2Y1YA

Human alphab crystallin acd(residues 71-157)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
DRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSMSSDGVLTVNGPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of R120G Disease Mutant of Human Alphab-Crystallin Domain Dimer Shows Closure of a Groove
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords ALPHA-CRYSTALLIN B CHAIN,
total genus 12
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2010-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y1yA00
4I88A 3W1ZA 2BOLA 1X5MA 2K8QA 3GT6A 3N3EA 4YLCA 3QORB 4ELDA 3GLAA 4MJHA 1WGVA 3J07A 2RH0A 3AABA 1WH0A 4YE0A 4YLBA 3EUDA 4M5SA 2KLRA 4M5TA 5LUMA 3L1EA 2MNWA 3QORC 2WJ5A 3L1GA 2CR0A 2N0KA 3Q9PA 2JKIS 3VQMA 3IGFA 3L1FA 3AACA 3GUFA 5DS2A 3QORD 4JUSA 3Q9QA 2Y22A 4FEIA 2KMWA 2O30A 3VQLA 1GMEA 4PCKA 1WFIA 1EJFA 2WJ7A 2XCMC 4JUTA 1RL1A 2CG9X 1SHSA 2Y1YA 4YL9A 4YDZA 4PBDA 4RZKA 2Y1ZA 5DS1A 4ZJ9A 2N3JA 3QORA
chains in the Genus database with same CATH superfamily
1MHHB 1T80A 5DK3A 2NY6D 3NIGB 4FLSA 4XP9L 2WNXA 4OFIA 1O7VA 3WELA 4WV1B 1H3GA 4CADA 1W72L 4PJXE 3OGCB 3V0JA 4DP9X 2UY6B 3AG2B 4JDTH 2X89A 2JLPA 1A0QL 1OAZH 1MQ8A 3QDJD 4JO8A 4V2BA 4PJ9D 1E5CA 4O2EB 4AQ8C 1N5YL 1QAWA 3R1GH 4MXWL 2VIRA 5ID1B 2FECI 2B1HL 4I3RH 3TFBA 5CS7A 3VYPA 4QXVA 1JNHB 4PHZA 1ZAGA 2ARWA 5A6IA 5CD5D 3JTSB 1TEYA 4PJBA 3BE1H 3BH9B 3FZUC 4K94H 2QKIC 1MFEH 4TTDD 3RTQB 1A14H 3T8MA 3V0VA 1A3ZA 4N5EC 2OMWB 3HN5A 4BSWA 2UXFA 4LLVB 4E9WA 3VM7A 4MQXC 1T1ZA 5E9DE 1O5DT 3TLRA 2XC8A 5F7HA 5CCKL 4NQUA 5ITFA 3QUZB 4LVEA 4I0CC 4AE1A 1I1CA 1CFNB 1IEAB 1MJ8H 5B1CA 4I3SH 2G5UA 4WO4D 4Y4KD 2OYMA 3FRUA 2VR7A 3HPLA 5J1AA 2J1KA 3L13A 1IGIH 1NBZB 2EEBA 1OGAB 3IU3A 2WBJA 3GSRA 4Y7OC 2Q87A 1A1OB 1PNCA 5L2KE 5JHDE 1SFDA 2APFA 1YAZA 1CJYA 1MCRA 3RX5A 5HYIA 5I6OA 2ITCA 1PD6A 4ZX3A 4L4TD 3FO9A 4BFFA 4F57L 3KBPA 1ACYL 1V7NH 4PRPE 2V7HB 5C0CD 3FRUB 1IVLA 1Z9PA 1E4XI 2DTSA 1S78D 2BVOB 3HG1D 2D7MA 4JFQA 3I75B 4QRAA 2BS71 2JJTA 4X80L 1OY3B 1CGYA 5C2BL 4EOWH 2COQA 2W94A 1M2VB 3FT3B 5DVKA 3PWLA 4Z7UB 1OP5K 1U8PB 4BDVA 4EZLA 5T1KB 4UB0L 1MPAL 3KPRD 1JNLH 4L8SC 4TF4A 4UM9A 5IFAL 2IADB 5LBVA 2KLTA 4ZUUA 3ZOAA 5T3XH 5DMKA 3MUZ1 1KXQA 2FO1A 1HNFA 4I1RA 3MLTA 1HVXA 4EN3C 4JMNA 5LQBL 3SKJL 4AUUA 2GVYA 3MA7B 3N40F 4GO6B 1P5VB 3VWJA 1NA8A 2D3JA 3CN1A 5EZJA 3HHMA 4B95C 4F58H 2XVGA 2UVFA 1U8PA 2X2JA 1QVOB 2J12B 2PXYB 2YUWA 3ARDA 3VA6A 3SDDD 4DO6A 5GZNC 4XOCA 2R1WA 4WUUE 3I50H 3RWJB 3K6DA 5EBGA 2CDFB 1KIQA 1WPCA 3O8XC 4FG6C 4NHCH 4N2FA 4CNIB 4F2MB 1IU1A 2MSPA 1HSAB 2C3VA 2WGNB 2BP8A 3AMLA 3X14B 4JR9H 3EFFB 3IXTB 1QO3B 3HE7B 4DCQB 4UMSA 3TYGH 2CIKA 2Y1YA 1G94A 2AABH 4OCMC 5D1ZC 3TVMB 3A6BH 4QRSB 3CFBB 3D25B 5LHDA 3FOLA 2YK1H 3OXSB 4Z77B 3L16A 5GRZA 5A6LA 5F9DC 2FX9L 3VD0A 1S46A 4U6YA 4HHGA 5MP6L 4K5NA 1NEZG 3BUPA 2ZKWA 4JRXD 4N2GA 5AW7B 4P49A 4YXKH 5MEPB 2WLLB 5I26A 2WTPA 3O3BB 1NGWA 4LPXA 4XWGH 4ELKA 2R0KL 3GSVA 3O9WC 3JT2A 4PTTA 3FZUD 4CRPA 4QF1B 3ETTA 3DVGB 3X1FA 3NSXA 2XLLA 4PJEF 4AQZA 1E5BA 3II1A 3N44F 3N9GL 2ZPKL 3QISA 2GIXA 5DJ8B 5CFHA 2HB0A 1U41A 2R2BB 1VFMA 3IAGC 1PVHA 1ZGLB 3NACL 1L5GB 2RQEA 3S34L 5D71H 3U9WA 4PJHA 4HALA 4CILA 5HXMA 3DK0A 4WSGA 3TL5A 1A6ZA 2DQGL 2JIXD 5HHVL 5I6LA 1TPXB 2R0LL 1UM6L 4KFZC 2E27L 5KAQF 1IC0A 5I76A 1DQML 3AS1A 2APTA 2FO8A 4MKTA 4FXGB 4P3DA 1CGUA 5GHWL 2VAAA 4ZO7A 1QABA 5EF0A 1IB5A 4OIAA 3SCMA 4KKNA 5KSUB 3T08A 4L3AA 4XNXL 4L2LA 2I32A 4Z7UE 4JMXA 4F8NA 3HB3C 4J3WA 1OCZB 3RVXD 1TFPA 3CDCA 3BUYB 3ULVH 1A5FL 1KGIA 3WJMA 4D3CH 2B1OA 3EHBD 1E27A 4ISVB 2Z91A 3LEYL 3FT1A 3KZ8A 2M83A 5IFHL 1BFOB 1U3HA 4UANA 2PP8A 4PI0A 5CBAA 1UFUA 4FNUA 4OZIF 3UTOA 1A6UL 4B9FA 4M03A 4U3HA 2H6UA 5B1JC 3SDDA 3ZDZF 4KXAA 1M56B 4EXPX 2MCPL 4FG6D 3NT0A 1BM3L 2Q6WA 1MCPL 1ITBB 1R3HA 4XBEH 2HKFH 3T3MB 4EI5A 1Z5YD 2KL6A 4AUYA 4XT1C 1Q72L 3BKMH 4G6FD 3WY3A 4JKMA 4WFGE 2FR4A 1HINL 3JXAA 3WSQH 4ZK8A 1WAEA 4L3ED 4ZQKB 1GIGH 1J0KA 4PLNC 1KLGB 3CCHA 3QDMB 4L1LA 4GT0A 4ZX5A 3I9PA 4F33A 4OJYA 2QQKL 2X44D 4X7TB 2H2SD 2QT6A 3PWPE 2QELA 2BNRD 4Y16C 1P2CA 1UT2A 2OL3B 2R9HC 1UEYA 1DQVA 5L88H 4JFFE 5H37G 3P0VH 2FX9H 2G2PA 1I9RH 4JO3L 1G1OA 2XQBL 1HCFX 4PGDB 4P23C 2ATKB 2NYZA 3UX9B 4MXQC 3DRQB 4JFPA 1JTOA 3K4ZA 4MD0A 4P2QD 4YDVB 1ZTXL 4ABWA 2FECL 2BSRB 2O4EA 4BE5A 2ICEC 1M7UA 1R4XA 4FKEA 2ARJA 1K8IB 2ZP8A 3Q8CA 3LD8B 3R0NA 2VUOA 4EBQL 4ZUSB 3U0WH 1FFRA 4TUOB 3NJHA 5F9JB 2Z35A 4WU5B 3QZWA 4GQ9L 4KROC 4LFHG 2PXYD 1NBYB 3ZE0E 5A1AA 4OCYH 5AENA 4OJCA 2VSCA 2JIXA 1JS4A 4HAFA 5IQ7L 3Q44A 1X9RA 3BKCH 3JBG7 4GI6A 1HOCA 2NMSA 4P2OB 5CP7B 4LPYA 4HSQA 4NQVA 1FPTL 1J5OH 4S1SH 1V8HA 2Q8AH 2GTZA 2W65A 3BQUD 4KI5E 1A4KB 2J5LB 5GS3A 1FBIL 2B59B 1Z0NA 1HIML 4FZ8L 3TZVB 1FLTX 1FNGA 3G7TA 1AHWC 3ARDC 3N5AA 1ZS8B 3QQ3A 5GZNA 3BVUA 2ZAGA 3PAYA 4PBXA 4PJXA 5IB5A 1MQKH 4MB5A 1BF5A 4Z7NB 2Y9RT 3OC8A 5C08D 2H41A 1T21A 4NKDB 3BSZL 4LSTH 4QKTA 4LCYB 2ZUQB 5G4NA 4CGTA 3MUHL 4EQ2A 3GRWL 2QR0B 1GYUA 5CGTA 3GXIA 1I9IH 4ORGB 1A2YA 4QHUB 5D1XE 4PYGA 2ERJC 5L6YL 1WZAA 1AKJA 3SYAA 3AFLA 3ZBMA 1E4HA 4JPVH 1IM3B 5LG1A 3IETA 5FB8A 2AQ2A 4XPGL 