2Y22A

Human alphab-crystallin domain (residues 67-157)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
b'MEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSMSSDGVLTVNGPRKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CRYSTALLIN B
molecule tags Chaperone
source organism Homo sapiens
publication title Crystal Structure of R120G Disease Mutant of Human Alphab-Crystallin Domain Dimer Shows Closure of a Groove
pubmed doi rcsb
total genus 14
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y22A00
3L1FA 3Q9QA 2CR0A 1WGVA 2Y1ZA 1SHSA 1RL1A 4M5SA 3VQMA 3Q9PA 4PCKA 2RH0A 3IGFA 2XCMC 3N3EA 3GLAA 2WJ7A 4YL9A 3QORA 3J07A 3L1GA 4ZJ9A 3QORD 4JUSA 3VQLA 5LUMA 4I88A 1WFIA 4M5TA 3W1ZA 2O30A 3GT6A 4FEIA 4JUTA 5DS1A 2K8QA 2Y22A 1GMEA 3L1EA 2JKIS 1EJFA 2Y1YA 3QORC 4YE0A 2CG9X 4ELDA 2BOLA 4YDZA 4YLBA 4PBDA 1WH0A 3AABA 3QORB 2KLRA 5DS2A 3AACA 3EUDA 2N0KA 4MJHA 4YLCA 2KMWA 2MNWA 1X5MA 3GUFA 4RZKA 2N3JA 2WJ5A
chains in the Genus database with same CATH superfamily
2VWEE 2CDFA 3GMRA 3WHE1 1WWCA 2X28A 3RHWF 3MYJA 4AQEA 4M7LL 4M6AA 4HLEA 2NY6D 1R5WA 4PTTA 2IDQA 1KYOJ 3WLBA 2AEPL 2I85A 2CGYA 3V0HA 4IRZH 5CHNB 3C2AH 4OZFB 4B9CA 2FECL 3PWPD 5HJDA 3O4LE 2P45B 1D7DA 4UM8A 1TJIH 1HQRA 4KY2A 4Y2OB 1ZJBA 2A9NH 3QXAA 4PU2A 2WXHA 2BH0A 4IK6A 3QJSB 1O9WA 3BKJH 1TCRB 2NDFA 5DC4B 4OY9A 4KK8D 3BEVA 3SKJH 5IF0B 5GJSL 4RFNB 2F19L 1P1ZA 1F90L 1PNCA 4M48L 2Z8WC 1NBZA 2FEJA 3VFTB 4O51A 2YK1L 2VTFA 3GXPA 3EYFA 4ZS7L 2Q0ZX 5IFJB 1HL5A 2L3BA 3B7RL 2J6WA 1QG3A 3IXTB 1LVEA 1Q94A 4QO1B 1IO4C 2YBRB 4BUHA 4JZJC 4DGWC 2LTQB 5IBLD 3L08A 2A6JB 4I3RL 1OHQA 2NY7L 3UMNA 4KJQD 1ET8A 2R2HA 1RUML 25C8L 1G1OA 1RZFH 2P24A 3STZB 3U0WH 3GSXA 3K7UA 3DURA 1UB6B 3MX0B 2GK0B 2C1OA 5DJ6A 4LLYB 1JFQL 4J1UA 4FQXB 2IGFL 1IM9B 1MCWW 2VLKD 3TN0C 4OGAC 1P5UA 1MCEA 4O00A 4YSOA 1W72B 3HMWL 2GK0A 3QHTC 2WVSA 3QPQD 5DVOA 4JY6A 4NRZA 2VXTL 3STZA 5BV7H 2IANA 4PGDB 4TSBH 2BOBA 4XVTL 5K33A 5F3BA 1SYVB 5AW3B 4YXLL 3NK3A 5HHXH 2BVYA 1CLYL 1GJIA 3BIAX 1IAOB 3LMJH 4GBXA 3FUMA 4J4PD 2KI6A 1QSEA 1TJGH 2DN7A 1QFWI 2E4FA 3PUCA 3T0WA 2BVQA 1MIMH 2NZ9C 2ZOTA 1UKTA 3MDJA 5CKAA 5KYWA 3VM7A 2V7NA 3BAKA 3F12B 2EXWD 3C5SA 2CA4A 2CHNA 2Z91B 3RU8H 3K4ZA 4E5XB 1FIGL 5TK4A 2VWEC 2WBJB 1UKSA 3OKEB 4XC1L 4IRSB 1E3ZA 1PYWB 3TCXA 2VLMD 1LL1A 1I1FA 3EYSL 3HHRB 4R83A 4XP5H 3MACL 1PG7X 4NO5A 3V4PB 1CFTB 2DJUA 1I1RA 2O5XH 2YKLL 4WFGE 1COBA 4FRWA 1OCWL 4U1JB 4A2LA 3GS4A 4FFVD 5ENWA 2OK0H 1I1AA 1A8JH 2RQ8A 1N5AA 5J11B 2C9UA 4Q9BA 1MCNA 2WLZA 4GS7C 1YEJH 3ARPA 4F7CB 2X87A 4ZFOL 2ITFA 4OZFH 4EBQL 2XIDA 5J13C 2YAHA 5I1AA 4X8XA 3B2VH 3MYJB 2E56A 2VZTA 1FL3A 1J1XL 5EORL 4WHYG 5TQ0L 4JM4H 2CO7B 2IAAC 1XAKA 4GXUN 1FNEB 2XWTB 2FJUB 3SPGA 4PJIF 3GHPA 1YEGH 4XN2A 5I15H 3Q5OA 5D9SB 3V4VL 1ZWIA 4KXBA 4F8NA 2VDOB 3LEYL 1S7WA 3HCVB 5DYOB 5T5NG 3BP6A 1NGYB 5DVMA 4CSSA 4G11A 5JW5B 2R83A 2VLJE 4GKSB 5CSZB 3S3BB 3K91A 1OTSC 5I1IH 5F0PB 5AOZA 2OP4H 1OAKL 1U8IB 2CGRH 3GLEA 1VERA 2CH8A 3ZY7A 4F1SA 5IHZA 3P9LA 2GAZB 3V0GA 2FT7A 1S9KC 3VRJA 4F3FA 3DUUB 3TCTA 3IFOA 3PXLA 4IIQA 4YHIA 4G1EB 1FGVL 2NX5B 1C8QA 1BBDH 4M3HA 4YH6A 2ADGA 1PZ2A 3QHFL 1CQKA 1RK7A 1XSIA 4BZ2L 1MCWM 4Y16D 5AL0A 2YUZA 3TPUA 1QA9A 5IFHL 2FWUA 4U7MA 4WKZB 3VXNB 4LLUA 5I5MA 1U93B 4ZZKA 1FNLA 3HZKA 3MYZA 2VXVL 4XP9H 2WC7A 1NMAL 1DEEA 3FSAA 1TQVA 2R1WA 4TUJB 1PZBA 3VJ6B 3I3EA 3KLAA 4LXFA 1GAFL 3SOBH 5FKPA 2C4FU 1UWXK 3QJTB 4OZHE 3V55A 4MRBA 4XO5A 3AG3B 3RX7A 5JHDE 4N6RB 4Q7DA 3KBPA 3IYLW 5F21B 4OD3L 2P48B 2V5MA 1VFOA 1NINA 4CNIB 2VDQB 4YSTA 4AL8H 4FQJL 4OI7A 5I8OH 1FV1B 4QHKI 2CHXA 5CZVH 1HX0A 3FSVA 3US9A 4Z7UF 4R26H 1CDYA 4WU7A 4XO3A 4OF3A 5IJKC 1YA5A 3RGVA 3K6FA 4YZFF 3CDZB 3TO2B 5CP3A 1A4AA 1G7MB 1TQUA 2Z4QB 3L5XH 5L2KB 1KOAA 5DEJA 1AO7B 1CF1A 4KFZC 2BOCB 5JPMA 2VLKE 5F7EH 2B77A 1HDMA 4X5RA 2DMCA 5C07B 2AXGB 1WAAA 2OJEB 2XDHA 2IFFL 3QE5A 5AOMA 3LHPH 4LVHC 2XBTA 5E8EA 1U3JA 3I6SA 3D25B 3AWEA 1G7PB 3WJMB 4ELMF 5G4MA 3GMNA 3R06A 5FYKD 1MIEL 1OP9A 1JXKA 4R5XA 4G9DA 1SJMA 4NJAL 3MODH 4ZUWA 1QW8A 5BRZD 3VXME 2A83B 5IUCA 1CTNA 2ZCHH 5E8NB 4BK8A 1CFVL 3M6DA 3BP7A 3D51A 3VFSB 3ARVA 2X4UB 4AJYV 3IPBA 5J6HB 4HP5A 4XMPH 3QIUA 3REWA 5SV3A 1J05A 2BDNL 3HNTL 4KKBC 5EU5B 2PYFA 4JPWH 1HHGB 2VABB 5EO0A 5J6GA 4KZEL 3I9GH 43C9A 1WZAA 2AK4A 5EIIG 2F08A 4ETQB 5LCVA 3NSFA 5I30L 1TG8A 3MRMB 4LEOB 4CBZA 1LWRA 5DC0A 5HYEA 3SO3C 1M2VA 3KL3A 2J71A 4NENA 3ZKMC 4GRLB 5EA0L 2YMTA 2VZSA 2WZPA 4DQAA 1FRGL 1I9EA 1EO5A 5BCAA 1YO4A 4NZDA 1RIHL 3PWJA 4ZMWA 1WGOA 2CALA 3HRZB 4R7NB 4QHKJ 3PQYA 2CDEA 2D7OA 4P3CH 3TNMB 2CE6A 3BDYH 1MFDL 4NN5B 2ZX8A 5DHDA 2VSKB 1NMBL 1MWAB 1SY6L 5SWSA 3BZEB 1ZA6B 3GRBA 2EH7H 2GITB 3JTTA 3RYMA 3ZKNC 2QGBA 1THCA 2WWMD 1P4LB 5IM7B 3H9YA 5D96C 1BX2A 2TSAA 2VDNL 3BJLA 5LXVA 1PG7L 1XH0A 3M8OL 3N06B 1S8DA 4OLXL 1OPOA 1FHNA 1ADQA 3H42H 4QNPE 2EIZB 3HKZA 1QUNB 4ZS6C 2XPGB 1HILA 4G5AA 3TZVB 4Z6AT 2AFNA 3QDMA 2AEOA 1KC5L 2HLAB 5KYXA 2XTJC 2YBGA 3WNLA 3G5ZB 3APDA 3VWKC 3EBAA 2NY0C 4ZUSB 2Z65C 1G1KA 2P5ED 3IMVA 1CO1A 4NNYB 1UJ3A 4UQ3B 4YHZL 4WY7L 4XE0A 4BSVA 1JVOA 3CDCA 1FGNH 4K71C 1I3GH 4M3KB 3DX2A 