2Y1ZA

Human alphab crystallin acd r120g
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
EMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHGKYRIPADVDPLTITSSMSSDGVLTVNGPRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CRYSTALLIN B CHAIN
publication title Crystal Structure of R120G Disease Mutant of Human Alphab-Crystallin Domain Dimer Shows Closure of a Groove
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 13
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y1zA00
2Y1YA 4JUSA 4YDZA 2N0KA 3L1GA 5DS2A 3W1ZA 2XCMC 3GT6A 4M5SA 3GUFA 3AABA 3Q9QA 4RZKA 3AACA 3J07A 3QORB 4I88A 4M5TA 3VQLA 2Y1ZA 3L1EA 1WGVA 2KLRA 2WJ5A 2Y22A 3N3EA 4YL9A 2WJ7A 4YLCA 1SHSA 3L1FA 4FEIA 5DS1A 1WFIA 2CR0A 2BOLA 2KMWA 3GLAA 3QORA 4YLBA 2K8QA 3EUDA 3QORD 3VQMA 2O30A 3Q9PA 1X5MA 2CG9X 4MJHA 1RL1A 2JKIS 4ZJ9A 2MNWA 1WH0A 5LUMA 3IGFA 1EJFA 4JUTA 2RH0A 4PCKA 4ELDA 4PBDA 1GMEA 4YE0A 3QORC 2N3JA
chains in the Genus database with same CATH superfamily
2R4SL 4S1SH 5T5NG 4XAKD 1P4BH 2Y69B 1NCBL 3CU7A 4KDVA 3VQLA 4HHAB 4DGIL 5IJVA 1QSFD 4JJ5A 4WI2A 2R39A 2YS4A 2YO3A 4RGNB 3HI5H 1RZKC 2HTKC 3IXAB 2CLZB 1I1AD 5D7IE 3P30H 4PJGB 4GUCA 2EQDA 3EFDH 3H7LA 4RFNC 4ORGB 4WNQA 4WKXA 4W93A 3QHTC 2LQRA 2HLFC 4YC2B 1MPAH 5B3SB 3LKQB 2B1OA 2WZPD 3ZT6A 3FH5A 3GGWB 2DQTH 3CLWA 4XB8A 1WAEA 2EDBA 1NMBH 2IADB 4I87A 4N1CA 5JUEH 3AY2A 1FL6A 1FLTX 4U2YA 4X9IA 4EUPH 4JM2D 2R59A 5AVUB 4BKLB 2BJMH 2OP4H 3NDZE 4P46A 4PGJA 1INQA 1CLOL 1GRWA 3AXIA 2C4XA 4MJIE 1BQSA 4Y1AA 3ZRFC 1H9DA 2B8OT 2AI0H 3LXBA 2F19L 4OD2A 4Z7UA 1WVZA 4AWJC 3GMOB 5CD5D 5IJKC 5K9KA 2EUZA 1CK0L 2GEEA 3IRCA 1KBGL 1KN2H 1T2XA 1HN1A 1L0QA 1U3ZA 5IB3A 3I9IA 5DURB 1BZOA 3VFPA 2KQNA 1NAML 3U7YH 2IOOA 4IIQA 4NQQA 2NY3B 1E5CA 1RLBA 3AC0A 3QUMB 2W60A 4HKBA 4HMDA 3VA6A 1ODUA 4Q97A 5FYJH 3HZVA 3BWUF 3RPBA 5HY9B 1FYTE 1LL1A 1SDDB 3MOQA 4BFFA 3WTSA 2P8LA 1JVOA 3DPBA 3UTPD 1QSZA 3B9DA 2FGWH 4U1KB 2W65B 1OPOA 1TCMA 1U58A 4BCZA 1P6AB 2FHCA 3HG1B 5HYSA 5BS0D 2V5TA 2CKNA 1IBGH 4C4KO 4DUVA 3AG4B 4MCZB 1E5YA 2HH0L 1EMTH 2WZ5A 3KJ6H 3LAFA 4FNUA 4N2KA 2YD2A 1EDQA 2NTFB 2OQJB 4MLSA 2X53A 3WS6C 4U1HB 3GRGA 3K8MA 4L8CA 4Y2DB 1P53A 4M8UA 5E4EB 2MQCA 3WEAA 2NXYB 4BXVA 4OM0H 1B0GB 4P23A 4P5TA 2Y7OA 1I1FA 1E9OB 1R6VA 4G1EB 4PJAA 3G5XB 5FUZH 1RJYB 3SE6A 4PWGA 5EG6C 3L9YA 1A6UL 5SX5K 4IBZA 3UBXI 1ZA3B 3WNJA 3GXMA 2SEBB 4ZO9A 4M1GH 1J5OL 3MREB 3FB7A 4DJMA 3RWJB 1T5WA 3TJEL 1QYGH 4XCNB 2HLEB 4PY8J 4TXVB 3ATDA 1NGXA 4MCYB 4PJCA 4ODXA 2X4PB 3UXFA 3BAEH 4PQXA 1T0MB 2NUTA 5GS2H 4OZHA 4X6BA 3SDCC 5JHAA 2E9WA 4CU6A 3NIDE 2J6WA 4GKSB 4QRUA 1MHHA 5IFAL 1FC1A 3EBIA 3RZCC 5FFGA 1CPUA 3T0ED 2WUCH 1JNNH 1UH2A 2W0KA 4GKZA 4PJIE 4J4PD 5GPRA 4LDEB 2ZUTA 4B50A 4L29B 5FA4B 3FOLB 2FJUB 3HCVB 3ZDYE 2VSDA 4MBOA 3RWEB 1XF2B 1ETA1 2QTEA 4HUUB 5F9WC 3LNHA 2NR6C 1CGWA 1XGYL 4U1LA 1J1XL 4BJLA 4Z3IA 2HSIA 4LLQB 5DK2A 5TE6H 2HG0A 2NX5A 2PXYD 3KYOA 3QIUB 2JELH 2ZKHH 4ZUUB 5C0EA 4PYGA 1G7IB 1UH3A 5AVVB 4KAQL 3V0AC 3I9AA 2F8VA 2FRGP 3NFNA 1IU1A 1W72L 3L3HB 4M43L 5LXVA 1F45A 1INEL 3WXWL 3IWUA 2WXIA 1Q4NX 3I02B 4PN6A 5E24E 4N2LA 1RJZB 1WFIA 3H56A 2MQ3A 3BGAA 2D4FA 2I69A 4UAOB 3ORJA 5CUSH 3GS4A 3QRLA 4AM0Q 3FT9A 3D39E 5HGDB 3C2SA 5LGHL 1AQKL 1JN6A 4J6RH 3EOBA 4HKZB 4LLYA 3BPNC 3DJZA 3TURA 1IBDA 1RHHB 5LB1A 2CO3A 3W9EB 3US1A 2O5YL 4E42A 5MERB 4E2OA 2YUXA 1WV7T 1IAKB 2CDGB 2DQCL 3TJHD 1WUNT 2H1LM 4XCYB 4B95C 1LYQA 1R3LA 3QIWB 1IKFH 3DI2B 2QQLL 3H6JA 3K6FA 3VXPB 2CO7A 1DL7L 3BUIA 3ELQA 2I85A 2Y36L 2YGVA 3RIFF 2BDNL 3ML8A 4LEOB 1HIML 1O9ZA 1W80A 3QDJB 5I74B 3OV6A 4CMMB 5D70L 3HE7C 4JVWA 3O9WA 4NDMA 4QYOB 2DBLL 3VWKC 4XODA 4KKZA 5IHBA 1I7UA 3FSVA 5C0GB 1WC7A 4LCWA 1PVHA 1X44A 1HQRA 1HZHL 4ODHH 4YIQA 5D1QA 4DFIA 2X5PA 3QSKB 3SYCA 1PY0A 1U4EA 5C0AA 1W0VB 1BMWA 4NN5C 3FTVA 4H88H 4L9LC 3W9DA 1KPVB 2FBJH 1RXLA 5FCUL 2PP7A 4D8PB 1F58H 5AKRA 3LPOA 4UAHA 2EYRA 1BM3L 2OR7A 5IR1A 4P4KD 2HT4D 3QK0A 1LO5A 2QKSA 4NO5A 2Q76A 3EJSA 4N8CH 2MOGA 4LGPB 4EDWH 4WF7A 3LPGA 2N0MA 4DW2L 4EMZA 2CU9A 2G3ZA 4ZPVB 3TEZA 1JZDC 5DZAA 1Q0XH 4JFSA 5DVKA 3S34H 4BZ1L 1TEFA 5B7MA 3NSDA 4JQXA 1AGFB 2BZ7A 4KK5C 1G7HA 3D6GA 4ADIA 1RULL 4S1DD 3NACH 2EDXA 4XR8C 2N01B 5C9JB 3H4FA 4PSRA 5F0JB 3UAEA 3L17A 2V2WA 5HHQB 1WTGT 2I26N 1QO3A 4QXVA 3W0WA 1RL1A 3ZMEA 3QJHB 5GZNA 5C0IB 4Z0BH 1RCYA 3T4AC 2VXQA 4NQSB 3QUZD 2V33A 2BNQD 5HI5D 4UT6L 1PZ2A 3H7BB 1CTOA 2AJ3A 4X7SL 2WLIA 1CGUA 3WDIA 3CE1A 1BQRA 1FO0H 2B1HL 1A4KB 1SGKA 3QCUL 4JO3H 5ADOL 5AW0B 3RDTA 1E90A 4MJJA 4RQQA 3BIKB 1GSMA 4YGAB 4PJBE 1T0OA 4H44C 3UJJL 3RLSA 5FCSH 3R7QA 3MRJA 5JDSA 4GMTH 4PJXF 4LPXA 2HRLA 2XTJB 1EEYA 1G5GA 1JV2A 2EKSB 3KL3A 1RUPL 2IAND 2VMEA 3OAZK 4I5BB 4NUGH 5B1KA 1Q9OB 4L18A 1FZKA 4Z7NB 3AREA 2EH7L 2CHDA 5AW7B 43C9A 4O2CA 2WYZA 1JTPA 4NO3B 4KMQA 3RUGF 2ENYA 1E6JH 5B4MC 4U7MA 3C5ZC 3LKPB 1Q94A 2CR0A 3ATBA 3O3EB 3TT3H 4OJFL 2A77L 1DJWA 1R24B 4KHXL 5EU5B 4DPAX 3HC0A 1VZGA 1NC2D 2MSPA 1BQLH 1HAWA 3D39D 2Z0BA 4GXVL 2UX6A 3S6CA 2O61B 1NGYB 2XPGB 5FV1L 4HISA 4B96A 2EE9A 3FQNA 3IU4L 2EVHA 3BFOA 4NRZA 3M17B 3T77B 3Q1SH 3NBNA 3NABH 3GSOB 2AJXL 5GS1C 