4M56A 2KDYA 4YE4L 3P4LA 4NCDA 3PHQA 4M62H 1GA2A 1CI5A 5F1KC 2CPCA 2E7DA 1GTNA 3VGBA 2HT2D 3L3IB 4R84A 5J11C 3PABA 2HFFA 1SYVA 2YPKB 4JO2L 5DHMC 4F27A 3O81A 4NUGH 4OBRA 3MCKA 4TYUA 1ITCA 3VH8A 3ZKSD 4YHML 4WI6A 1FZKB 1JPGB 2DBJA 3O2VL 3VFSA 2NYKA 5T3XL 4G8FA 3QYNA 4Y19A 2X6VA 4HXAL 4TL5A 3B8YA 4MB3A 2LOEA 1VACA 4PY8I 1N0XL 4LOFA 1E4KA 1M7DB 2YUZA 3BQVA 5E6IB 3WENA 1MLCA 4N8PA 5EA0L 3WHXB 4IHBA 5C0FB 1YQVH 4PB9L 2CK2A 4D8PB 1YO4A 4DEPC 5C0AA 2Q20A 1CYXA 2QJDA 4NXKA 3U46A 3UO8B 1KYAA 4GRWB 4F93B 2HMID 3QI9A 2BRQA 3IDMB 2VN5A 3IDXL 3CDGA 1T0MB 2ZCZA 1RUQH 2PCXA 1F11A 3OSKA 4ZTPH 2KHAA 1J5IA 4WKZA 1DN2A 1AR1B 1IAIM 3TO2A 4ZMZA 2ZUUA 2FGZA 3GO1H 15C8L 2JSFA 1FNGB 1DEEB 4UV7L 3LMJL 2EDTA 1FJ1A 3P2BA 2IOMA 1UXWA 3EJZC 1MIEH 7PCYA 3MRNA 4WDIB 5J6GA 2WC7A 1N26A 2F15A 3K71A 4JE4B 1D2PA 5D55A 1COBA 5F8RC 3WFDH 3EO0B 4TL4A 3LIZA 5TD4A 2QADB 1QEWA 2A9NH 3C08L 2LGNA 1UFGA 3AADB 3GXMA 5EO1B 2FE0A 3BXNB 4Q56A 1MFDH 1IAOA 5DMYA 1N4XH 5IB2B 4Y4KA 1AO7B 3FTUA 3OKNB 5TFSH 4FQHB 5GRYA 2FQFA 3TO2B 2G4EA 4LLYA 2FWOB 4EI5D 3TA3B 1MQKL 3QNYA 2YZ8A 5BOZG 4KROD 2X4QA 3P1VA 2D0FA 2XN0A 2ZPKH 4JRYD 4PJHE 4TQEL 1YUKB 2WV3A 2NY4C 3O9WB 4S10A 4Y4HA 1YY9C 1GW0A 4QHKI 4FI8A 2P49B 2XNAA 3OJ2C 5FYJE 2UX7A 3UABA 3JWNG 1CICA 1G6RA 2DBLH 4YFDB 4EDXA 1BOYA 4LSSL 4I87A 2Z31C 5HY9B 5TDPB 5JPNA 3OAZK 4DGIL 4WLCA 1I3VA 1IBZA 1A4JB 1QI5A 1SDYA 5EF3A 3LRSA 1UACL 4N8VB 3U25A 2Z8VC 4X6DB 2V9UA 1GYVA 3QXDB 3RDTC 2KLSA 2FB4L 4FA6A 4HKJA 1X5XA 1URIA 5T1LD 3ZYZA 2KMWA 5DMKB 5EOCH 1ASOA 3ZMNA 4HEME 2VUKA 1E4WL 4W9HC 4LCIL 4W81A 1MLCB 4PMEA 3QIUB 2OLDA 2K7PA 3HZYB 4DP2X 3PXLA 4WGVB 1I1FB 3MRMB 5C09E 2HJKA 4YFLI 3PJSB 4TMPA 5B38A 3M86A 1SF5A 3GBNH 5EU6D 2CK0H 4ZNEA 4RGNE 3KEHA 1Z5LA 5AB2A 4GRWE 3EFFA 5C92A 4G3YH 3RJQB 3KDPB 4HBCH 1GVIA 1TTBA 3E1F1 2F19H 2HLAA 1LO3L 2HT4D 4P46C 3ZTJH 4ZXBA 5BS0D 1O7DC 5B38B 1MNNA 1SXBA 4ANXA 4LCVA 3FTYA 4EJ1C 5I8KH 1SVCP 1SJMA 2OP4L 4EF3A 2XFXB 2BFGA 1MPAH 4OVVA 1R6VA 5FYKU 5KVFH 1S7VA 2YQ3A 1PGRB 1T2QH 2GY7B 1ZE3H 5C08A 1KJ2B 5AEAA 2CJUL 4AM0Q 4KRLB 1N19A 1P5UC 3VXQA 3IDNA 1PLGH 1WICA 2ZD0A 1C08B 1HFUA 2Q76B 4WHCA 4YVNA 3VFUB 4DAGL 4JO3H 5ESVB 5A16A 1UZ8B 4ZD3H 1OE3A 3TA3A 3D18A 4Y1AA 4I2XE 2K8MA 3VFOA 3OG4B 3GMOA 3SOBL 1OWWA 4FNLL 3SODB 3V9CA 1FZOA 1U3HC 1AGDB 5T3ZD 4ONHB 3QJRB 4K3JH 4J7RA 2NW3A 5IOPB 4OIIL 1IM9D 5HI4D 3UG3A 3U0WL 3FH8A 4R4ND 2XG5B 4AQ1B 1ED3B 1SXSA 1YEFL 3RVUD 3CSPA 3QA3B 2P47B 5LO7A 3EYSL 5D1XB 5EOQL 4O00A 3O11B 5C9KA 4N1HB 1OE2A 1J8KA 1G9NL 3KJ4B 1HYRC 3HFFA 4YK4C 2DBLL 1MIEL 4ONHA 5EOTA 3EDKA 2C5DC 2C9RA 4HX1A 3APFA 3PV6B 3CIAA 4LBEB 1NMBH 2VXVH 2JJWA 2R4SL 2W0LA 2N0MA 1R5IA 3GSNL 4GMSL 4DGIH 5J9PB 2Z4QB 1GL4B 4L1DA 3ECVA 4S2SB 3TXAA 1KUMA 3UTSA 2CPUA 3QNXA 1NCDH 1TEFA 3Q6GL 4E0RB 3SDAA 2C34A 3QA3A 1FV1B 3GI9L 1H6EA 4TNFA 3MGTA 4XB8A 3EAKA 1AAJA 4ONFH 5JIHA 5H35A 3WMQA 3NSCA 4HQQL 1PL3A 2AERT 5I1CL 1I9JL 1PNDA 3F85A 4JFZH 3QT2A 1NAKL 3BVWA 3SDDB 1V54B 4ZTOH 3RZCC 1Q94A 2AQTA 4KQ4L 3S97C 1YQ2A 3BGFB 1WRFA 2KH2B 3KPSE 4PRBA 1JK8A 4DGUA 4XN4A 3V4PL 2FH8A 3NK4A 2Y5EA 1RU9H 2MOGA 3SE9H 1FRGL 1RHHB 1PLBA 2D7QA 4ODVL 5LWYH 2AK1L 1NGQH 4LK4A 1CDIA 1RJLB 3P9MB 3PGFH 5CLTA 4POYA 5C0JA 1SQ2N 1ZVSB 3DGGA 4P46D 3WDHA 1W72H 3ZTNH 4F33B 2QPEB 2WXLA 1Z9SA 3V0WL 4AIEA 1JUFB 3OAYH 3GMQB 2ZOLA 3MNWA 1I8LC 1JZJA 4R4FL 2J8UA 1R3KA 1TR7A 4GPVA 4MAZA 2A1WL 2DWSA 2HUEA 1NICA 4W6XB 1NCOA 2EYSA 1IQDB 1KJVB 1MLBA 3I84A 3N85L 4IRJA 2M26A 4WFHE 4XB7A 4F9PC 1MAJA 1LEIA 1EWHA 2JKNA 2PCYA 2HFGL 3J07A 5AKVA 5EZIH 3VFVB 1BVLB 5FAAA 3HAEA 1L6ZA 4Z3FA 2HX8A 1JWUB 2DYPD 5F21B 5T33L 3C75A 2VN7A 3L3DB 4HBQA 4RNRA 4AQ1A 3FTZA 4MJ6A 1UQSB 4NEHB 4QYOB 1QSFB 4FG2A 3V4PB 2OCCB 3VGDA 3VQ1C 3KYMA 1BF2A 5KBNC 2GSMB 1KENL 4FLQA 2OFQA 3QVAA 4XMKH 5JXED 3TP4A 2ICWB 2D2CC 4AYEC 5DLLA 3IMUA 1OCCB 2EDMA 25C8L 4XOEA 1HOCB 5CP7A 3SPIA 1BVLA 2XHNA 3VSVA 3QPKA 1D2OA 1SQMA 3W3BA 2OULB 3S48A 5HHPB 5FF6B 2EKSA 4NUGL 3NMEA 4FLHA 5F3HA 5CR8A 1M05B 4PJ6A 3GXFA 2P52A 1U91B 1ZTMA 5CHNA 4ZUVB 2JKXA 3G5VB 3GJEB 3Q6FB 4FQ2L 4QXUL 1CTOA 1EEZB 1WC7A 3O0RL 5HGHA 5EU6A 4MSWB 4J23A 4HLJA 4HW6A 4QMEA 4TXVB 4U05A 1MXDA 1IIIA 2XWDA 1D9KB 4JJHA 3FN0L 3SDYL 1J0YA 1CLZL 1ZEAL 5K93A 2FYVA 3GSXA 4KO6A 3H53A 2WQSA 4JB9H 4XO8A 5KYXA 4GUCA 5CJBA 4N22A 1U91A 2YRBA 4LSTL 4L9LB 2P8LB 2YGOA 4K3DH 1VZHA 3PHQB 4HD9A 5CKGA 3UCQA 4YIQB 2Q8BL 3BZ4B 2A6JB 4PVMA 1T2XA 1F4XL 3RUGE 1D6VL 3TBTB 3TBWA 5IG7A 4R7NB 3AQXA 4LSUL 4Z78A 2AQSA 2XA3A 3MNDA 2HJLA 5E5MA 4GI9A 1OGSA 2UYLA 1CE1H 2IIJA 2LAGB 3QHZH 2O72A 4LVOB 4HLZH 1K3IA 2JI2A 3GXUB 1CD9B 3UPCA 3LS4L 4AYBA 2CLRB 3IN2A 1DR9A 3IJYB 2WINA 1F2QA 1QTPA 1TVDA 4KVNL 3MBED 4TUJA 3N50A 3P77A 1BOGB 4OLZL 5C7XL 3GB7B 3OKDB 4UOW1 2BSRA 1ZHBB 5EC1B 1T1WA 3SDXF 5IUCA 3FB8A 2MQCA 1MEXL 3BP4B 2XKUA 1BWMA 4HWBH 1ZLEA 4G72B 5J6HB 3DBSA 2R2EB 4YLQT 4NHUB 3ULUE 3JTSA 4PJBB 3X11A 2IFGA 3WKYA 4ZMWA 1JHLL 1ZPLA 5LWYL 3FMGL 5AWNH 3BZEB 5AW4B 3LH9A 3QIWC 3GLAA 3VFGH 1DSYA 2BSEA 4JZOA 3ECBA 4NQCA 4W9IC 3V8OA 2WGXA 3NJFA 1G0DA 2AMGA 1IFHH 1NFDA 1S9XA 1WG3A 4NN5B 4Q9BA 3VJ6A 1A1NA 4HEPA 3NVQA 4RESB 1NCBH 