2PP8A 3OM3B 2PPEA 3CDZA 7PAZA 4CSZA 4E9RA 4HHWA 2PPFA 4MFHA 5B1KA 2E86A 5I26A 3G5WA 4AKOA 2XU9A 1M56B 4YSUA 1FA4A 3CZUB 2HZHA 2J57A 3QJSB 3AZUA 4KNSA 1NWPA 4DPAX 4F2EA 4G70B 3ABLB 3PCYA 2XV3A 2BW4A 1IKOP 1KGYE 2DY2A 1KBWA 3CDZB 2UXGA 1OV8A 4RH4A 4L0PB 2HRHA 2FT7A 1NICA 1KDIA 2HX8A 1SFDA 2IDQA 2RACA 5PAZA 1E67A 1KDJA 4DP2X 3FT0A 3AW5A 2CALA 1AOZA 5AKRA 4GP4B 3PLYA 1W6WA 3KW8A 5I5JA 1BXUA 2FT6A 1ADWA 4G7QB 1KV7A 1KCBA 2UXFA 4A66A 2P80A 2XV0A 1ID2A 5B7EA 1BEXA 2WO3B 4KO9A 2CUAA 2H47C 5LDUA 1W8EA 4HCGA 3WI9A 5B1AB 2PPCA 3FSVA 3FYEB 1CYWA 1QLEB 3IE9A 4JHUA 2N0MA 1AS6A 5F7AA 4NERA 4QKTA 3BVDB 3FQ2A 1JZEA 1NPJA 4KO7A 3QJQB 4BWUA 3QPKA 2VSKB 1HAUA 2OJ1A 3EH4B 3EH5B 1L9RA 5I6KA 1IBZA 5IY5B 2MTAA 4ENZA 2B08A 3IN0A 1OCOB 3ABMB 3IN2A 1QHQA 4ZK8A 2YAQA 2AZAA 1AZNA 1MZYA 2YAOA 4Q8BA 4W1TA 1MDAA 2FTAA 1SHXA 4BDVA 3FSZA 5B1JC 3OD3A 5PCYA 1OF0A 1WA0X 2X88A 2YAEA 1V10A 4HCIA 2H3XC 2I7OA 2YAMA 3N55A 1AS7A 1A4CA 1E30A 1PCSA 2HXAA 3QJVB 3WIAA 3NP3A 3OMAB 1HAWA 3NJIA 3U25A 2QDVA 4AKQA 1XMEB 3S3DB 4GY4A 1XB8A 2BP8A 4YSCA 4A67A 3NSYA 2P80D 2GBAA 3L45A 4E9SA 1A3ZA 2GI0A 3NJFA 2YQBA 2WSDA 3T6XA 3AG1B 3UADA 4F2FA 3T6ZA 1SNRA 4YSDA 1XB3A 3NJMA 1GS7A 1N68A 4KOBA 2GHZA 1W6LA 2MRYA 1PMYA 3JTBA 4YSEA 4HCFA 4JKNA 2UX7A 1IUZA 3X1GA 2LLNA 5I6OA 2Y1AA 3S3CB 3GDCA 4KO6A 1OCZB 2YAHA 4KOCA 2CCWA 1MZZA 3OMNB 1M57B 5B7FA 1BYPA 2PP9A 2OV0A 3N2JA
chains in the Genus database with same CATH superfamily
4JS7A 4BWWA 2QVFB 2APSA 4KKLD 1Y18B 1FUNA 5T3ZD 1R47A 2BSEA 2COVD 3HC4H 1SLWA 2NPLX 3WIHA 1VKXB 1H3TA 4O4YL 5JOFB 4NIKB 2VRQA 5E08H 1U58A 1I8KA 3MRFA 3DBSA 4N2FA 5DRZB 2J6WA 3ZMNA 3R7QA 1O6TA 2XPYA 4G43B 3RVXD 2MOQA 4PVMA 5E00B 4QHKJ 3U46B 3OAZK 4HJ0D 1U8NA 1AGCB 2WM0A 4Y2OB 4R9HA 2Q86B 3STZA 2OXHA 2VDQB 3C12A 3TF7C 2P26A 3PNRB 4RWYH 5DJ8A 3LHAA 3PAUA 4X4MA 3S3JA 3QBTB 3KEHA 4BFBD 5E2TL 1R5WA 4XAKE 3LVEA 5F1KC 3AU1A 1LM8V 2D9QB 4LVHB 1TMQA 2UXTA 1NCOA 1NUFA 1QFWH 5F7KC 4CGUB 3TVMB 2E7DA 2PABA 4WFFE 2WIIA 5TE6L 1X9QA 3D85B 1ES0B 1ZSDA 2ADFL 1Q9LA 4OD3L 4YHNA 3MJ7A 4BFFA 3SE9L 5I1IL 5L4IA 3V4LA 1EERB 1KUMA 1PG7L 2EECA 4PGZA 1XFPA 4RFEA 4Y4FB 5D71L 3BZEB 5E5LA 2Q7NA 3GZKA 3J8F7 1KNOB 1SDDA 2B14A 1BQUA 2GUYA 4HBCL 1AR1D 1CGSH 3CE1A 3TBWB 1DQMH 4ZTPL 3BRGC 5KS9E 1ED3A 3MCLL 4DKTA 3ZTEA 4HUKB 4HU2A 5EO1A 1PIFA 3GJFA 1IBBA 4FERA 3T2NL 1XGRB 2NNAA 3FC8A 4G8EA 5A2IH 1OTTC 4HHAB 3THML 3SKJH 2F18A 5EZPA 1OAJA 1PFCA 1PZ3A 3MV8D 2CKNA 5HJ3A 5HGBA 5C0CE 2VZVA 4PLKD 4JG0H 2X10A 1FBIL 2XXCB 5C0CA 1CLZL 3BI9X 2NY7L 2VN7A 1RIUL 5D72H 5ITBL 1KELH 2J2ZA 5D2NE 2X70A 4K3DL 4C54A 5KSVA 2R2BA 4X6DB 4LDOB 3RKDD 2R1YB 3EGDA 2A0LC 3CVDA 4PRID 3HTLX 5BOZG 3PGFH 4TSAL 5AVSB 5DWPA 1CS6A 1BQ5A 3IXAA 4GI9A 4OGAD 3D2UD 1XGTB 4UAOB 5FK9B 1GH7A 3H7LA 1TOXA 4HS8H 4PJ6A 4BFEA 5SWZB 2FEJA 4KQ3H 5AYUL 3HG1A 1HCYA 4GW5A 2BP8B 4FADA 3O3BA 2GSIB 2BVQA 5BJTB 5INCA 3GXPA 3GO1H 2VDRL 4JFED 3BD5A 1M2OA 3CHOA 4X7TA 3O6MH 1LJMA 4UNTA 5FA3B 3TJPA 4J39A 4XX1G 5FO7B 3MRQB 3SKMA 3MOQA 2XZAH 1CFTB 2YWZA 3BZFB 3KWTA 1ZS8B 2CO6B 4P3CH 3L7FB 4IRJA 2BXZA 3D0AA 2W38A 4OZGB 3HRZC 2XWJB 3U1SH 3F58H 2VDNL 4FA7B 3KGUA 3MLTA 3RVWD 1RZQA 1A7OL 5B1BB 3KWWA 1MFDH 4JG5A 3EBGA 2H6UA 4FG0A 3F58L 1N59B 2YO3A 3DKHA 4U1LA 5K1VA 2XVLA 1YEJH 1MCOL 3OJVC 4OW6A 3RIKA 2DL2A 1NBYB 3B34A 1RJLB 2QGCA 2P8MB 1U41A 3HAEB 2ZCZA 2ITCB 1K8IB 5MP6H 1KYUA 4HDIA 1BSIA 4WI5A 1DBMH 4LDEB 5LNDA 3MCKA 1FH2A 1MCCA 2IPUK 4OJFL 3VMNA 3L08A 1R3LA 2WO2B 3I6LD 1JGEB 3NCEB 1NIFA 1R3JA 2RAMA 4OUUB 5C07A 5FKPA 1MEXL 3FK3A 4YXHL 1T03H 1EAPA 4RWHA 2YXFA 4LVOB 3QDGD 4QRRA 2O5XH 3WFDL 2CUIA 3PXHA 2XBZA 3BXNB 1E6JL 1X7SA 5CR8A 4BRVA 3LS4L 3B2MA 1F11A 5CP7B 3C2SA 1CLYH 4YGAB 1KBBA 1MHHA 2VZUA 1GC1H 2FUTA 4N0FA 3MLRH 2DQCH 3B2XA 5T1KD 1DVFB 2NX5D 1LNUB 3DX6A 3L13A 3WBDA 1CLYL 1JNNL 4WFED 4LK4A 4ZAKA 2UZXA 4KK6D 1MRFH 1NBVH 3JXAA 4IMKC 2UXVA 4P9ML 2IALB 4I2XE 5L2KE 3N42B 3LXBA 3GJEA 3IWUA 4Z7NE 4H40A 4TVPL 1O6SA 1X5KA 4KC3B 3VXMA 1XR9B 5DJ0A 3H3KA 5FGCE 4YFEA 2OK0L 4PWKA 2VR6A 1XGPA 4DP0X 4YHLH 5E1QA 3QUYC 3WU1A 2NR6C 5E99L 4LB8A 1FL5A 4ZMWA 2QHRL 1M9SA 5DD1L 3EO9H 4CN6A 4ZMZA 3IKCA 1ET7A 3ULVD 3M46A 4JKPL 2LU4A 2IAAC 1KGWA 1BZ7A 5DHVB 2O5ZH 1UB5A 1INDL 2OMBA 4M6AA 1IX2A 4IBWA 1WT5A 2FEEI 3I6KA 4JY5L 3IPBA 3U2SB 3AS2A 5I18H 5I1GL 1JCKA 3BLPX 4F15B 4XNAA 1AI1L 4JFVA 1JFQH 5A2BA 1T66D 5ACZA 3EJQA 5BV7C 3IRZA 4CUCA 2GJ6E 1RKRA 3BVNA 3OAWA 4MJ4A 4WUKH 1A2YA 4MAYB 4ZFOB 5ESAB 2EKSB 2VN6A 4P4RA 5KJRH 5EH1A 2NY4B 3CVIH 5EHFA 2B1OA 5T1LB 1T21A 3WFEL 2WP3O 3L9RA 3MYJB 5D6CB 1NCTA 5AWNH 4P04A 3CVIL 3JWNC 3QC5X 4KNUA 1X9RA 2BIHA 2XTLA 3VWKC 3NFPB 1N64L 3EJSA 