3WE1A 5AZ2H 5F7MC 3GXUB 2E6QA 1G6RH 1GOGA 1OGAD 4OCXL 4PRIB 3HR6A 1KCSL 3EUDA 4NI3A 1NEUA 1ND0A 5L6YL 2HFFB 4ONFH 3BKML 2D0HA 5BZWB 5E56A 4GRWE 3RWDB 3NPSC 1X5YA 1JGLH 2IDQA 4G8IA 3GXIA 3RWHA 4K0OA 3BAIA 4AYGA 4Q14A 4EO5A 2QFPA 4GSUA 4R2GC 4QHPA 4WDIA 3U1SL 3QDGB 3CVHL 2ENQA 2YZ8A 4RSVA 3VTTA 4B9GA 4XP5L 3S37L 4U1GC 2VLJA 2PPCA 2P8PA 4JFYB 4ZO6A 5ERWA 4AYFA 5IB4B 4JR9L 2WVVB 1KCBA 4RGMC 3PNWA 1UGNA 3PDDA 5EU4A 3A21A 4GBXD 2MCPH 2PWHA 3FONB 3QG7L 2ARJA 1T5XA 3U4EB 3V0WH 4A1RA 3RURA 4X6CF 2CPCA 3FFCB 5CKGA 3MGOB 1UJ3A 2PO6D 4J27A 2ZICA 2P5EE 3CCHB 2ZYIA 4C83A 2YC1A 2G4EA 4X4ZA 2CRZA 1I82A 4WHDA 3O6MH 1YN7B 1YEEH 4MNQE 5J13B 1RZGB 1SY6H 1Z66A 4HK3N 4Y16C 5IMOA 3WO4B 3C9NB 3GXNA 5CU9A 2ZONA 4OBSA 1CICB 1T2QL 3E1ZA 3Q05A 4F20A 4BSWB 2ZJSL 4Y7OC 3P9MA 5L88H 1LM8V 1NBCA 4R4FL 4FQLL 4G1MB 3A6CH 1S4IA 3WD5H 4Q2ZB 3LVEA 1J11A 4ZPTA 5AG9A 5K1NA 4PRBA 4FG2A 1Z5YD 5CCKL 2IBZY 4HJGB 2R69A 3L3KB 5DU7A 3JWNH 3V0VA 3M1BA 3BVUA 4J1UA 4AV5A 5D6CB 4QHNA 1RZIA 1KJMB 3DTXA 4FNTA 4ELME 2DQHH 2YBRA 5K33A 1KIUA 4D9RE 1U8QB 4TLSA 4ISVA 5KVFL 4BFIA 3K4DA 4LCYB 4XP9L 1YMHA 3D85B 5DMKA 3VFRA 2PTVA 5EC2A 5IHWA 3MVSA 3N1MC 2VW6A 1VIWA 4GRLB 3RWFB 3D0AA 1PIFA 3OXRA 5D7LB 5EDSA 1K6QH 5KYXB 1FH2A 4AGNA 4AYEC 1F4AA 4UQ2B 5T3ZL 1MCLA 1QI3A 4K5LA 4P5TD 2G2RA 2I32A 4R7NB 4JAMA 1FORL 1IGJB 3GO1L 3SKMB 4UILH 5GHWL 4BE5A 2IQAB 1JWSA 1YMMA 2LTQC 3DRTA 1TQCB 3JYBA 2BRQA 4NPJA 3QJUB 4R5XA 3TBSB 2WLZA 1RZ8A 3OM3B 4J28A 4MQXC 1IT9L 3AXHA 2QHRL 2OSYA 4K5MA 4OQ1A 1G9NL 3B2XA 3JWNC 2ORBL 1LWHA 3NZ8B 4HOXA 1XCQA 1NEZA 1LNUB 2HVKB 4JFED 5EUOF 4CSPA 4JHWL 1JPGA 4R7DA 3ZDZB 3GSQA 4Y4HB 4HWEH 1A1MB 4IRJD 1UXLA 3KYNA 2ZOKB 2I9TA 1YY9D 3QHFL 5CILL 3J27A 2CKBA 1FDLL 5FKPA 1HHGA 4D8OA 1QW9A 1PTZA 2QQQA 1OP5H 4IBSA 2JB5H 1KY6A 5F1SA 3NN8B 4HWZA 2GW5A 5KANG 1ZRUA 1XR9B 3QFDA 4BK4A 4C56A 1CWVA 2IV8A 5FPIA 3IBEA 4Y4FA 4MB5A 4CVUA 1WT5C 2F5AH 4H13C 4U7SA 1GTFA 5D2NA 3LN4A 1QSFA 5IMKA 3QDME 1XGTB 3GTVA 1U3HA 2K45A 1I9RH 3IEAA 1I1AA 2XT1B 2ITDA 5LQBH 4YHNB 4G6FB 3CSBA 1HE8A 4JFXA 4MAUL 2OI9C 2X4RB 2X4TA 5D1XD 3CXFA 1CGSL 1CI3M 4JQIH 3PHOB 1ZEAH 3MOAH 4JZNA 2WZPA 5EF0A 2TAAA 1HHHB 4NCDA 4POZC 2CDFB 5DUPH 5K39B 2Y1VA 3TZVD 5KSAC 2FO1A 2NZIA 2FLBT 3LNEA 4JM2A 1BLNA 4PR5B 3QI9C 5L4IA 1CBJA 2XOTA 5CP7A 4XVJH 5FO9A 4MMXB 3F7RA 3L45A 4Z3HA 1OPGH 5KAQG 5H4YA 2UZXB 2NYYD 5C07B 1GKOA 1TCRB 1TTBA 1ICTA 3VXRE 1QTYT 2ZXQA 4YFLF 5JQ6L 4MNQD 1OTUC 2A74A 1F1DA 5IJDC 2CO4A 4MQSB 2WXRA 3FQUB 4WU5A 5J89A 3ZE1F 5G5DB 1IUZA 1W0YT 2WQAA 3MJ6A 4GP8B 4WHYG 5BVJA 2YUWA 1F97A 2EDKA 4UTCA 5ICZB 5EOCL 4NUJB 4HEMA 4NCC2 5C0CE 3MV9D 5AWNH 4GFTB 2YZ1A 2OL3L 3U0TB 1FIEA 3MLZL 2C9XA 1UOVA 1DBKL 4HGWB 4NOFA 3JWNE 4TQPA 3QJTB 5CEZL 1VFOA 3E6FB 4G9DA 1GXEA 3DVGA 3D9AL 1HE7A 1IFGA 1FL5A 3MYZA 2X3BA 1JK8B 4AMKH 2XV6B 1N70A 3NP3A 1A7QL 2FT6A 2L3BA 3QQ3B 2A3TA 4LPCA 3RTQC 2YRZA 4XMLL 2ZD0A 1PG7X 1HX0A 3D0VA 4QCIA 4XB7A 2NT0A 5ESQA 2NLJB 1NFDB 3ZQ9A 4PWHA 3N43F 5LG6A 5TF1L 1UWEL 4IOIB 3CGTA 4FMVA 1PY9A 2L4OA 1BJMA 3PL6C 5ITFA 2ENPA 4JRWA 4ZX4A 3GRWA 1IMHC 1BEYL 1KCLA 3HBQA 4KKAD 1S9YB 3TPUB 3DGGB 2OSLA 4L2YA 5DJ6A 4UM9B 5DVOA 1EO8L 4IM8A 1NQBA 4BK5C 5I1GH 3PRZA 4UNVA 3LRLA 1INDH 1U33A 4Q58C 4OI8A 5HDQL 4BH8B 4QHMB 3T0EA 4JFPA 1JGUH 2B9AA 3IJSB 1EK3A 2X1OA 3S96B 2BOLA 4J4PA 1LE5B 2W88A 5E2UL 3X3GH 3HB3D 2OJZH 1QHQA 4LOUD 5IVXF 4DHLA 1D6VL 5E1GA 3EYQC 2WQSA 3OWEA 2AHIA 1KXQA 1EJOL 1MH5B 4BYHA 3T8XA 4MJ2A 2VMJA 2PXYA 1ET7A 3HC3L 1NGPL 1CFQB 2K70A 4G6JL 5C97A 4KZEH 1KN4H 3GTTA 5LHDA 4PWKA 1I3GH 2H2PD 4FTVE 4GSDH 4XNYH 4GJTB 1L5GB 4FJ6A 4UYPA 2VDNH 3D69B 4BFRA 5BRZE 1F3JA 2Z31B 3WEXA 3HLAA 4BWTA 1U3YA 2XPZA 2EDTA 2VLRE 4IKNA 3SY6A 1Y07A 4DUWA 3FFDB 2VC2L 3TBVB 4MXVE 1DVFC 3CZNA 4UNIA 3V6FA 1BIIB 5DZPA 1NZRA 1J8HE 2F54D 2ZCHL 3LYRA 5HHOD 3J2PA 5F1IB 1GAFH 3GZQA 2VJ8A 2AS5M 1A4AA 2D31B 5E9DD 4ZAKD 2CIIA 2PTTA 5IROC 2WBJA 5CLTA 3BQUC 3QR1A 4JFVA 3WOVA 3UEZA 2EC9T 2VXVL 3MJ7B 5GISL 3VGFA 5I1CL 1R33A 1CGTA 1CLZH 3WGVB 5A2IH 1HHIA 4OF5A 5B3NA 4RZCA 4G9FD 4KHTH 4V33A 3MCLH 5BV7B 3RWGA 5A2KH 5I28A 5KYUA 5KBNC 5LDUA 3IFNL 2IJ0C 4E9YA 2N7AA 2KHAA 5L0QC 3OL2A 1JTOA 1HTYA 4NQXB 3TBWB 1JBJA 1HEJC 1MIEH 3DO7A 3RVVC 3KPTA 3PU7A 1L7TH 2RTTA 3CZEA 3BZ4A 3OKLA 1GIGH 5DQDL 1FYTA 2X0UA 1KXVA 1CYXA 2F61A 2A6IB 1I9IH 2FDBP 5HVGB 1CFNA 3HHRB 1T1YA 1O7VA 5B38G 3GJEA 3F64A 1VFMA 2OZ4A 5ADPH 2WC7A 1GGCH 2EIJB 3FS9A 2BX5A 4KMLB 2YWZA 1JHKL 1ZHKA 3BHBA 3II3A 4BE6A 5IQ9B 3H9HB 3VYPA 3W39A 3DV6A 2AMGA 2CKBL 3P9WB 1D5BB 2VUKA 4M3JA 5F8QC 3AQZA 3TH4T 2XWBA 2R1YB 1ZHNB 3IN2A 4LRIA 4IKKA 1EJFA 1NPJA 3DIFB 3OHXA 1IX2A 4JO2H 5H94A 1EXHA 1QP1A 2GEQA 5SV4A 4ZXBA 1S3KH 5C09B 4G8GE 3TXAA 3GMNA 4P49A 3VXUB 2G2PA 1CG9A 1N64H 2A1WL 3F7VB 3DGCR 4WJKB 1G84A 4D0CB 5DJZA 4B7IA 4ODVH 5KSBB 4YHYC 4M5ZH 8PAZA 4JL2A 5CINH 5KWYC 4PGBB 3G6JF 1IEHA 4OZFH 4HUVB 2LR4A 1MCKA 2JH2A 3TA3B 3CH1A 4JS7A 2HX9A 1RPQA 1NJ9A 4ETQB 3FO1A 1QPPA 2GT9A 4EDXA 1K4CA 3UBXG 5E6IB 4Q52A 1NH6A 3CUPB 1AXSA 2R1WB 4RA0C 1YEDA 4L2LA 5IK3A 3SCMB 5IBLD 1SUHA 1A6ZB 1UFUA 3SODB 5LAXB 4M62H 3HRZC 2X7LB 3GQFA 4YSEA 