4ABUA 2B3RA 3BISA 2VLJE 4D9RD 5AAWA 1G7LB 2A73A 2JI3A 4KPHH 3A23A 2XA8L 2XKSA 5EU7E 5KEZA 2A9BA 1W15A 3P3RA 4Z7WA 3CVDA 3MRGA 4YFEA 2FSEA 2YXMA 3H42L 1KN4H 4DEPB 2ZX7A 1G5AA 3ECBB 4APQD 2NXYC 4HPYL 1IGJA 3TOPA 1MG2C 4Y5YA 1NBZA 4Q4IA 3CHOA 4KITB 5I1AA 1VFBA 5D2LF 2NR6A 3BOVA 4K71C 5DK2B 3ZT6A 3K1KC 3QUYB 1N7MH 4A04A 4MS6A 3TGXA 5AZ2H 5BUAA 1IQWL 3O3EB 2B1AL 4LSVL 1LP9E 2BY1A 1NCWL 1U2CA 4UIMA 4CMHC 6FABH 2GJ6B 4KAQL 4ODXA 4YHYC 3GSOA 3JWDC 3IM1A 1CFVH 2VO5A 3BGMA 5K9OB 3MKGA 5CSZB 3AMKA 3ATBA 4WGWB 4X9GA 4D0CA 5F96H 5SV3A 5E5UB 3VMOA 1HZLA 2IQAB 4FNQA 5E2VL 3RVVD 4YBLC 1M7IA 5SWQA 4OF0A 3QZMA 4X7DC 5C0EA 4JY6A 1VACB 5FGBC 5ABAA 3K6FA 2SEBA 4OBSA 3O45A 4U1MA 1ROWA 3EG9A 4U1NB 5DMGC 1DUZA 5J1TC 2WD0A 5F7MC 5FWQA 4Z7IA 4KY2A 4BJLA 5ANME 1YC8A 2AVGA 3DHPA 8PAZA 2DKMA 4D9QE 1X4YA 3R4RA 5GGTA 3X17A 1O9WA 1JF1B 3U1SL 1AS8A 1CT8A 1GSKA 3K81A 3SKUD 3VWJB 2FQDA 4H40A 2RALA 1ZGLM 3TESA 2PPFA 1PY4A 4N2AA 5FGCB 3SE4A 3O2DH 2YJQA 3UBXG 1S7QA 2PW1A 2YD1A 1NOAA 4O4YL 5DS2A 1Y0LB 5GIRA 2R29H 3KYOB 4L1SA 3OX8B 4XP1L 5I6MA 3EBIA 2PN5A 3VFRB 3II3A 1XIWC 1MIMH 2OZ4H 2W0KA 3CNKA 4IEFB 43C9A 1J0JA 3FFOA 3IFNH 1AZNA 4J3OC 5A2LH 2YWZA 5IREA 2ZWZA 1ODUA 2Y06L 2MKLC 1KNOB 2Y4SA 2VERA 4JHAL 3SCMD 5CR1A 1YEIL 4X6BA 1EIBA 4RZCA 4IDJL 3CPLA 1BLNB 3HRZC 1LE9B 3M7OA 1JXDA 1TCRB 2GT9A 3LNEA 2DIJA 4TTGA 1PG7L 3GSNB 1YDPB 5BZDA 4L1BA 5I15H 4X8GA 3RX7A 1RP9A 4IEFA 1WV7T 4J6RH 1A02N 5DWUH 4KO5A 5INCA 1UKSA 2DEYX 3EJZD 3PQYE 5DJYA 1AIFB 1I7UA 3UTZA 3B3IB 1AO7D 1KEMH 1U42A 1TCMA 3O9WA 2P80A 3WKML 3HBGA 5IOPA 1JFQL 2WVUA 4FQIL 4HFUL 1RKRA 1TJHH 2G2RB 4MMZA 5DD1L 2R4RH 3X1BA 3S88L 2UZXB 1DBBL 3ESPA 1FVCA 5T5NG 4N9GB 3F05A 4QRRE 2HP4A 2WLZA 2QHLA 4CA4A 1MJUH 3ENEA 1S9WB 4MTMA 4OZFA 5IJKC 3RKPA 4DUWA 1FHGA 2Y22A 3MBXL 4WUUA 2NY2C 2FJFB 4AVJA 6FABL 4RFEB 2BCMA 4XC1L 1UVQB 4C54A 1QWHA 3DUUA 4UQ3B 5DRXB 1RCYA 2NW3B 2DJMA 5KSUA 4U6HA 4NO2B 5IFJA 3MTXA 1XAUA 4NSKB 2VXQH 1JGUH 3C6SA 4UOW0 2I9LB 5IQMA 1N70A 5DJAA 1IAKB 2VDPL 3OM3B 2F58H 4MAYD 4DERA 2R23B 4MQTB 4NJAH 4X7EC 3SBWA 2DQCH 1UA6L 4NKOB 1VSCA 2NY5L 2WM0A 4XH2B 1V55B 2AW2A 2AKRB 4FX5A 2I9TA 1RU9L 4Y2OB 4ZUUB 4M5ZL 2X1QA 3HE6C 4LHJB 5GS1A 5AVZB 3AC0A 3KYKH 4YXHH 2A99A 3CN2A 2JCCA 1TMQA 3ZT5A 1VPOH 1HAUA 4XZ4A 2JKLA 1INEH 5JUEH 4CSPA 1WGVA 3D0LA 3OQRA 1JGDB 3OXRB 3EBHA 3WAKA 1RUPH 2VM4A 1UWEH 2VC2H 3CZLA 3S3JA 1G9NH 3PLYA 4LLUB 3NPSB 4H25B 4XP9H 4NPYA 4ODVH 4HGWA 3FTWA 3HPJA 5DRNB 4IJ3C 4N2IA 5FW7A 2FX8L 5DZJA 3A4AA 4Y16A 4HUCA 3BH8A 3JWDH 1S7SB 4IRZA 4M3JA 4U6XB 4LVNB 4DFIA 3ARYA 3LRKA 4HFWB 4H5SB 4NN6C 5FA4B 4ERSL 3CH1A 2NY0B 3ULUH 2OK0H 1Q9OA 3BUDA 3HAEB 1BD2A 1QSFD 3ESOA 5HGGS 5I1CH 4AQEA 3B7TA 5KTEH 1QRKA 2OS7A 4RGNC 5D8JL 4H88L 1F90L 2DB8A 4XE0A 2EE6A 3ARGB 4MVBD 5DRWB 3A6OA 1EAPB 1IAMA 1OP3H 3KYMB 4NQCE 4F2EA 4DP5X 4OB5L 3LZFL 1T5XA 4RRPM 5MENA 4BK5A 1YHPA 1QACA 2ICWA 3UZVA 3WFBL 5IQLA 2VTFA 4PJDA 3QCVH 2MQ0A 2BDNH 4HWBA 4YHNA 2WNGA 3MXVL 3T0XA 2C3HA 3VD3A 3WE1A 4AIZA 2NTFB 2WVSA 3DBXB 3O2VH 4Y1AE 1CFSA 4J8RB 4X2UA 5GGSA 5FLVA 3BKYH 1MJUL 2AI0L 5CEXB 5GGSY 1YEKH 2OX5A 4CC1A 2DQDL 4B41A 4EO5A 3D4YA 2YAPA 3QORD 3FN0H 3MJ7B 4YDMA 3TBSB 3L5WB 1KPUB 1EEZA 1D9KD 1HESA 2R69H 4O51A 4EIUA 5J12C 3KGSA 3SCMB 4QJ4B 1JPST 5CBEB 3S3BB 4G59C 4OVUA 5DI8B 2NZ9D 3K80A 4GO9A 3ZQXA 4N1CA 1F1GA 3V6OC 3AS0A 5J1SC 3BMWA 4F7PA 4N28A 4CU7A 2IDUA 1I3UA 3GSXB 5JQ6H 1UH3A 4NIYE 4YSOA 5H37A 4PRNB 3MOQA 5I6XB 1BEYH 4X9YA 5AVTB 4RFNB 4GAGL 3DO7A 3MJ7A 4L8CB 2IXQA 1OSZA 4XNUH 4KTEL 1ZV9A 3S98A 2HN7B 2ZCHH 2OA9A 4M6ML 3GM0A 3KR3H 4HUVB 3BT0A 3EJTA 4FNTA 2CBTA 3Q5YA 1KN2L 1UXLA 4PAZA 4MRBA 4OCSH 5GRJH 5FGCE 5GRVL 3L4TA 1BZ9B 4LDEB 4NKQB 3WO4B 1CIUA 3ZGIA 5KS9E 5F6HI 1EFXA 1EGJL 1TQWA 2V2WB 3FK3A 3L3HB 3B7YA 2Q5BA 4K7PH 4B3VA 5C07A 2CLRA 5D1QA 3A67L 2ATPA 2VSMB 1EEQA 4LRNL 2VO8A 3GB7A 2ZUTA 3O4LE 1NCTA 1KGYE 3NA9L 1IL1A 4PG9A 4GQ9H 3IDIB 1C16B 4XBGA 1IBYA 1A1MA 3I9AA 5IVNA 5GGQH 3FQXB 2TSAA 3ATEA 3OLGA 1BD2D 1QSFA 5TQ2H 1AXTL 4H0LC 2XTJB 4TVPD 4ZW3A 5ITBH 1MWAL 5AOJA 4MAYB 4F8OA 1WT5A 1LEGB 4JB9L 1OCOB 3HC2A 3Q5TA 3I3DA 3WLBB 4AT6A 4HHAA 1WEJL 1KPRB 3W57A 4HS8L 2J44A 4MD0B 1F11B 2GPZA 4RAVA 5L7XL 5HI5D 3ML9A 4JL2A 3G08B 4P04A 5F7EH 1KIPB 1S2EA 3KYNA 5KJ4A 2JELH 1TO5A 4MAYA 2NQ3A 1HZHH 3F7LA 4PBDA 4P07A 4BELD 3MRJA 2KYIA 2PMZA 4K15A 4PRID 4S1DD 1E28A 4PD4K 4GKLA 5LN8A 1XB6A 2X2HA 4QY8B 4M02A 3ZTJG 4M48L 1IAOB 1RIVH 2AJSH 4IBYA 4R2GC 3Q7JA 1OLZA 2XRAL 1WFNA 5KSVB 1ACCA 2HTKD 2Y5TA 3OKNA 1OHQA 4LQFH 4BV1A 5BZXA 3IU4L 2WTRA 1KXTA 5IUSA 3DC0A 3ZTDC 3PWUA 4PJCB 1DQIA 1YN6A 5E8EA 1ESOA 3KXFE 3NIDF 4AVIA 1TU2A 5LGHH 5AL8A 1SHWA 1Q9WA 4F8QA 4L4JA 1AMXA 4FQCL 1M6OB 1O6SA 3I9GL 3QEHB 5FC9A 3GMLB 1BQKA 1QBML 1ET8A 4OI8A 2F2HA 2LVEA 2D03H 4HC1A 4JJ5A 4LNRA 4BZ1A 2OXHB 4DO5A 1T2JA 2JK5B 1CC3A 3L1GA 2NUTB 2YKLH 5DMIL 1NCDL 3PHOB 1EFXD 3WDIA 1AZCA 4AUJA 5SX4H 4AMXA 1E7UA 3AU0A 3SGEH 2BSDA 2JMRA 3H7BA 5HI5C 4KKAC 4YHZH 1T3FA 1LO4H 3MBEB 2DQCL 4J3OH 4N3UA 4Z18A 4LEXL 2D3VA 3NSJA 4W9LC 4GG8B 5FKPA 2XQYA 5DD5L 1VKXB 2FBOJ 3FKUS 2CD0A 1WBYA 1TZIB 2XBDA 2ODIA 2K78A 5E6SB 