4DN3H 3DGDA 3ZDXE 3TH3T 4JE4B 4XE0A 3RTQD 1T2QL 2G2PA 4I5BA 1KFGA 3AXLB 4H8PA 4O58L 4FL4B 3K8KA 3FQXA 4G9FD 3KR3H 3DVFA 4GAJH 3WLWC 4GBXA 5EBMA 5I15H 5IMMA 4K4KA 3QAZB 1SQMA 4CC0A 2O93L 4YVNA 5IG7A 3WFBL 1BLNB 3SO5A 4X6BB 1JGLH 3RGVB 3MOBH 1LWHA 2AQSA 4P2CG 2WSPA 3TC9A 1J1XH 1KACB 1ROWA 3NIGB 1RZJH 2QVTA 2J55A 1JJUA 3L3IA 1Z9LA 2ZOWA 4FYRA 3DROA 3Q2CA 1QG3A 3UPAA 3KPOB 2X9ZA 3K7UA 3ERXA 4GW1B 1XH2A 1VEPA 5E6SB 1UXWB 5HHOA 3E1ZA 3T3ME 5ADPL 1MUJA 3QZMA 3VRLF 2DQDH 2V5TA 4KXZI 4PREB 5HI4D 2OR7A 4YZFE 1PLCA 3IGAB 1N6QH 5TE7L 2VXQA 3P30H 1AGDA 4TUJA 3FO1B 2PPEA 4NKDB 3ZZSA 5HGHA 2PPFA 4KY1L 1U8MA 3FH7A 5SWSD 4ODBD 1CXHA 3TBVB 2G5BA 5HJBA 3CZUB 4GKSA 6TAAA 5T1DH 3K72B 3GM8A 1FZJA 5AB2A 2LVCA 1Q38A 2PWHA 3ABLB 3PCYA 4PU2A 4Z7VA 4AYSA 4NUMA 5DSCB 1RZ7H 3DNKA 3HHMA 1MVUA 1J7VR 3U9WA 2HT4D 2ZG1A 1RJYB 4XPFH 3FCTB 3GI9L 1V7ML 4KTEL 4G1MA 4L4VA 5E8EB 2F08A 2GFBB 3DGGB 3RHWK 1WIPA 5DJZA 2AQQA 4R4BB 2DQFA 4ISVA 4XPFL 4DP2X 1AGEA 4H25B 3MSPA 3AW5A 4M5ZH 5A2KH 4LASH 5T8IA 3SDCA 4FABL 5DS2A 3BWAA 1ITBB 1CF1A 4Y2DD 4JMXA 2DMCA 2Z4TA 3LKPB 4NM4H 4U1KB 4OGAC 1LL1A 1D9KD 5D5MF 4P59H 2DIBA 2A9BA 4XP6H 4Z95L 3PV6A 4FG6D 2ZSWB 1MOEA 3SPCA 1OT1A 4X9IA 3KYKH 2BXYA 1OT4A 2C4FU 4HKJA 5I8CA 3G6JF 1LE9A 4NWTH 3SE3A 4YK4C 1PSKL 3PWNB 5EC1A 4AL8H 2OZ4A 1JPSH 2OFQA 3ELQA 4AVHA 1JZEA 4C4KO 5IMKA 5TQ0H 3KPQA 4N8VG 4JO2H 5B39B 4Y5VC 2XWRA 4JN1L 3RL1A 5C0CB 4XP9H 1KCRH 4NWTL 5D1ZC 1E8ZA 4V2CB 4Z8FH 1TPXC 3CN3A 3IFNH 1E9OA 2Y7OA 2DLGA 4WNQA 3WY3A 3JVFC 1A8JH 2WXRA 4JDEA 5C0NC 4XCNA 4DEWA 3IJYB 5AENA 1AO7E 3IMUA 1IGIH 2J4WL 4MS8C 2PKDA 1ZT4B 3MREA 4XAWH 3W0WD 3KPNB 4XWGL 2R23B 3DPDA 4L29A 5IB1B 2R4SH 3ZKQD 1AZNA 4Z6AT 1L6PA 4OLZH 2EICA 4PRPE 5DHXB 4M3JA 2F1AA 2NX5E 2R9HC 3G5VB 2NY0B 3V4VA 2CO7A 1BD2D 3L1FA 3SDAD 4J3BA 1QI5A 3SKMB 4WCYL 1NEZG 2VR5A 2ZWYA 2CR6A 3SE6A 3GNML 5BRQA 3QXAB 3BGFB 3SPVA 3D7PA 1EGJL 5AVWB 4HWEL 1CI5A 3BMWA 3CHXA 4PV1C 2FX7H 2GI0A 1MHPH 5TE4H 1O7SA 3MGOA 2OKMA 1PZSA 3AM8A 1HINH 3BD4A 4NM8H 4PG2C 2FL5A 3EOAB 3GSNB 4QAWA 3TA3B 3TVMC 5JIPA 3RJOA 2EC9U 1W9XA 4CMMB 1D7CA 2WZ5A 3OKLA 3QQ3B 3LJ3A 2J8UE 4H8WC 5BW7A 2QHLA 1JBJA 5F93C 4AL8C 1CTOA 1I9RL 4AEIH 5L0QC 2AXWA 1HIML 3O0RH 2BY1A 2LLNA 1BX2B 2DWDA 3K91A 3VXSA 3BUBA 1UWEH 3MRKA 2NY5H 3I6GA 4MASA 4PGBA 3GIVA 3QNZA 3RFZA 2CR3A 3R1GH 4YEFA 3JQOB 1MW0A 2P8PB 2XN9D 1F58H 4PJ7F 3IMRA 4OZFA 2FQFA 4OKDA 4IU3A 2X1QA 4B9PA 1LP9F 5CLWA 2PYEA 3K4AA 4N2HA 4MJ6A 5TF0A 5E7FA 4P4RB 4TMPA 3WJMB 3LEVL 4Y19E 1KB5H 1TMCB 3D2UB 4DZ8B 3D8MA 2DV6A 4QPEA 4AG4L 1FO0H 4H2AA 4ECNA 1P4LB 3NFPA 4XBPB 1CE1L 3L8QA 3E6FB 3UC2A 2OSWA 5E2WL 5I1HH 2QQLL 2AMGA 3NSXA 2E6JA 2QQKH 4D8PB 5C3IA 3CIAA 2NUTA 3PAYA 3GSVA 3IJHB 2ZPKH 3SO3C 2B20A 2V2WA 1FNSH 1WJ3A 2WLZA 2M1KA 4AVIA 1G9NL 1I7RB 5LUMA 5AB9A 2VW6A 4UDTB 4HIXH 2UWEB 1F13A 4K9JA 5DD0H 2YQ3A 5F9AC 3SODB 1MJ7H 2EYRA 4YXLH 2Z31D 3CX5K 4ODSL 2OMZA 4RMVA 4KV5E 1V05A 3UACA 2ROYA 4X7TB 4WNSA 1K85A 2MIZA 4P57A 5HYSG 4NT6B 4DGVH 2WVUA 4AM0Q 3SPGA 2XKNB 4ODSH 3CC5A 3M1OA 1NGPH 3ZTCC 3G5XB 1KTRL 2DQJH 3DETD 4MTMA 3DJSA 3EYSL 3TU6A 4DK6A 1IC0A 1FHNA 1QFPA 3LXCA 3MLTB 2A9CA 2GW5A 1URIA 2AANA 4NPYA 1I9IL 2YD1A 5F9WB 4B9CA 2C3GA 2NNRA 4OAWB 4GKZA 4QUOA 5CJXA 3B5GA 3BIKB 4FRWA 4BKLA 2EO7A 4PBWD 3U9PL 2JVUA 9CGTA 3LNIA 3UO1H 1RZGA 1V3JA 3D18B 5D5MB 3CSGA 4PJFE 3UXFA 1NM9A 4R97B 2VWEE 2WKLA 4YX2H 4U1SB 1UJ3B 3HG1E 1AOHA 1UOKA 1VPOH 2ROXA 2AAAA 4LRNH 2J8UB 4X7CC 3KVDD 4LEBA 5DRWA 4EUPB 5I8OH 1ZKAA 1AQHA 1AGEB 5LNGA 5D2LF 4NO0A 5HHVH 3EGXA 5EC2B 3TH2T 2OCJA 3Q06A 4ONGL 1L5GA 4FFTA 2VAAA 4GAYB 1TT6A 3WNIA 3GI8L 5LGKA 1JRHH 5HHVL 1F3RB 3CZKA 3QQ9C 5ERWA 3N1FC 3U36A 4LRIA 4NENA 4PV9A 5DHMC 2ZCKH 1YNKL 2YIHA 2ARJB 4PWEA 2PCFA 4MCNA 5DHVH 2DD8L 1TJGH 3LY6A 5TF1L 4KQ4H 1FG9C 3RHWF 3RGVA 1J1OL 1EV2E 2A0LD 2NRDA 1N4XH 3T6QC 1KJ3L 5C08B 3HE6A 5HHME 3GEFA 1IT9H 4TNVK 4XVTH 1OGTB 1SY6A 4W9JC 2NCMA 2WKOA 2YA2A 3OKKB 4GW1A 4P5RA 2EUZA 3V6OC 2V17L 5DTFA 1J8KA 3MJ9A 1FVCB 4NC2B 4OZIE 1RJCA 4M8RA 3BE1H 4WI4A 3QZWG 1UA3A 1F6LL 4P5TC 1KGCE 3K5SA 2P42B 4AYDC 2DMGA 2LFGA 1ZLWK 4NI6A 5C9JA 4DN4L 2O61A 5L2KB 4TUJB 1FZOB 2ATPB 3TF4A 4AQ1C 5D1ZA 3TZVB 2HFGL 1MF2L 1UH4A 4MDIB 3T6VA 5HHQA 5JW4R 1FNFA 3QFJE 5F88A 1BQHG 3MJWA 5I6NA 2FWLB 2CHWA 5J9PA 3UFIA 3GB7A 1GOHA 3QHZH 1YN6A 3FZUD 2J88L 1O7DC 3II1A 5L6YL 4WWKD 1BLIA 4BSJA 4IGBA 4OZ4B 1Z5HA 4TTDC 1HL4A 1RJYA 3WTVA 2OZNA 5G4NA 2K4AA 1Q8MA 3QQ4A 3FUEA 1WBXB 1M7XA 3QHZL 4NHCL 5E0QA 1OGPA 2AQPA 2QGDA 2XNAA 4UT7L 4N2LA 4N6RA 1AGBB 3CQQA 1BQLL 1MAJA 4LVOC 1U9KA 4CMMA 4PB9H 1T83A 4HJGA 4J3XA 3LH2H 4IBSA 4AIZA 5A1AA 2QJDA 5HI3C 2Z7UA 4PGCA 4IMLA 