4F37K 3I85A 5D5MB 5JIKA 5GZOA 1AYRA 3LXAA 3TEUA 4RAVA 1HINH 1AOHA 4QIRA 4MBRA 4NHCL 5J06A 2ED8A 4KKRA 1YEDA 3IGAA 2XN9B 3OX8B 3P9MA 4XVOA 5GGTA 3WFCL 1XR8B 2I60H 3UAJA 1Y6KR 5FKAA 2VQUA 2N3JA 1EBPA 2VM9A 2GCYB 3C5JB 4GSDH 1XMWA 3V7AE 2EDJA 2R39A 3AQDA 5E70A 4Y16B 5IVXF 1KYOK 5HDWA 5HVHC 3PGDA 3CFTA 3LPGA 5HPOA 1IAIM 1AP2A 1QI5A 2XFGB 3IDIA 4LKCB 3VRLE 3SQBB 4KUCF 4NAMA 4Q9QL 4H8VA 4J3XA 4XP1L 1U4EA 4I3SH 3ZMEA 1LO2L 2BWQA 4POUB 5T1KA 3D0LB 3DDFA 4MA7L 5D7EA 1VA9A 4G83A 5EMYA 4CMHB 2JQZA 3PUUA 2BPBA 1XB6A 1IGIL 5DQ9A 4JPSA 3KYMB 2EECA 2MSPA 2ZKWA 4MZ3A 1U36A 4OCSH 4AW4A 1LP9F 4XMWA 1OF2A 3HS0B 1EZVY 1ZHLB 5B1CA 1UA6H 4ZO7A 1YECH 5KYYB 1OQXA 2FX8L 3W57A 4XI5D 4LSTH 3JYCA 3TT3L 4HWUA 1NGWA 3VFUA 2JKIS 4B3EA 2YPKB 5LLIC 4G9FB 5D2LE 4JG0L 2V2TA 4YXKH 1MFMA 4NQEB 5DO2C 3LY6A 1IAII 5AAMC 4L4VE 4L1DA 5C0IB 2GJJA 3S3CB 5C07E 4RZCA 4Y4FA 3RE0A 3VXOB 1TZOA 1NCAH 2AC0A 2IGLA 2EUXA 2HG0A 1AH1A 3JYBA 3MROB 3ZDXB 2Y5EA 3C5ZA 1E6OL 3FO9B 2YD9A 3GRGA 4UILL 5SX5K 3U9WA 2DD8H 3CFBA 2XV6B 2BVPA 2HJLA 3RZCA 3KS0J 1AZUA 3BP4A 3L9RB 2E7LA 4LLQA 3K3QA 4G7YL 2OMTB 4QCIB 3KPNB 1G0DA 2PP7A 4ANWA 1U21A 5E9NA 4N8CL 3L4UA 4CU8A 1U0QA 1A6WH 3VH8A 3MROA 2VDRH 3ARXA 2AQ2A 1UWGH 5KSAD 4A04A 2J88L 3FU7B 3CZFA 4N0UB 5F0JB 3P0YL 4G8GE 2KDYA 3L2MA 4HK0B 1KXVA 2E0PA 2QDWA 3N41F 3VI4A 1DSFL 1EX0A 4P23A 5CO1A 1T22B 5E7FA 3TNNB 1H5BB 3V0JA 3ES6B 3SQOH 1AE6L 4DJMA 3GTVA 3EJRA 2WXLA 4EN3B 4NN7C 3HMWH 4PJCB 1DL7H 1UOWA 1A4JA 1XGRB 4OBRA 4PJGA 4C57C 2CLRB 4X80H 4F27A 3UZVA 4Z7IA 1OGAE 4GRLD 2G0LA 3VD1A 3AITA 5FYLL 5IOPB 4P8QA 2YAEA 4DK3A 4NKIH 2YD3A 1LM8V 3MV9E 4NQQA 4BV1A 2OMXA 4X50A 2XETA 1SOXA 5D1XE 3ARGA 4AG4L 2I25N 1RUAH 2ZOOA 3VRLF 3FO0L 4YR6B 1JK9A 5GRWA 4BUQA 4OZIE 1FIGH 2HAZA 2WMPA 4LCWB 2VDML 1BQKA 1YJDH 1YEIL 4GXFA 4A6YA 1RZKL 4PVLA 3IETB 3IF1A 3QEUA 2ZX5A 1KGJA 5D7LA 2PPCA 2KKQA 3GEFA 1EV2E 5HHOB 2VH5H 4MWFA 2PR9A 3BESR 3B3BA 5DD3H 3ULSA 1MW2A 2YHGA 4GUPA 1ORQB 2WGXA 3F83A 5D7SH 1MAKA 4FQJH 1U8LA 5SWZE 3PL6B 5GS0H 1DQDH 3HG4A 1HL9A 4GRWE 3I2CL 4XRCB 5EBMA 5JO5A 4KV5E 2OCJA 3ZK0A 4A7UA 2BVTA 4QKXB 1OL0A 2P5EB 3ARBA 4HXBH 4P5MB 5D7LE 4XO9A 4RMBA 3MV7B 3WDIA 2Y7NA 4FAAB 1G7HB 1ZPLA 1T4KB 2CBTA 4G3YL 4OKDA 4K5LA 4NM4L 4FYRA 4ZZFA 5F6IC 3L54A 4DETA 1K85A 1DVXA 1S9WA 3PDOA 1X7QA 3DI2B 1X5ZA 3W11D 3H7BA 3LS5L 1MVUA 3KLLA 3PWVB 3QDGD 3PJSB 4JJ5B 4QRPB 2XN9D 3CFMA 1NEZG 2VE6A 3EJCA 1XGZA 4ODSH 2D31B 5EOCJ 5H37G 3SKMB 1T5KA 3L1GA 1QBMH 1XCTB 5JQ6L 3FBKA 2NY5L 2H6OA 4B5ZA 3L6FA 1K3IA 4AXWB 4Q97A 4PJ8B 1OCRB 1Y1UA 3EO0A 5KSBF 4UIKH 1RJZA 4MQ7B 5DD6A 4JQXC 4YC2C 1DBMH 1I31A 2VJXA 4GT0A 2Z92B 4AH2A 1CU4L 1OAKH 2D8KA 2EDEA 3K5RA 2CDGB 1JTOA 3LPWA 5H35A 3THML 2A0LC 2FR4A 1HL4A 3HN5A 3ARFA 3OKLA 3N1QC 5E00A 4AKOA 1MWAA 2YFOA 2ZT9C 4JJOA 5SWSB 3E9UA 1I8KB 2EC9U 3K0YA 4ZTPH 1OAYH 2CDEB 2J72A 5A6MA 4XR8C 1NEUA 1EZVX 3LN5A 1PJ9A 3QHFH 1QBAA 4R5TA 3U4KA 1DANU 3QJOA 3VMNA 3SCMD 4NC2B 1PCXA 1OSPL 2P9RA 2F1EA 3LZFH 1UOVA 1TENA 2OX5B 3CUPA 4QHUB 4LDLB 3QZPA 4G6FD 2GYSA 5KYUA 2J1XA 1T21A 5D7KE 4LEOA 4ZBJA 3K2IA 4G9FE 3T2NH 4OZIF 2PMZA 3RTLA 1HHGA 4MTMA 4MNHB 4N0FB 1EEUA 4E9WA 3RPIA 1FLRL 4NQED 4L5FL 4YDLC 1FZOA 4JKPL 4AMWA 1ACCA 2QADB 3PNWB 2DQMA 4K9EL 1BLNA 5FYKE 4F58H 2KHAA 3RL2B 4KMTH 2FVNA 2VXUH 4NKMA 4PH8A 2BSTB 3EZJB 2J4WL 5F8RC 4AL8L 1OP5K 5HGDB 3WEXA 3SGKA 2WZAA 3F7LA 3MHZA 3OKOB 4H5SA 3QZMA 4W6XB 3BKYH 1N59A 3QQDB 5FDYA 5T3XD 4JL2A 3KPLA 4P5KB 3MXWL 2F2HA 4I18B 2V6HA 1IL1A 4QXUH 2VDLH 3TFKC 4FXGB 1ORSA 2OYLA 3QNZA 2P8PA 4RDQG 4OGXL 5I1KH 2G3XA 3Q5TA 3CHXA 4RDQF 1HDMB 2KC0A 1H3TA 5F89A 3EH5B 3AU0A 1HAWA 4H7VA 2H26B 3P4MA 4QYAA 1U92A 4NC1E 3MRRA 3GIVA 3N5AA 3RGVB 3TO2A 4EN3D 2I5YL 1H3PL 1N9PA 1T66C 3GBMH 2M2DA 4WU7B 4HKJA 3ARWA 3A5VA 4I3GA 3HZMA 2XJLA 1F3DJ 2BSRB 4EZKA 12E8L 1BZ7A 2O26U 1CZ8L 1B4LA 3IDJA 5A16B 3B2UD 4LFHD 4YSCA 1VADA 5FPIA 1UG9A 1DQJB 3GSUB 1YEFL 4N6RA 4V1DD 3II3A 2BFVH 2PXYA 3FPXA 3U6XS 3EYVB 3C60A 3HKFA 3LS4H 1K8DA 2AXFA 5A2IH 2XZAL 2C7UA 3ARBD 1VZIA 2Y1YA 4ODUB 2UZIL 1YPZE 4UNVA 4OZIB 2GIYA 3OKNB 1VGKB 1F86A 3EH2A 4I85A 5KYNA 1MSPA 3FFDA 3QCVH 1ZT4B 4AEEA 3M17B 3V7AG 5J1AA 4OCNC 4OV5A 2N01B 3RI5F 4PLNC 3ETTA 1EXGA 4N5UA 4WFHE 2W91A 5KJRH 1BYNA 2DIAA 1DJYA 1HEHC 2FIKB 4MGXA 4PRPB 2NW3A 4WKZA 1V7NL 1A1NB 4XCCL 2JK5B 4YSSA 3O0LA 4WNQA 1XIWA 2OW6A 2DZEA 1NLDL 2J6EH 3NBNA 1UA7A 3IDNB 5DVKA 3O8XA 3PPEA 4H88H 1FVEA 4HBQA 4X6DB 5D7LD 5DZAA 1UEYA 4G1EA 2CO4A 1D5RA 2VLRE 4L1HA 3GMMB 2WQAA 3QA3A 2HT4D 3KMDA 1NCUA 4UANA 3CZUB 2MTPA 1VB9A 4X4XB 1SQ2N 2VUKA 4KHTL 4A7GA 3D3VE 4OZ4A 3U7AA 2IOIA 1U8IA 4DHLA 1L4IA 1QFWM 2VDNH 2XU9A 3LQZA 4JFEE 1T0MA 3JWNH 1VGEL 4TNEA 1KSRA 4WJG3 5EO1A 4AM0B 1M56B 4XCNA 5T3XE 3H6JA 4JDTL 4Q8BA 2CO6B 1Z32X 2R4RL 1SDDB 3O3UN 4F1ZA 2V17L 5D1QD 4F8LA 5C2BH 3TF7C 1KBPA 3R8QA 2RFXB 2VITA 3MKKA 2BNQE 1TVHA 3HE6A 3QEGH 4D2NA 2X4NB 4TUOA 4CVZB 3TBVB 3D9AH 2XXCB 3LCYA 1PFCA 3U7WL 5JIMA 1FC1A 2OXGA 3DJTA 1P9MA 3SDCD 4H1LB 2EE6A 2D7TH 2B8OT 2CO7A 5FYKL 2YQ3A 1UQSB 1MJ7L 3WFEH 1EXUA 4OH2A 2YSSB 4NM8L 3SDDA 1JZDC 2ZUVA 2XQYG 1UWGL 3FC8A 4MJ4A 5I1AB 5JW3L 2AV7A 