4IK7A 4NP4L 3NZ8A 2IDTA 1IM9A 3WIHL 2O5XH 1FFPB 1GOHA 4PRHD 1QMUA 4JHAH 3EOBA 3QPQD 1B90A 5E94A 5TPWH 1GAFH 1RL1A 1VRSA 2PWHA 5C0AB 1JG9A 3AQZA 4DGVH 2C9PA 4PP1C 2OPCA 4NQED 4PJ9C 3VXSB 4IGBB 1SNRA 4HIXH 2ED8A 3SE3A 3VUAA 3TVMA 2WXPA 3EKCA 3M45A 3VXMA 4F8TA 4UT6H 1R46A 2HRPL 5CJOL 4UTBL 5TE6L 2BC4A 3FCBA 3AGVA 3FQ1A 3C6EA 3E38A 1XT5A 3T4YA 1QFUH 3C2SA 3H9SA 4MRCA 4ODUB 5F6IC 5KG9B 1OF2A 4DUXA 1A7NH 3D0VB 2X4RB 4OW6A 3WYRA 5F7UA 1IRAY 3W0WA 2Q76A 3VFUA 5ITFB 5DSCB 4PBVC 2DS4A 2PPCA 3HC0A 3QK0A 5E2UL 3ZTEA 1W8NA 1MWAH 1V3MA 1LVEA 5E8EB 5BRZA 3WIFA 3WI9A 4MCYB 1B4TA 2G9KA 5TK2A 1YN7A 4QXGL 4MWFB 5DMJB 3EJSA 2BOLA 2EH8H 1X5MA 2ED6A 5FGRA 1DUYB 3QEQA 4XN1A 5IMLB 1TF4A 2EIEA 3ISYA 1MFNA 4GS7B 4NQSB 1ACYH 1V7NL 2EDNA 2ADGB 3MLYH 4G42A 4AEIL 5L4MA 2ZNXA 5IOKA 4CU8A 2WSKA 2BHFA 3SJVD 2VH5H 4FQJH 1AMYA 2NY6B 4FP8L 3ILPA 5FCUH 1A7RH 2QKIA 5ENWA 1FFTB 5FYJL 1XIWB 2KZKA 4ENEC 2OM5A 5CLWA 1FUNA 1IAII 2WVTA 2BIPA 2MWCA 3PAUA 1H0DB 1XO8A 3QWOA 3W1ZA 4PJFA 1XB3A 2X28A 4N0FA 5E4IA 2FIKA 1U3HD 3LS5L 1N3NA 1SLVA 1M2VA 1XTLA 5JHLH 2ZKXA 1JPSL 2IV8A 1WBYB 3H4HA 4PLKD 3ZDYE 3OJDB 5SX5H 2GEQA 4R3SB 4BUQA 1TNMA 1TITA 2IMMA 3DIFB 3WJJC 3B6SB 4W70A 1TXKA 5H35B 2BZ7A 5EHFA 4OGYL 5GJSH 1ZT7A 3S37L 3VU1A 4XPTL 2WLIA 4OV5A 2YAEA 1XF3A 4ANVA 4YSQA 5DHEA 4YS4A 1UD8A 4NP9A 3LAFA 3EBGA 4WI7A 4BRVA 5JR1H 1PY0A 3PDOA 3FCSB 4IHOA 1UM5H 2DICA 3BE1L 5D7IA 1P4UA 1SDDA 5JXEA 1HHGA 1VEMA 2VDKB 4UDUA 1CFVL 4PUBH 5ECGA 2Z8RA 4HJIA 2XPYA 3BMVA 3FFDB 3QDGB 1NC2D 3CFQA 4JKLA 1LP9F 1XCTA 3V5DB 4F2MA 3SPVB 5C0DB 1RUML 3VX0A 4IOFC 4DCQA 1AGFA 4K8RH 4EEEA 3ZDZE 1KBGH 1ONQA 1U4EA 2ZUWA 1WBZA 3ECQA 4PJAA 4ZXBB 4B3EA 1BJ1J 5D2LA 1TTUA 4K71B 3H9SD 4DEWA 4JKKA 3K74B 4E41D 1SLUA 2BHUA 4P2QA 4WI2A 4MCYA 4J4PC 1IC7L 2AXFA 4MGXA 3BD5A 4D94A 2WZ6A 3TEZA 4R0LB 1DANU 3L4ZA 2MPAH 2WWNA 5LJYH 3BVVA 2CNZA 5JMOC 4OF8A 3O8XA 2O5XL 5LB1A 3OWRA 1VAHA 1G84A 3ARED 3CLEH 2VL4A 1A4BA 1DVSA 3HG1B 4PR5B 2HKHH 1AGEB 1MCBA 4E9SA 4PTTB 4KWUA 2XWRA 2RCSL 3VFNA 2VDKL 3ILPB 4X5XB 3CV5A 4MJ2A 4YDKL 1R17A 3A21A 1OAKL 1KGJA 3KPRB 4Y4KC 3GDBA 3OAUH 4GQQA 4HJGA 3RGBA 5DEFB 4BZ2H 4KGJA 4NKIL 4Z3IA 3DIDA 5C6TL 2WQXA 2KZWA 3LZFH 1FYTB 4A2DA 2IQ9L 1GGTA 3GKWH 3CFDB 4Q9QL 1ILSA 4OJEH 3TC9A 4C55A 1OARH 3IGFA 2DRUA 1AFVH 5EDXA 4A2MA 5BQDA 4DQOH 4OIBA 4MQ7B 1FG2A 5SWSD 3QQ3B 1XSJA 3VGFA 4MS8D 3D5OF 1M3IA 2BIIA 4TVSa 1D9KA 4GW5A 4OJAA 2F1AA 2DMCA 3EDDA 3SO3B 3WEBA 1IKFH 1E43A 4HIJB 2CU9A 4L23A 3FONA 4OFPA 3FMGH 3BWAB 4J27A 5BV7H 3ESVF 4ZFFA 3TN0A 2H6PB 2MCMA 2JVUA 43CAA 2OJEB 3WXWL 1QRNB 4HV8A 3BKJH 2WO3B 2CR0A 4GUQA 2FL5A 2YC1A 3G5XB 4NO0B 4YIQA 1OM3L 2WW8A 3H6AA 2V2TA 1CCZA 2WWMC 3MLXL 4DZ8A 4JR9L 1INEL 1NLDL 1OB1A 2PTTA 4OGAD 3V6ZA 4NQDB 3MV9B 5ICZA 4ZFOL 4U3SA 1UM5L 4D7BA 1FNHA 2AV1B 4B7LA 2XVKA 4Y19D 3BWAA 5G2NA 1SYVB 3OMIB 4QD2E 4AYID 2YOAA 4E42A 1JPGA 4J28A 1JHKH 1U8HA 2HRLA 1AACA 3IDGB 1H3PL 5K9QI 5F1NA 4PV8B 4YDIH 4L1TA 2XTJD 4UZGA 1HZKA 4PJBF 3P77B 1YUHB 2KDGA 3T3ME 1OB1B 2PTTB 4K7PL 5E8NB 3L7FA 2ESVB 4R2GD 4N26A 2W81C 4KX9A 4N90E 1WCBA 3NEXA 1KEML 1MFCL 1P1VA 3FQRA 4MCNA 4AT6B 3BRDA 3O3UN 4PJ9B 4XN5A 4UOZA 3VH8G 1RJZB 3OC5A 3PXJA 4F7KA 5HYJB 1MCKA 1WZKA 3HTLX 5EUOA 4XCCL 2VH5L 2JB5H 1IO4C 2F19L 1QI3A 2Y36L 5AZEH 3HUJF 4QLRA 4KXZH 4X7SH 5DVOA 2F7PA 1QR1A 4WKZB 1JRHL 3WFDL 4I13B 2OX5B 3VXRE 2JKTM 3QS2A 2WBXA 1WBXB 4ZOBA 3S2AA 1EHLH 4ACPA 1ID2A 2AJVH 5KANI 1DFBL 4M43H 5I16B 4EUPA 2HTLD 4MASA 4QGYA 4QO1A 1LD9A 3U1SH 4KJWD 2JE8A 4YHIA 4BBWA 2FEDD 2PXYC 2F7IA 2XYBA 3F7YB 2XPGA 2YXWA 1SYSA 2CUIA 3MNZB 1JL8A 1IFGA 2FWOA 1YG9A 4Z8FL 4JREB 4JM2F 4KH9A 2WJ7A 1UHVA 4A2FA 4XPFH 1CDUA 2IFFL 5CU5A 2F8IA 4ETYA 4MXQD 4QEGA 2NY4B 3DYOA 1VCBC 4NKDA 2NCEA 3Q1SL 5I30L 3FQNB 1MF2H 5TDOB 5EOQH 1UB6B 3WAJA 4JZNA 1JZDC 1A0QH 1OAZL 3DXAD 3PS6A 4X4YB 1NBVH 5DUBB 4N5UA 2VDOH 3S4SG 4PJFE 1OARL 4A7SA 5F1NB 3M6DA 4KI5C 3BVDB 4I3RL 3IETB 4D0DB 2R9HD 3L95A 4DKAA 5EC2B 1HXYA 2SEBB 2XZQH 2BRRL 4ALAC 4G1MB 4IRZH 4N20A 3LVTA 5KJRL 3WD5H 2BJML 5DGQA 3DURA 3W0WE 3GSUA 1TQCB 3OB8A 4K3GA 4PJ8C 1U3YA 1IGYB 3NJLA 1KCUH 4XBEL 4YPGA 3SDCA 5FECB 1K5NA 4JZJB 3GHPA 1SOKA 3Q9PA 5JW4M 2EDRA 3TN0C 3C8DA 5D8JH 3ZTCC 3K6IA 4GRLA 1Q1JH 4MX7A 4FTVA 4OCRH 4UMGA 3HNSL 3AG1B 2NNFA 3MBXH 5FFLA 5L2JA 1X5ZA 2VLRE 5ESQA 5I66B 3UBHA 3RFZB 1EUTA 1WAPA 5B22A 4HZLA 3O2WL 5GGVL 1FN4A 4FABL 2GI0A 1HHIB 3X11B 1CBVL 3SPHA 3P3UA 2MH4A 3ECWA 1VDGA 3STZB 1NEZB 2DKSA 1U58A 4OCNC 5MHSD 4ODSH 5E7FA 1QNZH 1T0MA 4F2FA 5L8KB 1FZMA 2E5EA 1H9VA 2K4WA 1YYMH 1ZSDA 2ZTBA 4PCSA 4ZT1A 4XMVA 1AKPA 2N0KA 1XCQB 1KFAH 1RZJH 4AMWA 5JHLL 4CMMA 4TQ8A 1BPLB 1ACZA 2OR7A 2P46B 4XO9A 2CKBA 3GHEH 3HFMH 4WFEE 3H3PH 3B3IA 4WI0A 1YZZA 5KSBF 4YWGL 1OKEA 3RNKA 1ILUA 1A7PL 3K1DA 4XPAL 5B4MC 1AHWA 2RBLA 1AGDA 3DX2A 3G6JE 2H0EA 1ETZA 4FP8H 1F6AA 2E75C 1BQHA 1PS3A 3AVEA 4HF5L 4KK8D 3CE1A 2NUPA 5IB2A 1HH6A 3VB8A 4R2GB 5CF3A 2PYFB 3E1ZA 1IFHL 3Q43A 4A68A 1YMMD 5ES4B 5I8CA 5JHMA 4I1NB 1U8QB 4DSYA 2CJSA 3MJ6A 4RA0C 1TVHB 3II2A 4HEPG 3WE6B 4KZDL 5DDHB 3QG6B 4AEHH 2NW2A 2YXFA 3QFDB 3RILA 5TJWK 1PYWB 1WLHA 2J8OA 1Z2KA 4FFZH 5DD6A 