4TOYH 5DMIL 3ESVF 2O30A 4KO6A 4PJIA 1VACA 12E8H 2NZ1A 2O5NA 4LMQI 3K2UL 1NGQL 4YNYB 1NLDH 2ZX6A 4MMZC 1TTFA 1KJ2H 1GZPB 1ETZA 3MBED 4ODTH 5IQNA 3TFKC 2NY4D 5TH2A 2IANA 4AE0A 5DF0A 1LK3H 1OTTC 1KLUB 4M7JH 4OFYD 2BS71 4QKTA 2A9NH 4HU8A 35C8H 3C08H 1WEJH 4WWPA 4A63A 3V4LA 2JKWA 2CHXA 3ABLB 3QFJE 2DH2A 4M1DH 1IV8A 2DMBA 4CN6A 2ZTBA 4MA8L 1QKZL 3RIKA 4PS4L 1KDIA 1T20B 4R84A 2QMKA 3BKYL 3K72B 1L0PA 2ZXDA 1JZ2A 1F2QA 3G3LA 3LN5A 1DQQA 1DCEA 1OQXA 2ERJB 3D39A 3QIBC 5DUMH 5IOPA 3KLKA 4FGMA 5B38B 2LVEA 4WV1C 1J8HD 3BRGC 4XE5B 3BN9C 4AKPA 1F1AA 3RILA 1MXDA 5PCYA 1U4FA 2WD0A 4X9BA 3UROR 4JDZA 5ID0A 4Y7MA 2EDJA 1UD6A 5GGQH 1OK0A 3VDBA 5DJAB 1IGMH 4GH7B 4QXTA 3AQDA 2VDLH 4QO1B 3N06B 3ZK0A 1JYNA 3TNMB 1R5IB 4D9QE 1QWHA 1MCIA 4Q4EA 2XWXA 1NCHA 1Z0MA 2F7PA 3QDHA 4I48B 1FFQA 4HZLA 3S2AA 2ODHA 1TTCA 3L2NA 4L4VB 3VRIA 2V4LA 3D51A 1I9JL 3GRWL 2NY2D 3B2PA 3HNVL 2FB4L 3CHXA 2DWDB 4MXQD 3U0WH 5AOZA 4F7KA 3Q6GH 3QARA 4KDWA 1F6AA 1SLXA 1CC3A 3MRLB 3C6LD 2B9BA 1E6OH 5I2IA 4EI6B 5BNXD 4Y5XA 4LCUA 4PBXA 1ZLWH 1G7LA 4ZMYA 4XHJC 5JYMA 2X3CA 4H5SB 4XWGH 3B7UX 3IE9A 5IB1A 4UT7L 5E99H 2DQJH 4XPTL 1DLFH 2EADA 2E59A 1CT8A 1ZANL 3ARFA 4U0RC 2WUBL 1OP5K 4KJPD 4JDEB 3KD4A 2OMUA 4GBXA 3WIFB 1VB9A 4B7LA 4ZYKA 2J8OA 3ABMB 3VMNA 9PCYA 3E80A 1TENA 3O4LB 5C0BD 2ED6A 3GK8L 4DP2X 1V27A 2PO6A 3LJ3A 2AQ1A 5TD4A 4FYSA 4RX4A 2CLVB 1NSNL 3LH8A 3OR6B 1EH9A 1OWRM 4LGSB 4PJ7B 4DESA 4OZIA 1VEMA 3IM1A 3BUBA 4EN3A 1LQSR 4O2FA 4WWID 2J8HA 4FYRA 2MHAA 5EBMA 3E0GA 2YGQA 5DJ8A 1JPTL 1RUAL 4I9XA 3RAJH 2VO5A 2DLTA 1QSEB 3DXAB 5HPOA 1PAZA 2QSVA 5TDPB 5CEXA 5L4JA 4W9IC 1CE6B 2FUTA 2VZUA 2MTPA 3LNIA 2ESVD 2H9GA 1A65A 2DYPB 3NRQA 4I2XE 4QTIL 3FO0H 5IESH 3NEOA 3EFOB 4ZQKB 4N25A 5JORB 4PJ5D 3L3OB 4Z5RA 4LHUA 4L0YA 4DH2A 2BNUA 4X8GA 2QKIC 1F13A 3P11L 1T0PB 5JA8B 5D4IA 1B3IA 4APQB 5T1MB 2WZAA 3UC2A 4HT1L 5IHZB 1MF2L 2WNGA 1QRND 2Z65C 1B0IA 4LKCB 4OBRA 4PJBA 3VXMB 3ZQXA 1A22B 5I18H 1MHPH 2JJUA 1JK9A 4OIIL 4I0PB 4UT9H 1MFBL 1K85A 1YEFL 3IETA 5I0VA 2RFXB 2HVBA 2Z92A 5A2AA 2J6EA 5T3XD 3G08A 4WTWA 2YQBA 1ILUA 4Z7OF 4JN1H 1VADB 1WG3A 4OFKA 1HH6B 1N0XL 3VD7A 4CN4A 1HL8A 1AJ7H 2WZ0A 3NSYA 1Z5LA 1WUZA 2BVPB 1JHLL 3HG4A 3PXJA 1W6LA 4JCLA 3QFJD 2Y24A 4XPFH 1KTLA 4Y4KD 2OZ4L 4ALAL 2B2XL 1YEKL 1DVTA 1C08B 3O45B 4X8JA 3ZHLA 4JFZL 4DKEH 1FE8H 2P44B 4TVPE 2E7MA 2I07B 5LN4A 1CFVH 3V6OC 1W72B 1YPZF 1VSCA 1BZ9B 3TO2B 2PN5A 2HFGH 3Q2NA 2YRBA 2RQ8A 4AVJA 2GJJA 4LKXB 1IGYA 4MWFB 1YDPA 3POCA 1P1ZA 4HBQA 3A4AA 5E5MB 1D7CA 1GC1L 3PWPB 1C5BH 2IOIA 3REVB 4OTXL 4P9HL 3FTGB 3RGVB 1DQML 2HJLB 2CK2A 3K3QA 3EGSA 4Z0XA 2IIJA 1ZA6A 5F1NB 5HDOA 1X5LA 4EQ3A 4WFFD 3MRKB 4DQAA 3FU5A 1CTNA 3OLDA 5HHPB 2QR0A 3RL1A 3H42L 4YXLL 4A2EA 4BELD 3KPSE 4GQQA 1QLRB 5BUGA 3D18A 4PWEA 1HZLA 5KOVC 3HUJF 4ILDA 3VI3B 3VQ2C 3TN0D 3VD5A 3K4AA 5IFHH 4NO2B 4Z7VF 4NZFA 5D1ZA 3RA7H 4KXZI 5C6WH 5HHNA 5DRZB 3L5WA 1KPUA 1YN6B 3ESOA 5JA9A 4LASL 3WLWC 1LP9E 2VMCA 3QRGH 4AIEA 1WIOA 4FQ1L 2PCFB 4I89A 1KBKA 4PJXE 5DEGB 1DANT 4PGCB 3FU8A 1LK2B 5D1XA 3DTUB 4A38A 1Z3GH 4WAFA 5AW6B 1ROWA 4S1RL 5JXEC 3MLPA 1GOFA 1M42A 3TZVA 1YEHH 4JY4A 4N2BA 2R0KH 3PABB 4M7LH 1D5XA 1XGRA 1OAZH 4AY0A 3OKDA 3MRFA 3QQ9C 5GJTH 1P4BL 2H0JA 4OGXL 2P5EA 4J3TA 3BUQA 2BP3A 2BXYA 2FTAA 4ZFZA 1BDYA 2WLLB 5BOJA 3K8LA 4N0UE 1FN4B 2G2NA 3LIZA 3VRLE 4MNQA 4PG2C 4YHIA 3PCYA 4NQED 3T4YA 1OGTB 5C08D 2ICES 1T0NB 4U1JB 1QI5A 2YEQA 1ACXA 1W16A 4C4BA 1E28B 1P84J 2P7TA 4FOMA 1QG3A 1FGNL 1WICA 1BYOA 1MPAL 3MGTA 3TS8A 1B9KA 4YE4L 5IJVB 3BT0A 3K91A 4JJ5B 4ELKA 2HN7A 2ZZUT 3CIQA 3IDGA 4QRBA 3MV9A 5F21B 3TCLA 4ODUA 2WMPB 3OWRA 1M3JA 3GWJA 3V6OE 3BRDA 3ALXA 2KPWA 3O81A 5DYOA 2BJML 3GSWA 3PAYA 4KWUA 3FMGH 2VDOH 4LO9A 3HLKA 5F72S 1L0YA 2AI0L 2HT3C 1AHMA 1BD2E 1M71A 5DHDA 4NENA 5DRWA 3E38A 1CFMA 1MW0A 2WKOF 1KN2L 4XNXH 1F90H 5F9OH 2AZUA 1A7NH 2ATPA 1FL6B 1H6TA 2AEPL 4OJYA 4QOKD 4WI3A 3RPIB 4PCSA 2CALA 4NPKA 3U7YL 4P46B 1NGZA 1INQB 4PPTA 4Y1AB 3WN6A 2EXSA 1HS6A 4OD2B 4Z7UB 4H8PA 4OV6F 3BD3A 5K9KB 1MREL 4L1BA 1NCOA 2JXMA 3GHPA 5IB3B 1SEQH 4OF8A 4U3SA 5GZOC 1CR9L 1S7QA 3AT9A 3HN3A 4KK9D 2W60B 4HKBB 5EV7A 4Z76A 4Z9KB 2EINB 3HZVB 4AENB 1LWJA 4F9LC 3L7EA 4JUTA 4LPYA 1J9RA 3QORC 1EMTL 2P8LB 2Q7YA 2Q5BA 2H6UA 3DPBB 3GMPA 4XVUC 1VHPA 5I71B 5J11C 5I1JH 2G9HA 2VDQH 3W5NA 4UTAA 3MLWH 5FUZL 2KZWA 1ETB1 5CLWA 5CS7A 3IS1X 3BW9A 3QZBA 1ZTMA 4UQ9A 4N0YH 3SDXF 3MV8D 3ZKXC 4BIKA 5KYYB 3KH4A 2W9LA 2F74A 5KOMC 4P23B 4P5MA 1I1FB 1OAQH 4PJAB 3RY6C 3QUXA 2LVCA 2ADGB 2Y0SA 3EO0B 4HEPA 1COBA 4Z7WE 3NESA 4RDBA 3BAEL 4P8QA 4M5TA 4F57H 3O6FC 1N5YH 2MH4A 1S3RA 1E8YA 2QZ5A 5BZDA 5KJRL 2GJ6D 2V9TA 2X4OA 1A2YA 1T5WB 4Y19D 1MFCH 1JWMA 2WUCL 1E27A 4X5LA 1JNNL 4XMKH 3QCTL 1BJ8A 3ARGC 1J86A 1NGXB 3L3GA 4KK8C 4ODXB 1N67A 1PGRB 2IDFA 4J3OF 4PJCB 3TTYA 5HHOA 3VI4E 4N9GA 3ZKND 1CD1B 5IEHA 5F1OB 4OZHB 4X6BB 3FUNA 2A73A 3KH3A 4WRLA 4WWNA 4FA7B 4HSAC 1XBDA 1FF5A 5E9DA 4ZAKA 4QRUB 1SYSB 4AYBA 1BV8A 1MHHB 4KJYA 5TE6L 3R0NA 3SKOA 2JELL 3JYCA 1QTSA 1EEQA 1ZSDA 2J8UA 4GKZB 2HZHA 1RK7A 1B6DA 1IZJA 3VFNB 5CSBA 3BVNA 2GTZA 2FQEA 3QW9A 3MLUH 1LO0H 4KRLB 2CNZA 2EECA 1CVRA 