4YXLH 4HUXA 5HDQL 5D1XC 3RWHA 1R3LA 2DPKA 3LMJL 4LQFL 3CH1A 1YUHA 1WBXB 5E5MB 2G75B 2W38A 3NK4A 4CAGA 2W07B 3L5HA 1HHHB 4IGBD 1WD8A 2XZQL 1I1AB 1RUQH 3OGOE 5IK3A 3SE8L 1F4XH 1PZCA 2PWHA 1JHKL 3HR6A 5C9KA 1VEPA 5L6YH 4HOXA 1BQRA 3K6SA 1KXQA 3APNA 3FU8A 1KPVA 4U1GC 4OCMC 4JFFE 1R4XA 4TVPE 2JKXA 4PJDE 1PQZA 3LQAC 1UM6H 2HSIA 4LPVA 3ROOA 3D08A 3GSNH 4XP4H 4QRRD 1U8NB 4NFBA 3PWPE 3VXUB 1F11B 4RBPK 5ERWA 1P6AB 2I9TB 3RG1C 4AV0A 4XOCA 4U6VH 4K3JH 3OF6A 4MDJA 4B7IA 3IFPB 3QJVB 1JE6A 5JIQA 4W9LC 3ZT5A 1U33A 2Q87A 3U30B 2CKNA 1H6UA 1Z9SA 4JPVH 3ZPDA 1KJ3H 4IKLA 2C4FT 3N44F 3VGGA 2W9EL 2VH5L 1MFVA 1S2EA 4PW4A 4J3OC 1EHNA 2K45A 3O9WD 2MCAA 4FI8A 3RY6C 1XGUB 2BRQA 1E7UA 4XNBA 5ID1A 1GSMA 1QHPA 1TTFA 1ACYH 1UCBH 4JFED 5E00B 1H0DB 3GMOB 3LN4A 4DEPB 4J1UB 2VR8A 4LF3A 4P07A 1XVSA 4AITA 4XN7A 5ILTL 4JRLA 5H35B 3UG5A 1RUPH 4CJ1A 3PAZA 5IVOA 2GK2A 5F96H 2WBKA 4I1NB 2P24B 4DTGL 3TN0D 1C16B 1ONQA 5EUKB 2EYTA 5ADPL 3H9ZA 2JSFA 2JJSA 4IMLB 5FHBH 4KNUA 3BQVA 4J6RL 4LZKA 4TNWF 2X1OA 2Z1KA 4DESA 2FEDC 2D31A 2Y07L 4GXVL 4U1MB 4WI3A 4H2CA 3LS5H 1J8HE 1HXMA 1RZGB 3ULUD 3AS1A 2YMXH 4ANXA 2VDRL 1X7QB 5HYQA 2H0JA 3SYOA 4HEPG 3ZL4L 1KFGA 1RU9H 1UASA 1AC0A 4G6JH 2R69A 4AYMC 3GSQA 1G7HA 2COVD 3G5XB 2DQEH 1FORH 3HMXA 4ZX5A 1CL7L 3ARBB 2IO5A 3T0EA 1NWOA 3N40F 3VWKB 3RNQB 1QFOA 5FK9A 4MBOA 1NCDL 3VXQB 3ZL1A 1G4MA 4X80L 3B7TA 1YQ2A 4YO0B 5HI5D 5EG6C 3T09A 2L8AA 4PS3A 1F4HA 1IKFH 2F1BA 3K2MC 3CIAA 3DIDA 4I13B 3DX8A 4WCYL 5CZKA 4BZYA 4F93B 1JI2A 2OFQA 5D6CB 4MNGA 3VWJD 1XBDA 1BVOA 1BF8A 3H6AA 4LSPH 1X5IA 2HYMA 2IV8A 2JF1A 2XQYA 3IDXL 3HRPA 4KKLC 4P9ML 4K8RD 4LDEB 3HFFA 2R0LL 4MNQB 5D71H 4PBXA 4M7JH 5DYFA 2NT1A 1NCGA 2HFFB 3RKPA 1YEIH 1XTLA 1ADQH 1S7SB 2K4WA 1KIQA 3D52A 5CZVL 4MMYB 3DTUB 3PQYD 3WEBA 3H4FA 3MRQB 1FG2B 1NJ9A 4XNYH 2DQ6A 4BQ8A 3ARUA 3C6LA 3G08A 5CWSA 5KBNC 3VUAA 3FB7B 4OI9A 4PWFA 2OZ4H 5MEOB 1U8JB 3L5WB 2EO9A 1EHAA 1NEPA 5TE7H 1N3NA 1S7SA 5EDSA 1A66A 4A1RA 5F6HI 2WCPA 1F2XK 4POZD 5IMMA 1IKOP 4HS3B 4F7EA 4HUUB 4KV5F 2ZCKH 3HUJA 3NH7L 1G9NH 4PHXA 2CU9A 4YPJA 2LAGB 3N42B 3L9BA 3BIBX 3WG7B 1DE4A 2BW4A 2GQHA 1JK8A 5EUOF 5AOIA 4FYTA 3AROA 3L3JB 1E5YA 3V5KB 1DFXA 4XAKD 1UZ6F 4RMQA 5I1HH 3U7YH 3IGUA 2DKSA 1BOGB 4MXQD 3HBGA 5F9WB 1WYJA 3V4VB 2EKSB 4JDZB 5CCGE 4EIUA 5BRZA 2BDNH 3HNTH 4K3EH 1ZV5A 1ZSDB 4N8PA 3T0EB 3GMLB 4H25B 1T0OA 4UYQA 2X70A 2HKHH 1O6TA 4KZEH 3OXSA 1A25A 4CW1A 3EIFA 5BO1H 3T4AA 2ADFL 3BMWA 4FFTA 2X4SA 5EU6B 3DETC 3GUTA 4DEWA 2ED7A 3AG1B 3LAFA 4DSYA 3M07A 2ZOLB 4AQOA 4NPYB 4AC2A 3MV9A 4HHWA 3SKNB 3QAZC 5C0FB 3QH3A 3BZ4A 1H6EA 3IKCB 2F61A 1BV8A 2ZYIA 1SXZA 4OUUA 4NZUH 4P04A 4QRAA 1MDTA 2D7QA 3D39D 4JHWL 3RDTD 5JOPE 1GYCA 1OF2B 1TJMA 1YN6A 1P4IL 2E7CA 3I6LE 2P26A 5I17A 2NY3C 1FSKB 1A3QA 4UDTB 1DLHA 1QOKA 2KL6A 3VVVA 4QTHA 1X5JA 4HFWA 3V9CA 4NPJA 4KK8C 1DANT 5KANI 4OIFA 4WI9A 3A0OA 5EPMA 1ET7A 5HVGB 2W1NA 4RVBA 4FA7B 5DJCA 4BZ2A 3HLAB 1WUNT 4P2QD 3UYRL 1YN6B 1R33A 4KXAA 1GHFL 3EUDA 1MNUH 4ES8A 5BS0D 5ESAB 2HTLD 3DTXA 2HKAA 3TV3L 4MAUL 4EO5A 2J44A 1S5IH 1EBAA 1XXFC 2CKBL 3CFUA 1UZ6E 2EKJA 3AADB 2OMUA 1T7ZA 5E6SB 4L8DB 4BFGA 2JKNA 5DZVA 1RFDH 4F57H 3EBGA 1KEMH 5DJDB 3MTXA 4Q0XL 3RTQA 4NPYA 3K71A 3D0VA 5F88A 4G8EB 1KGCE 2YKKA 2QQKH 3CC5A 1RURH 3D50A 4XCFH 4M48H 5FFOA 3U48A 4ONGL 4PJHE 1CURA 1L9NA 1E7VA 3F65A 5DSCB 1FFTB 5D2LF 2F6AA 1D2PA 1QBLH 3QO0B 2R8SL 3OXSB 3WS3A 1FAIH 1LO5A 3DKHA 4XCYA 5L88L 1U8MB 3BI9X 4KRNA 1OAQL 4AQZA 1UXSB 2KDGA 4IGBA 4N5EC 1YPZB 4Y4HA 4F8TA 3P2TA 5KSAA 2EO7A 2MEJB 2MQ0A 2EDOA 2Y4SA 4N8VB 1IGJA 4C83B 3OAYK 2WP3T 4N9GB 4GO9A 3MA7B 2YD4A 4AGOA 5CR8A 3CN4A 1CD1A 4QJ3B 1BMWA 2DTML 3NZHL 4E9RA 3B2MA 3BT0A 3IRPX 4N0YL 4U0RB 3SE3C 1RZFL 2GEQA 2P49B 2VN6A 2G75A 1EAPB 1E4WH 2V3DA 4KRPC 4HKZB 4Q2ZA 4UUJA 2ZWSA 4JR9L 5DA0B 2W95A 2WM0A 2ALAA 3TVMD 2ZOWA 4HUXB 1L6PA 2V33A 2IGFH 3UTZB 4CN4A 1LYQA 1T83C 4K15A 4Y2NA 1HWGB 5KVDH 5T1LD 2D3VA 4BYHA 1QTSA 3KH3A 1JHKH 4OLZL 1OLLA 4W81A 1E5AA 2B4CH 2NY4C 4IBQA 4OLUH 4C8XA 1HXYA 4P5TB 5IVXE 1EGJL 4E41E 1AZZC 4XVTH 3LNIA 4HUWA 1MRDL 3KGTA 2FEEL 2VXQH 3Q6FA 5MEOA 1V7MH 1WQVT 3JTTB 3O2VH 1HSAA 2D9QB 2LFEA 2YPLE 2WNGA 4JZJB 2ITDA 3PQYB 2HFEB 1JNLL 2F1AA 3FQXA 4AM0A 1OB1A 4N26A 2HPOA 5DFVC 4FNLL 5D1ZA 3QVAA 3FB8B 3DVNA 3GZKA 4KGJA 5E99H 4F5CA 4U6YA 2DLHA 4JGMA 4MS8C 5J1TC 4YC2B 3VFNB 2XWZA 3BLBA 3D30A 5B4MD 4DFHA 4DN3H 1PZAA 3DOSA 4ERSH 2ODIA 2HJKB 4GUQA 4FQQA 3UX9B 4BKLA 1XIWB 4KO6A 3MNZA 5E8OB 5I2IB 1CD0A 2VMDA 4OD2B 3GI8H 2CUHA 4LPXA 2B14A 5ILTH 1O9ZA 2LAAA 5IJKA 2F0CA 1WC7A 4RFEB 4XXCC 3WIAA 1UJ3C 4NC1C 3SD2A 5EORH 3AU1B 2K1MA 4K4KA 1T7VA 4UNTA 1F41A 2PYED 1TETH 3RWFA 4AQ1C 3SQOL 2WK2A 3ARGD 3N1MC 2BX5A 4ODUA 3O3BA 3BZ5A 5DK0A 2NSXA 5BJTB 1BF2A 4HH8A 4I0PD 3OJVC 1TTUA 1G7PA 1HXMB 1RZGA 2K4AA 3WJMA 4AENA 3CVDA 4OFVA 1ZVYA 2MPVA 2WVUA 4I8DA 4CADA 4G71B 5C0NC 4LLVA 4WK4B 1KY6A 5DHVH 1F00I 2NY1D 3UC2A 4WSKA 2WWKT 1MLCA 3TT1H 3MTRA 4HIEB 4B5EA 3I6LD 3WHXA 5GXBB 3VI3A 5JZ7C 1FZJB 3V4PH 1XWVA 3X3FH 1JZ6A 1NFKA 2AS5M 1U92B 5FUCC 3P4MB 4YHMH 5EH1A 3UYRH 4ZUVA 3CAFA 4YSUA 4HIIA 4L8SC 1X5AA 2JCCF 2N7SA 1BJ1J 5CCJA 