2Y22A

Human alphab-crystallin domain (residues 67-157)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
MEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSMSSDGVLTVNGPRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of R120G Disease Mutant of Human Alphab-Crystallin Domain Dimer Shows Closure of a Groove
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords ALPHA-CRYSTALLIN B
total genus 14
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y22A00
2BOLA 1RL1A 2N3JA 3L1EA 3QORD 3J07A 4PCKA 4YLBA 5LUMA 2WJ5A 2CR0A 4PBDA 1X5MA 2N0KA 2O30A 3Q9QA 2MNWA 1GMEA 3GUFA 4YE0A 3GLAA 3IGFA 3GT6A 1WH0A 4RZKA 2RH0A 3QORB 4YLCA 2K8QA 4YDZA 4FEIA 4JUTA 2CG9X 3N3EA 3VQMA 3W1ZA 4MJHA 3AACA 4ZJ9A 3L1GA 3QORA 5DS2A 2KLRA 4I88A 4M5SA 2JKIS 3VQLA 4M5TA 3Q9PA 4YL9A 1WGVA 5DS1A 1WFIA 2XCMC 2Y22A 3EUDA 1EJFA 3AABA 3L1FA 4ELDA 1SHSA 2Y1ZA 4JUSA 3QORC 2KMWA 2Y1YA 2WJ7A
chains in the Genus database with same CATH superfamily
4KHTL 3CMOL 3DOIA 4NQVB 4X9BA 1MCQA 1ET7A 1FNSL 5CJOL 2VR6A 3O3AB 4P9MH 4NKMA 3LRHA 4ZXBD 1OK0A 4CMMB 3G6JA 4L4JA 1ZLWK 4Y2OB 4OAWA 4XVUD 3V4VA 1YNKH 1D9KC 4YXKH 4AQOA 2YJLA 1I1AA 4JY5H 3SY0B 2X4UA 1MF2H 1ZOXA 2IXQB 1SYVA 2ZX7A 1Z3GH 2BVPA 5DMGC 5EBMA 2X9YA 3RWDB 3D52A 3RRQA 5T1KD 3RIFK 4UIMB 3TBCA 4LIQE 2EIZB 3FSOA 2CKNA 5IF0B 5B3JE 4HCRA 3D3VD 1UENA 3QNYA 4XPTL 2XVBA 4APQB 3JZYA 1JZ8A 3GSQA 3STBA 2VR4A 1YVLA 5CBAA 4O58L 1X5LA 3WGVB 2ERJB 4PB9H 1E6JL 5JPMB 4I3SH 1F0LA 2ZOTA 1ZTXE 1BFSA 1E5BA 5ESVA 1BEYL 3ZHKA 1I9RL 3OXSA 4HJSA 5JUEH 5BS0E 1IVLA 2F5AH 1RIVL 1IAII 4CN1A 1BBJA 1S7TA 2LT9A 3BKMH 3ESPA 3BX7C 4U1KA 3Q2VA 4QRSA 2GSGB 3ZKSD 1D9KA 2JELL 2VDQB 2VQ4A 4WJG3 5E23A 5I0ZA 4F15C 5EU6D 5GRUL 4J4PA 3IFLH 4HAKA 4X6BA 1B9KA 3MVSA 5E08H 4WW1A 2VM4A 1YNTF 5IVXA 1U93B 5E1GA 1EHAA 1M7XA 5CLTA 4WZ9A 4G8IB 4ZMYA 1RJZA 4P46B 2IPTL 2CBTA 5DS1A 4XPTH 5DJYB 1UKQA 3T3PE 3OC8A 1KFAL 4XH2A 5EMYA 3CDZA 2VXTL 3N41B 3HI5H 5G4OA 4PJ7B 2XFXA 4P23A 3NEEA 