3VFMB 3ZKNC 3ARBD 2PKDA 4F2ME 5KVFL 4M8UA 1NDMA 2DEXX 4PJFB 5FCSH 4AL8C 5JLZA 2AAVA 1PIFA 3C9NB 4NO2A 5E8DH 5FW8A 5J9PA 5KVGH 3VFWB 4FXKC 1UB5B 4AZ8B 2Y7SA 3I75A 5FCUL 5I17A 4GXFA 4YGAB 2PP7A 1CUOA 3EUDA 1E9QA 2NXZD 5BQ7B 5IFAH 1BYNA 1AZBA 2XBZA 1KDJA 2OV0A 3DK2A 4QAWA 1CLVA 2FEEL 1MCEA 4I0KA 1BEYL 4K0OA 4Y2OA 1WAAA 2C9UA 1KSRA 1I1YB 3SD5A 4K2UL 2CDFA 3MRIB 3KPPB 4OI9A 5DC0A 5HYFA 3EYFA 5CJXC 3CSTA 3MBWB 3BUQA 1E8WA 1J9SA 1SVZA 4P5TC 4L0ZA 3IFPA 2EIZB 3T6ZA 3DX8A 3VWKC 4JN1L 3ZKMD 4F5CE 3IJEA 1Z1WA 3BUYA 4LDOB 3NPZB 4L0PB 3SGDI 5FHBL 4HHWA 4GMTH 4PJ5D 1BA9A 3LV3A 5HYEA 1O6VA 3TEYA 5J3HD 3F64A 1X5KA 2BX5A 2EO9A 3U9PH 1D7DA 2E4TA 4WO4A 3QWQB 4BD4A 3U83A 2NOYA 4Z95L 4Y4FB 3MI6A 4AG4L 4YR6B 4UQDA 3UG5A 2B0SL 4ICWA 3RVWC 3L3OC 4LP4A 3QZNA 2DYPA 1UASA 3GS0A 3KWWA 4NQTA 2WQWA 4PJIB 5EIIB 5HHVH 3JSSA 2OI9C 1WIUA 4PGCB 1J0ZA 2M2DA 1B2WL 1Q9OB 1KJ2A 3CDFA 4ZNCD 3KE0A 4JM2B 3SPVA 4DN3L 1GGBH 1AG6A 1X9QA 4DP7X 2NUPB 4BQBA 1MW3A 4O4YH 2BCKB 3SGEI 1HXMA 2WXMA 1FQ9C 2Q1EA 4QI3A 3W56A 3ZU8A 4NP4H 1EJ8A 3FO1A 3KLAA 3CZGA 3ME0A 1XZ0B 1J8HD 3Q48A 1J10A 2OL3A 3JV0A 4PCYA 3VMNA 5HYQB 1MZYA 3LPFA 4Y7MA 3CQPA 5A2IH 4DPAX 4MD5A 3O6ML 4JFHE 3SCMC 3FB7B 1B0RA 2MPAL 3QC6X 3FH7A 3TCLB 4XX1G 5SWZE 3MJ8A 2WUCH 5I8EA 2G2NA 3HOGA 4M1GH 1D5IL 3U9UB 2W9DH 1GHFH 2WBJC 1TZHB 4HKZA 4KDWA 1AP2B 2GG1A 4ZFOB 1T7ZA 2Y2WA 3EO9L 5JW4R 1WITA 3L08A 5MP6H 5HHPA 5DCCA 4QHMB 5E2TL 2ZWNA 3ZDZB 5BQ7A 4K8RL 3ATFA 3ARBA 3J8F7 3ZYJA 4AI7A 1KPUA 3VDAA 3U2IA 5IJKA 3P4MB 1I8MA 1GCYA 1QNIA 3V4VH 4DKTA 1AQDB 3UCRA 3DSNA 3MREB 3GTTA 4P5KB 5FYKD 4PY7B 5DQ9B 4PJ7A 3F65A 1EHAA 3HC4H 1M1XB 3C5JB 1DQLL 4RZKA 1K4CA 5KSBB 2VZ3A 1GGCL 4H2CA 3QDME 5JIPA 5BOPA 1PZ2A 2R4RL 1BAFL 1E30A 3CLFH 2FD6L 3BRFA 3BPCB 3I9IA 4FQCH 5EORL 1OE1A 3MHZA 2PR4L 4TLUA 4Z0BL 1CXIA 4NQDD 3G5XA 4NO0A 1FV1A 5DO2C 3C8KB 2DJUA 3WTXA 4JFEE 4P5KA 4NZUH 5F7EL 4ABQA 3T04D 3WEXB 1PKQE 3ARBC 5J11B 3HMWL 2LHAA 1NGQL 3MV9A 3QUZC 4D9LL 1GOGA 1KDIA 3KLDA 5F97E 2EC9T 5E24E 4MNQE 4HS3B 1BMGA 2X5PA 1QFWH 1JV5B 4Z7OB 2VZUA 2NPLX 2NYYC 1GOFA 3M7FB 1A2YB 4QCIB 2J71A 4FI7A 4L8BA 4PEEA 5CZVL 3FSAA 3F6LA 3HRZA 4AW7A 4FADA 2IDSA 2Y7OA 5HYSB 4ZAKD 1F18A 1S9VA 5CCHE 3FFCD 5MI0C 4G6FB 3O0RH 4CKVX 2E7CA 5LBGA 2AS5M 4NPYB 1WA2X 4ZD3L 3T0EA 3VFGL 2H9GB 1B4RA 2ZOLB 4QRFA 5IQ7H 4PJIE 5CUSL 4GI8A 4QHNA 1XHHA 1CIDA 3QUMA 1DDHB 2APVA 1P1ZA 2QGCA 1MAMH 3NK3A 4ELMB 1LEIB 2H47C 2OQJA 5C0CB 4F15B 2WCSA 4IJ3B 2EADA 3VFVA 2V5RA 3WIAA 2RD0A 4QXTB 1IMHC 1P5UA 1MFCH 1NLDH 2WYZA 1YEFH 2YD9A 3RL1A 4FAAB 5C2BH 1NFDB 4AEHL 1U8MB 2AVFA 3S5ZA 4KUZL 1S5IH 4RSYA 1BZOA 4Y9CA 4MZIA 1BSIA 3MRJB 3PWJA 3KM2A 1TSHA 3T0DA 4IRJC 3SOBH 1L9PA 3BPLB 4PJCF 3DI3B 3IJHA 3D3VE 3HUJE 1IZJA 1A9EB 5LGYA 4DP1X 2ESVE 1NCWH 2Z0UA 1G87A 1MFEL 2VMEA 4EZJA 3OPZH 4RMVA 3FT2B 3ZRFC 3WLWC 4U33A 4HYTB 4TVPH 3DECA 4HF5H 2JH2A 3JWNE 1M71A 1EH9A 3T2PA 1AKJD 2L04A 1MCPH 1L7TH 1H6TA 4X9HA 2XV2A 3OLDA 2OBGA 1HXKA 4XHQA 4FFYA 1TU2B 1EEYA 4FTVE 4P46B 1QI4A 5E6IC 3WSQL 5JYLA 3PIQA 4JK0D 3NEOA 3P11H 4JN2B 4KROB 4JCMA 3SE9L 3MRCA 2A9AA 3H7LA 3MV9D 1NCGA 1LK2B 4MMYB 3CZEA 2PYEE 5I71B 3QNYB 2LU4A 4PJXF 1UXSB 2CHDA 2EE9A 4JEGB 3ZJAA 1CF1A 3OPUA 2DF3A 1K3ZA 2P8LA 2B2XL 2PWFA 3OSVA 4X99B 5ACMA 1I85A 1DZBA 3CWGA 3TWYA 1KLFA 1JVKA 5DGRA 5IVOA 3RWFA 3EOAB 4OZIE 3AAZA 2QZQA 1SM3H 4CVUA 3B34A 3KS0J 1IC5L 2YS4A 1F2XK 3WIIL 2NX5D 1FSKB 5I0YA 3WTWA 1RY7B 4FS0A 3VD1A 1BECA 4F1ZA 2UX6A 1CGXA 4LEOA 5BRZD 4OLWL 4BM7A 4L4TA 1L6PA 2WIIB 3CBKB 1TZIA 4UAOC 1OQXA 1UWXH 2MCPH 1LHZA 3G04B 5AFAA 1D5MB 3FU3A 3IDIA 2KQMA 3QEQD 4IM8A 4XBGB 1HE7A 1GGUA 1CLYL 3VRJA 1VPOL 5GIRB 4C4BA 1G1YA 3DUSB 5HD8D 1J1PL 5JZ7D 4W9KC 1T1ZB 1S5HB 4LCWE 3IVKB 5IT2H 2JKRM 2Y6SD 1FL6B 5DURB 3NGBB 3P69A 4C56D 3MV8E 4XCNB 3KXFA 3VXUA 1B0GA 3LKQA 3QWRA 5ILTH 1J12A 4MJID 4NO5A 5ALCL 4QO1B 2VJ8A 4OZHE 3G08A 7FABH 3FC8A 5IBTL 3VRJB 3B2VH 1RZGA 3D0VA 5D70H 3ZIYA 2NLJA 2FHBA 4KMTH 3FQTA 2IBZX 5CJ8A 2O61B 5D5MA 1SJEA 4HIHA 3ARDD 4P57A 5D7EA 3HC0B 4NAMA 1TYJA 5CMAA 3HI5H 4XCNA 2DQHH 4HT1L 3CZFA 3SDXB 5K39A 4EN3D 1XF4A 4K7FB 3CXHJ 1EEYB 4HUUB 4KKAD 4P46A 4ZXBC 2P5WA 4XOAA 1OAUL 2R15A 3ZYIA 4Z8FH 3QQDA 4JM2C 1MRFH 4LCUA 5DT1L 4YUEL 2F68X 2D0HA 5D7LE 1S7TB 1EAQA 3F7VA 3O3BA 5I73C 1SJEB 3DO4A 3EW3B 1AOHA 2HVKA 1CDHA 1CICD 3KVQA 3QUYA 2IJ0C 4ADGA 4JO4H 1CXKA 3EYOA 4TS6A 3X3GL 3J2PA 3GZQA 2NY3C 2ZSWB 3UTSE 1F1DA 3F6IA 3QJXA 1FGNH 2CO4A 1AZVA 5LAXA 4Y2DB 3HI1B 2DLGA 3A67H 3LX9A 5BXFB 2UXGA 5T5NF 2YQGA 3BAIA 4JHUA 4O2CA 1PDKB 1MRCH 2DQFA 4X9FA 2OXHA 4HUXA 4PP1D 1KGCD 2WHVA 3B9KB 2AEPH 3CFKB 2MHAB 3BSZH 1E42A 2EDYA 4JFSA 3RVWD 4OLZH 5C7XH 3HNTL 4FXGA 1I1YA 1QLEL 1FLRL 1I7RA 3MLZL 4XX5A 5E99H 2V2XB 4XAKE 1A7PH 2ZSVB 3LNHA 5C7ZA 4J5VA 5DUPL 3HI1A 4J3OF 4IBWA 1TJHL 3GTVA 2X88A 4U1HB 4JVPA 3V7AE 4YDNA 3HE6A 1NGZA 5KN5B 4K23H 3HZYA 4KKRA 4LKXB 5AG9A 3AJ7A 2ZNWA 1NBQA 3F7RA 3DARA 3MV7E 4UDUB 1L9OA 2AXJA 3OL2A 4F91B 2YAHA 1IKOP 3QEGL 1J5OL 3PAZA 1DHKA 4EVNB 4UIKH 4ETQA 4KXDA 2EIZA 1WT5C 3HKZA 4IDJH 4GS7C 2DQDH 1I8LA 1Q1PA 2DIAA 1ID5I 4P8QA 3DPBB 5B8CA 1C8QA 5IB1B 1ONQB 3GSVB 5DFAA 2JKWA 