1G0XA 3MOQA 1N64L 2HMID 1WVZA 1U2YA 2QGEA 3NA4A 1BBDL 3NA9L 1UFUA 3QNZB 3QI9C 4FNUA 5C6WH 1IQDA 3BKMH 2NPLX 4M3JA 3ZHFA 4JREB 4NO2B 2VSCA 5EBWA 1Z9SB 4H2AA 1QLEH 3AW5A 1B3JA 1WCBA 2A4ZA 4RWYH 4QGTA 3FUEA 1OK8A 4WFEE 3IDXH 5FO8B 3VXMA 3WDHA 3CFEA 3ZMRA 2W60A 2BSTA 1JTPA 1SN5A 1WK0A 1U93A 4XMKL 4H20L 2XBDA 1PF3A 1RIVL 4FTVE 2O5NA 4R7DB 4MCZA 4KTGA 3GGWB 3T08A 2ATKA 4M7LT 1OKEA 2YMOA 1I8MB 3L3HB 5IQLA 1KYFA 3ROOB 4AEHH 3H9SA 3QFJA 1ZHBA 4MNHA 4L4TB 5I1LA 3HFMH 5A2KH 5JA9A 1KGIA 4NGHL 1KXQE 1EH9A 2X4RB 4KI5F 1TTGA 2FO4A 4LCWE 3HNSH 3FZUC 4HD5A 2CRYA 2Q8BL 2XWDA 2BZDA 4OLYH 3DX9B 2GAZA 1GW6A 5I71B 3CDYA 4NJ9H 4APQD 4XOEA 3KR3L 4U1SA 1D5ZB 4PRBA 4EDXB 2JNZA 2WKGA 1JZFA 2FT8A 1H3GA 4Z7NF 3MAWA 2NXZB 4OFYA 4P2RA 2X9XA 2DQGL 2VDKH 3VU2A 4Z0XA 2GHWB 4Y4FD 2EC9T 3BAEH 1ZWIB 2QQNL 1WFMA 4FKEA 4HU8A 2ENSA 1TITA 3IGFA 2XSKA 4ZO8A 4YHOL 1MY5A 2D0FA 3MRGB 4DP8X 4IU2A 3A6CH 1XMEB 1CFQA 3BAJA 4ES9A 2W92A 1NAKL 3FU5A 4L4VD 1EFQA 4Z8FL 2IMMA 4GY4A 4HZ1A 4F9LC 4P5TD 4MRCA 1JYNA 4BIKA 2BCKA 4OBSA 5EOCH 7FABL 4PSRA 3PQYE 3O3EB 4P4KA 3CSFA 2QZ5A 4QRPE 1IARB 2W8CA 4JFEA 5DFAA 5F93C 5IB5B 3DX9A 3N1GC 3UOAB 5ENWB 2C3XA 4FQ1H 1AY1L 1M05B 2YAOA 4OQTA 1E65A 1OANA 1MXGA 4JG5A 1X9UA 2YRLA 2A73B 3MV7A 5DJ2A 4H0LC 1R3HA 3S8FB 4PJAA 5MP6L 4KXZI 5KSAC 4L4TA 5I1LB 1SF5A 4O4YL 1YPZF 2JMRA 3ZGHA 2V5SA 3RDTC 3P73B 2GSIB 2FYYA 1KCRH 5HDBF 3A6OA 1SEBA 4MXVF 3QDMD 1HH6A 2GTQA 2VQ1B 3E6FB 3EOAA 4KROD 2W59A 1M3JA 2FIKA 4HIPA 4LHQB 1I85A 2R2BA 4J27A 3MJ9L 4QHMB 4LSUH 5EN2B 3MXWH 1YUKB 3ULUC 2APSA 2W0FB 5DC2A 2RTTA 1XCQB 4DF9A 5HGBA 1R17A 2VIRB 3UGXA 4BE6A 1YLBB 5E5LA 4D9RD 3T0BA 4K5OA 1ECZA 5AVTB 1IV8A 3C60B 1MJ8H 1OW0A 1XF3B 2CHZA 4B9PA 3CZNA 1DQJA 4B9YA 4PLKD 4EI5C 5C7XL 4HYTB 5FW6A 2YS4A 3FUNA 1MAJA 1I7ZB 4KX9A 2NTSP 1KN2H 2V9TA 1CXFA 1L0QA 4G8AC 3OG4B 5FA3A 1BVNT 1PL3A 3DIVA 5TFSL 2E7LC 2H6PA 1HZHL 5GGSY 2OSLA 2NY1B 3ARZA 3F01A 3NACH 4OB5L 4PJGB 2EDHA 4WW2C 1QLRB 1KGWA 4BDVB 1LDPH 1IM3B 2M1KA 2W94A 1OAJA 2I7SA 5HGHA 5JOEA 3C5XA 4LU5H 4AIXA 4K3DH 1AJ7L 3L4VA 5HYSA 1LE9A 5JLZA 6FABL 3RFRA 4F91B 3UGUA 2Z93A 4XZUA 1RJYA 2Y1AA 4TPRL 1N59B 3M46A 3QORD 3OSKA 1LNUB 3V0VB 3ZOAA 5HGDA 5IF0A 4JE4B 1MFAH 3L9RA 4A37A 2G5RA 1AR1B 3GSRB 1U91A 4WI2A 5LBGA 5C3LD 3G3LA 4URTB 1AFVL 2X6VA 4QTIH 4M5YL 5E8OA 3MNZB 5I2IA 1E4JA 3LRLA 4UDUA 1N0LA 3ISWA 1UWEL 2A9NL 4FTVB 2CJTA 3LNGA 4U1NB 1QBBA 1F0LA 4XBGB 4MJIA 5FECB 5C0IA 1KB5L 4X7SH 2H4EA 1JNJA 1UXLA 1DVFB 3LPPA 3TN0A 4U6YB 4QHUA 3RB5A 1R5WB 1N7MH 5EIVA 4L4TD 5AW9B 4ZMPA 2FQEA 4ZAKB 5KVEH 4M43H 4GQ9H 5HI5C 1ZTXE 3QUMA 4OCSL 4N20A 3NIFB 3SGKC 3CVHL 3WEAA 3D0AA 3JWOC 1O6SB 3X3GL 1J5HA 1E4XI 3HNVH 1IAKA 3TYFA 1TO5A 2ITDB 2GI0A 2ITCA 5PCYA 4WW1A 2VLLA 3DROA 5AD0B 4JFDD 4J2XA 4YXKL 1Z5YD 2C7FA 2DH2A 2IAND 2E7BA 3TJEH 2PXYD 3VQMA 2FWSA 4PGZA 4DH2A 4V2CB 3NEOA 1XL6A 1R24B 3X12B 1AGCB 4JPQA 1MY7A 3P0VH 4P5SA 4UOW0 4X9IA 4J3TA 4DT2A 1DJZA 3O4OC 3BH8A 5AB9A 5CP7B 3FF8A 4UTAH 1NCCH 3CMGA 4LQFH 3A47A 3STLA 1QO3A 3D4ZA 1UEMA 1ASOA 1LEIA 2BS71 5I9QC 1T2QH 4LBAA 1JZJA 4ZYKB 5T1MA 4TL4A 1L9RA 4JJ5A 4QRPA 3ZKSD 2XWEA 3WIFA 5HPMB 3SGDI 5SWQB 4KBPA 1A6UH 1EAPA 1NUNB 1N70A 5JORA 3OC5A 4YDJA 2WSDA 4Q74A 1U95B 4HD9A 2Q3XA 1DVSA 1E4WL 3IGAB 4D0BA 5LN8A 3AY4C 5J12B 3QORA 1CLYH 3ZO0A 4Q4IA 1PTZA 1KDJA 2IALB 4UT9A 3GXUB 4P5MA 3ZLQC 5CIPH 2YC1A 4J3OG 1WSST 4AYID 1NUFA 4S2SB 1QSFB 1HYSD 5EULV 3ESUF 5AYQA 3VRIA 3EH1A 2CUIA 2A9BA 4YZWA 4IHOB 3GIZH 2R4SH 4H8WC 4PJBA 4LSDA 3BRFA 1TEFA 3BUYA 4ZFFA 3ULSB 4MXWL 4YGAB 5L4JA 4FNQA 5KG9A 1KCSH 3GHBL 3DJZA 3IVKA 3LYRA 5I24A 1I8AA 1LO0L 4MJ5A 1QUNA 4KJPD 2AJSH 1ROCA 5G55A 1FNSH 4A6YB 5T33L 3LV3B 3S2AA 3RJOA 3DTXB 3VSVA 3BISA 4JM2F 1IVLA 4MJJA 1GGBL 4CUCA 2AEQH 1RIVH 1A14L 5HI3D 2X40A 4UQBA 2O61B 2OTWB 3MA9L 3NCEB 2JKLA 4PVBA 5L2JA 4JHAL 5BNXD 5CUSH 2ENPA 4FADA 5IMOB 4YUEH 2YPVA 4QRTB 1A9BA 1U42A 5D1QE 2COQA 5I6XC 2D9CA 4Z7UA 3I50L 4NGHH 4J6RH 1E9QA 1MHHA 1UXWB 4XPGL 4XODA 2P47B 4DO4A 2ZPKL 4FMVA 4ZFZB 1OT1A 3D85D 3GI8L 1NCWH 5C0FA 4KAQH 3ZL2A 5MENA 4U6XA 2V8LA 4I0CC 5E94B 4OCYH 3VI4B 4J4PC 1IM3D 4HC1L 43C9B 5HDOA 2QPSA 3QB7C 4WK0B 1D7BA 5GS0C 2OYMA 5ELIA 3W82A 3VH8B 4HMDA 4M8RA 3B6SA 3ECQA 5I1EH 4A7VA 3RKDD 3OKDA 1RULL 3FK3A 1PKQB 4GSRA 4AIZB 4PJXF 1QWNA 5E9AA 2H32B 4ODWB 2X2UA 5JMOC 1T2XA 2WPGA 2Y6SD 4NQSB 1G6RA 1Y6MR 3EDKA 2FDBP 3VFPA 1AIFB 4LLAA 3RJDA 4G9DB 5EV7A 3FQWB 1C5CL 2VW6A 3QIBC 4Y19E 5EOCL 7FABH 2O6PA 2J8UE 4L4VA 4QHNB 3VG0H 4ZT1A 3F00A 4OUOA 2X3BA 4LHUD 1W0VA 5I0YA 4FLSA 2WJ7A 1TQCC 1KGUA 3UJTH 1Z0NA 5CJOL 3QEQE 4FTVD 1WO2A 3EO1B 3BWZA 4K23L 3KEHA 5AAPA 3L81A 1REIA 3MBEC 4DUWA 3PGCA 2BOCA 5I6KA 4LIQE 3KL0A 5I74B 3MUUA 5A2BA 4P59H 1TTRA 2PWDA 2WXJA 4YDIL 5IIEA 5JHDD 4BBWA 2WSPA 2E6QA 5C0CE 5CMAB 3WJJC 3O2WH 1NGPH 2VDQL 1RJLA 3FT4A 2ZYRA 2AJZA 4M62H 1FG2A 5DRWB 4R8WH 3GJFA 3X1BA 5KSUB 1B88A 1Q1PA 2DWSA 2EXTA 5E6RB 4W9CC 5ABAA 2AW2A 2YJQA 3HB3C 4WEMB 2ZUQC 2X0WA 1H9DA 2UY7B 1FO0L 2Q76B 3WUWA 5DFVD 1TEYA 2NMSA 2LQRA 5EUOE 3Q1SH 3ZJAA 1DEEB 5C09A 2Z31C 5HYJA 4AKQA 3WTUA 2Q7AA 4IRJC 3KXFA 1WZ1L 2LVEA 4XBPB 2BERA 3WKMH 4E9TA 