1LEKA 3NCBB 5HDQH 3ZTJG 4S0HA 1CL7I 2DQHL 1KCSL 3LIZH 1Z3GL 2DYPA 2FYVA 4R3SB 4UOQA 2IDCA 4G8FA 1BIHA 1CLYH 1GC1L 5F7WC 1QR1A 3IKCA 1NLBH 4Z7QB 3RG1C 4JY5L 3A6CH 2YOCA 3OR7A 5KW9L 3DIVA 5GGQL 3S8FB 4NQQA 1SY6H 4YHML 1BWMA 1B2WH 1X7TA 2FZ3B 1PZSA 2UZIH 3IMVA 3AADB 3DIDA 2E3VA 4WFGE 4F33A 2VMJA 4ZXBC 2LU5A 3VMPA 1WCBA 2VMEA 3O0RL 4LBAA 4PRIE 4M7ZC 5EIIB 3VGFA 1EPFA 4DO4A 1CL7L 4YE4L 7TAAA 5EA0H 3VWJD 2X2JA 4ZOEA 3S36L 4ENZA 3D25A 2FQGA 4RSYA 1IGYA 5DZJA 5EZJB 1JAEA 2A99A 5FKAA 3SCMC 5AB2A 1QFUL 2Y07L 1DUZA 3CK0L 4AM0A 2ICEC 1AG6A 2R1XB 3Q8EA 1HH9B 3C6LD 3UJTL 3I9PA 5AW7B 1R3HA 5F3BB 2P8MB 2ZXDA 1DQJB 1J18A 5CEZH 4AL8H 4WI0B 2VT0A 1QZNA 1D7FA 4MMXB 4NZTL 5IFHH 2NXZC 3RX8A 7CGTA 3MODL 4LVNC 3V0VB 2V3DA 4ANWA 3VXME 4JN1H 2UWEF 2P5ED 2UVFA 4HKJA 1XR8A 2AK1H 3TV3H 2I69A 3MX0A 1DQQB 3NZ8B 1NFDB 2W0FA 3B9KC 4DPBX 1KXVC 2Z31C 3FKUS 4FXGC 3AQXA 5KANG 3QXAA 5A40E 5T1LA 4MAUH 3NCWA 3QH3B 3KPSA 2Q20A 3ZU8A 3W82A 5IHZA 1WFIA 5F7MC 4BUHA 1U8PB 2EZ0C 3NJGA 2EXSA 3D3VE 3BD4A 3B9DA 1BQKA 2C9UA 4RAVB 4LCIH 3FT4A 4OZ4A 1E6JH 3J7HA 4ZAKC 3NJVA 2QEJA 1H3UA 5C2UB 1NBVL 1KB3A 4YO0A 1W8EA 4LLMB 1G7IB 1UJ3A 5J56B 1YEIH 5JPNC 1M7DA 4NO0B 4ZMNA 3RVUD 2DYPB 1JGUL 1OV8A 3G6AA 4NQCB 4PS3A 3V9FA 1VFAA 3KLAA 4KDVA 3LB6D 3OKDA 3P02A 3VSTA 1MWAB 2FX7L 3SYPA 4ZS6C 4M3JA 2XOTA 2V5YA 3ENEA 4DT2A 5F0JB 3MCKB 5DO2C 3MNVA 4PRHB 4BZ1A 1HEZA 2VKWA 4ZSOB 1UH2A 1S7UB 4AQAA 1TJHH 4JJOA 1VFOA 4A2HA 2FTAA 3IGUA 4KKLC 1M57B 5ID1A 5FUCE 4FG4A 5LKNA 1USQA 4G9DA 2XQYK 1JDCA 2GTZB 3ZTNL 4DKTA 4F9PC 2VLKA 3C6LA 4JO3L 4JO8A 2PP7A 2XPGA 3CN3A 1ZSDA 5B8CA 3LS4H 3GSNB 3GUTB 2F7QA 3AXLB 2Q7AA 3BISA 5DUBA 5DSCB 4U1HA 5L7XL 5E9DE 3WTUA 3NN8A 3QPXH 4HD5A 1E3FA 5AAWA 1K4CB 2O30A 4Z7VE 4PJCA 3O41A 3BUBA 3LKNA 4OT1L 3T5WA 4HCIA 3JWNE 3T1FA 3HLAA 3SOTA 1WV7T 2EC8A 3KNBA 1YECH 3DHJA 4F2FA 4KZDH 3OQRA 4FFZL 3V0EA 4APQA 4JHVA 4Z3JA 2FATL 4NCC2 2F54E 2QSTA 4JFFE 2CH8A 1NOFA 4L4VD 1A7QH 4TQEH 3VFOB 4Z78A 1G84A 4Z7WA 