4GUCA 3NG5A 5G5DA 3HG4A 1NMAL 2CKBL 3WIFA 4NZRH 4EIBA 4CILA 4IIQC 1EJ8A 4ZNEE 1HU8A 1JGVH 1PFOA 2H3NB 4M03A 4WHYG 5KG9B 4UT6H 2K4WA 4HJ0C 1XSJA 1N5YL 4ORZC 1M2VB 3FPXA 4N2MA 4WO0A 3Q6GL 4FE9A 3AABA 1ORSB 2QSCH 3EYUL 3HHRB 3DX7B 4MBRA 4PB0L 4UT6L 2N01B 1TZ8A 3IU4L 1GY2A 1JZFA 4ZUVA 1JVKA 3N9GL 1LEGB 2XWCA 1MCWM 2K6ZA 2WBKA 3LRGA 4NRXB 2IC2A 2MNUA 3FQXB 3L16A 4PB0H 5ETUB 3CLEH 3BKML 5CNHA 8PAZA 3HKFA 2ZJSL 1HNYA 4ABWA 3T2OA 5EBGA 3O9WD 4O4YH 4DVBB 4U31A 2QKIB 1BFTA 3G5ZB 4EZLA 3K6SB 3WHXA 1K6QL 4MNGB 4BGLA 4G8IB 2X4RB 1K5NB 2BNRE 4N68A 5IB1A 1AMYA 3Q3GA 5DD5L 2QTEA 2FCBA 4N24A 3NIDB 2WWOA 1QBLL 4OB5H 1HDMB 4UT9L 4XMKH 3LS4H 2IVFC 4X5RA 4ALAC 2DOCA 3ARDC 4DGYH 3MPCA 2EDDA 3TCLB 2CKBB 2AHIA 1S8DB 3SCMD 5ICXB 1O9WA 3BQUC 1MCBA 1G7PA 5CEYB 3W0WB 4XMWA 4GMSL 4UAHA 4OM1H 4QJ5B 3FO1A 1MJJA 3SBQA 3FQ4A 2EYRB 4UV7H 1MCJA 1XEDA 1XL6A 3VXRB 5KJ7E 3AQXA 3FT2B 2IADB 1HL9A 1T7VA 4P46D 3INOA 5F97E 4DGIH 1DYZA 2F74A 2VDLL 4I85A 1UZ6F 1UA6H 5CUSL 2CCVA 3K72A 4CC4C 3KXFB 2DWYA 4YDIL 2JJVA 3EYQC 5TH2A 1RERA 1TEYA 3EH1A 2A38A 5DZ9A 5DJDB 2FVNA 5DZJA 1D5ZB 1QLFA 1Q0XL 4IIZA 5F6HI 2YBGA 4NP4H 4PJHA 3EGSB 3NSFA 4P2RA 4N90D 4QT5A 3I2CH 2WXMA 4M1DH 4G8FB 5DEGA 5DJZB 3H8NA 2NY5C 2R0ZH 4WNJA 4OAWA 1DQML 4KJPD 4H25A 1NGYB 1AE6L 2Z35A 2OULB 3ASNB 3PNWB 3BIBX 3WLBA 1M1XA 2EXTA 3MV01 4K7FB 4RBPK 3T0BA 3MOAH 3O3DA 3A4FA 1BIIB 1A6VL 2D0FA 1T03L 1NCAH 2CBQA 3QDGB 4LGSB 5A43C 1KIUB 1D9KA 2PWDA 1XH3A 2ZXBA 5HHXL 3LV3A 1BVOA 4U0QB 5D9SA 3JTTA 3FH5A 4IOIB 1OCRB 4MJ2A 5DUPL 3HUJE 4DZ8A 2KPWA 1GGCL 1CO1A 2Z4QB 4B95C 4HUVB 4JO4L 4POZC 4AGQA 4CU7A 3QHFH 1CD1A 3OQ3B 4NRYA 4S1DD 5CEXB 4NO2B 3MUHL 4WWKC 4U1NB 3O3UN 4HD5A 5LCVH 1GOGA 3MV7D 1SPDA 1I8AA 2EDFA 3G5WA 1BZOA 2XU9A 1KLFB 5F7EH 4L37B 4EIZC 2HZHA 1A02N 2PNDA 2JB6B 1GMIA 3S98A 1M05B 5D1XD 3VUAA 3QUZD 4O9HH 2DY2A 4ZOBA 4O58H 4WI2A 2YN5A 5JQ6L 3FQNA 5J11C 1HSAA 4W81A 4NSKB 2RACA 5C71A 4NQSA 4GEIA 1KDJA 3QXTA 1MELA 3LZOA 3ULSB 5T3ZL 3HC3H 2Z7WA 4NN5B 5GPRA 3KPSE 3KW8A 2B3RA 1IGFL 3LQZB 2JELH 1S7RA 4G7QB 3FSOA 1KV7A 3F6JA 1RSYA 3D85A 5D7SH 2VLME 2WO3B 5DJXA 2N3JA 1FAIL 5L0QB 1J10A 2R1WA 3MLWL 1A6ZA 3RDJA 4X80L 5I1CL 1H9DA 2Z8VC 5MENE 1XF5A 4NNPL 3MLVH 4FOMA 3GB7B 3ARGA 2P48B 2LAAA 2Z64C 4KO7A 1E5BA 3TNMA 3QDJE 4BA8A 1KIQB 4KVPA 3FN9A 1NAKH 2OJ1A 2X0UA 4KJWC 3U1PA 3L3JB 2WTRA 4Y5VB 4R26H 2I60H 2MTAA 5K9KB 5D1QA 5LGHH 3VFUB 1JGDB 1PGRB 1A7NL 2ETWA 1U42A 5IJDC 1OAUL 4PSPA 4N0YL 4W93A 2YAQA 3OJDB 4BZ2A 3D50A 3II2A 3RE0A 3CN2A 4X5PA 4XI5C 5D6DC 2JH2A 3N50A 4MA8H 1I7UA 1MDAA 3D87B 3VTMA 1SHXA 4BUGA 4HUWB 1A7RL 4UQ2A 4PS7A 2I07B 2WV3A 3TBWA 2ESVD 3QUXB 4Z7VE 2H3NA 3HJEA 2X4SA 3V4PH 4JY6B 1A4CA 2YD2A 4MXVE 1NCJA 5DI8B 1HHJA 3RIAF 5KAQG 1LGVA 4H0GA 5FOBB 4XBPA 5J6HB 2P7TA 3MRDA 3ZR5A 1FCCA 3GBNH 2WSDA 3QO0A 1U8JA 3VGGA 1CVRA 3RIFK 2NY2D 1IEBB 5K1NA 4G42B 2ZKHH 2KI6A 4GKNA 3QIUD 2WBWB 4JFFA 1S9KC 3WENA 3OZLA 5IJVB 2DLFL 5F1IB 4JKNA 2NXZD 5EZOL 4MD5A 3X1GA 1WEJH 1WDAA 5CLXA 5KN5B 2CLRA 4B3EA 3B6SA 1XEUA 5KVEH 5ILTH 4EN3A 2DI7A 3M1BA 2PP9A 3H3PL 4LSPH 2IGFL 5L9DH 4LNRB 2JJSC 4NUPA 3KMDA 3NOIA 1T1ZB 5J9PB 3NJLA 4ZS6D 4JGNA 4G8GB 1BJ1H 1MQ8A 1DQDH 4KY2A 2VXVH 5CJOH 4QRBA 5DYOA 1I1FA 1XD0A 4OLZL 3FTZA 2J20A 4JFYB 2CHZA 4B9GA 2EE3A 1E4JA 3FRPB 1FH5L 1MJ8H 1FN4B 3V2AR 3CUPB 3AG2B 1JHTB 4WCYH 5F3HB 3VFPB 1ZDSA 2IDFA 4GINA 1NCCH 5CXPA 3FQWB 1NBYA 1XCXA 2OMYB 4PJHB 4LFHD 3UAJD 2V7HB 1A3QA 5IW1A 3UO8B 1A1MB 2H6PB 1JZ2A 4YHML 3M17A 2C7UB 3KL3A 1RLWA 1DUZA 2EDOA 1QRNA 2Z7YA 1NGYA 5I75C 1E9PA 4FQIL 3QXDA 4OVUA 1P5VA 3MROB 3QORB 5IQOA 2I85A 2BHFA 1I9RH 5C0BD 3DUUA 1ED3B 1ZMYA 1GMEA 3KPTA 1YQVL 4U1JB 4X8XA 5ERWB 4PJDB 4Y4FC 3ETBJ 5ES4B 4HW6A 1F02I 3LSOA 1UURA 5BRZB 3RDTC 3QYNA 3V95A 3R1GL 4GSXA 5DJ0B 3EH3B 3LKRA 3IGFA 1XT5A 2M26A 1FNAA 1YA5A 2JIXD 3LOWA 3RTLA 4KPHH 5ID0B 1TO5A 1PZ2A 3FTYA 4L8BB 3UAEA 1T4WA 1DVFA 3DX6B 4WI0B 1JYNA 1FL5B 3MA7B 3MBED 4X99A 4JGJA 2WXLA 2R2BB 2EE6A 3OR6B 5AW4B 4F58H 1DZBA 5F9WC 3ABKB 4MDJB 2AEWA 1NFIB 1MG3C 3EXLA 4CJ1A 1ETB1 2WWKT 2DQTH 3BP5A 1MJJB 1TYJA 3A4EA 4YR6B 4J5VA 1OM9A 5IVXB 3GXUB 1ZLWH 1DJWA 3RVUD 4XVJH 2Q76B 2PWFA 4NJAL 2H2PC 1A6TA 1I82A 1NLDL 25C8H 2HX9A 3FT3B 4QXUL 4R2GC 5D93B 2NW3B 1T0PB 3B2UC 5ESAA 5AL0A 3RL2A 4MSWB 5FO9B 1OXYA 4I18A 1KCSH 4WJ5B 5KVMC 4KROD 1A64A 2YMXH 5FYLH 3FO0L 3HZMA 1QO3B 1YYMH 1OE1A 5IW6A 4KJYB 4X6EB 2DPKA 4YHZL 2W9EH 3RWFB 4MAZA 4ZMNA 5HHNB 1EO7A 5K33A 5C08E 5FF6B 4IBTA 5IHWA 5TFSL 5KSAD 3VQMA 2QSQA 1XF2A 4FA8A 2LLGA 3FS9A 4NM4L 1VSCA 3VQ1C 1A66A 5JR1H 1BF8A 2DQJL 2FWSA 4K5LA 4FFYL 4K55A 5I0XA 1ZY9A 5IHZA 5FHBL 4LQFH 1IARB 3OSKA 1JXGA 4P2RD 2NY0D 1QFWI 