2WBJC 2XTSA 1ESOA 1FJ1B 4JKKA 4P2OB 2PPAA 1G7LA 1D5XA 1UOKA 1M57B 3BKYL 4AK1A 4RAHA 4ZMYA 3ZBMA 2MKWA 4N0CD 5LQBH 1XV8A 2QGCA 1EXHA 2KQMA 2JJSC 2DIEA 3OPZL 1BVZA 4Z77A 4NJAH 5FK9B 1CC3A 1GYWA 2D3NA 2ZUXA 3QJUB 1PDKA 4F7PA 4QRFA 2BSED 2G0KA 1FFQA 5E2VH 5C08D 2E86A 3L4TA 4G72B 2HH0L 3GBLA 1HZHH 3QQ9C 1Z5LA 4PJ6A 4G1MA 4Z1PA 4X8CA 1AACA 2J1ZA 3KYNB 5GGQH 2EIDA 3TBTA 1BQUA 2NNRA 2PO6D 5EOTA 1TFHA 2BHYA 2BINA 5T3ZE 3RHWK 3ASOB 3OZLA 2WO2B 2ZTBA 3I9GL 1RIUL 2XPZA 3AQYA 3QQ9D 1FSKC 2MCG1 5F3HB 3HVNA 5JW5A 3PREA 4AVHA 3QBTB 2DW5A 2ATPB 1S7WB 3D4CA 5IR1B 2X6CA 3F05A 5CZRA 5IBUG 3ULVL 1HOCA 2HRPL 5M94B 2MFNA 2Q86A 1C16A 1ONQB 2HT3D 5EUKA 1GZPB 4B41A 5H94A 2ZXAA 1N0XL 3CN1A 3RVUC 4BHUA 2NYKA 3CSPA 1ZXKA 2DI7A 1AY1H 1OW0C 1CL7I 3NQKA 3V6FA 4TNFA 3BXNA 2JFCA 2V2XB 3MRHB 3ECUA 3L7FA 2Z35A 4I1RA 5JPNA 1DQQB 1MCOH 5LXGH 1WFUA 5DJAB 1EZLA 3CDFA 4GW4B 4IOIA 4YHYB 4NUJA 5CBEA 3VE0A 2GIMA 4FA6A 1EIBA 5MERB 5EU4A 4IQHA 3WHE0 1A6PA 1CFMA 2B2XH 3KAAA 3UADA 3ML9A 5DJ0A 4H8HA 4WW2A 4ONGH 1M2VB 1J48A 3R18A 3H7LA 3P4NB 5CN1A 2AV1A 3EYUH 3V4PA 5IT2L 1HHKB 4NO5B 4PREA 3DX7A 1J7VR 1KTDB 1Q9WB 1VFAB 4JCWA 3RQ3A 4A38A 5C0EA 5AAWC 3ZTNH 2QTEA 4JPIB 3T1FA 4O9HL 1B4RA 1PYWA 2QPUA 2WXRA 3LVEA 4GQPH 1W9XA 5EU5A 1EWHA 3DHJA 5IB1A 1UM4H 2CA3A 3MLRL 3SE4A 1P7QA 3O6FA 5IGXL 3PABA 4TLTA 1VGEH 1ND0A 1PKQE 1SY6A 5C08A 3NZ8A 3PV7A 1C8PA 3IDYB 1XT5A 3JSSA 2P5WE 4CC4A 3NSJA 4XMXA 4D8PB 2I24N 5F1SA 3BQUD 5ABZA 4G7VH 4XN8A 3FS9A 5AB2A 1IGML 2X4OA 4B97A 4OQ1A 1LWJA 1HHHA 3IDMB 3OXRB 5GGRY 3LHAA 1M7IB 3D25A 3WIHL 4FERA 3VXRD 3R1GH 1SUHA 4XO4A 2YAQA 4JFFB 1ID2A 3L4YA 4PJHB 1TZAA 4WHCA 1I8LC 4NT6A 5HJ3B 4HJTA 1JZ2A 5BUPA 4HT1H 1EAJA 2IADA 2JTYA 2NR6A 4UTBH 1YY8A 1BYOA 2JV6A 3L3KA 5HI4D 2J73A 3IWUA 2C1OB 1E9PB 4FX5A 5DJ6B 3HZVA 4DK6A 2C3HA 4QF1A 2D03H 4PW9A 4XPHL 3TH4T 3ZDXE 5BOPA 2F8IA 1R0AH 4MB5A 1RZJH 1FDLH 3GKZA 3MGAA 3O9WC 3HHMA 1EK3A 3QXVA 4MSWB 3KZ8A 3GPEA 3DIFA 1E28A 2DS4A 2X2YA 1AXTL 4HGMA 1V27A 3ZTJG 2LGNA 3NABH 2IQ9L 2R7EA 4HSAC 1AGDB 1RSFA 4L5FE 1E8XA 1G7IB 2R51A 3KWUA 4JFDE 4JS7A 4MXWH 3D33A 4R5VA 3ZUCA 4OZ4B 5F9AC 4K8RL 3X1NA 5KJ7E 5ACZA 3EGDA 5I75C 3MNDA 2QSQA 5KVFL 5IFAH 2XXFA 4ERSL 1TZGH 3W56A 1IZJA 2FLBT 1XH3B 3C5ZD 4JFOB 1BG1A 4YXHL 3TO4D 3UTQA 4KH9A 5E1QA 3RX9A 1FVEB 1GCFA 1RD6A 2W9DL 4LQ1A 4FI7A 4Y5YB 2DLFH 5BO0D 1TZHB 5LGKA 3VQ2C 4E9VA 4MX7B 5SWZA 3QXAB 1CDGA 4KRPB 1A1NA 3CVHH 3O2DL 4MMXA 1IQWH 2DQUH 3KCPA 4HZLA 3P11L 2OJZL 3MLWH 5HDBB 1UCTA 3QORC 5I6MA 2AXJA 4LPYA 1L7TH 4OLWL 1WAPA 3K6IA 4HSCX 4LVHB 1CDHA 1C5DA 3LKQA 3GXTA 4PB0H 2VZOA 2ZICA 1HS6A 2IDUA 4QYOA 4Y4KB 3FONB 1FFOB 2IDTA 2R23A 1QNZH 4L05A 4NX0A 2XQBL 3RB7A 4HALA 4Y2DB 4AGLA 1VAHA 1N26A 1NIBA 2CRIA 3KNBB 4Y1SA 1BBJB 3WNIA 4DUXA 3U1QA 2XFXA 5GGRA 4ZW6A 3WJJA 5KVGH 2P8LB 1A5FH 3HR5B 1MJUH 5J9PB 4R96B 2ESVD 3TEZA 1JPST 3HZMB 4YBLC 5I18H 3HZ3A 2YIHA 4W70A 4X7TA 2HTKD 3REVA 2XYCA 3QPXL 1BBJA 4WW2F 3QUXB 4DKFH 2ZKHL 2WOYA 3GMQB 1OARH 4OCWH 3P77A 5F89B 1YNKL 1FL3B 2DI9A 1FFOA 3F6LA 3GI9H 1XGQA 3GMPB 4FQCL 5C0BE 4UQ2A 3SHSA 3VACA 5FLUA 5K59E 3EHBC 3LKQB 5K9KA 4XI5C 4Z7WA 5AVXB 1D6EA 2Z31D 2EC8A 1Q1JH 3IU3A 1E27A 2DQIH 3BO8B 3B9KD 5I0DA 1DBBH 4XXWA 3S96B 2DQTL 4ORGA 3GIZL 1B2YA 5BZDA 3DXAE 1TZHA 4GJTB 3VYPA 4AYEC 5EFIB 1YMHB 1XF4B 4P59L 1TSRA 2DF3A 3KPSE 4B7LA 1AHWB 1BWMA 5CSBA 3KLHD 5DURD 2WW8A 2OKMA 5HHMB 5KZCD 3QG7H 1V05A 2G2PA 3EFOA 4XNZC 3VW3H 3VM5A 4LHUG 4HCFA 4EZJA 4JQXA 4YDVA 5DGQA 1QYGH 2D4FA 3VXTB 1NM4A 5I23A 5IMLA 3FMGH 2GJ6D 4HJ0C 1B0WA 4JHVA 3WJLC 4ZTOH 3QUKB 5LNDA 2BOLA 4AT6A 2GPZA 1V8HA 5DVNA 3CUPB 4PD4K 4N90E 1I1AC 2QHLA 4J6IA 4LRIC 4PY8I 2H1LM 3IXAB 4X4KA 3DIFB 1SYVA 5D7IA 1KTJA 5TE7L 4A6YL 3SKOB 43CAB 2FO1A 4PGDA 5DWUL 1ZGLB 2NLJA 5G5DB 4LLWA 4XCEA 3UPAA 2XZZA 1JXJA 1DEDA 2J8OA 1CI3M 2IAMA 5IP4A 2ZKXA 1HCVA 2WY3B 2K6WA 3NJLA 1A9EB 5F7BA 4JO5A 5JYLA 4KJPC 4Z8FH 5GSRB 1CLZH 1KJ2H 1UB6A 3L4CA 5DJZB 4ICXA 3MBEA 4NKDA 3RKDC 4BELD 4AH2B 5L8KB 1AKJA 3HC3L 2E47A 4X5WA 2VDKB 1J9SA 1R46A 3VO0A 5I1EL 4X4ME 3D2UD 3R7RA 2A9AA 2X4OB 4QO1A 5FO7A 1ECYA 1K4CB 1LK2B 4ZSOE 3MCKB 1S9XA 5BVJA 4JN1L 4ZMVA 3ZZSA 2BJML 1L6ZA 4R0LB 2G2RA 2HT2C 4FNTA 3BPOB 3DRTB 3SDCC 3VFOB 1S4IA 3LPOA 1ZXQA 4QLRA 4WHDA 1S9WB 4Z0BL 3VTAA 5CGMA 1P7BA 3VFWB 4IEFA 1KPRB 3AAZA 5I28A 4NLHA 4ZOAA 5E56A 1CGYA 3VG9B 5IQ9A 5CLXA 3QYNA 1ZVHA 1GIGL 3MR9A 5TDOA 2EICA 1YMMD 3UJTL 1A47A 4ODHH 4AYGA 3BPCB 1W0WB 5FCUH 1JGVH 3HG1B 1V3LA 1LQBC 4PCKA 4FQIL 5IB4B 2C34A 5HI3C 5DJ0B 3UBGA 1QSVA 2HLEB 3CX5J 3KGUA 1HVXA 1RHFA 2R29A 2CO3A 3VE0B 2IC2A 1GGIL 4IM8A 1ZGLP 3Q3GA 4ZPVB 1BVLA 1AAJA 5DJAA 1IBGH 2AKRA 3NGBB 5F71A 3CLEH 3QO1A 5LAXB 5JPNB 4F37F 5DFTA 2YPLD 1J1OL 2VDMB 1JXFA 4LEBA 2XRAL 5FV2A 5AZUA 1E5CA 2UV3A 2FJHA 3A4EA 1Z9LA 3ABZA 2BK8A 5FYJH 1DTUA 3IJYA 2IG2L 5EZJA 4CU6A 1VCBC 4QXUL 4UB0L 4BFOA 2PTTA 3DSNB 1F8TL 1P4BL 1XGPB 4R7VA 4L2YA 4M00A 4LKXB 4NKOA 4FLOA 1AKJD 3MBWB 4ONFL 4Y2DD 1TKWB 2C9XA 3CX2A 3QAZB 4RAUB 4H1LH 2ZSVA 1WH0A 1G6RL 5TDPB 2FO8A 1RURL 2Z1PA 3FQTA 4JFHD 4XCFL 2H3NB 1GJWA 3MLVH 3OMZA 2ESVB 2GY5A 3HAEG 4BSWA 2EH8H 1XQ4A 2BLFA 3IAGC 