3F04A 4XPGL 5EUKA 3C08L 3RWEA 5EBGA 5SWZE 2YJQA 3BUTA 3B9KB 3O9WB 4L4TE 2X2HA 3EG9B 4J1UB 2QVMA 4J7RA 1MRFL 3EYSL 1MRDH 5CS7A 3RL1B 2YK1L 2FECI 1BD2B 3OHXA 3S3JA 3TFKC 1R3KA 3IF1B 5HVHB 2YAOA 1PS3A 4KUZL 2D7PA 2EABA 5B4MD 1AYOA 1JHLH 3MU3A 5E4IA 5BCAA 4F7KA 4IQHA 4YEEA 4GO8A 3WXVL 5JXAH 1SHSA 1YYMH 3GLZA 1U6AH 3DO4A 4S2SA 3NT0A 5IBTL 5EOCH 3UTZB 1D6EA 1IFRA 1T04B 1YSOA 3S37L 4AEIH 5C6TH 3SQRA 1FSKB 3QUXC 3FAWA 1CFBA 2J20A 2MCAA 1XF1A 1JHKL 4HJJL 3BWSA 4XNQB 4NCDA 4WK4B 2G2RB 1BZ8A 5A7EA 3HNTH 5C09E 4F7CA 3IJ8A 3DV6A 1QKZH 3WNPA 5IZ7A 4YSEA 2A73B 4LLQB 1NGZB 3IFPB 5G4MA 2CBQA 3MPCA 2VERA 3EYFB 1FL3A 1JZJA 2OQJB 2PABA 4OM1H 3V4PA 5IJVA 4O00A 3GIZH 4QRRE 1ZVSA 1T3FB 1XMWA 3RX7A 1RL1A 3ZSSA 4JKKA 1SVBA 1YLBB 2HVJB 2VLRB 2Y7LA 4R4FH 4XNYH 5EU6B 3X11B 3DPBB 3KR3L 3Q5OA 3VSQA 1OTUD 3S8WA 1XGZA 4G1MB 43C9A 4P23C 2I9LA 1EHNA 2DJSA 4FMKA 5I75B 4OCWL 4O9HH 3S5LA 3UTPE 1HU8A 3KPPB 5F7HA 1CLCA 3I6LD 2VXVL 1ES0A 4P49A 3GBLA 4RWYL 1CO1A 4G7SB 5E6ZA 2WZPD 1BBDH 2P28B 3M86A 4PRHA 4W9LC 1DEEB 3ARFA 3DXAB 3PNWA 5E2WH 1HHJB 4LSDA 5F7KC 4AM0B 1XH2A 2A2QT 2V6HA 3LHAA 4LQ1A 3P2TA 1Q0EA 1LO3H 4KXZI 3GBNH 3WJJC 3LKPB 2GJPA 4Z3FA 2VDRL 1ITBB 4OIBA 3SDAC 2VDOL 2ZICA 2GIMA 1KXQE 5FO9A 1NFDE 1EEUA 15C8H 5I8EB 1X9UA 2H9GB 3QFGA 2DMCA 4J6RL 2Q7YA 5ALBL 1M71B 5BOJA 4JRYE 5I6XB 4LRIA 2FZ3A 4L1DA 4WNQB 2WZ0A 3QC6X 3IE4A 4N0FB 2Q3XA 4K7PL 5E4EB 2AXJA 1KLGB 3GMNB 2X41A 4YX2H 1KLUB 2Q8BH 1DSFH 2V17H 3HE6B 2PPFA 2P5EB 3L4XA 1SJEA 1TF4A 4A7VA 3MZTA 3GB7A 1Y6KR 4JFTA 2YUXA 1QRKA 3TNMB 4V1DA 1YUHA 1AIZA 4PRPD 5CAYB 3D4YA 4FQPA 4WEBH 3WIFA 4IJ3B 3B2XA 5IQ9A 5HHPA 5MEQA 5I6PA 3V5KA 4YSAA 1WBYA 4G8EB 4BFRA 2D8KA 3OPZL 3UO1H 3RZCA 2VR5A 3MV9A 2AQ3A 3HLKA 4HLJA 3F6LA 4XBMA 1JF1A 3EGDB 4TSBL 1I8UA 1CGYA 3FFOA 3ROLA 1NM4A 4PY8J 2J1XA 2Y24A 1A4BA 3G5XA 2BY0A 2WN3A 1DEEA 3ARFB 3PNWB 5D2NA 1KMGA 4FLHA 4WUUE 1BD2D 5INDA 3H42L 4YN3A 2AXWA 1A4JA 3N44F 5J1TC 3GNML 2KERA 3T2OA 3GIZL 1OKEA 4KBPA 3ZUNC 