3OMIB 1G5AA 3VUAA 5GS0H 5DK2B 3F12A 1R3JB 2NX5B 2B08A 4OKVA 4NS0A 1X5AA 5C0EB 3X3FH 1MEXH 5D7SH 3GFUA 3APNA 3AGVA 1G9EA 3NFNB 3IMWA 2X4UA 3WENA 3WTYA 5DO2C 3B9VA 4JFHD 3V0HA 3CLEL 4I8DA 3I6LD 2LFEA 1MCPH 3KAAA 4IBLT 1IAIM 4WQOA 4LIQE 3LPWA 3N5AA 1JIBA 1OW0C 3H54A 5F6IC 3TEYA 1N10A 4KI1A 4AG4L 2PLTA 1NMCB 1JN6B 5KEZA 5L7XH 1HSBB 4LLYB 4YDIL 2DYSB 3EJZD 1CDJA 3VG0L 1UD2A 4JB9H 1AYRA 1R3LB 1HEZA 5I73B 3AS3A 5B3JF 4YVNA 5DHXB 4RCAA 1ZVYA 2E75C 2H4EA 3DK0A 4D2NA 4ODHL 1HL9A 1O6VA 1R9FA 4HK3J 2BIHA 3N85H 2NDFA 3LN9A 3WE6B 4OI9A 3GUTA 3PUCA 4RIRB 2H47C 3O9WB 3P3RA 1U8NA 4NDMB 4XI5C 3ZE0F 4BFNA 3FZUC 1E50A 1SYVB 1K8DA 3DHUA 1I7UB 3SJVE 5DD1L 3IDXL 1HQRB 2G5RA 4N8CL 4XXWA 4YIQB 5D1QB 4DETA 4DZ8A 4NFBA 4EDWL 2GPZA 1KFGA 4KKLC 1FNSL 3JTSA 2DQEL 1S2EA 3W9DB 3WFCL 4LSPH 4B41A 3X1NA 1E5BA 3C8KA 5AEAA 1IKOP 3AWEA 4W9ZA 4XCCH 5E1HB 3S34L 1X4ZA 5IR1B 3ZDXB 3GIZH 3D2UD 1LO5B 2AEOA 1SDAB 3NACL 2Q76B 4YBLB 5FM5M 3ZE1E 2MCMA 1A1OA 4PP1D 1OD7A 1XF1A 2E7HA 5IG7A 4RMQA 3LIZL 3QC5X 2IPTH 4P48A 5IBUG 1BZDA 3MBEA 3UTSD 3W2DL 1USZA 1FZJA 3O4OC 1G7HB 4WIQA 1MQ8A 4OLYH 2H45A 4BA0A 3T0AA 5KYNA 2RCSH 3ULUF 1SF5A 4EZMA 4L3EE 4NN7C 2V2WB 1QO3B 3C6SA 2GUYA 3W0WB 1P2CA 3MNMA 3TVMD 4WFGD 3V0EA 1OD9A 4XMVA 1M4KA 5BRZA 2CPUA 2KMWA 4CADB 4RRPA 2NNXA 1FO0L 1UWGL 4JO3L 1Q38A 4L37B 2J3SA 2AP2A 2JCCE 2FX9L 2GTWA 4UQEA 4N87A 1GL4B 3BN3B 3ZTNH 4MAYD 3D08A 2GY5A 4BQ6A 3F7PC 2GJZA 1J8HA 1KXTA 4PTTA 2ISDA 2KPNA 2AJ3B 4GMTL 4L1DA 5F70A 2JTYA 2W91A 4XXCA 4CL7A 1IEAB 5JIQA 5HVWA 1Q1PA 1TTAA 2J56A 4NUGL 3SDDC 5F96L 3CVDA 2FT8A 5EO0A 3TU6A 3RDTB 3JT2A 4I18B 4RQQB 3N1GC 3NCWA 3QJSB 2IH1A 2J1KA 1BX2A 3GXFA 2P43B 1E5AA 1RZQA 1DO6A 1FQ9C 4DPRA 1RK1A 1Y7VA 3MRJB 4HWBA 3DX6B 3DA0A 3DOSA 3TT3L 4HIXL 1EEYB 1JV2B 1EFXD 2RACA 1AS8A 1UYWH 2JJVA 1GZHA 2VXSH 3ABKB 3AREB 1CO1A 4H0LC 3SGJC 4O2CB 43C9B 5I23A 1HYSD 4LSUH 4DOHE 3QUMH 4UU9A 4KX9A 3SYPA 2AGJH 2C7UA 3C6LA 1Q94B 5E70A 3NABL 3B4NA 1LO2H 1YYML 5G4MA 4KK6C 3IU3B 3OLGA 1M6UA 5E51A 4YH6A 1UKQA 4W6WB 2K4WA 1V5JA 4ONFL 4RDQF 5IHLB 4NERA 5GRJL 2GHZA 5C0BA 3L9EA 3LRHA 3OZ9L 1HWGB 4JDTH 3RX9A 4OJDH 4MJ5A 3LKOA 1WE5A 2VSKB 3DX8A 5FGBC 4G8GA 2A4EA 4KO7A 5IBUB 1ND0B 3U6RA 4W9CC 5IREA 4G8AC 4MNGB 3DARA 3SDAD 3EXLA 3B56A 3J8F7 1BFTA 4CDHA 1EAQA 5DS8B 3HPJA 1F4XL 1HKLH 1FCGA 4M3HA 3RWHB 2O1AA 4TRPH 4U6TA 1GYUA 3NRPA 2O6FA 1XIWB 2ESVA 4WDIB 3UERA 4LXFA 1KENH 1WIPA 1KTCA 1JERA 1N6VA 1TYJA 1ZDQA 1P6FA 2MCPL 3V0WL 4PRHE 4JCMA 4PJ5A 5E5LA 2QADB 2VLJB 4OLUL 2P8PB 3Q8EA 5CR1A 4XN9A 3NUKA 5BO1H 4TNWK 1KNOA 3RWCA 4AYFB 3BO8B 4Q0XL 3PNWB 3U7AA 1VFUA 2OTWA 2X6AA 4N0FA 5FYKH 1ZPUA 3O6ML 1ZTXH 5EU4B 4FQIH 1DJSA 4NGHL 3QUYD 4Y2DC 2ARJB 1T5XB 2NXYC 1E8WA 1PLAA 2WSDA 2Y23A 1CMOA 1WCQA 4Q9BA 1TQTA 3WNMA 2YPVA 4C83B 1D5MA 3QWOB 5ETUA 5IGXL 3RVXC 1QNIA 3GBMH 3RRQA 4I1PA 2ZAGA 3WD5L 4ZTOL 1EXUA 5IMOB 3O8XC 5E7FA 4YZFF 2XIIA 3QFJA 4Z18A 4OSUH 4Y4KA 3GSNA 3IMSA 3QC6X 5TGBB 1LEIA 4N3UA 3SKUD 1XQ4A 2JJWA 3P9MB 2FEDD 1XAKA 5ICXA 1CD8A 1CQYA 3MUHL 4V2BA 4AW4A 3MUGA 4YR6A 4O51B 3EAKA 1YCSA 1WRFA 2DQHL 3FRUA 4FFZH 3PV7A 3T2NH 3FT2B 2X9WA 4MKTA 4ZPTB 3K46A 4LARH 4FQQA 4PRBB 4PG9A 3E8VA 3COOA 4HD5A 1E5UI 5E9NA 3FN0H 3V0VB 5D8JH 1KB5A 4FQJH 5CGTA 5D4QA 2VC2B 1K6QL 1RZIB 1CGYA 3HMXA 3DTXB 2YBRB 1KIUB 4ISVB 1D3CA 5ISZE 4R3SA 5FO7A 1A3ZA 1YMHB 5AD0A 5DMKB 3VFRB 2JFCA 3KWUA 1DCLA 4FCAA 5EC2B 4CGTA 4PJEF 4M00A 5H35A 2TRYA 4UILL 3Q48A 4QRTA 3GMMB 3I2CH 2C7FA 4AEFA 3OXRB 4LE8A 2VSMB 5KVDE 6FABL 5CLYA 3WLBA 1H5BA 1CZ8H 3P0VL 4HKJA 2G2RB 4MJ6B 1OF0A 5TF0A 4KV5F 4JAMB 1KF9B 4WKZB 2BVTA 2QFRA 2BFVH 2VE6A 4J12A 5EOTA 1PZ5A 4HJJL 1JWSB 4YK4B 4HWEL 1CU4L 1YMMB 2ZCLL 3DRTB 1J9TA 4KJQD 4KZ0A 5DRXA 4HUXA 1ILSA 4TL5A 1RZ8B 4JY5L 2C1OA 2DZEA 2MCG1 3T6ZA 3QIWC 4FA8A 3GSXB 4YOKA 5I0DA 1JPGB 4R7DB 3GSQB 3AUWB 3KR3H 3UC0H 3S88H 5I74C 2CA3A 4OGQC 3NGBC 3KYNB 3K6NA 3TBTA 4HW6A 2CKBB 1MFUA 1HHGB 1NKOA 3G6DL 5FKPB 1FAKT 3S4SG 1CIDA 1DZ0A 3GBLA 1I9RL 2WQRA 4HWZB 2WXGA 5LQBL 2XWRA 4B9JA 3KM1A 4C56B 3VO0A 1QFPA 3QT2A 4XPBH 4ZW3A 2JJTC 4Y4FB 4JQIL 3PAVA 1P4UA 1UZ6E 2EXTA 1U95A 3MOAL 2ZPKH 3Q3GA 3LN4B 5D2NB 5IMKB 3NJMA 4I2XA 4L8DA 3UJTH 1U3HB 4H26B 5I0XA 4WUUE 1T7ZA 1BEXA 1I1AB 4J8RA 2ITDB 3QFGA 5ACLA 1LHZA 2Z8WC 4LSRH 3CC5A 4W6XB 2ZF9A 3HN5A 4S0SD 1L6XA 3IGKA 4LAQL 5HYEA 2VRKA 2ZXCA 1OPGL 1J8SA 4H1LG 1NIFA 1ZTXE 2J57A 4AQ8C 4JZNB 4LOEA 4HWBL 3U9PH 2Q7NA 3NAAH 3ZR6A 1V10A 4DGWC 4QLWA 2BSSA 1KTDA 4JM2B 1BLNB 4NI6A 2JQZA 4QOKA 5CJBA 3VFMA 4R96A 5EHFA 3SPVA 1MRDL 1TT6A 4C59B 2E76C 2IALA 2P26A 1UOWA 4WO0A 3C8HA 5FO9B 3VFVB 4YSAA 5F7LB 1YY8A 3QJZA 4R0LA 3ULSB 2DIJA 4PP2A 3SN6N 4GW4A 1NAKH 4ACPA 2BSTA 4O02L 3OXSA 5LVEA 1E9PA 1XBRA 2A74B 4PRPD 3S97C 4LL4A 4CC4A 2D03H 2P5WD 3MCYA 5A2LH 1PZ3A 2A9ML 5LBSA 3X1BA 4JKPH 3F01A 4HJ1A 4WU5B 4HS6A 4YEEA 5F9DC 4B9CA 4X6FA 5BVJB 3ECQA 3CVBA 2G5UA 5B8CC 3T3PE 2QJDA 4HOZA 5CBAA 1M2VA 3CQQA 4L4TE 4IRSD 3W1ZA 5EOCJ 4M4PA 4ZTEA 4AMKL 4N4YB 4KNQA 3UPAA 1FJ1B 3PIQA 4PD4J 5I30H 4X4XB 2AC0A 3ASNB 4CSTA 3VX1A 4G9DB 4PI2A 3ML9A 5CNHA 4WWKB 2NR6D 3DVGB 3HNSH 2XICA 3RKPA 5IMMA 3MJ9A 3QZPA 2XTJC 