3MRFB 5EOTB 2FH6A 3CVHB 1X5GA 2CHDA 4MKTA 5ETUA 3GRWH 4UQEA 4EN3A 5E1AB 4W9IC 1FHGA 3MUGA 3KPRB 4OZHB 5FX3A 4A7QA 1CFNA 5KN5A 3QG6B 5D96B 3S37L 4DZ8A 5I75B 2EIMB 3T6XA 3SBPA 1G0YR 4TF4A 3SJVE 2YPVH 4N0YH 4O2CA 4R4BA 1XF5A 3C08H 1DJWA 2BY1A 3DXAB 3ASNB 4TTDD 2UY6A 1DN2A 4Y5VB 2Y7SA 4LLQB 4M5YH 4OFIA 2ZUTA 3MGOA 3S5LG 3KPSB 3GKWH 2BVPB 2WQSA 5I5IA 2LOEA 2H5UA 3Q9PA 3GJFH 3GXDA 2YQ2A 4U1HB 4E9YA 3CU7A 4NWTH 1U8QB 3EJYC 3RNKA 4F20A 3TBSB 1U8PB 1KENL 2AQNA 1E5ZA 2WXOA 2GABA 4FEIA 4S0TD 1VFMA 2AEPH 4MMZB 1PG7W 2UY7A 3WUWB 3C75A 4JFDA 2GW5A 2OZ4A 3O4OB 3KVDD 1P6FA 5A2FA 4B3VA 1EANA 4L9LC 3IN2A 1BGXH 4MDIB 2OM5A 1BQLH 2Y7MA 4L3FA 1YNTF 2V2TB 4AL8C 4M7KH 3RIAF 1TJIL 3MRJA 4U3SB 4YLCA 1MDAA 2FATL 3LJ3A 3QIWA 2X53A 2W65A 3AB0B 1JNLH 4QGYA 4U1LB 4KHTH 3EJJX 5IEKA 1JGLL 5CZXC 3UBXG 5EF2A 4D3CH 4HJSA 1J1PH 2C1PB 4JFXB 3GSOA 1JHLH 3B2UC 4JO8A 3FT3A 1ILUA 4G6KH 3U4EA 1UUNA 2F19H 2FEEI 1BVKA 5DQDH 1BHGA 4JDTH 5D2NC 2ZXBA 4ZQKA 5DS1A 3MRDB 2EZ0C 2O5YH 5DTFB 4AZ8A 4GAAA 1T66D 1IB5A 1ZMYA 4DW2H 1OXYA 3Q01A 5DHEA 3PS6A 4BH8B 3LNEA 5CEYB 3ECBA 2F58L 4UNUA 4EKJA 2UXTA 4YHKH 2IDFA 5DUJA 3ARFD 4MMZA 3SQBA 2MOVA 3HB3D 3PXHA 2FD6H 5AVWB 2WGNB 4GFXA 3DV4B 4FFWD 5LGHL 1B4TA 3TBWB 3ZTCC 4QLWA 4L0YA 3MJ6A 5GGUA 5IJCC 2P5WA 2GKIA 3VFRA 3VGHA 1HHIA 5JQIB 1PX4A 1AGFB 4QR7A 5EC2B 4QXWA 2K9UA 1PKQA 1JERA 3LHPL 4Y5VA 5DMJB 2CRMA 4AIZA 4CMMB 1K5WA 2JI2A 3OX8A 4QTFA 3WFBL 2FL5A 4UYPA 5CJBA 5B8CA 3NCYS 5I18L 4NDMA 1DBKH 2HVJA 4DZ8B 3C6SA 3D2UA 4DGUA 5DJYB 1WA0X 2ZCHL 5DRNA 4JQVC 3B83A 3FUKA 5D2NB 5HD8C 3NIDE 4GT7A 1OARL 1FYTA 3DOIA 6CGTA 3LIZA 1UM6L 1IBBA 3UZEC 3OWEA 2Y22A 1QKZH 5GRXG 2AI0H 3F3HA 1E9QB 1MHHB 2CG9X 3O41B 4HWNA 1FZKA 1Q72L 1T89C 2Y2YA 3A4DA 3ABGA 3KH4A 3RL1B 5EEWA 2CCLA 1FYHB 4J3OF 4UQCA 4GW1B 3GLDA 3NVQA 1CXEA 2G9HA 5K1JA 1K9TA 3VCLB 4F2MA 4LMQI 4PRIA 3QCUL 2AQPA 2IFGA 4RGMC 2X1WL 1XD1A 3T6WA 4LLDB 3ZZLA 3MMEA 7TAAA 3EGXB 2VAAB 5HY9A 1F2QA 1A64A 3G5VB 4OZFG 3ROLB 3PV6A 3RWJA 2NRDA 4C58B 4DPAX 3DUHA 4RWYL 5JHLL 4PJFA 5DI8A 2FE0A 3AREB 2R1XB 4KVNH 2ID5A 5A2AA 5JXED 1KIRA 3B7YA 3RUGB 2OMBA 4HJ1A 3MV8E 3OPUA 2GJ6A 3QO1B 5LAXA 5CIPA 1VCAA 3KJ6L 1NIFA 2LU3A 4PS7A 4GAFB 3WY3A 5IQ7H 4XNXH 4AV4A 5C07D 1F18A 5DD3L 4R7XA 5GRVL 3VSQA 4GRLA 3P11H 2OJZH 3MLWL 5MHSD 5C0RL 1JYVA 2W0LA 5EF1A 3HE7B 1ZJAA 3HIZA 4N2AA 1I3VA 4P9HC 2DY2A 2XN1A 3QJZA 4I0PA 4L3CA 1WWBX 4KKNA 5A40E 1F6FB 5CINL 3BUIA 1DQDL 1NC4A 1CG9A 1YC8A 4LVOB 1O0VA 3SOTA 1EO8H 3ARQA 4P4KD 2ADIB 3O3DA 1VIWA 4X6BA 4KPHH 4NQXA 1JF1B 3QRBA 5DLML 2RQEA 1OGSA 2ORBH 4JFQB 4OIIL 3VFMB 4MZIA 1FNGA 2WVVB 4BQBA 5HPMA 1AD0A 3QCTL 5I16A 4A2GA 1N10A 1AXSA 1ULVA 2UUDH 3W3BA 4NHCH 4OM1H 5ALBL 3TS8A 2D7NA 4L9LB 1SJHB 4GAGL 4HV8B 4CSTA 1G6VK 1O7DC 3UXFA 4H8UA 1CGSL 4RQQB 1FGVH 3PE9A 3QWOA 2NZ1A 2VDOH 5DD5L 4MASA 3ZVVA 1AHKA 5FHAH 3H9SE 2D73A 1T1XB 3MJ8A 3HJEA 2FHCA 3D85A 1JNHA 4NO0D 3U0PB 2APWA 3PL6C 3OHXC 4XH2A 2FECI 1IAIH 2NXYB 1G7MA 3CFDB 3WSQH 3HS0C 3QWNA 4GSXA 1T7YA 4Q6YA 5JUEH 5JTWA 4ALAH 3NCYP 1WFIA 1M6OA 2JJTA 3TASA 4F7TA 2P44B 2OI9C 3MLXH 3MOBH 2EE0A 4XP6L 5AWNH 1CYGA 1BFOA 3AUVA 3DC0A 4MDIA 2IAMC 4FGMA 4JN2A 4KXCA 5HGAA 4NRXB 4ZPTA 3ZKMD 1GGIH 4PV8B 4PYHA 3LZFL 3ZRSA 4LEXH 1T3FB 3O11B 3DGGA 4RZKA 5FKPB 3WFHA 1NBCA 1D9KB 2Z9TA 3N6YA 4U1NA 4Y19A 1GRWA 1Q9KB 3WNJA 3TBSA 2I07B 3OB8A 1F6AA 1BXVA 4PYGA 3EO9H 4OGYH 1ZLWK 3UJJH 1MHEA 4WWKD 4KK6D 4KZDL 4L5FH 3FTZA 1GGUA 2VMCA 1ET5A 4Q89A 1XF4A 3IJ9A 3OTTA 4IIZA 5BQ7B 2Z0UA 1LP9A 3DXAA 5JR1L 2VC2B 3MSPA 4O2CB 1SLWA 3VSTA 2F15A 1ZE3C 4KK6C 4M1GL 35C8L 2WINA 4G8GB 3UAJD 1SJEA 2UX6A 3QI9B 4HJJL 3MNVA 3QJFB 3WLWC 4K3EL 3X1GA 5AVYB 1M1XA 5JDJA 1B3IA 1J0IA 1NAMA 4ALAC 5I0XA 5C0ND 3CSBA 2FJGA 2FJSA 4F3FB 3WD5H 1UM5L 2EDTA 3P9LB 4IOFD 3OGCB 4GO8A 3VGDA 4UAOC 2Z8VC 1VDGA 2YAMA 4NNXA 1TYEB 3QUML 4J3SA 1AS6A 4OSUL 2P5PA 3FQTB 2EEAA 4OJDH 1EUUA 5FA3B 4QXGL 4APXA 5BVPL 4H8WL 3TZVC 2UWEB 3LNHA 1JSYA 3HCVA 5DDHA 1S9YA 1YYLL 1KIUA 1MUJA 2X42A 5IVNA 5FGRA 1RXLA 3P0GB 2ERJB 2MCPL 2PP8A 2C9PA 2P8LA 3MLZL 4MVBD 1NGXB 5I30H 1FYTD 3DX6B 2FB4H 1MLBA 1TJHH 5JXEA 1TMCB 5ACLA 4KQ4H 4PUBH 3RTQD 2CJ3A 1M71B 2XTJD 5F0MB 3UDWC 5GZNC 1WLHA 4WTQA 4JY4B 4Y4FC 1WAEA 3FONA 2AJUL 1JP5A 2B0SH 3B56A 3EGSA 4IMKC 4X6FA 1EO7A 5HHOE 3W0WD 3SDXE 1WP6A 1DR9A 4XPBL 2H8PB 3QDHA 2BXYA 2DL9A 5GRJH 1R3IL 3NJGA 1SBSH 4G9FD 4Y5VC 3KCPB 4HIXH 1JWUA 1E8ZA 3B8YA 2L7JA 2FYYB 3R4RA 4K5MA 2GSIA 5IBTH 5C6TH 5KJRL 3QDJA 3MFFA 4HH9A 3BH9B 3QPQC 2L4OA 4AQ1A 4X7SL 3CLEL 3Q2NA 5JQHC 4PPTA 2OMZB 5E03A 5EUOA 4X6EB 2XWBA 5KWYC 1ZT1A 5ISZB 4JFOA 4L18A 2J6EL 3RRQA 1H8LA 4G6ML 4HBCL 3OKEA 4FJ6A 4HUKB 3G6DL 4GAYB 4XXDB 3L3OB 5A2CA 1HYRC 1XSJA 3F7VB 2QEJA 4ZD3H 3LSOA 2EDYA 1OAQH 5JHMA 2ZJSH 4XWGL 1MRFL 3SBWA 3ABMB 1WD9A 1DBAL 1IFGA 4WQOA 4YHZH 4MB3A 2SEBA 3BH4A 1OAXL 3IEAA 4ACTA 2PCPB 1EJOL 1W72L 4KKBD 4QT5B 1RK0B 4JQIA 3DX6A 2EH8L 4N2KA 2AANA 4FG2A 5DHVB 1JUFB 1OIOA 1WA2X 3QJRB 4G8FB 4PCTA 3R7QA 3AS3A 3RURA 3ZGIA 1DVFC 4F15C 4XX5A 4AWJC 5AVQB 2Y0SA 4LLYA 3WFBH 1JZGA 4EUPG 3QFDA 4JRXA 1MJ7H 3DURB 3IJHB 3S4SA 5EZPA 1SHWA 1RZIB 4NQCB 3IMBA 3DECA 