4LPWA 3V4VL 1NMCC 3VI3B 1IGFH 2AQRA 1CU4L 1KWKA 2CXGA 3OKMB 4KMTL 2HWZL 3LEXA 3T4YB 3GXPA 2MCG1 1XWVA 4UT9L 2Y2TA 3IKKA 5HGAB 2EH7H 2BSTB 3MLRL 1A14L 1S7TA 1KLUB 2Z8WC 5FYLE 1FSKC 3T2LA 3AT8A 3UPRB 1FPTH 1SEBA 1YNTF 1OB0A 4GSRA 5I75C 1SBBA 2BIQA 2NSXA 3WIFB 4C58B 5BRZB 3WE6A 3EH2A 5KBLA 4AYDC 3C87A 4GXUM 3L2NA 5F7LB 2OJ1A 5GSVA 1CL7H 3R8QA 4GRMA 2V7HA 2DL2A 3DRQA 2AJYL 4H0GA 5DS8A 3N3EA 3W11D 4ECNA 2VLLB 3RZCB 2DQEH 3UPAA 4YN3A 2VABA 3QRLA 4OQTA 4HUXB 2WMPA 4IK6A 5LXVA 4FG0A 4N2OA 4R7VA 2EE2A 2PLTA 5EN2A 4QHLB 2OYLA 2E0PA 4QT5B 3MRHB 3I2CL 3EYFB 3NRFA 3LQAH 1CD0A 5HVWA 3U0PB 3VI3F 3N43B 1T0NA 2ITDB 4KDVA 4LARL 4PREA 3QJSB 3SKNB 1OAQL 2FUTA 3TN0B 1YEEL 4QHMA 1OTSD 2VABB 1NIAA 2F5AL 2G30A 5BS0A 3DYMA 2IXQB 1T0PB 4QT5A 4EN3B 2FZ3B 3BN3B 1NM4A 5IK3A 1WVZA 3L1OH 3FO0H 3WNMA 4R9HA 1EHLL 3SKMB 4ZUWA 1NCNA 4MCZB 1L4IA 5HHNA 2YPLB 1I53A 2EIDA 2BP5M 5ISZB 4EI6B 1ZDQA 3PP3H 1JZ3A 1BIHA 1E3FA 2EVGA 4RWYH 3QXWA 4B5ZA 1BFOA 4LIQE 3D0LB 3DROA 3QR1A 4A55A 5KAQG 3SO5A 2BXYA 1BBDL 4Z7NE 2I07B 3QQ4B 2P8PB 1I3GL 2Y7NA 4GUPB 1ZANL 3DX9A 3FFCA 1VFAA 4UNIA 1ZD6A 3VXNB 1AJ7L 4ZUSA 1GGBL 2C3WA 2E8YA 3IMBA 2BVTA 3WMPA 1R24A 3ROLA 4QPEA 4I88A 3D39A 4ELMA 5I1GH 1S5IL 4F8LA 1OAXH 4P2RE 3ZRCC 3WY4A 4ZMVA 4NRXA 1K5WA 2VR8A 1JHTA 1MVUB 2XV6B 4MNQB 1G6VK 2D7TL 1OTUC 3ZE1B 2LLGA 1ZJBA 1E8ZA 4DZBB 4GG6A 1ML0A 1P69B 4Q2ZA 1XGZA 2JKSA 2X38A 5HGBB 3UZVB 3QYMA 4KK9D 3FQUA 1GW6A 1N64H 1MCCA 4FFZL 5IW3A 1M1XA 1GZQB 3C5JA 2XWCA 4URTB 4OGAC 4YDVA 2QVIA 2C7FA 4O9HH 3H9ZA 1BREA 1MXGA 2VL5B 3P3YA 2HCZX 5AVXB 2DTML 3OB0H 3KW8A 1KB5A 2ZT9C 1BQUA 1IBGL 4DK6A 5K9KB 3VXTB 2BY3A 3NDZE 4QXUH 1LWHA 1S7UB 3QAZC 5DUPH 1WTLA 5EO0A 4Q8BA 1NL0H 2WYIA 1DVUA 4QRRB 4DW2H 1R0AL 2J6EA 2X4NB 1QHOA 5C0CE 3RY5A 3TNNB 4X6CF 2NCMA 4XMXA 4I18B 4HBCL 2ROYA 3PABB 4X98B 3RWIB 1Q72H 3T65B 3HNVL 4JFFB 2AEOA 3EYVB 3A47A 2FHCA 2Y6SC 1BIIA 3QSKB 4MQXD 5F71A 3V4LA 4OD2B 3DLQR 3LZRA 5D7JC 3ZK0A 1XMWA 5EWIH 5GS2H 3LCYA 2YPLE 3GXNA 5C6WH 3RWFB 4FQ2H 2BHZA 1EZVX 4H8QA 1BFSA 1FGVH 3MLUH 1ROCA 4GUPA 4HUMB 4L4VE 4DFHA 3D3VB 1Z9LA 1ZIAA 2FJHB 5F7WC 1TJIH 1J1OH 3CC1A 1SF3A 4QHNB 1JHKL 3UTQA 4L9DA 1WP6A 4H13C 3VVWA 2IH3A 4MBRA 2BINA 3CHQA 5HHOD 3UJIL 4A2EA 1C1EL 2X6BA 2W95A 3NDYE 5IT2L 4PS4L 5BPPA 1MUJA 1T1XA 3KLHC 1UUSA 5J6SA 3ETBJ 5HDQH 1MFAL 1PZ5B 4PWFA 1SUJA 3UOAB 2JF1A 5E6ZA 3PWNA 4MJIB 4FDWA 5IBTH 2P8MB 2R2EA 3C12A 3DX7B 3BDYH 1X5YA 1XGRB 4MA1B 3HG2A 4XO4A 3QFJE 1HHHB 1JGEA 2BSSA 2OMTA 2AK4D 4Q6KA 1TTFA 1MCSA 1OPGL 1EDQA 3I6SA 3KYOA 4HDIB 3UO1L 5EBLB 2WP3T 2H26A 1XCQA 3SZ6A 3F12A 4GRWF 4PB0L 1R3JB 4MXWH 4DNLA 3C5ZC 4KMQA 1OAUH 5AKRA 1AOZA 4APQA 2XN9A 3D33A 1ANUA 3EDJA 3GZOA 4BRJA 3MU3A 3IMRA 2E6QA 2VITB 3MR9A 4AKOA 1C8PA 4XPTH 1EQWA 1RSYA 4HP5A 3UFIA 2NR6D 1MY7A 1J1XH 1KXHA 1QYGH 2SODB 2O5YH 4KXCA 2YD6A 3U30B 1NLBL 2EDKA 2NZIA 4N5ED 1A7QH 4XCCH 4JX0A 1JV2B 1OP5H 3EYQD 4ZO9A 4D8OA 2CO7A 3D0AA 2BNRB 3WKPA 3SPJA 3TFKC 3X3FH 3IKCA 2WYHA 5AW2B 1BGXL 3BVXA 4G6KH 4P9HC 3IFLH 3T4AC 5EDSA 3FO9B 5C0BA 1C7SA 1MH5A 3GFUA 1QLRA 3L8QA 2RGSA 4HJ0D 5CINL 4HK0B 5HI3C 1PG7X 1XF4B 2AJVL 4K7FA 2Y1ZA 5DD6B 3UAJA 2VR9A 3T2NL 1NBVL 4XVUD 2NY5C 1RZPA 3MRPA 2GCYA 2F8XC 3LZQA 3ROOA 4G9DB 4BGLA 3NTCL 4Q9RH 4IBVA 2DDQH 4JG9A 2UY7B 3KH4A 3BC9A 5SWQB 2C8NA 5D6CB 3L95B 2BP0B 3DIFA 4BHUA 3SDXE 2FWUA 1NDGA 1PQZB 4OLWH 4JO5A 4P99A 4J2QA 1LO2L 2A83B 2HT2C 5I1HL 2PYEA 1M53A 2CR6A 2J1YA 2VIRB 2PPEA 2ZCLH 2HFEA 3IPEA 3MYJA 2WXRA 1P5VA 2I85A 2ICES 2IC2A 2W80C 4ZBJA 12E8L 4P05A 3TH4T 3OTTA 3BFQG 2WWKT 4WFGD 2PXYA 1LDSA 1ZA3B 3DV4B 4P59H 3QW9A 5FOJA 2Q8AL 3CAFA 4GEJA 4ES9A 3N40P 1LTXA 4DTGL 5DA0B 4PRDA 3TIEA 4LPTA 3DMMD 2PW1B 2VW4A 5D96C 1VCAA 1NFIA 1I82A 4WWOA 2H26B 1IE4A 5FYLH 3FCGA 3PV7A 5AKSA 3ZHKA 2Q3ZA 2OMBA 4JFFD 1AIFA 2CJUH 1F86A 5C70A 5IJBC 1JPSH 3OXSA 4GFXA 1AGCA 3LXCA 2XX0A 1JZ8A 3RI5F 4DN4L 3K71B 2VDML 5EUOF 2H5UA 4W9ZA 1I8KB 2CKNA 3UXFA 1UACH 1YCSA 1Z9SB 1RSFA 5E6YA 3I3BA 1HXMB 3DDFA 1ZRUA 3FRPA 2BP8B 2GSIB 4B7IA 4JPQA 2GSGA 1AC0A 3CN3A 4NZUL 5B8CB 1BFVH 5I2IB 2D7NA 3N0PB 1L9TA 1B88A 3J7HA 2MJWA 5HHOB 1WGOA 5TGBA 2K6WA 2VERN 4DHLA 1CLOH 3VYNA 1AQKH 5E08H 1TOXA 2CHZA 1AYRA 3LEXB 4Y5XC 3ZZLA 2OSLB 4HIQA 3X3FL 5BJTA 4G7YH 4OIFA 1M3JA 1MHEA 3UJTH 4DQAA 2HPOA 3WHE0 1IAKA 4PWIA 5E03A 3RWEB 2YUXA 1AQMA 1MKFA 4PWHA 3LIUA 1LP9A 1A3QA 5T1KA 4B5EA 5HHOA 5GXBB 3MRHA 5L4IA 1UATA 2P44B 5F0LB 2F53B 3V8CA 5C3LD 1FG2B 3DSNB 3MREA 4QTHB 4AYMC 1WDAA 1PZAA 3RTLA 3Q8EA 3U36A 3DBXA 1KCUL 1LO5A 4GW5B 2MOVA 1QYGL 2O5YL 2GC7C 4P5MA 4DVRH 4I77L 3TURA 3TONA 2OMVA 4IIQB 4L37B 5K1JA 1FNEB 1EK3A 1IBBA 1RUQL 3FBQA 2Y2YA 3T8VA 1R5WB 5I6NA 2FX8H 3P73A 1K9TA 4OZFG 4NN7B 4RWYL 3NJXA 2IVFC 1FO0A 4FZEL 5D1QE 5IQ9B 2KZ1B 2E7LC 4OV5B 1L6XA 3E80A 4QOKB 3VDBA 2NY2D 2L7JA 5DS1A 4I18C 2IANB 1B2WH 2WANA 2YFOA 3LN4A 5HHQB 3CVHA 1J5DA 3BYTA 4X6CA 1YY8A 3C08H 2AANA 5E2WH 4NJAL 1EXUB 2ZJSH 1O5PA 3MXWL 5CGYC 1FZJB 5AUMA 3O6MH 2VKXA 1RLBA 1B4LA 4X7TA 4OJFL 5C0DA 5IR1A 4R7DA 1D5IH 1S7XA 2H3NB 1NGWB 3F7PC 4TQIA 4EZKA 3PNWB 4ZNEE 3S88H 3GMOB 1CDBA 2XX1A 1MCIA 2EXSA 4YBLB 2D73A 3I9GH 4OAWB 3C5ZD 