5I17B 2F8OA 2CGYA 3PAUA 4JO8A 2W9DL 3MV8A 1C1EL 3MR9A 4UOW1 3NCXA 2ADFH 4IHBA 4HLEA 5AAMA 2VIRA 3MV7D 4NKQB 3KPSA 4HPHA 4Q6IA 3BIBX 1RHFA 4XX5A 5DEFA 3S4SB 2WXMA 5C0JA 4QCIB 3D0VB 1WAPA 2XZAH 3FQ2A 4LLVA 4UYQA 5ESQB 1Z2KA 1SVCP 1RVFH 1XV8A 1CB4A 1GPOH 4O5LH 3WCYA 3OKEB 5GS2D 3ARDA 2GJ6A 3RY5A 2HFTA 4BCXA 4CA4A 4PM1A 4PJXA 4XRCA 3RFZA 2XNAA 1JXJA 3TTSA 5MEPA 4C4KT 2DS4A 3LNDA 4RETB 3X3GL 1XR8B 4CW1A 3BZFA 2OSLB 5DJ6B 2TRHA 2AV1B 1B4TA 2JSFA 5C71A 3EYSH 5GSRA 1OV8A 1W2KT 4XBMA 5IW3A 1U8LB 1IBZA 4BV1A 4LVHB 3VQ1C 3RUGA 3T0EB 4AMXA 4OV5A 1J1OL 3CDGA 3WY3A 4KZEL 1KN4L 4RAUB 3F7QA 3VFSA 4X7DC 3HE7D 1I3GL 4G71B 4GSDL 1PKQE 3GJFH 4YBQD 3IWVA 2QVTA 4TN9A 1SLUA 3VWKD 1YPZE 1T21A 1YC7A 3GSNL 4N0UA 1AGBB 1IE4A 4ICXA 3T8XB 2A4ZA 3MRGB 1I7ZA 5ENWA 1P0SE 1AR2A 2ICEA 4KRPC 4M48L 3L48A 3DJ9A 1Z9LA 4GQ9H 4D7BA 3CX2A 5C0DA 4N2NA 4ZMXA 2VMFA 3MLTA 4R7VA 4ZNEA 2AXJA 4PUBL 1T1ZA 3CFEA 4I7ZC 2W0LA 4KZCA 3WEXB 5LNDA 2VB5A 1U92A 2OMYA 3HLAB 2EIKB 3SE4C 3VTMA 1HEHC 3IKCB 4WUUD 5D7IB 3DV4A 2X0VA 1Z9SB 4ZX5A 4XMUA 3ET9F 1BXVA 1QPKA 3ZZSA 4DTGH 3MTRA 3HMXL 5ESVA 1GJWA 3I3BA 2VABA 1SZNA 2C4FU 3FXIC 1HQ4B 4FCHA 4X50A 4NJ9H 2CIIB 2WIMA 1ACYH 2WBJB 3PP3H 2YWYA 4AH2A 1OLZA 2XTJE 1MIEL 5EULV 4FHKA 3WO4C 1HHIB 4X7EC 3N1QC 1L7TL 2WKGA 4RZCB 3BGMA 1CICC 3CFMA 1AG0A 4EOWL 4IOFC 2HVJB 1I9IL 1TPXC 2EDLA 3FT3A 4XOEA 3MC0A 5DTFB 5BW7A 5ADPL 1GGCL 3LHAA 3NZHH 1IIKA 4MVBC 2WWKO 2QVIA 4X6CA 2VDKH 1IZKA 1HHJA 3RHWK 2JCWA 3BEWA 2PYED 2DYRB 3F7YA 2ZUUA 1H3VA 1NLBH 3BZ4B 5AVRB 3OKLB 4YSDA 1FYTB 1JS4A 2DLFH 3GBNH 5EUKB 5F7FA 1CFNB 4JO2L 1B90A 2CDEA 5AALA 3GJEB 1FNFA 2EE3A 3L1OL 5FYJU 3OKYA 4L4TD 2J4WH 3ABZA 5DLML 1ZHKB 3ESPA 1FHNA 3DV6B 3W39B 3T2PA 5GS3A 3S9DB 1DJZA 1RUKL 1HJBC 4ODVL 1C8QA 2WXPA 4M5ZL 5H94B 2VR4A 3UTSA 1KYDA 3SY0A 4GRLC 4ZXBB 3BWAA 5JR1H 4AZUA 4ZRGA 5HHXH 3GMNB 3UOAB 3D30A 2YFNA 3C5ZD 1URIA 1CG9B 4LRNH 4XP1H 1IL1A 1L4IA 2OMVA 2WXJA 2GI7A 3TVMA 4ZSOE 3WU1A 3NIFE 1XVSA 2ENJA 2GSGB 2G60H 5CP3H 1H8OA 1TQCC 3PYCA 2OCFD 3ISWA 5DK0B 3QQDA 1Y6NR 4FQ2L 1RFDH 2MPAH 3FO1B 2GT9B 4MAYA 1AHWC 4FG6D 4LLUA 1K4CB 5T5FH 1L7IH 3PV6A 4I9WD 3VI4A 4DP0X 3JTBA 4AGMA 4PREA 1NLDL 2VN7A 3SZ6A 4EIBA 1AXSB 1KJ2L 4NJAH 4ODTL 5IK3B 5T8IA 4TQEH 4Y4HC 3LKNA 3QPXL 2XYBA 3NIDB 4P5SA 5E6RB 4FLRA 4M7JL 3INUL 1XXDC 3F83A 3HBGA 4U6XA 4DCQA 8CGTA 2A9NL 5I1IH 3C08L 1WEJL 1E0OB 4PJIB 4OLXL 1DYZA 1VACB 3HAEA 4HCRH 1CDHA 4GW5B 3P2DA 4Q9CA 4G6AC 2KLTA 4LCIH 3K6OA 3ZDYB 2OMWA 4FD0A 4BZ2H 1JYXA 1ETZB 2R0LH 1DVZA 3BT2H 3QXVA 5LBSL 5TH2B 2IANB 4ZUWB 2MJWA 1ZJBA 2YLKA 3H9YA 5T1KD 3ATFA 4JGJA 3CBJB 4DNLA 4JMXA 4F7MA 5EUOA 5DHEA 4QRSA 4TVPL 4EQ2A 5DT1H 3T71A 1TZIA 4LQFH 1YECH 1B2WH 3BVXA 1FA4A 2FO4B 3EYVA 3KDMA 4NM4L 3RVTC 1PMYA 1YEJH 1OZUA 2V8MA 4AITA 4KUCF 1FUNA 3LN5B 3LRKA 1UHVA 1DQQB 3ARQA 3D39B 3IN0A 4IGBD 4W6YB 5HGBA 3G5WA 3MJ9L 2WANA 1CDGA 1CQKA 1SHMA 4KXDA 3B9KA 2Z91A 3SOBH 1E8XA 3LZFH 2GI0A 1D2OA 2RBLA 4MMXC 3RI5K 4JDZB 5ID0B 7FABH 2JKTM 3EG9A 4PH8A 3U0WL 2PR4L 3ESNA 5C0FA 2OJEA 2OXHA 2XFXA 4KI5E 4QXTB 3OKKA 2J71A 1JNLH 3Q5OA 4XTRD 4PAZA 3QCVH 4NXSA 3O6KH 3FHEA 2DMCA 4HZLB 3CFBA 2DDQL 3ULAB 4KVNL 4R90H 3VRIB 2XN9E 4IEFA 2PPEA 2NW3A 1ZWIA 2VZSA 4XWGL 1BVKA 4YPGA 3IFPB 5E99L 3G9AB 2CH8A 3IAQA 4MDRA 4X80H 5AYUH 1TYEB 4FZ8H 5KS9E 3TBCA 3P4OA 3CN4A 5I2IB 1PCSA 4LCUB 1LXMA 2XBTA 4JO4H 3FT4B 1G7LB 3D48R 3L3JB 1B4RA 4UF7C 1H19A 3ARFB 5CJXC 1CT8B 4OB5L 3QEQD 4QRRD 4ZUTA 2N1TE 4ZYKB 2OMUB 3QUYA 3FJTA 3RZCB 2VOTA 3UYOD 1N7ML 3UDWC 2MPVA 4GEIA 1FZMA 5I15L 5DJCA 4XPAH 4M1CC 4K5NA 2PO6B 1NIEA 4JRYD 2G5BB 3RGBA 4PS3A 2QQKH 4FXKC 5F9WB 4Y5VA 4NYLA 3PGCA 4OZIB 3E8UL 1SXSA 1J0KA 2JJSC 4EN3B 3SDYH 1XZWA 1GY1A 4JG5A 2QPUA 3K6IA 3QZLA 2MHAB 5IESL 3V4PH 2JQMA 4L9DA 5MP6L 2L7UA 5FUCE 4UNTA 3KPNA 3QPQD 4IBQA 3TV3H 1F6LL 2QQNH 3GINA 4Y0GA 3IJEA 4MQXD 5I75B 1GGIL 3PE9A 4N6QA 2FJSA 5CEXB 4WUKH 1JWUA 2H9GB 1KC5H 2JCCA 1OW0A 4X2UA 1DO5A 1SOSA 4FFYA 3EKCA 5I18L 4G80A 2DWEA 3M6DA 1IE5A 1MCRA 4F93B 4L5FE 5ID1A 4XBPB 4OFDA 1U8OA 1V8HA 2XZCL 3EH1A 4LHUB 4Z95H 4Z5RB 2BNUB 3MROA 4PJGF 4ZMQA 5ACMA 1A6PA 4HBCH 4XVOA 3SBQA 4MZ3A 3L9BA 2ZOWA 1UACH 4QHLA 4G43A 3HVDA 4BUQA 3QRFM 4JN1L 3L2MA 4XZUA 2VQ1A 4PJBB 3BVDB 5EEUA 1AJ7L 1JK9B 3MUUA 4MJHA 4XPFL 2PUQT 3SEPA 4EIGB 1HSAA 1OTSC 2BSEA 5BV7H 3AQXA 3VFTB 1E4JA 3EHBD 2AK1L 3OJDA 5EIIA 3G08B 2J1ZA 2OMNA 3FAWA 2VZOA 1IQWH 1E4KA 4JFOA 1CFVL 5TJWK 3MUZ1 3MUY1 2YARA 2Z31C 4KC3B 3LDBC 3B2UC 2HFGL 4P5TB 3WFEL 2AQ2A 3CWGA 1KTLB 1LMKA 4D94A 2VUOA 2C3XA 2YSTA 4JZOA 4EI5D 2FIRT 3DK2A 4X8JB 4LNRA 2WZ6A 1UTDA 2PWGA 3OGCA 1C5BL 4NN5B 1EXGA 1KELH 4L9LB 2XQBL 1QZ1A 3DURA 3QI9D 4YLQT 1BAFH 1P7KA 5IT2H 3WFDH 5KSUB 1YDPB 1YEIH 4ZMAT 3I3EA 1UFGA 4G5ZH 2XXGA 4FRWA 2WCSA 4K94L 1J48A 2X9XA 4XOAA 5I19H 5EZPA 3IFLL 5BV7C 1JZFA 3EGSB 4Z0XB 4JRXD 3RIAF 5IFHL 1FYHB 4YXKH 1ZA6B 3OKNA 1CYGA 2H0FA 2P3YA 4J3OD 2IPUK 3E3QE 4NZDA 1MLBA 3RL1B 1UB6A 2QR0B 3C8DA 4DN3H 4GRWB 3SBWC 3FO9A 3QBTB 3K2MC 2PYFA 4I13B 4DN4H 1Z6JT 1CXHA 3D18B 2H3KA 4M6ML 2R2HA 2D8KA 3QA3A 4GG6E 3WXVH 3AY4A 1JZIA 4X0KA 5GRVK 5ABZA 1KCRL 2WN3A 3R18A 5D1ZB 2O5XH 