3T8XB 3OGCA 1QR4A 3IDMA 1DVYA 2EDKA 2CMRH 3W11C 2G60H 4I5BB 3NSCA 1QLFA 1Q94B 3UP1A 3QIBA 3U36B 4G7QB 1PZSA 4FNSA 4LCWD 3QJFA 3BE1L 3BWSA 2Y5TA 3VTMA 4TOYH 4LCYB 4FNLH 2IBZY 2FAUA 3LDBC 3U6RB 4YDVB 1J8HA 5GPRA 4Z7QF 1P1ZB 5LNEA 1DDTA 4FXGC 1D9KD 2VZ1A 1EDHA 4GAJH 3QUYB 1TDQA 3H0TB 4MD5A 5KJ4A 4KU1A 3HI1B 5C0AD 3PL6D 4YDZA 2NTFB 3JUYA 1W0YT 4ORGB 1MI5E 1PAZA 4WWKB 4N1HB 3V6ZB 5K9OA 1HCZA 3UYOD 2HZHA 2OL3B 2WV3A 4U1KA 3X13B 1S3KL 1JV2B 5CBEB 2X4TB 3FTGB 3LRKA 4L29A 4PRAB 5HHVH 4PTUA 3LX9A 4PV8A 4Z76A 3RTQC 1BAWA 2YZ8A 1RCYA 1L0PA 2YEVB 2Z35B 3SKUD 1BFOB 4K94C 1KPUA 1BFVH 1XGQB 2VGLM 3GMPA 1XO8A 3ARFC 4MVBC 1KB9K 5HVHB 2IPUG 1HESA 2ICEB 4QRPD 4TL5A 5FYJD 3T5WA 4CN1A 4FEMA 2A6DA 2XG4B 4YHKL 2OK0L 5AEAA 3L95A 2XG5B 2LFGA 3OZ9L 3PWUB 4HAKA 2C9SA 2E46A 1YEJL 4LCCB 4AUJA 2WIMA 3CCHA 1OLZA 2Q86B 1ZHNA 1ACZA 1SNRA 3L16A 4Y5XB 5EEUA 1JIBA 3MLTB 3U0PA 5IR1A 3V0EA 3B7UX 1OHZA 5T5FH 3H56A 4NN7B 2R2EB 4X5XA 3TBYB 4P9HH 3QWOB 4M4RA 3HG5A 5GS1A 2V5RA 3HAEB 1F1AA 2QHRH 3FUIA 1HN1A 3HE7C 3TIEB 3ZYOA 4WO0A 5EOQH 2DEYX 1AXSB 4FZ8H 3ZR6A 3SY0A 5F1NB 2WWKO 5I16B 2MQGA 3PFUA 2DWEA 3KGSA 3K0WA 3VFMA 1F4WL 4AYFA 1J0YA 1PZ3A 2WJ5A 1H6FA 3GB7A 1TJXA 2DWDA 3IU4H 3W0WB 2NY0B 4KTEL 4G43B 3U4BL 3WY4A 4Y1AD 4Z77B 3K5SA 1KB3A 4QNPF 1YEKL 5BRQA 3CFNA 4YIQA 5HGGS 5MI0C 1OPGH 1Z0MA 3LXUX 1CMOA 4KJWD 2EDWA 4FC3E 5IVZB 3MXVL 3CXHK 2HG5A 1CQYA 4YK4B 2A6KB 2LE9A 4KI5C 4YGVB 5C09B 5HYJB 2Y5QA 1EMTH 3U82B 4WI5A 4D0DA 2H9GB 2HKFH 4GRWH 2AK4E 4MCMA 2MPAL 4LRNH 3RX5A 4BQ9A 1J9QA 5CU9A 3NCCB 3HFML 1A3RL 1AYOA 3FOMA 3MRBB 4MMXC 4XO8A 1ZA3A 4I9WD 2QQLH 2VLJB 4YBLB 5DRWA 1U8HB 2A9CA 1KLUB 1E28B 1I9JH 2FWLB 4AOFA 4DP9X 3ROLA 3G5VA 4YSRA 3A3YB 3K81A 1FH5H 3WFDL 1Z3GH 3UABA 5J3HC 1CFSB 3ILPB 4FABH 3IK2A 2DQGH 5T3ZL 2NZ9D 3BWAA 3T0VA 5T1JA 1M42A 4K7FA 3PHOB 1ZS8B 3PWPB 4P46C 4PLOB 2H6UA 2V4LA 5CGYD 4ANUA 1KGXA 3JWDL 1IJNA 4TSCL 2VLKA 5E95B 4NNPH 1FO0B 3D9AL 1NCBH 2P52A 2YGVA 2LR4A 1BQSA 4UT6A 1I85C 2WQWA 4WHTA 5DLMH 4DP4X 1P5VB 4NB7A 2IH3A 1IFHH 2NY7H 4AUUA 4ZUTA 3BFQG 2IVFC 4C83A 2IPTL 4IRJB 4OSUH 2GT9B 4WTZA 3BGFC 2H32A 2HVJB 2N59A 4ODWA 5E0QA 5KW9H 1TUPA 3FCTB 4FFVC 3VMOA 3IFLH 3WTWA 1NEZA 2FL5B 4OJFL 4XMUA 4FFYH 3TO4C 4XNQA 2JCCB 2RACA 3KLDA 1NGZA 4YQXH 3LD8B 5FB8B 3UBXA 2W81C 1OF0A 5CZXD 5JNYB 2PW1A 1X7TA 1J9TA 2VNCA 4XXWC 5INCA 3A21A 1WT5C 3BT2L 5TJWK 3P4NA 1OTUC 3S35L 3TBWA 1KFAH 4UOZA 3QUYD 4HFUL 4M1CC 1JPGA 3H54A 3NUKA 5C0AB 4ZFZA 5GS3A 4J3WA 1AO7E 4AY0A 3NIDF 3HVDA 4ZQTA 1ILSA 2VLKB 2VDPH 5J6SA 5GGSB 2CBPA 3NEEA 4J3OH 4PJ7B 4U7KA 1MCPL 2R69L 3E6HB 2VISA 4S1DD 1LEKA 5EPMB 3ZDZB 4EEEA 5BW7C 4G82A 3BUBA 4UB0H 3NCMA 4HFWB 1GL4B 3B2DC 4YNYB 3ILPA 2IJ0C 1ZVNA 4UDTA 2QSTA 1M3IA 4FXKA 1A7RH 5T1DH 1B90A 1DFBH 1IC1A 3DTDA 4XB7A 2ARJB 1OK0A 1GZPA 2BIHA 1QD0A 2DWXA 4Q6IC 3U25A 2EVGA 3DK2A 1PGRB 3BVUA 4QJ4B 1L9PA 5CJXA 3QIWB 4M5SA 1MCQA 5ABDE 3V95A 4JRXE 3FO1A 2NDGA 1SY6H 2WBJD 2NXYC 4YPGA 3OWRA 4IRSD 2F68X 3MBXH 3TM6A 1O9VA 3ZKXB 5MEPB 3BVNB 1G5GA 2DYRB 5IMKA 2QPDB 2C3VA 1YMMA 3NYKA 3ME0A 3VGAC 5K9JL 1YQVH 3RNKB 1U8QA 3UACA 2WN2A 4Q56A 5JDSB 2MMXA 4APQA 4H25A 5AVVB 3MLYH 2AAAA 3O6MH 5LBSL 4WV1B 1KC5H 3ASWA 2XWRA 3S97C 3W0WE 1BOGA 5G4NA 4EXPX 2BXZA 5IG7B 1GOHA 2H1PH 4AMKL 1LGVA 2WXMA 5BV7B 4J3BA 4FN0A 1MFAL 3S2CA 4QRRB 3SDCA 1GGTA 4RNRB 4FYSA 1IC5L 3D3VA 3HI5H 1NC4D 3BDBA 5EEVA 4F33B 4HUVB 1MPAL 4UIMA 3HUJB 5GSVA 2Q76A 5IZ7A 2FB4L 4XNZB 1KB9J 1D6VH 1IM9D 1K4DB 1OGTB 2UXGA 2IAMD 3BH8B 4F2FA 1NDGB 2A6IB 4M7ZC 4PWJA 4TLKA 32C2A 1ZANL 4AE1A 1BD2E 4GS7B 2BSSB 1JYWA 1BDYA 4RAUA 1NBQA 4HS6B 3BN9C 3QRGH 1J1PL 2CK0L 2VRAA 3K8LA 5BS0A 1CDCA 4LKXA 3QR2A 2JB5L 4MFHA 4NKOB 5AB1A 1NLDH 5GRJL 4P2QA 3QULA 3DSNA 1ASQA 1A1OB 2WOBA 4IBLT 4MMYA 1MCLA 5DU7A 3Q48A 3FB5B 2XG5A 3VFVB 3IJYB 4JO3H 3WE6A 2G4GA 4O02H 5LB1A 2FJHB 3QT2A 3QUMB 5F7FA 2FGWL 1Y0LB 3KPOB 1IBDA 2EXWC 3F6IA 4ZAKA 3NCJH 4LEEA 5CR1A 1GC1L 2X1PA 4DQOH 1DVFA 3TN0B 2W9DH 3K80A 4IJ3C 1OAUH 3ZTJH 5LUMA 4PRID 4ZPVA 4AYBA 3W1ZA 1GTFA 1I9RH 5CD3B 3H1ZA 4UI2A 4PGEA 2AITA 1JHTA 3KDMB 3SY6A 4FTVA 4B9IA 3Q8EA 2ZAHA 3N41B 4OF6A 3V6ZA 3MV9D 1XZ0B 4TTDC 1B6DA 1O7SA 4ZD3L 1O7VA 1VKXA 3HG1A 3R0NA 3MLUL 3TBBA 1U3HD 5DEFA 3VWKA 4XWGH 4GP5B 1GC1C 5LWYL 4PJCF 4OF8A 3F58H 4P06A 4KDTA 4QPEA 3QXDA 3P3TA 3B6SB 1JWSA 5E5RB 2EEBA 1LEGB 5EC1A 5TH2B 3FCGA 3E1ZA 2IWGA 1E6OH 3D48R 1B4JH 4Y9FA 3NJVA 2VJ8A 4EZMA 3G5WA 4QRUA 2X9WA 1YEEH 3F7YA 1MIEH 4GSUA 3MKGA 4I5BA 4ABWA 1IEAB 1IM3A 4JFUA 4LSSH 4N2MA 5JIDA 3T8XA 5L2KD 2VXTH 1QHQA 2WN3A 2EEXA 3E1F1 3VWJB 5D7IF 5D93C 4A68A 3EXLA 4PJ7E 5TK2A 5DLLA 5DF0A 3PP4L 1E30A 1HTYA 1H15B 4NOBA 2ROYA 1THAA 1CICA 2VZ3A 1XH1A 1H0DA 1JGEA 1EPFA 2NY5C 5TE6H 4JFWA 3RGHA 3X11B 4KVNL 3FOLA 2EINB 5KOMC 5DRXB 5C0DB 4FXTA 3BSGA 5DZPA 5D4QA 4PW3A 1QFUH 1KZQA 4RMWA 4U6TA 5FYJE 3MOAH 3V9FA 2RCSH 1SPDA 3S34L 3L3IB 1SRDA 3ZQXA 3CNKA 1FNFA 4HA1A 2C8NA 4HZAA 4MQXD 1PD6A 2LV4A 3WTXA 1CK0H 2BY3A 5AW5B 5I19L 2BCMA 4PJBB 3QIWD 1AGBA 3EYOA 4ZNEE 1DO5A 1U8OB 5ERWB 5D4IA 2ZOKB 3J7HA 3ZDZF 1QTYT 3E8VA 3VXTA 2VQ1A 5I1JH 4H0GA 3TVMA 3MNWB 3U1SH 3P73A 1M9SA 3QJXA 3ARTA 