3QNXB 4F2EA 1LMIA 3KH4A 1H6UA 4J27A 1TVHB 3AM8A 4GKSB 2XG5A 4W9CC 1A3ZA 2YPVA 4R4ND 2XG4A 1MVYA 3SE8L 2NW2A 1I9JL 3WUWB 3MV01 4UTBL 5D1XD 3AABA 5FECB 5BUGA 3SOBL 4D0BB 1O6SB 5E2JA 3PCYA 4NNYB 5LGYA 3TV8A 5DJ6A 2ERJC 4AGNA 1W2KT 4YE0A 4AEIL 1U6AL 2OCFD 1OE3A 1NGZA 5JW4R 1M3IA 4YDJB 5AW6B 3VI3E 1K4CA 5KAQF 3KPSB 1CVRA 4PHZA 3V4VL 5IMMB 5C0CB 2XXCB 3LKRB 3IFOA 3UJJL 2ZKWA 5I1EL 4Q9QH 2HRPL 5KOVC 2EKSA 2A77L 2BC4B 5KVEE 2MKLC 4BKTC 3VB9A 1NEPA 3LQAH 3VU2A 4M61A 2VDQH 4IBZA 3TS8A 1M56B 4U1MA 3BOVA 3DO3A 1BZ9B 2V37A 4IEFB 1U93A 1H3WM 1RHHB 4Y19A 1B4TA 3BYTA 5JHLA 4D7PA 3UGUA 2XJLA 5I1LA 4MCYB 1QW8A 3TO4C 1YAZA 4KJWD 5JW4Q 3OLEA 3DX9A 3VE0A 3VQLA 3Q6FB 4OKDA 1DQLL 2IMMA 3NDYE 1FF5A 4HHGA 3QUXD 4IRJC 2AEWA 2Y25A 4NQCA 4UTAA 5F2FA 3Q2WA 5T1DL 2WQAA 2R8SL 1G9NL 2ZUYA 1K3ZA 3K1DA 1JGVL 3NK4A 3ZKND 2WVVB 1OZTG 5ENWA 1VEPA 4HPHA 3F65A 4HBCH 5F7BA 5HYSG 3CVHL 4PS4H 3I85A 3T0EB 2RBLA 4V1DD 2XWDA 4AQ1B 1A4KA 1SXAA 5F7FA 1A6TB 1OPGL 1TTFA 4L9LA 3OLGA 1C5CH 4OLUH 3MYJB 5DJCB 3T2PA 2FEDC 2A0LC 3BKYH 5HDRA 3Q3GA 1G6RB 1OB1A 1FVDA 2B4CL 1TVHA 2E46A 3LKRA 4FQIH 1BECA 4GKSA 5EU5A 2JCCE 5FA3A 5FCSH 1TCMA 3GPEA 3PGDA 4KGJA 3P0VH 4CADA 4J4PD 5E8OA 4LKCB 3T1FB 1SM3H 3GSNA 1Q72L 1CVSC 3MRRA 3NH7L 4N2AA 1RSFA 1H8LA 3DROA 4KTEL 4XH2B 5SWSE 2ODIA 1GYUA 1W9XA 1VPOH 5F88B 1QX1A 3GXFA 2OW6A 3D39A 1T80A 4M5YL 5LBSA 2DTML 4QPEA 1KEMH 4N2EA 3T2NL 4TOYL 3M7FB 4UIKL 1A6WL 1FZOA 4E5XG 3AG4B 3ZTEA 1P69B 3D0VB 2YA2A 2J6EA 3ARFD 4M8VA 4UCFA 3LZOA 3MLSH 4DP2X 3AREB 3BUYA 2IH3A 1E3XA 5SWZA 1HHJA 1FLTX 2GBUA 4IU3B 1O6TA 2VXSL 2NXYD 1HSAA 4FLRA 4QHUA 4MB5A 5EIIA 3ZVVA 3V6OA 1AS7A 4J1UA 1RZPA 2NZ9D 1UXWB 2WZ5A 3BRDA 5JQ6H 2A6KB 3VXTA 5EFIA 4L1HA 3QPQC 4XTRC 5EO1A 5E9DB 2WINB 3ZKXC 1GPOL 2ZNXA 4XWOC 1A64A 1G9ML 4NO2A 5J8OA 1SBSL 5IESL 1XIWD 3EHBD 2R27A 1JI1A 4OCNC 3CZLA 4OZGE 1SUJA 4NUGL 2XTLA 3SE9H 2F19H 4X4MA 3CV5A 2IDQA 4XP5H 3WG7B 3GLEA 4PS4L 4WK2B 3SPJA 3OQ3B 5AG9A 2GITB 4Y1AD 5DJDB 