4X6DE 1RJLB 3L5WB 2YD3A 5DWUL 1RY7B 3T0DA 1YEHL 5IB5A 2R0KL 4M7LL 4NIKB 5T5NF 3WY2A 5CF3A 3AACA 1OAZL 4PRHA 4FQXD 2Y5QA 4WI9A 3CD4A 3DWTA 4JG9A 5D1XB 4HJSA 3GJFK 1M9WA 2BSDA 2QVMA 4TNVF 1O0VA 3DUSA 4FJYA 1BFSA 5DVNA 1C16A 3TZVB 3L08A 3LQAH 1DBJH 3EH5B 3R1GH 3GI8L 1XGRB 3OKDB 5D93C 3U9UA 1JDDA 4IDJL 4F2ME 2X6BA 2DQIH 2P5EB 3BLPX 3VFOA 2XZZA 5F7WC 4ZFZB 4NZUH 4D0BA 1CUOA 3PG2A 5D5MF 4IKIA 5AFAA 2FX7H 5AAWC 3UZVA 1SRDA 3PL6D 1A9VA 4MNQB 2X2HA 3HE6D 4LIQL 2W94A 1CE1H 4GSRA 4PRPA 1A4CA 4V1DD 2IWGA 2DQUL 4X98A 1SDYA 5HHVH 1SLVA 4CAGA 5HJGA 1CLYL 3MGTB 5D7EA 5E6IC 1O5PA 2MTAA 1NCBH 4ELKB 1F90L 2HN7B 3IDGB 3TCLB 4J39A 5F9OL 3SCMC 4ODUB 3EJCA 3KL0A 1A7NL 1OB1A 1B0RA 4IRSA 2CJUL 1S7SA 4DGIH 4GXUN 4KOBA 1AQDA 5DFVC 3GSWB 3LQZA 4U4BA 2Y3NA 3LQAC 5ITBH 1L9QA 3G6JA 1M71B 1PZCA 1A8JH 3P4NA 4NENB 5DRWB 3U1QA 1N2RB 3Q8BA 1XF5A 1JVKA 4MD4A 4ELMB 4A2MA 2ZKYA 1M6OA 5EBGA 4ZS6D 1RIHH 2UZPA 2DJ4A 3AQYA 3BP5A 5ISZA 1NC4D 4N1EA 3UFIA 5LUMA 5A3ID 5F7EL 1NGZB 4EVNA 3GSRB 3LRSA 1AI1L 2GAZA 2GIXA 2HT2C 3S5LG 3WBDA 1CLOH 1WZ1H 4GINA 4QEGA 3RX5A 4JGNA 2F19H 3HNTH 1EZSA 1SXBA 1KBGH 1S7QB 5I1JL 2VDQL 2I9LA 4GQPH 5CN2A 2ERJC 4AXWA 1QFUL 3RI5F 1HCFX 3IMBA 5TK4A 2WLYA 1OP4A 5HDWA 3EBHA 2ZSWA 3L7EB 5HXMA 4CMHB 4U1GB 4TLTA 3JWNG 3NVQA 2Q7YB 3ABGA 2BVOB 3WIHA 3CXDL 5JPMA 3ULUD 3GMPB 2MCAA 4DKAA 4WFHE 4OJEH 3V7AE 2G9HB 5AW1B 4HX1A 4O9HL 1GJUA 1OAQL 1T89C 1BGXL 3GMQB 3KLAA 1HI6A 5F8RC 4TVUA 3HG2A 4N6RA 3R8QA 2BMKA 4F57L 1DDHA 3FU7A 1WFMA 1ZLVH 4OFVA 3VWJD 5JLZA 3GEFA 2BO0A 1MFCL 1YA5A 2W9EH 4AM0B 3QUXB 1NCCH 4WSJA 4Y16B 1K5NB 2A0LC 4RMWA 4GW1A 3NH7L 1QFOA 3CVIH 1TUPA 4MZRA 1Q8MA 1DN2A 4MB1A 1KBPA 1JFQL 5BZDB 1QASA 1A6UH 3QDMB 4FE9A 2CO1A 4FYTA 2IBGA 4RMSA 1XEUA 4TUOA 4CU7A 2X4OB 4WUUA 3CXHK 1A2YB 2DPKA 1E3ZA 1JWMB 3WNIA 1E27B 1KYUA 2D0FA 3L8QA 3LX9A 5HYJD 1KGYE 5FWQA 1AR1D 3L3GB 5DS1A 5JDJA 4QGYA 5HHOB 3TJEH 4N9GB 3VXOA 5IEHB 3MLUL 3FB6A 4XH2A 2EIZA 4FZEL 2A73B 2DLHA 3MSPA 2YPLE 2DEXX 4S0TD 3BXNA 4IBYA 1TJHL 1R0AL 4ZAKB 1ZXKA 4KJYB 3REWB 4A67A 3EH3B 3SKOB 3HRPA 3C12A 4H8UA 5DCCA 1ZSDB 2ZKXA 1MEXL 1D9KD 3WJJC 5KN5A 5CN3A 3BVNB 2GTZB 3EYUL 1XX9C 4PV8A 5HDLA 3EUUA 3FFOA 4PY8I 5F71A 1MCPL 1GA2A 3DX7A 3UGXA 2E5EA 2BC4B 4LP4A 3KBEA 4XNQA 4NNPH 3VXRB 3F12B 3BE1L 1LEKA 4UANA 4OKVB 3LKSA 1IGFH 1XGYH 3APCA 1BIHA 2HRHA 5D7JD 3CG8A 1RU9H 2RR3A 2X4UB 1ZJAA 2PYEA 3PNRB 1QEWA 4OQTA 3TBYB 2X42A 4A66A 4ZOAA 4KAQH 1P7HL 3NPZB 1UURA 2FH6A 4J3VA 2XQYA 4JB9L 3WGUB 1W72H 4MA1C 1TEGA 1OCOB 2RGSA 4V11A 1AOZA 4L4TA 3LZQA 4APQC 5J1TC 2XC8A 1N5AA 1NCUA 3P0YL 5AW9B 3TT1L 3W5MA 1BVLA 1L6PA 4IK7A 2YAOA 3ERXA 3SGKA 5KG9A 1N6UA 2ZP0T 3KVPA 3N85L 1C12B 5B7FA 4X7CC 3QXWA 4YLBA 4ETYA 4I0PC 5L9DL 4IJ3B 1KJ3H 2D0GA 1IM3B 2ZX9A 3KG5A 1IEBA 4YSSA 4AC2A 4GO8A 1HEZB 1U9KA 3ZTCC 1KCWA 4GP4B 4MDJB 3KZ8A 1DP0A 5J9PA 1OCZB 1V7NL 1NGWA 4JPIA 1VKXA 2PW2A 4N0CD 1C9SA 3ZQWA 2ED9A 1J1PL 3PFUA 4WK0B 2DICA 2CK0H 2BZCA 2EYTA 3JBG7 4DAGH 2QQLH 5BO0D 4MYWB 3WEMA 5L8JB 5AVQB 2A99A 2K7PA 3GUTB 2O93L 3BSZA 1WK0A 2EDDA 1E7UA 4MXWL 3IJHA 1F5WA 1K8DB 5D70H 3KWWA 3FQTA 5I1AB 3QIBD 3SYOA 3GIZL 2DBLH 3OGOE 1M53A 1WWAX 3ALWA 4R4ND 4DZ8B 3BN9D 1EQWA 3JTSB 5EBWA 2EIEA 4JFTA 3EDKA 3LB6C 2YRLA 2C9QA 2N7BA 3C8KB 1CGXA 3CN0A 2XA3A 4NOBA 5CSGA 4P9MH 3RGVC 2HTLD 3FH8A 4OLYL 3SBPA 1NPNA 4FLQA 5KW9H 2Y6TE 5KSAB 5I9QC 5AVXB 4CGUB 1A1OB 1P1VA 1BM3H 4MA3A 2XACC 5IG7B 1PKQA 2WQVA 2V7NA 1I8MB 3ILDA 3T0XA 2XKNA 1YPZA 1FZJB 1NEPA 2NY4B 3G7TA 4Z78B 3FB5A 2C9VA 2Q20A 4G70B 5BXFA 4BZ1H 2RA1A 5AL0A 4KVCL 3K74B 1AY1L 2X6MA 1RULH 4FTVB 4QRPE 3HI1A 3C6SB 1YYLL 3R8BB 4K07A 5BRZB 4XWOC 2JIXB 2D7QA 5JOFA 4GPVA 4I1NB 2J5WA 2OAAA 2VLRB 5JW4R 2BFGA 3DBSA 3ZKQD 1QQDA 4IGBA 2GTWB 3ZYIA 5C92A 3C5SA 4YDMA 3RVUD 4E68A 2LAGB 2EZ0D 2XTLA 4ZMVA 1XGUA 2GJZB 1J8HB 4R4BA 2GTQA 3HUJA 2TSBA 4PTTB 3BGFB 3DX9A 1G7PB 4LSSH 2YPLD 5JPNC 3GM0A 4Z7VA 5EO0B 1FV1B 1QLFA 2R51A 1UYWL 1JGDA 4X7SH 4WGKA 2IH1B 4FHBD 1BX2B 3W3BA 5KVDL 4LSUL 2ZXGA 3QUML 1RK1B 1KGCE 2CO6A 3WFHA 2AGJL 1R3HA 4NLHA 1OCCB 4WEMB 1K9TA 1ACCA 2WLKA 3STZA 3DOSB 3UMNA 3SE3A 2N56A 3S8GB 1KCVL 3SD2A 3NIGE 1LO2L 2Z4QB 2QGBA 3GZOA 4LLAA 1ASQA 4WW1A 1UC6A 3NJLA 1IJ9A 1SBBA 5FHBH 1BFOA 1B3JA 1EJ8A 1RUPH 1YHPA 3B3BA 4URKA 5F3BA 3D3VD 2R29A 4UU9B 3BRFA 2V6HA 5GGUA 3BZEB 2C7UB 1TMQA 2KS0A 3L4WA 5DD6A 4GMSH 4NNYA 4O02B 2ROXA 4PV1C 4BQ9A 4NHUA 3MFFA 4BD4A 3KPLA 4JDTL 3SPIA 5J0BA 1G7QA 2BIMA 3E2HC 4OJFH 3UCQA 3PWPE 3QEHA 4KHXH 3X13A 5E4AA 3QEQA 3II1A 4QRRA 4AQAA 1UCBH 4ODSL 3VDCA 5AYQA 4GXVH 1UT9A 4M6OL 2Z7UA 4DF9A 3OBAA 3V8OA 4P46C 3B8SA 3W11C 3TEUA 1I53A 4JRYA 2HAZA 3PGDA 3ZDZF 4MJ5B 3LKOB 4KFZC 2ZF8A 4NUMA 3V2AR 1W9XA 1JXDA 1FG2A 3DX8B 4G8GB 4K73A 4I3RH 5FOJA 1JXGA 1ETJA 3DX2A 2OR9L 2MNUA 3CNKA 2NYZA 2OYLA 3AB0B 3BVTA 4IIQC 3GMRA 2F8IA 1N59A 2WKOA 3B7SA 4PB0H 4JREB 1QACA 3AWGA 5GRYA 32C2A 4ZSOA 5EMYA 1VPOL 1IGCL 1AAJA 3BH8B 4WENB 2YAQA 2ZXEB 1ZTXL 3J7HA 3LXCA 5DJXA 4K8RL 3V52L 5FV2A 2GBTA 4KRMB 5I71C 1MKFA 2BIOA 3HG3A 4HUNB 4YSQA 4C4UA 3PPSA 4JPKH 4A7SA 1KIRA 3U1SH 5TE4L 5ABDE 1DVFB 1JZ7A 3ESMA 1MCFA 3BP7B 2F1AA 2V3DA 