4IK7A 4L8CB 2EH7L 2CKBH 2XWBB 3N0AA 5TF1H 3WO4B 1EO8L 1IE5A 4D9QE 2F5AL 4DTGH 1YMHA 5EFIA 1MFCL 2BSBA 2HT2D 4IDJH 5BZDB 1OM9A 1TR7A 4NQVB 4R4NC 4F24A 2NUTB 5BRPA 1MREH 3GJEB 4GMSH 3OR6B 1BMZA 3BRGC 3KGRA 5CCHE 4C56B 5AG9A 4CN6A 5SWQA 1T03L 3LKNA 1PY9A 5FYKU 1HOEA 2YMXL 3RWHB 1T1ZB 3FCBA 4XPAH 4ABQA 1LK3H 1KGYE 2DYPB 3ARBC 3NTCH 4HUNB 3LKOB 1SYSA 3TONA 4G6JL 4PV1C 3P77B 4DGVH 4EZLA 4BJLA 1CLZL 1KJ2L 3HUJE 3DVGB 4H1LA 4KQ3H 4RFOH 1BZEA 3HMXL 3RBSA 2VC2L 3REVB 1FG9C 3AG4B 2DLIA 5ESVB 2Q6WB 4ALAL 4R90H 3D39B 4OCLC 2EVIA 1BD2B 1KBBA 2ITCB 3WNMA 4MAYD 1XBRA 4L8BB 3WFZA 2YLHA 4UWQB 2L04A 1FAKT 3KNBA 4C4BA 3W39A 3M1CA 5KS9A 1EDYA 1KDIA 2BP8B 1I7UB 2J2ZB 2R59A 5EBLB 4NZTH 4BINA 3LKRB 1JI1A 3F7RA 4HWEL 2RAMA 5TGBB 1C5BH 1KUMA 1FBIL 3CDGA 5SX5H 3Q06A 4WJKB 3PCYA 3QA3B 3QI9A 2QKIB 4CC1A 3VGAB 4MJIB 4FA8A 4C59B 2IEPA 3EO9L 3VXSD 2IQAB 3UPRB 2E7HA 2EIBA 1CJYA 3UMTA 1C1EH 4UDUB 5BS0E 3WS6C 4AQAB 3L3HA 2MPAH 4HVBA 3VXPA 3O3AB 4AGNA 1CXKA 3CZEA 2VERN 1XH2A 4PRPA 3T1WA 4LCUA 4W9JC 2DBJA 2N1TE 2XLLA 3TWCL 3WKML 3OL2A 4L0ZA 2YUWA 3NJXA 3T6ZA 1UD8A 3I6GA 2CPUA 4XBMA 2XRAH 2IF7A 2LT9A 2HLFD 3QJQB 1OGAD 4G6AC 4Y88A 3TIDA 4EI5D 3EGDB 2R2CA 3A67H 4I0PC 4PRHB 1JN6A 2ZYSA 4GRLC 2NNAA 5C08E 1TOXA 2QKIC 4C4UA 2QSCH 2EAEA 3H2WA 3NFSL 1JRHI 5E2VL 1PCSA 4JN2B 4K9EH 4RRPG 1WEJH 3IJEA 3BGFB 4H40A 3U7YL 4HIIB 4HKBA 3DJRA 1IBFA 3VWJC 3WMQA 1BEYL 1TZ8A 2B4CC 3GNMH 4M6OH 4PJEF 5E2UL 1Q9LB 5FYLD 5DEGB 2UYLA 1AQ8A 3O0RL 2NY2D 2JELL 3HZVB 2R56H 5GGVL 2QMJA 3AS2A 1CT8A 3J8F7 15C8H 1A6WL 4EXKA 1JNHB 2KUTA 2I27N 4FL4B 2VQTA 3CXDL 4NEHB 4L23A 5H8DA 3X1FA 3T0AA 5FGBC 1HK6A 2V5TA 2F54E 1XF3A 4GEIA 5LG1A 1LDPL 1M7IA 1LO4H 4WU5A 1Q90A 3O3BB 4OFKA 5DK0B 4F9LA 4F8PA 4BQCA 1KCLA 3EW3B 3KM2A 4PRHA 2JCWA 4JY5H 1FC2D 1UH4A 2X5PA 3OHXA 4HIXL 3UIYA 4YHYC 4HJEA 1E2WA 2K6ZA 5K1VA 3GSWB 4AK2A 2HWZH 1D5MB 1FUNA 2WLKA 4WJ5A 5J89A 4XXCA 2FTAA 3O6FB 1P7QB 4ELDA 3O3AA 1EEYB 4WGKA 4JHBA 1TLMA 5TTRA 4OLEA 3O8XD 3ZTEA 2YRZA 1AFVH 3ATFA 4NZRH 3FO2B 4AUYA 4PREB 2D7MA 3V79C 5KYUB 4M7KL 1CB4A 1YEHH 1KMGA 4OF5A 5TGBA 1MH5B 5TDNB 4O9HH 2AGJL 2FQGA 5IB5A 4ZFOA 1F4AA 4GG6A 4F57L 1GYUA 4DQOL 2E9WA 1CGUA 3ULUE 4QOKB 4S1QH 3CFCL 2B08A 3J27A 2NQ3A 4WI0A 4GLRI 3SB3A 4GQ9L 3L7FB 4M93C 3MV8D 5I1DB 4S1RH 5JHDA 2Q3ZA 2FUQA 1SEQH 4PY7A 1WFTA 3RVXC 1VPOL 3WI9A 3A4FA 5D4JA 3Q6FB 4QRRE 3UIZA 2FR4B 1CFQB 4XNMA 3MCG1 3TA3A 4FG6D 2F7IA 2C26A 5B38A 1RHHA 1IKNC 4TMPA 2KZWA 1UZ8A 5EDXA 3UJIL 4JB9H 4WY7H 5BZWB 4Y7OC 4GG6F 3NFNA 4GMTL 4G3YH 3P2DA 3L6FB 1GKEA 4GW1A 4KKLD 2KZ1B 3S3DB 1GPOL 1IGTB 3IPFA 4B9GA 1FZKB 4F80A 4MA3B 2EIJB 1KYUA 2Q7YA 3LKNB 5DS8B 5FM5M 1D5ZA 1QPKA 4QY8A 4J8RA 4NP4H 2CBMA 5AUMB 1XCWA 5EO9A 4YSDA 1FVDB 3BOVA 4JM2C 3TBTB 2BNUA 2QVIA 2PWGA 2EDXA 2P80D 1ZLUH 3J07A 3ARRA 5I8CB 3T8VA 1SXSA 3H2PA 25C8H 5KSAB 1WRFA 4FJZA 1M9WA 5HTSA 4F7MB 4AE0A 2E9IA 2NX5E 1HQ4B 1CLVA 1N6VA 5KSVB 3THMH 4IMKA 1AG6A 4LSVL 3PL6A 1NC2D 3L1OH 4K8RH 3I02A 4Q9CA 2GSGA 4MJID 4OU3A 3ECVA 5F1OB 4AMXA 3B5TA 5FUOH 3QFJD 1V3JA 4PJ8D 2ARWA 2QR0A 1CUOA 5GGUB 3D07A 5BV7L 4J5VA 4KZCA 1G84A 5DJDA 1ICTA 2X3AA 4WTXA 4GRMB 4JHUA 3OAUH 1KEGL 4HK3J 2AVFA 3P4LA 3Q0HA 5LN4A 3EJZC 1PZ5B 4PMFA 1QMUA 4H44C 1CIUA 3FB6A 1U3ZA 1JDAA 4EI5B 1E5UI 3HLAA 2FGWH 3HW7A 3WAJA 4MA8L 4WO4A 4CA4A 2CJUL 2XXGA 4QMEA 3AZUA 4LSUL 5ITBL 4IU3B 1X9LA 1YNTA 3MRDA 4PJ7F 5DTFA 3CBRA 4AZ8B 2VZVA 3FSWA 5K9QI 2X7LB 2OMWA 5KSBB 2HXAA 4U1IA 1D5IH 3JV4B 5FR3A 4ZSOA 2DLGA 3MREB 4IYKA 4ECNA 5IQ7L 3BPOC 5HHOD 3WHXB 2W9EH 3N44B 4WWID 2IFFH 2A4CA 2O6DA 4U1LA 3DBSA 4KNQA 4DGYL 2EACA 3QH3B 5FC9A 3V52H 1BIIB 2D4DA 2PO6C 3ET9F 4PJDB 4BFFA 5IWLC 4AENB 4BZ1L 2VMEA 2A74B 4R84A 4L4VB 2ZOLA 5EZOH 1TLKA 3D18B 1TMQA 3FQWA 1S46A 1J10A 4F7KA 2UWEF 3CZFB 3FU7A 3MLSL 4N0UA 4TQEL 5EC1B 5JA8B 2F54B 1J9CT 4EOWL 2WYTA 3V6OC 2AEIT 2X10A 3POHA 4K3GA 3TT1L 3BPLC 3NIFE 3WN5C 1KT2A 3KPNA 4LOUD 4DO5A 4KQ3L 4RFOL 4ZO6A 1YEEL 3S98A 2IH1A 3RZCB 4GQRA 3X3FL 5CEZD 1CYWA 5H2BB 1QSZA 3U30C 1YEGL 3OKDB 3V4VA 3RWEA 4EMZA 5I26A 4OD2A 1XF5B 1P84J 2DQIL 1EEZB 2XYBA 3LEYH 1ETA1 3C09B 2HJKA 1C7TA 5E7BA 3S3JA 3CFJA 2ZP9A 5GGTH 3O6FD 4R9HA 1P6WA 1MCBA 4MHHI 4X7CC 3RVVC 1JK8B 2R0ZH 5MENB 2X38A 1OP3K 3CPLB 5IB2A 4IBSA 5D72H 1A3RH 3ZE0E 4OF7A 3UG4A 5ES4B 2APFA 1JGDA 3KPPB 1FBIH 4P3CL 1AI1L 4KVCH 3FMGL 2J1KA 4K23H 2VDMH 2E8ZA 4OAWA 3SN6N 5ITFA 3X1EA 4RMUA 3CHSA 2APXA 4ZSOB 1T6WA 3FN0L 3MO1A 3AXIA 4C56E 2OMWB 2X7LA 3FFCB 3FB7A 3QXUA 5I9QB 3ABLB 2BY0A 5I6PA 5T3XH 4QRQA 4EQ3A 2Q1EA 1IZKA 2PTTB 1JPTL 1KIQB 3KL5A 3SJVD 1QUPA 3OMIB 5DZ9A 3VYNA 4HF5L 3G5YA 4PJFE 5IEHA 4GQQA 3OF6D 2ZKMX 5GSVB 5J12C 1N12A 2F18A 3JWDH 1R5VB 2YLKA 4TV3A 1AQDA 2DQDL 3TA4D 3IVKB 3PGDB 2NSQA 3C6LC 3KEDA 4HEME 4G70B 1YNLL 4ZFFB 6PAZA 1DBJH 3B34A 2QADD 4HKZA 1RPKA 5DJXB 2FSEA 2VDKL 2EP6A 4LAQH 1R1CA 5FKAB 2CBQA 5B21A 2VXSL 2GSGB 1QZNA 4YO0A 4ODTH 4BFIA 4QHLA 2DI8A 5I8OL 4S0HA 2X89D 3IFLL 4L1SA 4XC3H 2X4QA 1KCBA 4YHLH 2BIMA 1KNOB 5F9OL 1EHLH 1JPFB 1M7UA 1CDBA 3F7PC 3WS3B 5D5ME 3QORB 1MWAH 4QHLB 4BFIB 1U95A 3R8BB 3FH5A 1PSKL 3BWUF 5D1QB 4XZ4A 5JORB 4P2YA 1BG9A 3BCFA