2CM6A 3SE3C 3HE7B 2VW4A 1CICB 4ZFGH 4GQRA 4PWJA 5CZXD 4Y5VA 2FZ3B 3AJ7A 3DJZA 2XQBL 3ESOA 5B38A 5IR1A 1LO5A 1JGEA 4PP2B 3L3IB 4EDXB 1I1CA 2AJSH 3IFNL 2CDEB 2EEAA 4XBGA 1SJMA 2TAAA 3DO3A 5FCSH 5HD8C 4PCKA 1IVLA 1B4RA 1N9PA 2IFFH 4D9QE 1BOGB 3BAXA 1QACA 4P0DA 2HG0A 2N1TE 3WMSA 4K9EL 2B16A 1KJ2A 3FTWA 1B3IA 4UIMA 4ZNEA 1PNDA 4KWUA 4AMKH 4GLRH 4HSAC 2ORBH 1MFEH 2AJVL 3LXAA 3QXWA 3IDYB 5J1SC 5GGVY 2OW6A 4FHJA 2E6PA 1T2JA 3KLAB 3CZNA 3I3DA 1C5CH 3MV7A 3S96B 3CFDB 3O41B 5HI4C 3LPPA 4OJYA 1KGJA 1RULL 4A2GA 3F01A 2WZAA 1HOCA 4Z7VB 5K5YA 2R59A 1F8TL 1G7LA 3QDJA 4QEGA 2P44B 5ICXA 5DLLA 1A4JB 4O2FB 4NZTL 5DFAA 5AG8A 5JOPD 2DWEB 4LPTA 4CVZA 5DMYA 1H3VA 1MJUH 5ALCH 1IT9L 4ZO8A 1ZLEA 2X4OA 3NCYS 3SKUD 1D7BA 1IKFH 5TK2A 2CLRB 3WIHH 5GSVB 2OTWA 5JYLA 3VWJD 1F3JA 2YKLH 3QIWA 2P8LB 3CXHJ 4IJ3B 3KNBA 2HLEB 4FKHA 1UASA 1AQDB 1E2WA 4ZS7L 1CE6B 4Q52A 4JVWA 4FJYA 3UTSB 1GAFL 5CBEB 4HIHB 4YHLL 4Y16D 2DJSA 1UXMA 1FZJB 1WZKA 3WN5A 1NSNH 3TBSB 3UBFA 3ZOAA 5EMYA 1EJOH 4BFJA 5IOPB 2X9XA 2PCPA 2DQIH 3KGTA 3U2SA 1F58L 5G4MA 1H5BC 3QJFB 4Z7UA 1HS6A 1L3NA 3CLWA 3CZFA 5EU6D 1OP3H 5B39A 3LEVH 4URKA 5C6WH 4Z3IA 5D1QC 3SDCB 4Y1AE 2ZXWB 4PJDF 5IREA 3K6NA 3D07A 4M7LL 1JFQL 5FDWB 5HYFA 5DK2A 2E7HA 2F9BT 5J0BA 5JHDB 4JM2A 2BDNL 4K15A 3E6HA 2ATKB 1ZT4A 3MREB 4RMTA 2YQ2A 5IOKA 3AWEA 4MAYC 2ZP0T 4BFGA 1ZTMA 2ZX8A 4UINL 4D0CA 1HHJB 1UACH 2FEEL 3B5TA 3KHOA 3QHTC 5I1HL 3O6FC 1U8HA 4LBEA 2ZSWA 4CADA 2ZXAA 3VI4E 3PRZA 4L1HA 1G84A 2YQGA 2HKHH 5I1DA 1UENA 2GUOB 3ZHNA 4F7CB 1WTGT 2ENJA 2ZPKL 4BQ8A 1DSWA 3EDDA 4AK2A 4NFCA 1X5HA 4NJ9L 4LVNB 1IEBA 5IMMB 2Y69B 3GINA 2FO1A 1L3WA 4J6RL 3MTXA 2VDKL 5KYYB 1IM3B 3MA9H 5EU7E 1A9BB 4FZEH 4P3WA 5I16A 3HVNA 3GKZA 3S97C 4BGDA 3SE8L 2ILLA 4JPQA 1JI2A 2ZKYA 4R4FH 4HULB 2ZNXA 2D4DA 1HHIA 2NZ1A 4PLJD 3BWSA 3RGVC 43CAB 4DO6A 2VLJA 2ZJSH 5CGMA 4AC2A 2OAAA 3QIUA 3K46A 4L4TA 2XVGA 3CFUA 4LP4A 2B15A 4HXBL 1NFIA 4KZDH 4JFXA 4WK4B 5C7XL 3OF6A 2E9WA 3WIIH 1FLRL 2VXUL 1MNNA 2XG5A 5IVXA 1QFWM 4ZFQA 4WI7A 4KFZC 4M62H 2FECI 4DPBX 2YPLA 4HJIA 2YEVB 3EAKA 3I6SA 1R19A 4JFPB 5AALA 1RK1A 3ABGA 3C8KB 3U2JA 2ZUSA 4NO3B 1UTDA 2Y2WA 3F65A 1FFNB 3ARUA 1HEHC 4NGHH 1OQOA 3LH9A 4PJ8B 1TVHA 1IEAA 1XXDC 2BMKA 3JV6B 3AITA 1Q9KB 4MX7A 3DX2A 3UTTE 4YWGL 1P1VA 4AT6A 2V7HA 5T3XE 3O4OC 4OJAA 4NGHL 3ES6A 3FCUB 3GRBA 3U0TB 2BHUA 2HT2C 3QO1A 2C3HA 3ZDYF 4E0RB 4U7KA 1E43A 1WWCA 1J05A 3FU3A 3QISA 3UDWA 1MHEB 5DRNA 4KXCA 4M4RA 1HKLH 5AL8A 2V37A 2NNXA 1T22B 4MJ5A 4XNXL 3CMOH 3VFMA 4KAQL 3QQDB 1N12A 4X4XB 4XN9A 5A7BA 4H20L 4LASL 4OCXH 1HQRA 3EYVA 2OYMA 4X42A 2UVEA 1GW6A 5IB4A 3VWKB 1CDCA 3R4RA 4HD9A 4K0OA 2NZIA 5LBGA 5D71H 4P8QA 3S2CA 1KJ2H 4FNQA 1OVZA 4IIQA 3B1UA 1BXUA 5LHDA 4Z76A 2KLTA 4YJZL 1CFVL 3GK8L 2X4TA 1VF5C 5ENWA 5EUOE 1SYVB 3S5LA 2H1LM 3ALXA 2H47C 3BQUA 3KCWA 4JM2F 5LDUA 1OGSA 3CC5B 1Q4NX 1NGQH 1ZCRA 2BY0A 2D7QA 4YK4B 2MCG1 4M8VA 1GGCH 4JO2L 3TEXA 3EO0A 4M9PA 2OTPA 3GSVB 4KU1A 3M86A 5GISL 1P5UB 1HH9A 3UTSD 1TPXB 3DGCR 3QPKA 1CB4A 3BFQG 3INUH 5DJ2A 4B53A 2ID5A 2OJZH 2YD0A 1V3KA 4R3SA 2K1MA 1WVZA 3LIZA 5C0BE 1IBZA 1CLOL 5D7LD 3UX9B 4OR1A 2P5EA 5ISZD 3NCYP 2WXFA 4PRHB 3GZOA 4W9KC 4BA0A 1CPUA 2IJ0C 4PEEA 4QRUB 1YMME 3NCMA 3ZL4L 1YECH 5A6IA 1FLTX 2B4CL 1UZ8B 2ALWA 4G8GA 4Y2DB 4MSWA 3VSUA 5JHAA 3OHXB 4M43L 4PJ7B 3KLQA 3QRGH 4KK5D 3QH3B 4PN6A 4RAHA 1OL0A 1P84J 2X4OB 4I18C 4HK0B 2BFVH 4RESB 1WPCA 4Y4KC 1VAHA 5IMLA 4HCIA 4K73A 4BCYA 5C0FB 3WUWA 3NIGE 5C0IA 2AQ2A 1XSKA 2P1YA 2OMXA 5HHNA 4HSQA 1JRHI 1PJWA 2YRZA 3QWRD 3BGMB 4OFIA 2BS8A 5EOCJ 2BFVL 3U25A 4A7UA 4AKQA 3OBAA 3FRUB 4GY4A 4NCC2 4LOUD 1F2XK 1T7XA 5D96C 4EIGB 4HETA 4Z0BL 4F8NA 2YFOA 3P4NB 3WNOA 4GAGH 5IV2B 3F7PC 5EEYA 1XQ4A 1YMMB 1OY3B 1ZT1B 3DPBA 2VITB 5DD3H 1XB3A 1YN7A 3HS0B 2AGJH 2NXYB 1F6AB 1QASA 4HC1H 3OPZH 1DO5A 3IM1A 2B59A 4R7NA 1J8HE 4P4KB 2R39A 1QABA 3QNXB 2I5YL 3QRLA 4FYQA 1J88A 4C56B 3FTSA 4MNQB 5LN4A 3RVVD 5IHLB 1NGZB 4JM2B 2APWA 4HC1L 4JQXA 5JIKA 3ZHLA 3E6HB 5BS0E 3ZKNC 2X9YA 1FGVL 3I9GH 5IIEB 3ZGHA 1B0WA 3BMVA 3JWNE 2QMJA 3CJJA 2VYRE 3RWDA 4L0YA 4YHIB 2E47A 5HHQB 3VD2A 5D1QE 1E27B 3QUMH 3EUUA 2HH0H 2BOCA 1P53A 4QJ3B 2WMPA 1KPRA 3TBTB 3S5LG 3V4PL 4PH8A 1DTUA 3SJVB 2BVYA 2Y1YA 1QQDB 4AH2B 1ZA3B 1MREH 1YEKH 2HT3C 2VXSH 4W70A 4XMLH 5HGDA 2XWJA 5J1AA 3NBNA 1MI5E 2BLFA 4MNQE 2H32A 3DRTA 4JUTA 2KYIA 3SDDC 1HC1A 3LYRA 5C0CD 4ZYKB 3TO4C 1CT8A 5E6IA 2HUHA 1W91A 3CPLB 4K9EC 1E0OB 1NUGA 2VISB 2OTWB 4JKWA 2WLLB 1OF2B 3FCGA 5LBSA 3WO4C 1ZPUA 4HS6B 3B2DC 5FXCH 3SGKC 3AUVA 3VD5A 1T5KA 1NC2B 1LQSR 1WAEA 4NBXB 4TL5A 4I2XB 2ARWA 4WEUD 1T7YA 4HOWA 3O4LD 4FDWA 3TBSA 2BOBA 3LPGA 4QTHA 1M2VA 5BPPA 1HN1A 