3WNOA 1DQQB 2WQRA 2CGZA 5F3BB 5I0VA 4N2KA 1TVBB 2OTWB 3QO0B 3U1PA 3DX9B 5FM5O 4RIRA 2ARJB 4OGXL 4M5YL 1AGEA 4IU2B 3TH2T 5HVGB 2JFCA 4H1LB 3MMEA 4KJQD 1DBKH 1PAMA 1G7JB 4NHUA 4EN2A 5BVJB 4H8WH 4PJ8B 2B0SH 2K6YA 1T6BX 3CC5B 4JFOB 4IRJB 4XTRD 5C07E 4Z3GA 4H44C 1KPRA 1U2YA 5A2CA 2DYRB 5F7FA 4W9CC 3F3HA 1ASQA 1BPVA 3O4LA 3P30H 2BPBA 4TSAL 4LU5L 4PREB 1SY6L 1G7IB 5E1HB 3FB5B 1WHOA 1JXJA 1UGKA 4IU2A 4AVKA 1CFTA 4GJTB 4LMQE 4N0UE 3X12B 2FX7L 5HI3D 4FYSA 4Y9EA 5F9JA 3MGTB 2VR3A 2LU7A 2O6PA 1QBBA 1LDPL 2WVVA 1UZ6F 2MFNA 4F9PA 5T1DL 3VXMD 5JORA 4QYAA 5A2AA 1KELH 5CEZD 4NZFA 3D05A 4WF7A 4GKSA 3WJJA 2V5MA 1KYOJ 3TBWB 2VJ0A 3HS9A 4PGEB 3RVUC 3QJFB 4AQAA 5BZWB 2IH8A 2QR0A 4AC4A 2ZWSA 2A4ZA 2QMKA 4PJHF 1OF0A 3QUZD 1K8DB 4DPRA 1DLHB 3ARFA 3GM8A 2D4DA 2Z31B 1N6VA 3K2KA 4Z95H 4TULL 3GI8H 43CAB 4JQVC 2ZOTA 2ADFH 4B53A 1ZS8A 4KK6D 1CFQB 5E23A 2BM3A 2ZZUT 4HCRL 3UYRL 2IANE 5D1ZB 3AAZB 3V52L 5EC2A 1D5BB 2Z9TA 3O41B 4YDIL 3BZDA 5IW1B 4GP4B 5B1KA 5KVDE 2OZ4A 2XXCB 5B7EA 4YPJA 5GJTH 4CL7A 1OSYA 1J9CT 2H1XA 4IQHA 2CLZA 4KAQH 4BIKA 4XPAH 5D2NA 3ZE2E 5EU6E 5EEZA 3OHXB 1OSPL 1QQDB 2LLLA 4M4RB 4Y1TA 1KJ3L 4RGND 4MXVF 4YHLL 2E6JA 4NRXB 3GRWA 3JYBA 4YL4A 1RK1B 1LGVA 5FM4A 4JQXA 2FJHA 3ZTNL 2FNWA 3PWNB 4YHKH 1FYTD 4S1RH 5ESQB 5IWLC 2MCAA 2WZPD 3L1OL 3OKEA 5TK4A 4M8QA 4RGMB 5IMOB 3GHEL 3HFML 5C0GB 3NFNB 4BZ2L 4F7EA 1I1AC 1XMEB 2FGWH 3E0GA 5F7BA 2Z4TA 3VXUB 1ZLVH 1MCQA 1QSVA 1U58B 4FFWD 3RL2A 1PTZA 2RA1A 2J4WH 1NGXB 5GGUB 5LG6A 4K3EL 5T8IA 4NQEB 1KTRL 4QOKD 3MUGB 5D5MB 2X4UB 3M17A 4PWJA 5LCVH 4XBPA 3VXTA 1DDTA 2NT1A 3UTPD 3BEVA 1IGIL 1LQSR 3KPNA 3CLEL 4G8GD 1GGCH 3MROB 4TKWA 5E70A 3QXVA 4U1KA 3QI9B 4WI0B 3UADA 1X4XA 1NCUA 1XH1A 5KOMC 3PWVB 3HBPA 3T09A 3VQ2C 2ZX5A 1MCLA 3GXDA 3FTVA 5E4AA 2OMYB 2C9SA 2NNXA 4JCWA 4HU8A 3NCFB 1EBPA 3JYCA 3I02A 3FB6A 4PJIF 4R90H 3NCYP 4NYLB 3JWOC 4YGVB 5MEQB 1Q1JL 4OCRL 3QJZA 1F97A 4W9DC 3GUTA 4PJGF 5L7XH 1PCXA 1IV8A 4JDTL 4NJ9L 5IV2A 4IRSA 2G3MA 1JI2A 4U3XA 5I5JA 4LOEA 3N1QC 4YHZL 1K6QH 1RH8A 2VISA 3K5RA 2ITCB 5E4EC 1IGTA 2J5LC 2WO4A 3MROA 3EOYG 1W0VA 3BQUA 4Y9BA 2WKLA 1QSEE 4PJDF 2P24B 2Z6FA 4S0TD 1FHNA 3FOMB 5F88A 5BVPL 2NSMA 3VW3H 1NFDE 2MQ3A 2R0KH 1Q9WB 3DMMC 4O2CB 1S8DB 4ZODA 5I24A 3GMNA 2PETA 4KY1H 3OZ9L 4X4YA 2Q7YA 2LR4A 4G7RB 2AZAA 2WXFA 3C8HA 4N4YB 3E2HB 5FFOA 1UWXK 2G5RA 2ID5A 4XO5A 3OAWA 1EZVY 2ADIA 2J55A 4G80A 3O3EA 5IEHA 1KT2A 1D3CA 1DLFL 3H3KA 3MOAH 2VQTA 3UBXI 2P7TB 3WKQA 3JV4A 3S4SA 3T4AB 3KPSD 3HE6B 1S8DA 3L9YA 4U3CA 4KJPD 1NCCL 4PJAF 2VLJB 4M6MH 4XC1H 3LRSB 3BWSA 1VENA 2J7LA 3MRRA 4I2XA 5EZJB 5ID0B 2IAMD 5DEGA 4X6CE 4WWKB 4KQ0A 1Q0XL 2BP0A 5HSFA 3ZHFA 4B27A 1KB5H 4FTVB 4YDLB 5I74B 4EVNA 5FK9B 4OD1H 5DVPA 1FFPA 1QPXA 1XF5A 2A9MH 2BNQD 4Z6AT 1G6RL 1JAEA 4GKZA 3WN5B 3K7UA 1HWGB 1KV7A 3MFGB 4JM4L 3V6BR 3U4EA 4X6DE 4KRNA 2B39A 4YXKL 5KYNA 4APXA 2F5BL 4R26H 5GRUH 2AC0A 1B0GB 1TFHA 3LKQB 3MRNB 3OKOA 3AQDA 4WDIA 3D25A 5HPOA 1VJSA 1AYOA 5C0AD 3B5TA 3QBTB 1CLZH 1ZEAH 5CJXA 4OZIB 2R0WL 2P5PA 4RMRA 3GIZL 4G8GA 1KZQA 1J9QA 2W9LA 3GXTA 5DJDB 4B9IA 5IKCB 1OIOA 5FYJU 4AZUA 2XZAL 2ZX8A 2RJMA 3G6AA 5E2UH 4ACTA 2GK0B 4LSPL 4QRPA 3U0TA 4P3WA 1XR8A 2PWDA 2GW5A 3MNVA 2HVBA 4XB3A 1R3IL 4WUKH 4IIZA 2BVQB 4JG0H 4X6BB 4QF1A 2YJLA 3GHBH 3SQBA 2ZWLT 1KB9K 4R0LA 1FFNB 3FOMA 4UT6L 5F88B 4MCMA 5IKCA 3FRPB 5E99L 2YAQA 5MEOB 3MRPB 2ADGA 1F6FB 2YD7A 4U2YA 3UZQB 1GR7A 1B9KA 5ESAA 3S2CA 1QP1A 1UCTA 3VXOA 4CVWA 3FAWA 5TGBB 3RIAK 2R7EB 1PYWA 5ICXA 4M6NL 4QHLA 4OZHB 1NGYB 3IBOA 4O02H 4Q58C 3HZVA 1G5GA 2G2RA 3MZGB 1A7OL 5T1LB 1BBJA 1OAXL 1E9QB 1U3JA 4A1RA 1KBWA 3ETSA 5D7IB 2BVPB 4NZRL 2WWKO 3DV4A 1OCWL 3D06A 3OJDA 4IBSA 5ETUA 2CBOA 2N7AA 3PDDA 2F53A 5F3FA 3RUGF 2VDQB 5E0FA 3WNNA 2XXMB 3X3GH 1VLXA 4IOSD 4MJ5A 5G4MA 3MBWA 3V5HA 3WTVA 2WNWA 2IAMC 1Z32X 3S7GA 3MUJA 3Q06A 5T1LA 2CLVB 2G5BA 3KNBB 3NJKA 1BQLL 3B1UA 5F2FA 2BWIA 3NIFE 2PNDA 4L8SA 2R23A 4NLAA 1S7SA 2FJSA 2E59A 4N8CH 4Y2LA 4HV8B 3RY4A 3U4AA 4WKXA 4X7CC 3VE0A 4LL4A 1MFBH 3X13A 5LUMA 4XPHH 1DQDL 4JVWA 1CTMA 4IS6B 5AW3B 3LDBC 2F08A 4HUVA 2APWA 5FR3A 2XRAH 4FYRA 4KKLC 3VQLA 2V17L 4MQSB 3ULUF 3KMDA 1P4LB 3UBXA 2PCFB 1AGFB 1U8CA 1B9ZA 5DYOB 5INCB 1NGPL 3QUGA 4MJ4A 3UC2A 4QHPA 2E47A 1XGQA 3V7AG 2DQEL 3O8XD 4MLIA 1HEZB 4FQXD 5DRZB 3SJVA 4G9FA 3WTTA 3EFDL 3WLWD 3O2WH 5F7DB 1FAKT 5DO8A 1P1ZB 3QZOA 5JO5B 3KWWB 4Z7NF 4YO0B 2W07B 3KWTA 2WSPA 4XNZC 5DJ0B 5EU5B 4H25A 2VMFA 4KKCD 4I0PB 1KLUA 2IEPA 2D2OA 5AOIA 3W37A 2AFNA 2IV9A 5GSRA 5HYQA 1RV6X 1CLOL 4OUUA 2P45B 5HJDA 1TQBB 4G7QB 1Y6MR 2KZBA 3KBFA 2EAEA 1GZHC 4QIRA 1OAJA 1BVKA 4FXKA 4BQ6A 1U8KA 1TJXA 4HKZB 4XBMA 1BXVA 2PO6A 4J3VA 5DUJA 4TVPL 1UKQA 2WAQA 4LBEA 5F93C 1AIZA 2CRMA 2VR5A 4NC2B 2WWOA 1F45A 4TV3A 2K9UA 4KKPA 1NEPA 3WUZA 4HU2A 1DTUA 3C60A 1U3NA 2YRPA 3TO4C 3QHZL 5JR1L 1MDAA 2XZCL 5JW5B 1ZWIA 4NFDA 1FL3A 4IBTA 4OSUH 4V1DB 2E7MA 3DUHA 3SKNA 2I7OA 3ISRA 4LSDA 4XCEA 1Q0YL 2Y5QA 3T3PE 2AQNA 5I1DB 2GEEA 3G6DH 4A6YA 3GMRB 4Q6YA 3BI9X 3NJVA 4ZPTB 4O51B 3IF1A 4LVOC 4QXWA 2GJZB 4XN8A 2A0LC 4P3CH 2P1YA 1SLXA 3EGDA 4GEIA 1MCOH 3BW9B 3ABZA 1NOFA 4M7ZB 1A7NL 1SEQH 2F5BH 5GRUL 