5DFWH 5JW3H 1KNOB 5HI4C 3RWCB 2YPKB 1JD7A 4N0FB 4PCTA 2RHEA 5IBTL 3GBML 2NMSA 1J5HA 3TOPA 5KBKA 3EOTH 4JY6A 2VQUA 3WN5A 2C5DC 3K1KC 4OSUL 4P23C 2IGFH 4U6HB 25C8L 1P84K 3OSVA 1LQBC 3QG7H 1D5MB 3LZNA 5ETUB 5I0ZA 2UY7B 4F58L 2WVTA 2X1WL 3LS5L 4H8QA 4RA3A 1R3IL 1FSKB 2HFEA 5AZEH 3WLWD 1EXUB 1Y6KR 4FFZL 1JHTA 1CXLA 5CZKA 3LS4L 4QRPD 1J0HA 3QFJB 4HXBH 3F7LA 4PJ9A 4ES9A 2Z8VC 3GSNB 4LARL 4WHTB 2XWDA 4EI5A 2YD5A 2G30A 4BHUI 3ZGHA 1TNMA 2WYHA 3FN0L 1LGVA 3SDXA 4YHKL 3MUGB 4HHWA 3FULA 5HYQB 4M29A 3D25A 3HVNA 3EOYG 2B16A 4IRZA 3QQ9D 4R4FH 4FQLH 1MCCA 1YC8A 3IRZA 4FQQB 4ZX6A 3V0IA 4PG9B 1KB5B 3CN2A 1N12A 1KULA 3ECUA 1FBIH 1HDMA 5FA3A 4KQ0A 3BSZL 4LDLB 4JRXA 1CZ8L 1YG9A 4M7KL 5F0LB 5HHME 1PZBA 4R3SB 2JE8A 3GLAA 5FO7B 5AD0B 3MMEA 2VXUL 4GY4A 1CD0A 6TAAA 2ARJQ 3V6BR 5KVFH 2BFVL 2FGZA 5H35B 2VISA 3LSOA 4QRTB 2XN9A 4XP9H 1T3FA 5M95B 4AJ0A 4YHYB 1KLGA 2ZWYA 2BVEA 3WLBB 1H5BB 3JV5A 4HKJB 1BBJA 1PD1A 2AK4E 2E6PA 3OZKA 1QVOB 5AKTA 1XB3A 5J3HC 4AK1A 2FJHA 3HHMA 4PY7B 1NMCC 3PQYD 2VE6B 5T3ZH 3KR3L 4DKFL 5IFJA 1XZ0B 3H9ZA 4FQXA 5EOTB 1M7IA 1AHWA 1MCEA 5K59E 2A9DA 3L4ZA 1VFAA 3GO1H 4HUXB 3KEDA 4X9FA 5DRXB 4X4MA 3D05A 2K8QA 1ZLVK 3V0JA 1BOGA 4DP6X 2P49B 3ILPA 5FWRA 1E4WL 5I73C 2HA1A 5GRWA 5BQDA 3ZTJH 1O6SB 2QHRH 1A9EA 4DP9X 1G9NH 5DJ2A 4NWTH 4XPBL 3D07A 1U8JA 3I9PA 5CJQH 5KBMA 3VSVA 2QZQA 3TBTB 3CFQA 3U9WA 3O9WC 4CBPA 3UTTD 1OHZA 2VT0A 5EU7C 4JEGB 4YZWA 5LBGA 2YK1L 1FFNB 1DJXA 3HE6A 3VCLA 4K5PA 4I4WA 5I16A 1FGVL 3OHMB 2DY2A 5J6GA 3APMA 4LSRL 5D1QC 5E00A 2IAMA 5I6XB 5KAQF 5AW8B 4LVEA 5M94B 4A7GF 3QQ4A 5AZUA 1U95B 2VXQH 3Q3GB 5FF6A 2Y06H 4I2XB 3KLLA 4L8DB 4PW4A 1F11B 3FCUB 4XXDB 5CZXD 3U2JA 2Q86A 3P9LA 3GHBL 4J8RB 4KGJA 3U36A 4YBLC 1ML0A 3CC5B 4LP8A 3OJMB 5TQ2H 1RLWA 3BH4A 3ZZLA 4CNIB 3IDYC 2BY0A 4WU7A 2ZUVA 2MOQA 4UQCA 1G9NC 3EGXA 3Q7JA 1NAKL 4K7PY 4JQXC 5I1LA 1AMYA 2BSSB 1KTDB 1HOCA 1A6AA 3QNXB 5F9AC 3VAEA 3V79C 1J05A 1KJ2B 4J3WA 4R96B 3SPVB 2Q6WA 1NC4A 4NC1C 3VFMB 1OALA 4B9IA 4YAQA 2D03L 2IALB 3WS3A 4XP4L 4A2FA 2EC8A 1TNNA 1PYWA 1OT4A 2A83B 1YY8B 4KGLA 4R0LB 1V54B 4PP2B 1RZPA 4N24A 4GW4B 3UABA 2BSTB 4RMVA 5EBLA 2XSKA 3OXSB 5EA0H 1E9PB 1P5UA 3HC4L 5GZNC 4C8XA 3LH9A 2WM0A 1A4JA 3KVDD 3ARGD 4U3XA 1XMEB 1SXZA 1DTUA 2WINA 4HS6B 1J9SA 4OCSH 3WNPA 3EYOA 4X6FB 4FS0A 2KI6A 3HKFA 4IKJA 1SOKA 1UEYA 1FRGL 2GIMA 1I8IA 5CBAB 3IDUA 1WQVT 1EWHA 1M2VB 1T1XB 2C3VA 2NNAA 4NQTA 4Z7NF 3I9GL 4NQDD 1DQKA 1WZLA 3RDTC 1S78D 5EOCH 5GGVY 4EJ1C 2ADFL 1SJVA 3NJGA 4X0NA 3ROLB 1A7OL 3PIQB 4S10A 1PDKA 2ZE0A 4QIRA 4KVPA 3MLZH 1I8AA 4JKNA 3W56A 5IMMB 1MI5D 2Z1KA 5CEZH 3FF7A 1GPOL 2EXYD 5CJOL 3VWJA 4ANKA 1J0YA 3LXUX 3AREC 4N8VA 1CFTB 4JFUA 5E6ZA 2P8MA 2VIRB 3KPSB 4FP8H 4LCWE 4OR1A 4LLVB 2DQGL 5SWZD 2MRYA 3MA9L 4UINH 1JYWA 4XMLH 3Q2LA 5C0AE 1NDGA 3ARDB 4X6DA 5KSBF 3O3AA 4ODWB 2AK4D 3TLRA 2PPDA 4NZTL 4JG0H 5EZIL 3NCCB 4KDTA 5F3HB 3VGGA 3SQBA 5HYJA 1UWEH 4PJXB 4XRCB 2XNAB 1AD0A 5I1KH 2XYCA 1UD8A 5FK9A 3ZBMA 3HMWL 5INCB 3FCTA 5DRNA 1MAML 4KPHL 2X2JA 1F4YH 3I6KA 4JGUA 1MG3C 5ESAA 2DBJA 5GSRB 3AROA 5L2KD 5HYIA 1BQKA 1VEOA 1EAPB 3RUGB 2NNFA 4KKCD 5GS0D 3ILQC 1EO8H 2F58L 2L7QA 4JFDD 4OV5B 3CDGB 1AGEA 4L1TA 5E8EA 3VFSB 15C8L 1CL7H 5EO9A 1HL4A 3APFA 4F2MA 2HX8A 5IJCC 5DD5H 1D9KA 3Q5TA 5HDQH 3VJ6B 4KJWD 5LXGH 3LHPH 4XI5D 4JLRA 4KUCD 4KOCA 3H2QA 4EZJA 4AQ1A 1T21B 3O3DB 4NQCD 3DBXA 4GI6A 4N0UB 4LF3B 1EHXA 2BW4A 3W0WE 2XRAL 1XCTA 1I7ZB 1D6VH 3V5HA 3S8WA 5ENWB 1TQUA 2VDRB 2ICEB 1TU2A 1AANA 1EJOH 3DIVA 4X9HA 1I8KA 4KKLD 4DTGL 5D7JA 3MZTA 3HC3H 4YFEA 4MLIA 3WKMH 5I76A 4X7FC 3X11A 2XN0A 5K9JH 1L0XA 3TF4A 1T1ZB 3CFEB 1G7JA 3QUHA 1U92B 2OMYB 2BVQA 3WJMA 1ZV9A 4W9HC 3DV4B 1KXHA 3EGDA 1AZBA 3TA4D 1G1OA 2P80D 5MEOA 3IDJB 4ABQA 5DDHA 1BVNP 2R69H 3WNNA 5FM4A 1A0QL 2VABB 1P4LA 2NXZD 1ZT7B 2BH0A 1UJ3C 1A8ZA 5IVZA 2JKSA 2ZCHH 2VH5L 4OCLC 5A7BA 1SEBA 2DL2A 5TDNA 3KPRD 5EN2A 2AAVA 1JPEA 2VDKL 2ZXWB 3FO2A 4S2SA 1NICA 4N3TA 5FYLD 1P9MA 2E86A 2FEEL 3FCSA 3KPPA 1EBPA 5GISH 2VXVH 3SBWA 5I1CH 1JSYA 3V7MA 4L8SA 2J44A 5BVPL 5K5YA 4P0DA 3GBNL 1D5IL 5BRPA 1SLWA 3RB7A 3FT3B 2EEXA 1BXUA 1KB3A 2J4WL 2VR5A 3IFNH 2H7WA 4M9OA 1HHJB 1SJXA 3AAZA 2QSCH 2WTOA 2PNDA 5JHLA 4ZO7A 2H0PA 3SDDD 1CF1A 2X1XR 1RIVL 3JZYA 5D5ME 1E9QA 2X6CA 5H4ZA 4U1JA 5T1DH 3MCKA 4JZJA 3OTTA 1GKEA 5DQDH 3U7WL 3NSXA 5KZCD 2OULB 4K4KA 3DTDA 5HHXL 1JE6A 2K8MA 1D7BA 1ZOXA 4M5SA 3NA9L 4EXPX 2XY1A 1G94A 4ENED 1Y1DA 1MN4A 5FHAH 1ZT1A 5DMJB 2Z93B 2FEEI 1XHHA 2CKBH 5CAYB 5TPWH 3SY0B 2I24N 4WTZG 3BWAB 1HILB 1A64A 1R5VB 3UPRA 4RGND 3RG1C 4Y1SA 1RFDL 4ZMPA 3C87A 4PJHE 2VN4A 4QAWA 4Z7WB 1T6BX 2AQTA 2UWEE 3Q8CA 1L7IL 4WO4A 5E2JA 4OUUA 5T5FL 4EPSA 2OMVB 3B3IB 3MXVL 3MLYH 4NJAL 1RP9A 4L5FL 4TQEL 4YK4C 3K2KA 1JDAA 1VZHA 4MCNA 2LU5A 3CZUB 2XG5A 1UOKA 2SODB 3QQDB 1WIUA 1DSFH 1BZ8A 2XQ0A 3PGFH 4MAYB 4LLUB 3KPQA 4UOJA 3PV6B 3VI4B 2F53E 4QJ5B 1MELA 4PREB 1AKJD 3RL2A 2YPLA 3LKNB 3BT2L 5E1AA 4PJ6A 3WHXA 1JNHB 3CMOL 1E40A 3P4MA 1KMGA 1DFXA 4U6XB 5CGYC 1P6WA 5BJTA 2QLYA 1NOLA 2F7OA 5DT1L 2J73A 2Y3AA 4P2QE 2NY3D 2X12A 5AVSB 1YECL 1B2WL 5DMIH 2OMWB 1U91A 3NJIA 2R7EA 4MD5A 4A6YA 4TSBL 3MRNA 