1KBKA 3SGKA 4N22A 3OLGA 4E68A 2JJUA 3P3UA 1C5BH 1E9QA 3RVVC 1TF4A 4RDQG 3C75A 4Y7MA 2CAKA 1MIMH 5HHXH 3MAWA 4FLHA 4D94A 1O9ZA 2CSPA 1CFNB 1MAML 1HE8A 4HV8A 3JTSA 3BSZH 4ELMF 5BRZE 3ZT7A 2JKNA 1VENA 4JHWH 1N2RB 3D9AL 5G5DB 3H7BB 3QW9A 2W0LA 4FQ1L 1SJHA 4Y16C 5IR1B 1QATA 2Y1VA 2VM3A 4PRHE 2FSEB 4DEPC 2F7QA 2K78A 5FS5A 3KBEA 4LDLB 1VKXA 1HWGB 4YL9A 5D7JA 5M95B 4J3OC 2CDEA 1EAOA 5EC2A 3PWVA 1IGJB 3S36L 2CIKA 3UAJA 1R0AL 4LOUC 1SF3A 2NY3D 5BUGA 1EZVX 4KFMA 4HAKA 2GEEA 3EOTH 4JM2D 5CEZD 4PJXA 5DHEA 1BW8A 1KT2B 1HX0A 1FF5A 1V8HA 1G7PB 5CEYA 3O2VL 1IAIM 3TBCA 2ZICA 4PI0A 2VL5B 3I3BA 4IBQA 1GGUA 3NIFE 1ROCA 5FM8A 4Z3JA 4JZNB 1TFHA 5D93C 4DVBA 4JFZH 5FUCC 5B3JF 4M6OL 4PJ9B 4H8WL 1YQVH 5F1SA 1W8OA 3Q3GB 4J3SA 3OZKA 5I1IH 3QSKB 4AEEA 1B4JL 3NK4A 2W5PA 4Z7WB 1EO8H 4FFVC 4Z1PA 2VLLB 1JGLL 1AXTH 2ZX6A 4A63A 1ASQA 4GRLD 3PL6A 4NWUL 1FAIH 3ZK0A 1RZJL 4F24A 3HNSH 1WLHA 3K6IA 4DEUA 1D6EA 4Z18A 1JV5A 3MBEA 3TFBA 1LXMA 1CZ8L 5AKVA 2ZAHA 3WEXA 2B4CC 5TJWK 5E7BA 1RK1B 3C8KA 1S7SB 1CICC 3CK0H 3DJ9A 1AFVL 5EOQL 2ZUWA 4K3EH 1CK0H 4FF9A 3EDFA 4XO8A 4OIIL 2V9RA 5CJXC 6FABH 4Y16A 4LARH 2I60L 1NMCC 4UZSA 3PABA 2QPUA 4OTXH 1QFOA 4A38A 2V0AA 2B7DT 1RFDL 4JPKH 4AYMC 3CN1A 6FABL 4HXAL 3NJGA 3OKOA 4HHAA 2MKLC 4PRIA 3JWNH 2HN7B 3AY4A 3D0LB 4JQXC 2YLKA 3EBIA 3VSVA 5HJ3B 2G5UA 5HGBB 4ABVA 4EZMA 1U3HA 5I1LA 1WT5C 1MHEA 5I6XB 5HYJB 3MJGX 1S7WA 3BCFA 2C8NA 2ED7A 3O6FB 1YYML 3U6XA 5CCKH 3M1CA 4MCZB 2PXYB 2XCMC 4PW9A 4DGWC 3GO1L 1IJ9A 4BK5A 4ZW5A 2GG1A 3HN5A 4DVRH 4A7VA 1I1RA 2ESVB 2LR4A 1J0ZA 1K72A 4PRPB 1OAQL 3QWQB 4EPSA 3VU2A 4LAQH 3ARSA 5I1KL 1DQQB 4A7QA 4IIQB 3ZUCA 1F5WA 1HZLA 3NZUA 4MCYA 4YHKH 1HSBA 2Y06H 4R7NB 1OE2A 1EFXA 5I6PA 1Z5LB 1OLLA 1RURH 3AM8C 3O2WH 4NO2A 2RQEA 1ZGLP 5CFAA 5IB5A 4J28A 3GXDA 4JPIB 1UWGL 4JB9L 4IGBC 1XGQA 1P7BA 4FP8H 2EYSA 5F9JB 2R8SH 2QR0B 2FHBA 5L8LB 3RVTD 5GS2D 4NKQB 1KLFA 5KZCD 1AGDB 3T8XB 2EJ1A 4FP8L 4HYTB 4DCQB 2R8SL 5A2CA 3VI3B 3EOBB 2MEJB 4OF0A 2IQAA 1QFHA 2HCZX 2CRZA 4Y5YC 4WW1A 5FUOL 1SFHA 1HI6A 3OJMB 5AKSA 2B2XH 5TE6H 4DPRA 4FFZH 4WGWB 1HCZA 2FB4H 1G1CA 4XPAL 4F2ME 4E5XA 2VXVL 4HVBA 1NIDA 3K8MA 4ZX3A 2W80C 5E24E 3V6ZA 4DETA 5FA3A 1KIRB 1J86A 4Q56A 1ZHNB 4L4TD 3ZUNC 4PGEB 5GS1C 5J6GB 4OB5L 4UT9H 4PY8J 4AQ1B 1PS3A 1S7XB 2LU7A 2ZOOA 3ARDD 4OZGA 2JF1A 5K9KA 4R4BA 1OTUD 1DDTA 4U1GB 5D1QB 3VXRA 3CPLA 2BNQA 4PP1C 2J5LC 2A6KA 2VUKA 4JHZA 3TBYB 4UTAH 1MLBB 4EMZA 1F8TH 4WTZG 1E4KA 4RVBA 5LXVA 5GRXG 2XIDA 5D7IB 3LIUA 1EK3A 1FG2A 4G8AC 2DQCL 4WEBH 1LEIB 3RAJH 3GPEA 4YOKA 4EUPH 2DIAA 5DJDA 1JDDA 1M7DA 1LO0H 2W65B 3QUXA 1QLFB 3IPEA 4MX7B 4ZAKD 1OGAE 3S36X 1ONQA 3CHPA 3L5WB 1JYVA 5CJBA 1VERA 3BSZA 4PRDA 4HFUL 1IVTA 4BFIB 2P7TB 3I9IA 3MXWH 4YVUA 5H2BB 4UV4H 2GHWB 1H9VA 4LKCB 4PJ8D 4XO5A 1Q72L 4HKXB 2HLFD 3AXIA 3Q5OA 4ONFH 3L3OA 3OXRA 4FD0A 4URTB 1H6FA 5BZWA 1AE6H 1LP9B 1TSRA 1NDTA 4K3JL 3P02A 1GSMA 1NGZA 1S6NA 1WYJA 4RDBA 1MCIA 4OM0H 5B38G 1BREA 4BZ1A 2CGRL 5E4IA 4CSSA 1AP2A 1RUKL 3N42F 2UUDK 5IJVA 2BS71 4JFQB 1HQ4B 1Z32X 3X1BA 4Z7UE 4HAGA 2PXYD 3CFBA 4U1NA 3V0VB 3T04D 4F58L 3G5VA 4OD2A 4F7PA 5I18L 5KSUA 3W39A 1M9WA 4HWZB 5SWZE 1QEXA 3H42H 5LWYH 2XIIA 4F9PC 4HK3N 4OV5B 2YS4A 1BVZA 2HYMA 1JNHB 1BDYA 3PHOB 1QQDA 1GGBL 4IK6A 4GQPH 4WWKB 2JK5A 3UBHA 2CK0H 2IGLA 3QWOB 4EIUA 1M05A 4HAFA 4JFYA 3DRTB 1I7ZA 2BRRL 4FNUA 4QXGL 1MWAB 4M61A 2OSXA 4TQEH 3UJIL 4NQUA 1CTNA 2ZXQA 2XZQH 4OLEA 3C2AL 4M48H 1NAMB 3GXIA 1SY6H 5FKAA 4KHTL 4LLDB 3M1BB 4F20A 3FOMB 1MCNA 2DQMA 2X3AA 4ESKA 4PJ7A 5EO0A 2MJWA 4YXHH 1ADQH 3CU1A 3W3BA 2Z1KA 2Q7YB 3ZTJG 1MKFA 1TTFA 5H35B 3WFCL 5DMKB 4M1CC 4EXKA 5IESL 4CBPA 3I6KB 3RWGB 1BAGA 1RIHH 2JE8A 1E4XL 3WE1A 4EJ1C 1SBSH 4EAEA 5CCGE 4HPYH 3K0YA 1RAMA 3QUZB 3S3SA 1A7OH 3ARGB 3DX1A 3MLWH 1D2OA 1E4XH 2CZNA 1BWMA 4HOMA 1A2YB 1UD5A 4OLUH 5B7EA 5IG7B 4DESA 2AEPH 4PWFA 1E8WA 5I30H 5T1LA 4HCGA 3DX0A 3V5KB 2BVEA 5AAMC 3MV9B 1I1AD 4U6XB 1I8LC 5FYLE 3VFGH 3BVDB 1LK3L 1NPJA 1SOSA 3H6JA 2B59B 1D5IL 5KVEE 1L7TL 4MMZB 3V4UH 2Z34A 1MVFA 4PBXA 1B2WH 4X5LA 4PGJA 5C2BH 1Q9OA 2X0WA 1K4DB 4NPKA 3JWDH 1V3MA 4M00A 3TJHC 2W94A 2CWRA 3DO4A 2VDKB 4TUOB 2B08A 5GGVL 1B2WL 1MFBL 2PWGA 3ABMB 2C1OA 5HY9A 5FOBA 2Y0SA 2OMZB 5GGVH 1A1OA 1IC1A 2X2IA 3TV3L 5AOKA 1QZNA 5C09A 2Q76A 4PCTA 1AD9A 5EIVA 3H2WA 4OCXL 4XVOA 4ATTA 4DFHA 1H15A 2IOMA 2H3XC 2KZKA 1J12A 4K71B 3MA7A 3FO9A 2AAVA 4I18B 1EBAA 3ARBA 1UVQB 3QJVB 2APBA 2ENSA 1WF5A 3OAUL 2WUCL 5CCJA 3HI5H 2H32B 2FGWH 3F7KA 3SEPA 3APNA 3LNGA 1A9EA 4XGZB 2IQAB 1A0QL 5FGBA 1JV5B 4PJEF 3U6RA 5I71C 2KH2B 3QEGH 4KTDH 3BP5B 4HUCA 1XF2B 2H9GA 4JDTL 2CNZA 3VDAA 5CMAB 3PJSB 4OGYL 3MRHB 4JRXE 1P9MA 1NSNL 