5E8NA 3KS0H 4R7DB 5CSBA 1S7RA 2AGJH 3ATDA 4N2HA 5IVXA 1TQCC 1UTDA 4H0HB 5KVDL 5LBSL 3VSTA 4E9YA 2WXQA 3JVGC 1RZIA 4ZPVA 1X7QB 4JJ5B 3OZLA 3PNWA 2YIHA 3O9WD 5DD1H 1LEKA 3IJYA 4P2AA 2A4CA 5B7MA 2CHNA 4Y19B 2QQLL 2F61A 5GISH 5BMFL 4XVJH 4U49A 3L7EA 1CFMA 3BAEL 1IGML 3QXAB 3H2WA 5C2UB 5JIKA 1P6AB 3ET9F 3GQFA 4E9TA 3D69A 5EIQA 2AEQL 1UOVA 3DUSA 1MFMA 3QRBA 3VXUD 3POCA 3MKKA 1UD5A 3OV6A 3PREA 1IGYA 4QTIL 3O6KL 1IAIH 1KTJA 5D6DA 2HT3C 5JQ6L 4IGBC 4BWUA 3AWEA 4TUKL 1JGEB 1RURH 2BSSB 2VDLH 3CVBA 4B9YA 4C4UA 4XPHL 3SKOA 4PRPB 4J8RA 1IIKA 3L54A 5B1BB 2FHFA 2O5NA 3QDHA 5HYJD 2IGFL 1CFTB 4XCYA 1Y6NR 5IHWA 1AO7E 4TSBH 3KLLA 1VERA 3OZKA 4NBZB 3G5ZB 6PCYA 5DI8A 5TPWL 2DWEB 4UDTB 3BVNB 4L3EA 5HGDA 3RNQB 5GS0L 5LGJA 4JZOB 3WTUA 5BZWA 3DTDA 3MXVH 3P3SA 4WV1C 1NCCH 1KB5B 4PRAA 1OGAA 4XTRC 3S6CA 3QEHA 3REWB 1XH3A 1H5BC 4S1DC 1A64A 3BEVB 3F62A 4WTQA 3FO0L 3NJNA 1LO0H 3MNZA 4NKIH 5CP3H 1WAAF 2XWBB 4IRSD 1ADWA 4S0HA 5HHXH 1FNLA 3GGWA 2NY0D 1S7WA 1DVQA 3FPXA 4FNSA 3CPUA 4N0UA 1EV2E 3GIVB 3L4XA 3UJIH 5DTFB 1UOKA 3COOA 3VO0A 4YHMH 1NAKH 1QZNA 1E5YA 4ERSH 1MHPL 5I1IL 3ROOB 2AEWA 2EYTB 2HTLC 3UZEC 1B4JH 5K59E 5D6CA 1MFUA 3KPSB 4A37A 5D4JA 4GRLB 3L6FA 2BVUA 1EHNA 3LPOA 3P9LA 4XMUA 2CJTA 3FQXA 2AJXL 3IT8D 3QR2A 4JFEB 1YPZF 4LIQH 5KYYB 4UINL 2CO2A 1JF1A 4IBZA 1S9YB 3LKSB 3VD4A 1WEJH 2CGRL 3F7KA 3Q2WA 4ELDA 2IWKA 4I5BA 2DM2A 4Z7AA 4KK5C 2TAAA 1QPKA 1ZA3A 5IROC 3BZEA 4XMLL 3BZ5A 3QHFL 2UXTA 4PRDB 3TIEB 3VGAB 2A74A 4PJEE 3D85A 1PPIA 3X2QB 1ZK9A 2QDWA 2DQJH 1XR9B 4HFUH 2H2PD 4BFIA 1AC6A 4AGNA 4BXVA 5F9WC 1AHMA 1DBBH 3FU7A 3SO3C 3TBYA 4LL1A 1JNHA 1WK0A 3ARUA 4OGZA 4QHKJ 4J39A 4MAYC 3STZA 4UQ2B 3R06B 5JZ7C 4MNHA 1QSFE 2NNAA 3ILQC 4Z1PA 1CD1A 2XOTA 4M5TA 1FC2D 4HLEA 5MERB 3FQ4A 3ARFC 2EDOA 1HT6A 3LNIA 4JPVL 4Y4FA 2AABL 4H0IA 3VGAC 4CGUB 2OMWA 3WNKA 1HILB 3DGDA 4CC4A 5I5RA 3VXQB 2BSED 2W59A 5CIPB 4NQCD 1FDLL 4X8JA 3U4BL 4B96A 5AZUA 1U92A 4WNQA 1L9RA 3IS0X 4FHKA 2XWBA 1SZNA 4XVSL 4OLUH 2QQQA 4FMKA 4RQQA 2GBVA 4NGHL 3U2JA 4FQJL 3TTSA 2BMKB 4Y1AD 2XYCA 1YDPA 1DANT 3QQXA 2A9ML 4Y5XA 1IZKA 4YC2B 2R2BA 2GYSA 1A8JH 1ULVA 1AXIB 3HE7C 3MRQB 4H1LG 4K2UH 2V8LA 1JXFA 4WUKL 2O6FA 2EYTA 5FXCH 2X70B 1R75A 1W8OA 3LKNB 3FTSA 3K6NA 2OXGB 5JW4Q 4FKKA 3OMZA 1ZK5A 2F7RA 2R29A 4NFBA 2XBTA 4HCIA 4L29B 5IM7B 3SE8H 3WFZA 3LS5H 3MODL 5LBSH 3SDCD 5KVDH 2FH6A 2OTUB 2YPVA 3BAKA 3GBML 4WY7H 3L6FB 1SDAB 3RB5A 3HC3L 1HINH 2IPTH 3Q8AA 2P7TA 3DX8B 1TENA 1KENH 1Y7VA 3BVTA 2YSSA 1PF3A 4I7ZC 4E5XG 3MJ9L 4UQ9A 1U8NB 3CHSA 4I3SL 4GXVH 4YSUA 3DTXA 2VR6A 1SDDB 2VZ1A 4AL8L 3FT3A 4XH2A 2WJ5A 2P5ED 1KXVA 2I7SA 4P06A 4CAGA 2FIRT 4HOXA 5DURD 5F0JB 4C56B 1IJ9A 4TNVF 3NABH 5ALBH 1EJFA 1YYLH 1IT9L 5IFJB 4XNYL 3ABLB 4ODHH 1XR9A 3MFFA 4X0KA 2D0GA 3NPSC 3BAWA 3EJRA 3DOSA 2GI7A 3IDUA 1FIGH 3LRGA 5DJ6A 1ZANH 3CXHK 3H54A 4XXCA 3ULUC 5MENE 4KJYA 5SWSA 4R3SA 2ATAA 1Z5HA 3BN9C 1QVOA 3ARVA 2Z34A 2FRGP 1JWSA 1MJJB 2Z64C 1ET7A 5TE4H 2IWEA 5DJ2B 3QFGA 3N1MC 4RFOL 3ZZQA 2FATL 1SMOA 4PWEA 1QTYT 2CIIA 2QTEA 3V6ZB 5ICZB 4X5WA 5DMGD 1KIRA 5D9SA 3VRLE 2YAOA 2OSYA 1DCLA 2Z7UA 4UILH 4X8CA 3FO2A 2L7QA 3KL0A 1JDCA 5BUPA 4G5ZH 4Y4FD 5BUGA 1XGPB 1CGVA 4Z7VE 4IMKC 4DGVL 3MJ8B 3EIFA 1KGXA 3C5XA 5I8EB 4ZOAA 1VADA 4LSSH 2Y69B 3PFUA 1HQRA 4LASL 4PGDA 3CDYA 5DLMH 4AYSA 3F5WB 3EUUA 2QSTA 3BWUF 3MV8B 4Y2DD 3LS4H 3AXLB 4GQPH 3TF4A 4RNRB 1E8YA 1JHTB 1MVUA 4MNQA 2B2XH 1UADC 5I18H 4OT1L 5LXGH 3OLEA 3I6LE 4Y5VB 3DIVA 2FNBA 5KBPA 1RJZA 2OSXA 3ABGA 1J8HB 3NJMA 5B21A 2I60H 3VB9A 3EO9H 5GS0C 3UGXA 3GD1C 2P80D 4P2OA 2FUQA 5I1JL 4HIJA 3GMPB 2NZ1A 2FIKB 1N10A 2PO6D 3C6SB 4RAUA 4XPBL 1QR1B 4O02L 3X12A 3PUUA 1F90H 4Z7OE 2ISDA 3UMNA 1C1EH 2H32A 4P3DB 1S7UA 2CMRL 3MACH 1A6VL 1FO0H 1UJ3A 1SOQA 5EV7A 4V1DD 2YEQA 3ARXA 2I27N 4NHCL 1IGMH 2V9TA 5DHVH 1ZWIB 3V79C 4BWTA 3HLAB 3TNMA 1HHKB 1ZHKB 1MJ7L 1FYTA 3WJMB 2OYKA 1AZRA 3WFHA 3OLIA 3GSNH 4GMSH 5TQ0L 4N9OB 2J56A 4A6YB 2UZPA 5KVGE 4N24A 2AGJL 3LY6A 3D2UD 2Y7LA 3CU7A 1QBAA 2VDLL 1OAYH 3KJ6L 2WY3B 5FB8B 1OGPA 4MZ2A 1KCRH 1NUFA 4GT7A 1XCTB 3LPWA 5LVEA 3HNTH 2YBRB 4CVXA 5BO1L 2YD8A 3W11C 3GMMB 3LQAC 1HCVA 5F9OH 3GBMH 3FQNA 5TDOA 1CZ8H 1ECYA 2V2WA 1AS7A 2CSPA 2HJLB 2ZOUA 3ARWA 5EZPA 2YLHA 2MRYA 5GGVY 3AU1A 5E00B 2XTSA 2HRGA 5HPMA 1ES0A 1FL5B 5I1DA 3ZQ9A 3PP4H 1KYFA 1XD1A 3IDYB 3G9VA 5TF1H 4JQIL 5AUMB 5JOPE 2QVFB 1SMDA 1KG0B 4U6VH 4J8QA 4IU3B 3HG0A 3HG3A 1OTTC 2X9WA 1Q9KB 3NIGF 4PI2A 4Z7VB 1RURL 4OD1L 3RX9A 1QFWM 1P7KB 3FFCB 2HLEB 1FGNL 2J2ZB 3LJ3A 1OD7A 1FFQA 1SHXA 1E4JA 4XMLH 5HHMB 3EJYD 1SBSL 3B4NA 4OKDA 5AZEL 4FRWA 3S5LG 1SY6H 1H8OA 1JZIA 5L8LB 2NNCA 4DESA 4PSPA 1LL1A 1NIDA 3DRTB 2QSCL 3PNRB 4FXLA 2X87A 4WNJA 1I8IA 2MNWA 4U7MA 2XN9D 1RAMA 3DV6A 4QXTA 3GIZH 3QCTL 1N9PA 5T1DH 4JUSA 3RIKA 3VWJD 1TTCA 5SWZA 2A73B 3ZYOA 2R69A 3MOBL 1SGKA 2P5WE 2V8MA 3QUMH 4X4XB 3VCLB 1JZFA 3ERXA 3KPNB 2K1MA 2XICA 3SBQA 2DKUA 1M71B 2Y07H 4XAWH 4QJ5B 2CDGA 4OKVB 1D5XA 3QDGD 5LGJB 1UKTA 1WFMA 5FKAA 1IKFL 3RTQA 3T77B 5IHBA 3FYEB 4NQVB 1KTCA 2ZCHL 4A39A 1M05A 2BVYA 2YGVA 5C0BD 2Z92A 3V95A 3VTMA 3PWUB 2V6HA 4H2AA 3ZKXC 1OGTA 1ZE3C 5HDWA 1WFJA 1Q90A 3MLXH