3B2DC 4Y4FC 3K2UH 1U93A 3HZYA 5GGSY 3DUHA 1S5HA 3PUUA 4F7MB 5EUOB 3P2TA 1P7BA 4QRSB 1J9QA 5D2NC 2F18A 1M2OA 4JFQA 3IGUA 3D3VA 4N2CA 1U3HC 1TZIB 4FMFA 1I1AC 3HG1D 5F44A 4Y9CA 3EYVB 3KDMB 3D34A 3VGDA 1AP2A 2A6JA 2K7QA 2X89D 3LCYA 4MCMA 2QT6A 2XA8L 4X9YA 3QORB 4MA8H 7FABL 1ZE3H 3EDEA 4WEBL 5AZEL 4TPRL 4Y2DD 2D7OA 2NXYD 5J11B 5I66A 3BKYH 5JMOC 2G0LA 3O3BA 1JNLL 4JM2C 1ZSHA 3QCVL 4X6EB 5B1JA 4ZD3H 2DRUA 1MCSA 2IEPA 3B9KB 3O6KL 4KROB 4FKEA 2Z91B 4P3DA 5AL8A 3TP4A 4R90L 3RVXD 1OAYH 4AMWA 5CD5C 3EG9B 5C0FB 2OXHB 2XFXB 4UOW0 1SJHA 3OAUL 1JCKA 4X80L 1BQHG 2NTSP 2A74C 3PP4H 1ZHBA 2PKDA 3V95A 3CFBB 4Z7QE 2YUZA 3WYRA 3L5JA 2NW3B 1MDAA 1W6WA 1ZWIB 3H2WA 1BVKB 1H0DA 4GB9A 1YMME 4H20H 1F18A 4G7YL 2YMXH 3VI3F 3GRWH 5CFHA 5ILTH 1TFHA 2R15A 2FB4H 3ZXAC 2FJGA 4HC1A 4E0RA 3QZWA 1FVDA 1ZE3C 1AMXA 2KUTA 1TVHA 4PV9B 4QPEA 4XPAL 3T1WA 2HRGA 2VDQB 2WO2B 1UXWA 3X12A 3U83A 2FWOA 3BWZA 2IV9A 4N2GA 2CGRL 1KYOK 2QDVA 3QIUD 4ZUTB 2GHWB 3SDYL 3ZE1B 1AXTL 4UT7H 2RB8A 4XPTH 3TEXA 2P1YA 3GM8A 3V4PL 1EBAA 1ZANH 4OLWL 3ZL1A 5DJCB 3QO1A 3HN8A 3TV3L 1F2XK 1XAUA 1GYVA 4Y5VB 3MXWL 4NYLB 4XAKE 1G87A 2WK2A 4YUEH 1KC5L 4EXKA 1LTXA 4QF1A 1NSNH 1BF5A 3CFJB 4OD3L 3IT8D 5DS2A 5FO2A 4QRPA 2H5UA 2HKHL 2ZKMX 5D2NE 1QSFE 4GAFB 4Z3EA 2E27H 3KPNB 3UZQA 3OSKA 3IJEB 4HBCL 3NJVA 1BVZA 4DVRL 1JPTH 4WJ5B 1HXYA 1UACL 3OJVC 5AB0A 3FOMB 1JWUB 1NCJA 2K9FB 1RPUA 2JCCB 4N2IA 4TULL 4LVHC 1EZVX 2FSDA 2DWEB 2G75A 2H2SC 3T0EC 5ID1B 2VWEC 3JUZA 4G83A 3QDJD 3MROB 3N43B 1ZKAA 4DP5X 4J4PC 3SGDH 4LNVA 2Z3FA 5JHMA 1PNDA 5EORH 4QHLB 1OT1A 4G43B 1IQWL 3MV01 3P11H 4XZUB 2VQ1B 2Y07H 2APTA 4NM8H 1A66A 4X99A 4HG4J 3RBSA 4HT1H 2PXYC 3NCYP 1MF2H 3CPLB 1UATA 5HDBF 4DIXA 4DQOH 5AVZB 5FO8A 3N0PB 2EE2A 1HSAB 5CSZA 3K81A 2P52A 1MJJA 2BP5M 3OJDB 5J8OA 5LLIC 3P0GB 5ANMA 3VNYA 4JPVL 2Y2TA 2L0DA 2EH8L 3QGVA 1GTNA 2WXNA 3BMWA 4DOHB 2VZVA 4D7PA 5IHUH 1PSKL 4YN3A 5I0YA 1DQLH 1E7VA 4HEME 4G6KH 1N0XH 4ESKA 2Q8AH 1OE2A 1YEIL 3PQYA 4LNRB 4YHLH 3UTPE 4BWUA 2Y1ZA 4ZNCD 2OZ4H 2B2XH 4JPWL 3KBFA 3ZKMD 3DURB 5BS0E 3TJHC 3FUHA 4YXKL 1G4RA 2WBJC 1P7KB 1BWMA 2WTRA 2V17H 3BPCA 1X9LA 4DN3L 2IH8A 4TQ8A 4EF3A 4GS7C 4H0HB 4HZAA 4HUMB 4IOSD 1QUPA 5T1LA 1CN4A 5EEWA 3WXVL 1WDAA 1GC1H 2Y7QA 4A2GA 3O4OB 1J87A 2O5XL 1N8ZB 3OKNB 2N7SA 3MRCA 4OGZA 4KKNA 1DQMH 1MLBB 2DIEA 4HJEA 1L9RA 2RAMA 5DWPA 1S7WA 2PYFB 2C3GA 2DWXA 1C8PA 2VZ3A 4NN7B 4Z6AT 4PJAF 2R2HB 3H42H 3HHSA 3T6XA 3QA3B 1UM6H 4YDNA 4X0KB 1KXVC 3VFWA 1AYOA 1QEXA 2YKLH 4PJFF 2EXWC 1KWKA 4DKDC 3R1GL 2HT4C 4PRHB 4NAJA 2VITA 1QZNA 3I6SA 2DQIL 2UXGA 1Q0YL 3T0EE 5JZ7C 1ANUA 2YGOA 3LZOA 4LRIC 3DUSB 3OHXC 1UVQA 4NZUL 5D4HA 4OZHF 3VH8A 1QMUA 4A6YL 4J3SA 4ZXBC 1Q9KA 4S1DC 3U9UB 4S1RH 1GC1C 5FYKU 2H3NA 1DHKA 1N3NA 2R23A 1WITA 3S5ZA 1B9ZA 3BZDA 3D2TA 5HHVL 3N6YA 5FKAA 3CSTA 4OGXH 3H2PA 4HFUL 3UZVB 2QV4A 1ZDSA 2XV0A 5DD3H 4RRPM 4ZMTA 1XSJA 2IC2A 1K4DB 4X98B 1AD9A 2H0EA 1KGJA 1JOIA 2MKWA 3QULB 3GD1C 5ITBL 4K9EL 1ZY9A 4GI8A 4LHQB 4NSKA 5EF2A 2LFGA 2FSEA 1FFRA 1Z1WA 5DJ0B 2DKUA 1F8TH 1FGNH 3OX8A 2XDHA 1OB1B 1ZVNA 1B0RB 4IRSB 4PRID 1RIHL 4NQDA 1S7SB 4Q56A 5FX3A 4YE4H 5I26A 3TWYA 1AQDB 2YA2A 3QXAA 2M83A 5J57B 4FFWD 3LQZB 4P5RA 4U33A 3E6HA 1JJUA 1T83A 1BVOA 5E4IA 4PEEA 2Y7SA 3VA2C 2UXFA 4PLJD 2UZYA 1WZ1L 4MD4B 1WFNA 4QY8A 2DLIA 1S8DA 3ZL2A 3HNTL 1M6OB 4O00A 4FAAB 5IMLA 1UT2A 3BP5B 5ISZB 3L9RA 3QDGD 3L4CA 4QGTA 2B4CH 4QT5B 3LRSB 2AEPH 5GQBA 4ANVA 3EYFA 2GAZB 3IMVA 3K8KA 2HJKA 4E9XA 1MREH 2ZX7A 4ZFFB 1PEZA 3ENEA 1JPFA 5L8LB 1JF5A 2AK4A 5TFSL 2I9LB 1RK0A 3QO0A 3D4GA 2LLGA 4AXWB 2WJ5A 2VJ0A 3QQNA 2BWDA 3VXSE 1CR9H 2B1AH 5IIEA 3FFCD 4HS8L 2ZSWB 1S9XA 3IFOA 3M88A 3TO4D 5CD3A 4HUKB 4DEPB 5TQ0L 4MRBA 3WFZA 5JPMB 3H0TA 3ZE2E 4HX1B 1K8IA 2W9EL 7CGTA 1D5ZA 1NCCL 1HI6B 3KLAB 3MRIA 3GIVA 4N6RB 2H8PA 3RFRA 2WWMD 2BMKB 1UM5H 3CVIL 3SO3B 3U25A 3FU7B 5B39A 2B4CC 4AI7A 3P3TA 1OHQA 4NQCA 4XE0A 5E5RB 3VXTA 1GS7A 5JLZB 1E42A 4CC1A 2R9HD 2YD9A 5D9SA 4HKXA 3MUJA 3ZYZA 5C2BL 3MA7A 4EAEA 3O8XB 2MQ0A 3NSCA 1OCWL 4JNXA 4PMFA 4Y5XC 2NSQA 4UMSA 3MFGB 1ROCA 5BCAA 2BNQE 4OZGE 4TUOB 3Q2WA 4WUUB 5HDRA 4DVBA 2OK0H 1M7XA 2FECL 2P80A 3ARFC 5EPMA 4NKIH 2ZCZA 5KJRH 3WNLA 4GBXC 3VXOB 1JRHH 2P28B 3FB6B 4XH2B 2EIZB 4AT6A 3QCTH 3BXNB 4IU3A 2PO6C 2XTSA 3KWVA 1G43A 5D7LD 1HH9A 1T03H 4NNPL 4EI0A 1RH8A 3KPRA 4YMPA 1IGFL 3NZSA 4F7EA 2GQHA 2IANE 4EN3C 4RMBA 5KN5B 1AZCA 1RU9L 2J6EH 1XTLA 3ME0A 5KJ4A 5MHSD 2X6VA 3DX7B 1E3XA 5I5JA 4XNQB 2IO5A 1MRFL 3PWUA 3MI6A 1LEKB 4PJ8D 5G4NA 4ZMLA 5I75C 5E8OA 3IPFA 2XU9A 3IPEA 3NQKA 4F5CE 4PVBA 3FTUA 4GIPD 2PYEB 2FECI 1KJVA 5ECJE 1ITCA 5FW6A 1H6UA 3FSOA 1KJ3L 1KIPA 3T3PB 3V9EA 3CLEH 3R7RA 3UO1L 3ROOA 4M5YL 4L4TB 4NPYA 3VVWA 2X4NA 1IVTA 1N5AB 3WDJA 1BVLB 1ZVHA 5KG9B 1TVBA 3JWOL 4UBDD 4DAGL 2CK0L 4AG4H 2RD0A 1OGAE 1OK8A 3LQMA 5H37A 4F37K 1IEBB 3O2DA 1CXFA 3UX9B 4YDIH 3PJSA 3NGBB 4HHAA 3VG0H 4GSXA 3SE8L 5J9PB 4O58L 2BS8A 5DR5H 1NGWB 4JPIB 4W9KC 2CCVA 2PW2B 5I5IA 1GYCA 1VKXB 4GRWH 4JN2A 1OSYA 1FWXA 2CLZA 3WUWA 3VW3L 4PJGA 5FUOH 1CIUA 3IGFA 4G6FD 4P5TC 2LLNA 4HDIA 3ES6B 3B43A 3S7GA 3IJHB 5DZLA 4ZZKA 3FQTB 2CBTA 4P9ML 1QAWA 4UIKL