4V2BA 1FE8L 3TWCH 3L9BA 5D2LA 2GHZA 1YSOA 4QXTB 5SV4A 5F3BB 4BM7A 3QS2A 4R4ND 2DJUA 3QXVA 2YC1B 1I1FB 3QFGA 5JW4N 2NXYC 2ZYHA 1YEDA 3S3CB 1YO4A 1ZHBA 4ZO6A 4AEFA 3VFWA 1W0YT 2ED6A 1BYPA 2QTVA 3B8YA 5DR5H 3RQ3A 3N2JA 4W9DC 4TNGA 2XETA 1FG2B 3VGFA 2WGNB 3U0WL 2A9DA 3ARTA 3FW6A 3D33A 3PUUA 4AOFA 2ITEA 3E80A 4F3FA 4OQ1A 2IANE 4AZ8A 1CU4L 4K8RD 2V7NA 4R96A 4B6ZA 1QTSA 1QBAA 1A1MA 2DQEL 3CVHB 1BXVA 1JZ4A 4RMUA 1B0RA 4HBQA 3KPNA 4ETQB 4F27A 1VFMA 1GW0A 2E8YA 3LEYH 4GFXA 1E9PB 5JPNC 1G7IA 1H0DA 1XBRA 5IGXH 3KJ6L 3MNMA 3PDDA 4Y9CA 4M5SA 5I8CB 2BINA 3Q48A 1PLAA 4P3DA 4C83A 1H6TA 3EJUA 3L3OB 5FW7A 1NLBL 2QZQA 5K69A 3KPQB 2DDQL 3RL1B 4PJXB 1HEZB 5JW5A 3CHSA 1JOIA 2VZOA 5BRZA 1PZAA 4NXSA 1NJ9A 2O6FA 2O5YL 5DWUL 2IDCA 2K8MA 2PTUA 1FNGB 3LNDA 1AACA 2ADIB 3N1MC 2DEYX 3Q13A 5FW8A 4NYLB 2XWBB 3P3YA 1X5MA 3UJJL 3N9GH 4L8BA 2B1HH 4GO6B 3FONB 1MPAH 2NY6C 4F7EA 3PAVA 1ASPA 1PG7X 3GMLB 3BT0A 1EZUA 3N85L 3CBKB 4LSVL 2Z0UA 3D52A 1WAAE 4Y5XA 2JI3A 3PDOB 1UXSB 4XZUB 3SD2A 4RA0C 4Y89A 2VXUH 1D5RA 4OF7A 3N43F 4I0KA 4YDVB 5J8OA 1A4KB 2XY1A 3D4GA 3BP6B 3MRKB 5DD5H 3SDDD 2VDPB 1UKSA 3GYRA 4C56D 2UX6A 3DJTA 4CVZB 4O51B 4OCWL 2WLMA 1K2DB 2K3TA 5HYJE 3PQYA 3BVUA 4N3UA 3Q5TA 4YIQB 3RY5A 1CCZA 4DUWA 1U3YA 3MGOB 4HJGB 2P5ED 2P8PA 4XP1L 1ACYH 1FGNH 2A4EA 3P73B 1FVEB 3NRQA 4YPJA 4MLIA 2HPOA 3Q6FB 2N56A 1Z7JA 2VXTH 4G8GD 1HYSD 2KC0A 5DK2B 2H7WA 5JXAL 1DJSA 2L7JA 2OSYA 4EOWL 1NLDH 25C8L 2AZUA 4QXUH 4AJYV 4ZG1A 1QPKA 4TNWF 1OZUA 2CA3A 1QBMH 4YHYC 4QOKB 4B60A 4N0UB 4X6CF 1RVFL 5EF0A 1M1SA 5F96H 4GXUM 4RIRB 3O6LL 3P0GB 2HSIA 1TETH 4I9WD 5J1TC 1HTYA 4NUGH 5DEFA 4I4WB 2DI9A 3LKSB 4G6ML 3K3QA 1KN2H 4IEFA 4D8PA 4FAAB 3TEZA 4NQEE 4G9FE 1JXKA 1DJYA 1KFAH 4IGBD 2R2EA 5JR1L 2SEBA 3FB5B 4FABH 5I75B 4XNQB 3QORC 1IKNA 2JMRA 3M6DA 5EU3B 4DP6X 4ODTL 6PCYA 5K9QG 4WW2F 3CXDH 3PWPE 2ATKA 1ZS2A 3DUSB 4QAMB 4MD4B 4BH7A 4YLBA 1NFDB 2AV1A 3A6CL 2OX5A 1CDYA 4AITA 2CR0A 1OHZA 2C34A 1EGJH 2GJ6A 3RX5A 5ALBL 1S9WA 1EFXB 3ZDZB 3E6FA 3LCYA 3ZYOA 4S0TD 4P57B 1ETA1 3RI5K 5IHUH 1VZHA 3JZ7A 4L4TB 2EYSB 3ZE2B 4HWZA 2F15A 4XVUD 1AANA 5GZOA 4KKZA 2YWYA 1CFTA 3BZFA 3MCG1 3R06A 3ZE0B 3U9PH 2NXZB 4JFXB 4Z7IA 5A3ID 3X11A 2C1OB 5HY9B 1AKPA 4HIJA 2WANA 2XG5B 3SY6A 3KLAA 4WGVB 1DQLL 2Z8SA 5DJ8B 3CDCA 3SQBB 5C2BL 1ILSA 1BCIA 4WW2C 1DJZA 4Y9FA 3CFMA 3FTGA 4DZBB 3IDYC 4EZJA 1TKWA 4MMYA 2NCEA 2YPKB 1KTBA 5CR1A 1U3HC 1JHKL 1D5ZA 3FDWA 1ZVNA 4JCWA 2OL3B 2J43A 3CFEB 2WIIB 3QARA 1BFSA 4P2RB 4XT1C 3UYPB 3F83A 1UH3A 2R0KH 7CGTA 2A83B 2JKWA 4GRWF 2F54D 3UL4A 5D4IA 4ALAH 2Y7QB 1PEZA 4U6VL 4YO0A 5CP3H 1M1XB 3UIYA 4Z3HA 5HDRA 1H3PH 4RCAA 2YGNA 1YEGL 2NDGA 15C8H 1DCLA 2L4OA 1L5GB 3VFMB 4FQHB 3O3DB 1UWFA 3TO2A 4HZAA 3RUGF 5AG9A 1IZKA 3ECBB 32C2B 5DVLA 1EWHA 2MKWA 5IFJB 1UG9A 3EJCA 4ZO9A 1ZGLM 5KBNC 4F2MA 2XVBA 3VFWB 1JZ8A 1G7JB 3RTQC 4U1SA 4JR9L 3PWUA 1BQKA 3QS3A 4QRFA 1DVYA 2ZX5A 1CL7L 2C3VB 2WYTA 5ID1B 4JO3H 3MX0A 1H3UA 3U7YL 2X4QB 4X4KA 2ZKWA 3MRCB 5CIPB 1J05B 1SYVA 5CZVL 1OARL 5IF0B 5I2IA 5DQ9A 5F3FA 4OTXL 4F3FB 3GC3A 4ZAKB 5A6MA 1KXVA 1AXSB 4U3SA 4L37A 4ZXBB 2R29A 1EEQA 1DEEA 4ZMYA 4I77L 4WDIA 5D2NC 5I76A 2TSBA 1AP2B 4G72B 4KKNA 1A7NH 5AAPA 3CN4A 5FAAA 2HT2D 2BSCA 3LN5B 1R17A 2WWKO 5IMOB 4J3TA 3OHMB 1GTFA 5JW4Q 2BHZA 1NUNB 3CFBB 3QK0A 3F6IA 1G7HB 3TYGH 2J12B 4HSCX 3NIDF 4YDMA 2YD5A 2R69A 3MFFA 1G9EA 3GD1C 2HRPH 1H15B 3A0OA 4HZ1A 2Z7ZA 5EU7C 3UZEA 4R7XA 4DGUA 4XN8A 4NN7C 4KTYA 3P4OB 1F6FB 1A9BA 2G0KA 2L7UA 3GKWH 2PWEA 2D3VA 3I9PA 3SQRA 4EF3A 5AZEL 1URLA 1PQZB 3P0VL 3HEIB 1I85A 5D1XB 1AG6A 3JUYA 2JLPA 3GBNL 2BVOB 4HWBH 2YZ1A 3MA9L 1II4E 2FX8L 3B43A 4R3SB 5J5EA 2P5WD 3TZVA 5TPWL 4PGCB 3GHPA 5I74C 5AW5B 3GSQB 2K8QA 1R33A 1F90H 3QFDA 3QUMA 4UYPA 3ZMRA 3N06B 2OMVA 4XX5A 4MAYA 1TVDA 5J4MA 2FATH 1K8IA 2Q7YA 5H35A 3NEXA 2RTTA 3N40P 4KK6C 4N2GA 4IJ3C 1P2CB 3BZ4B 4E9LA 1ETZB 1WBZA 4FQXD 3RZCC 2HFEB 4W6YB 4WKZA 1FVEA 1F0LA 3UTQB 2YKKA 1A3RH 4X5WB 2Q6WB 2VO5A 1K9TA 1KEGL 1AHMA 2CHXA 2I07A 3F5WB 3VTAA 1ML0A 3D25B 4AI7A 4CVUA 1GJUA 1PX4A 4YS4A 4QJ4B 1GIGL 3D12B 3D5OF 4LSDA 3BP4A 4A7GF 3RFRA 2HLFC 3X3GH 3B2VL 3G5ZA 4F9PA 4GS7B 3KM2A 3SCMA 3DPBB 2F8XC 1TJHH 5KYUB 1K5NA 2VC2H 5J6HA 1H0DB 1QZ1A 3CVBA 1U8OA 3X3GL 3NESA 4Z0XA 5ADOH 2IG2L 3ULUD 2WMPB 2VW7A 1QUPA 3NQIA 3G08B 3W82A 4ZZFA 3ZTJH 3IYLW 1X4YA 4U2ZA 5B4MC 5HGDB 1BIHA 1V7NL 4PJXE 3VRJB 1CXLA 3KPRA 4M6OH 2NY7H 5JLZA 3CWGA 3HC2A 4AE1A 4JFHD 3L7EB 4NYLA 5EPMA 4G6KH 4TQIA 5HGAA 4XN5A 3P9MB 1JF5A 3BZ5A 1RUAH 2BH0A 4OZGF 4YHIA 4YGVA 3FFCD 3UG5A 2EDHA 2WKOF 1OCWH 4OVVA 4K7PH 3PWLA 4Z77A 1F18A 5C0RL 3K71A 3L2NA 1ULVA 1RZFL 4KXAA 5FO2A 4XZUA 3EO0B 3TNNB 3ZSSA 3MBXL 2Q2EB 5I5JA 5AVZB 1CGSL 4POUB 5E5UB 2UXFA 2XPZA 3DURA 4JHAH 5F6HJ 4JFEB 4A66A 3EFOB 2FBOJ 2XV0A 2EIZA 2F8OA 4M9OA 4P5TD 5DVKA 3SGDH 1AFVH 5EOQH 2H9GB 1CG9A 3DGGA 3MRIB 3DO7B 3K6DA 4DZBA 4LARL 1OGAD 1G6VK 1GHFL 5F8RC 3S9DB 1HT6A 4ZFOA 1MF2H 4N1HB 4K07A 3RWIB 4B5EA 2E4FA 5JIMA 1QHOA 5DDHB 1CLZH 4ZMLA 1SJHB 5FM5O 4H4NA 1X5JA 2PYFA 3ESPA 3SQOH 4Y2DC 5C0IB 3AS0A 2ERJC 3HZVA 3WUWB 2BP5M 2YJQA 3C87A 1MLCB 1NA8A 4YDJB 1PU0A 4PGDB 1IV8A 1DBML 3OZ9H 2YXMA 5DEFB 3QG7L 3K2IA 3MVSA 2JJWA 3FO0H 4I5BB 3O4OB 5I1AB 4G82A 2VH5L 1QWHA 1OAQH 2V7NB 4R96B 1BIIA 1N8OE 5DMIH 4G11A 4HF5L 1OF0A 4WNQB 1QBLH 1V10A 4XNQA 3LNHA 1KXQE 2W0FB 1U93A 1WIUA 3BKJH 5D96B 5EU3A 3W9EB 3BFWA 3MNVA 5T3ZH 1JGUH 4XN2A 2OMTA 1Q90A 4M29A 4R84A 5HYJD 5INDA 2OX5B 3RA7H 3D85D 3MO1A 1CD1B 2UVFA 4E9SA 7FABH 2ITDB 1ZVSA 1DANU 4O02A 2JXMB 1FYTB 1Q0YL 1T5XB 5HHOB 2JKJA 2Y2YA 1BJ1J 5IEHA 2ZP9A 2FJHA 1N0XL 4IOFD 1TG8A 4TULH 3NJMA 2XZCL 1X7TA 4HK3J 5KSAC 5D7IF 2BZDA 1GS7A 2VDLH 4GIOA 5CUSH 3E8UL 4DGIL 3MLPA 4KOBA 1KT2A 3PP3K 2ADGB 5IIEA 1I1AA 4XNYH 1UKQA 4NPJA 1S9VA 3IMWA 5JPMB 4PJAF 4Q9RL 1WBYA 3QVAA 2WKGA 2WXKA 4BK4A 1J0HA 3UPCA 2PW2A 2YSSB 1YMHB 3VNZA 2AQNA 3GDCA 4IBVA 1OEZW 5FYJE 3OMNB 3E1F1 1M57B 2M2DA 1D5MB 3S35L 3VGDA 1FPTL 2OV0A 1TKWB 1CLCA 4H1LH 3IDGB 4QKXB 2MPAL 1KC5L 2D2CC 1N70A 3DI2B 1GRWA 2VE6A 3U30C 2V5SA 1UYWL 4U4BA 2AJYL 5FF6A 2EINB 1C7SA 2CHNA 1JPGB 2H2SC 4PJGB 2DIJA 4MNGE 3KBFA 2D73A 3RYMA 3O6FA 1WZAA 1TSHA 4N5ED 3B7TA 3LHPH 3VRIB 2AV7B 4F57H 4YEEA 4QRRD 1KB5B 1X5FA 5HYEA 3QEQB 2A99A 4FNPA 2E7LA 1MRFL 1NBVL 5T33H 3BHBB 1NKRA 2J1YA 4P9MH 2PPDA 5BQDA 4PP2A 1NIEA 3DRQB 1CDGA 3H9SA 4DKFL 2ZE0A 3VA2C 1INEL 4XBEH 2Z8RA 4XBGB 4P46B 3F12A 4DJMA 5IMKB 5CINL 1VZGA 3NJNA 4H13C 3OWRA 1F4XH 4X5WA 2Q6WA 2EUXA 4TVUA 3ULUF 1INEH 5I2IB 5IF0A 4HH9B 1D7FA 2DM4A 1UGKA 3QUHA 2I32A 2YGQA 4NB7A 1A22B 2HFTA 4XCNB 4YBQD 1SVCP 4BFRA 2F53A 3NFSH 1YRKA 4LSPL 5IBLC 5L9DL 1NQBA 4W9CC 5DD1H 3RZCA 1T6BX 4TVSa 1TO4A 4TYUA 5E6IC 2VXQL 5DUML 1Z3GH 3BDYL 5H94A 3DMMB 5FYJU 1DQQA 3ZLQC 2NR6D 5K9JL 3BDYH 4OFDA 3V4VB 1P6FA 1KJMB 4DEPB 3RWEA 3A22A 4OF5A 4G5ZH 4GO9A 1JTPA 4WI3A 1IKNC 1DJIA 2GKIA 5F6IB 4JHVA 4J12A 2XKNA 2D7OA 5KUMA 3MV11 5I8EA 2NQ3A 3CFCH 5T5NF 5EF3A 3MLVL 3EOTL 3ZDXB 1BMWA 2QADC 1OP9A 2VR8A 4HIJB 4M6ML 4X6DE 2X38A 4LHQB 5K39B 1NCHA 5C09D 1SN5A 1X6NA 2IOIA 1JPFB 3T77A 1ZHLB 2WQ8A 3IJEA 3DXAA 2XX0A 4N2NA 3PWPA 5KN5A 4MMYB 5HBBA 5HJGA 1L0YA 3BESR 3DIFA 4ZDHA 3REVA 3LZLA 3FQWA 1KXTB 3HMWL 4RGND 1LD9B 2HTKC 5B8CC 2OL3A 4WZ9A 3T09A 3A4DA 5DJAA 4PJFF 5E2UL 3PG2A 4HALA 4OD1L 5CLYA 3NSDA 4R5XA 2EDMA 1UOWA 4LCIH 2O26U 3VJ6B 3FULA 4DFIA 2IDUA 3GS7A 2VDPL 4BFIA 3QJFA 3QPXH 4Z7UB 2JCCB 1NL0H 3QIUC 4Q58C 2P5WA 4X9YA 5E5MB 1XMWA 4PS3A 4QMEA 4AUYA 1TQBC 4GLRI 1TCRB 4ZUTB 3MOBL 4IRSB 4K94L 3DHUA 1AC6A 1CYGA 3QPXL 3GF8A 1S9YB 2BSSA 2WLIA 5GS0C 2E4TA 4K23H 5F3HA 3VFPA 2XDHA 5FDWA 4HUUB 4PJDA 4UU9A 4WTQA 3VXUE 1LEIA 3BPLC 3KYAA 4OCSL 4J4PD 4GXFA 1JWUB 4NNPH 4FX5A 5EF2A 4HJJL 1CK0L 4F2MB 5FFOA 4ANWA 4ERSH 5CBAA 1FSKC 3JSSA 3MX0B 4X83A 2YPVA 5I1DB 3L5IA 1TU2A 4NQQA 3V4VH 1AZUA 1QYGH 1XX9C 5CIPA 5JIIA 5AQ0A 5CO1A 4OD2B 1HNFA 1UCTA 2KQNA 2ZOUA 1FC1A 1P7KB 3B9VA 1EBPA 2DQHH 3ILPA 1FL3A 4L9LA 4YWGH 1KMGA 1JN6B 3B9EA 4UQ3B 1HL8A 3F85A 4HKXA 3TPUB 1T5WA 1JPSL 2VDQL 3AQZA 5BZWB 3CHRA 3WEAA 3CSYA 1I9EA 5D7HA 4Z8FL 4ODHL 1PKQE 1NFDF 1JUFB 4DQOL 2BNUA 5I1JH 5GRZA 3L17A 3P3SA 3KCPA 3C5XA 2ITDA 1NAMA 5IQ7H 1WFTA 3GTNA 5C08D 3C09C 5BS0D 4NT6A 3SE4C 4RX4D 4KK5C 1R34A 4WUUB 2GI7A 5GRVL 5EG6C 1E3ZA 2CDFB 3OR6A 3REWB 4W9FC 5E4AA 2CBMA 3MACH 4FFYH 2JK5B 1WAAA 3FU5A 2RA1A 2XXGA 2GJ6D 3TTSA 1AAJA 1CF8H 4IGBB 4I89A 2BVOA 4J8RA 3U6XS 3BJ91 1HJBC 1BZEA 1D5XB 2OXGB 4AY0A 3DV6B 4GKZB 2QFRA 3BC9A 4YLCA 4XNMB 4Z95H 3SDYH 4X6CA 4S2SA 2DLFH 4KROC 3D4CA 3GRWA 1JVOA 1IEAB 2WXOA 2MCPL 2B2XL 1KN4H 3V8OA 4X8GA 2DMKA 4GFTB 3HE7A 1X5AA 4S1SH 3FOMA 5KVGL 5A40E 1A14H 1ORQA 2EDBA 4I9WE 1VHPA 4LCWB 4OKVA 5SX4I 3BPNC 4UUJA 3IF1A 3ROLB 5AUMA 3UDWC 3WXVH 3H85A 4YHNB 1QSEE 2NY1D 4X6EA 2CHDA 2QZ5A 3SBRA 5KS9F 5KVGH 1SMAA 4P5SA 1MLCA 1YECL 4QLWA 4QRTA 3L9YA 4RAUA 5IFAL 1A7QH 2KS0A 2E59A 1FRGH 1U8PA 2MH4A 4GAYA 1YNTB 3Q8BA 2WYIA 3FQYA 3SYPA 4AQEB 4Y4HA 5DVNA 2J5LB 1CGXA 1OWWA 5E03A 3SDXF 5JXEA 1LEGA 1RQ5A 3LEYL 4PS8A 4TUOA 4HGWA 4KK9D 2H1XA 4AENA 1J5IA 1JD9A 2A6JB 4YNYB 3Q44A 1YEGH 3AGWA 4G8EB 1OP5H 3QGVA 2FYVA 2GK0A 4KKQA 1MQKH 1UOLA 5D7KD 3IDNB 2X4RA 4PJ5D 2Y24A 3CFDA 4LKCA 1TFPA 1OOWA 3BQUB 2BK8A 3GIZH 3RDTD 3N91A 5I0VA 3OKNB 1Z9OA 2CNYA 2W8CA 5E6YA 5C6TH 2OI9C 2X70B 1JVLA 1MXGA 4G7YL 2ICEC 1S8DA 4JZJB 5TK4A 1HH9B 3U7YH 4IS6A 3VXPA 1L9TA 5ITFA 2XWXA 3R8BB 3EZ8A 2DBJA 4FQQA 2R2HA 1FZOA 2ATPA 2AXGB 5FYLL 3MZGB 2WXHA 5C6PB 3CFJB 3D2TA 1LDPL 2HKFH 5E1IA 1DLFH 2A4CA 2EABA 3FT2A 2IADA 3EDEA 4KXBA 2Y3AA 2X1XR 1TZOA 2VJXA 3I9GL 2X53A 1JNHA 3PHOA 2VLRD 1VFAA 2BP0B 3ULVF 4OCWH 3IU3A 4ZOEA 4WGKA 3GXFA 5FX3A 1YY8A 2BNQE 5F7BA 1G6RB 2E0PA 1SXZA 2VE6B 4PLJC 1QW9A 5C0FA 4XC1L 2BIIA 1Q9LB 4G8FA 3FKUS 4ZFGL 5A6LA 1IZJA 5K59E 3CZLA 4LCWE 5TQ2H 5ABZA 1IAOA 4EE2A 4M4PA 5DO2D 3ZXAC 4HCRL 3GWJA 1C1EH 3BOVA 3UCQA 3TXAA 2W95A 3UTSA 5F3BA 3TN0B 5JHDA 1OM3H 5TQ0L 4HWBL 2EDYA 3UTSE 2X4UA 3QDGA 2FX8H 4AYID 4DH2A 1B0RB 4AXWA 1ZT7A 1IQDA 4QCIA 1AVAA 4XNZB 5MP6L 4ES8A 2EC8A 4LLQB 3ETTA 4ONHA 3UO1L 4JN2B 4ZPVA 4M7KL 2EH7H 2YMXL 2OBGA 3QYCA 3DRQA 4JJ5B 3QJSB 2OMNA 4Y88A 4C83B 3UZQA 2AK4D 2VLKD 5FKPB 2NTFA 4HIXL 4MAYD 2FWOB 5J57B 4OCRL 3ARZA 4QRRB 5LAXA 2X3CA 4JPSA 5AVXB 3AWFA 4RH4A 4L0PB 3LB6D 2FT7A 5I16B 2YEZA 2IDQA 2ZKMX 1X5LA 2CK2A 1IGYA 4P5MB 4JL2A 4OLUL 3VFTB 5KSAB 2H4EA 2IXQB 1KOAA 1F3DH 1UFUA 3DMMA 5EF1A 2FT6A 3O4LA 3SY0A 1U8HB 1TJGL 3VXMD 2GTZA 1P7KA 2GSIA 2OCFD 1ZVSB 5BJTA 2QELA 4R7VA 1MCSA 4JFDE 1SM3H 3SJVA 4GEJA 1VGEL 3C60C 1BYNA 2C5DC 1T04B 3WI9A 1REIA 4F5CA 3TIEB 2XC8A 1A4KA 1DQLH 3RVWC 3WKMH 3CSFA 4IRJB 2D03H 4GSDL 4ELKA 1WD8A 3HB3D 4MHHI 3PP3H 1CT8B 2WOYA 3WNPA 1CDJA 2YPLB 2OJEB 1DN0B 1QSFD 1P7QD 4LGPB 4X0KB 3EXJA 3FONA 1IL1A 1RUPL 1XF3A 2EH8H 4UOJA 3D05A 5A16A 3EO9L 4BELD 1OCOB 5D7JD 3SKOB 5BUAA 1UXSA 1CFMA 1RJLA 1GGIL 4JFTA 2WC7A 4U6VH 2K9UA 1IFGA 5AOLA 1D5BB 4JKMA 1LE5A 4MS6A 3ES6B 1EEYB 4PJHF 3GZQA 4N0UA 4BDVA 2P49B 5PCYA 2WTRB 2R27A 5IROD 1XSOA 4JY5H 2ZUYA 4N2EA 3C8HA 1YPZF 2YD3A 4A04A 1JFHA 4K7FA 3L4UA 4UNIA 3WEBA 1KYOK 1OPGL 4A7TA 1JGDA 1JDAA 4HIEA 3S3DB 1MY7A 1X6LA 2YRBA 2OR9L 4LSRL 3MGTA 4L1BA 5KVDE 2MQ0A 1S3KH 1X5GA 3L45A 1A3ZA 4X9HA 5A3IC 3NJFA 4W9GC 4A7GA 2OR9H 3M07A 4IOIA 4UOQA 5AUMB 3F3HA 3MYJA 5F1NB 1NMAH 2CKBH 5AWNL 4QNPE 3Q2VA 5IT2L 1OPOA 1VESA 3TT1H 3LRSA 4M5YH 3VI3F 1S9XA 3QQ9D 2QVMA 3VXNB 1U92A 3S34L 2JNZA 2YN3A 4DN3L 1SUHA 3DMMC 1IUZA 2Z6FA 2VL4A 2L8AA 4QYOB 4RRPA 12E8L 1ZSHA 3KDMA 1OCZB 2YAHA 3IAPA 2ZAIA 5DZPA 4ETYA 2R2CA 4N3TA 4LL4A 4LZKA 4WLCA 5BVPH 4ETQA 5C7ZA 4IBLT 2WTOA 4XWOC 3FFCE 2BO0A 1M71B 4BZYA 1VLXA 3CLEL 4U7SA 7PCYA 2J88H 1NCNA 4WU7A 3HNVH 1E4HA 1N7ML 2GY5A 1BPVA 1RUQL 4JRLA 5BZZA 2XKSA 1BAFL 3VXOB 4DK3A 4XX1E 3ULSA 1UZ8A 3T9WA 5AZEH 2EKJA 1MUJB 1UGNA 2J25A 1N7MH 4TN9A 3IKCB 3SDAA 4BFKA 4ELME 4L3EA 4U2YA 5C8JB 3B2UD 5EO9A 3OPUA 2PTTA 4IHOA 2AVGA 3LNEA 4NQVA 2H2PD 5FM4A 3KE0A 1QSEA 1RCYA 4FXGB 5K39A 4HGKC 2KDYA 2E9BA 4HQQH 4TRPL 3WFZA 1HCFX 5DWUH 3EUDA 5FYKE 4OQTL 2JKLA 3WEXB 2J56A 4YPGB 4LF3A 3FRUA 4TTGA 3Q6GH 4ZQKA 5CD5D 1OGAB 4MMXB 3MRLB 3OB0K 1A6AB 2XOTA 1F86A 2LU5A 4OFYA 4D0DA 4G6AC 4AYEC 4F37F 1A7BA 2NY6B 5HDWA 4X8CA 3O6KH 2V2XA 4NO5B 1WCQA 4ONGH 4Y2DA 4P46C 4CC1A 1ORQB 3VJ6A 2CLZB 4H8QA 1RZKL 4PCSA 3BDXA 4V1DA 3MUZ1 4LLMB 2AJXH 1OIOA 4N2KA 1MSPA 2CG9X 1NGWA 3NCCB 4V33A 3P2BA 1JZJA 4FQJL 4MXWH 3MLXL 4MCZA 1NFAA 5GGTL 4MA3A 1H8NA 5ECJE 3SCMC 3FQTA 4H8VA 2DTSA 2XFXA 3Q8EA 4PJBB 3LKPA 3JVGA 5H4YA 3GK8H 3OKMB 32C2A 2VJ8A 5F0LB 3L2LA 4NHUB 4RIRA 1RL1A 2PO6D 3GZPA 1BVLB 4DP4X 2VMDA 2GJJA 4CVXB 4AEHH 5ID0A 2RJMA 3GHBL 4WTWA 2F68X 3OGCA 3ARDA 5JORA 2CCLA 5E6RB 3O2DL 1QBBA 3NEOA 2EDQA 2PLTA 2W9DH 3JV5A 3V0WL 3S37X 4AEHL 1T20A 4L2YA 3H53A 1A3LL 1YUHB 3Q9QA 1FBIH 3KH4A 2EXWC 3ECVA 3IRCA 3IXTB 3SOBL 5DK0B 2GPZA 4KI5E 5T1KB 1G9ML 4GXVH 4K7PL 5IMOA 2X42A 2R4SL 4QRAA 1TITA 2DYPD 5GXBB 3PGDA 2X09A 1S9WB 4XP5H 5HHMB 4YR6A 3S88H 5B8CB 4PJIB 1ZLUK 3VFNB 2CO3A 3SO3B 4KRNA 2EIKB 4HS8L 3T3PB 1J87A 1E40A 1UUSA 2XWEA 5GGRB 4OLYL 4PJBE 3KJ4B 2AJ3B 1FNEB 3VG9B 1HZKA 4OZHE 4FQXB 4KROB 4WJG3 1FIEA 1NGQL 5AW1B 4L8CB 3KYMB 4ZUSB 4JPVH 3CIQA 2O6CA 2FX7L 5A7EA 5I5MA 3B3BA 4A68A 3ROOA 1QLEL 4CC4A 2E7MA 5FOJA 1IL1B 4ZYKA 2X6AA 3VW3L 3OKLB 3QQ3A 4DAGL 3FZUC 3SYOA 3VDCA 3F5WA 2AC0A 3DOHA 3V10A 2WXQA 3UOAB 4DAGH 4U1KA 2JTDA 4P2QE 1PW3A 5DFWH 5LCVL 2VQTA 2C7UA 2CRYA 2AQ1A 2F7PA 2VO8A 4KBPA 5CSGA 1P7HL 1NCDH 1BQHA 2F5AL 3QDMA 1E4KC 3LN4A 3WFHA 2BZ7A 1MFAH 2R0KL 2EE2A 2L3BA 4F1ZA 1ECZA 1FGVH 1E5YA 3N41F 3PWNA 1YNTA 2CBPA 1NEZA 2E7BA 3N0AA 4R26L 1WFIA 1DVXA 1ADQL 4EXPX 4Y4HD 3SJVE 4YHYB 2Y36L 3AMLA 4XPHL 4A7SA 4RGMB 4J2QA 1EXUB 4ZJ9A 4WO4A 4XI5D 2BNQD 2YEZB 1JSYA 3NACH 3RIFF 1LLAA 3GSXA 2AK1L 3TYFB 1DVQA 1JNLH 1K3IA 4NWUH 3T2LA 2QV2A 5D55A 1OB1A 1NCWL 1OB0A 2R23A 2ZKXA 1S9XB 1XCWA 2FLBT 4LCCA 1FFRA 4XXCA 3LIZH 3S3PA 1F56A 1JPEA 2F54B 4IKKA 5DZAA 1I3RA 5KYNA 3RTQB 1KB9K 1JNLL 1A9VA 1SOXA 5E2WH 1KWGA 4KJWD 1FDLL 2Y6TE 4KZCA 4JO3L <