1AGDA 1DDHA 1AQ8A 1OGAA 1QFWL 3CFUA 4PGZA 4XNYL 3MRBA 3A21A 2EEAA 12E8L 2NXZB 4KQ4L 5DJ2A 4DN4H 5FF6A 1K9TA 2QPUA 4XO9A 4ADJA 2WN2A 3FB5A 4JZJB 5ILTH 1KJVB 2EDHA 2FIKB 4NS0A 4GNKB 5JW5A 2FLRT 4X5WA 1KJMA 2VDPH 1K6QH 1S7RB 4YHKH 1ZHBA 3I9GH 4GLRH 4L3CB 4X6CB 5SV3A 3S48A 5J9PB 3U4AA 5C6WH 1F5WA 3I50H 2LE9A 4WO4A 4H0HB 2AJXH 5IW1B 2UZIL 1JXDA 1R1CA 3UIZA 5C0JB 2OYKA 2Z31D 3C5ZA 3TYGH 1BBJB 1SY6L 2X4RB 1KCUH 2ZAGA 3PL6B 5HDBE 1MLCB 4OBSA 1NGPL 1QPXA 2EDNA 4IKIA 4A2MA 4IBVA 2I07B 2GJ6B 1A0QH 3BH9B 4KI5C 2R83A 3O8XB 3QI9A 2L04A 3ZRFC 2C1OA 4F8QA 3B7SA 3FO1A 2AZAA 1G7PA 4XP4H 2XXGA 4OGZA 3T0EA 3OV6A 3LZFL 2NPLX 2DBJA 2Q7YB 1A3RH 4CGUB 3MRKB 1NBYB 1UB6A 5TF1H 5HHQA 5KSAB 4PJEB 1CLZH 2M83A 3QWNA 4GKNA 2AAAA 1J8HB 4F5CE 4IU3A 2B08A 2OFQA 3PV7A 1QSFD 5FHBL 5F8RC 1M2OA 1U8NB 4OQTH 5LAPA 3TJEH 1XO8A 4HKZA 1W0YT 4KVPA 5IVOA 2C26A 4XPGH 5L0QC 3UZQA 2KUTA 2YD4A 3O11B 1TMQA 3B1TA 4KX9A 2UZXA 8FABA 3KPMA 2NY0C 5CP7B 1W72H 4ZOBA 4U05A 1EEQA 2KI6A 4HWZB 3U9PL 3PGCA 4U1MB 4Y8AA 3RZCB 1ET5A 3LXUX 4OQTA 5I1AA 3V4UH 5IJCC 4I3SL 1OQOA 1R24A 5C07E 3QS2A 1II4E 3BRGC 1X44A 3QZBA 4L4TA 4Z7WF 2BMKB 5C0RL 1I8MB 1Q9WA 2R1XA 1R6VA 1C8PA 4Y19D 3O0RH 1T22A 3V7AE 4PJ8C 3US1A 3JVFC 3N1QC 3D39E 2VXUH 3QIUB 1UOWA 4HG4J 4PJ9A 2QFRA 1T1XA 1J5OH 3NIDB 3BZ4A 3X14B 5DHMC 4MXQD 1T1ZB 1I85C 3CSFA 3E7JA 2P5EE 2N1TE 4J3OC 5JA9A 4P46C 4GRWB 2JCCB 1Z5HA 1OCWH 5C0FA 1DQKA 3FQUA 1UWGH 1UHVA 2WLJA 4NQXB 5AYTA 2RGSA 3TYFB 1L3WA 3UBGA 4G6AC 5DWUH 2YD8A 3STZA 2VXUL 1S7WB 4MB3A 4AIXA 2JMRA 2V2XA 2EH7L 4AYFB 3CPLB 5ITFB 1HXKA 1Q1JH 3IKCB 4G11A 3KEHA 4N8PA 4KHTH 2BVTA 3A0OA 2APXA 1LK3L 1HE7A 3MRDA 2VDOH 2VUYA 2XV0A 1BP3B 1NJ9A 4LSRL 3OHMB 3O4LD 1RSYA 1RUAH 2DBLH 1OGPA 2JLPA 3B5HA 1P7QD 5E56A 3BP4B 2H6PB 5JIMA 5KUKA 4XP1L 2WGNB 1GJIA 1ZHBB 1ZA6B 2J1ZA 4LOUC 2NT0A 4B7LA 2YGOA 1L6XA 1BZ9A 1Z9NA 1JZ5A 2BC4A 4CGTA 4FNRA 1JPTH 3IETA 1TJXA 4ZG1A 3TBWB 4D2NA 3ZMNA 1Y1UA 4B9CA 3KPQB 4KQ3H 3ZT6A 1BD2A 3OHXB 3QP3A 3HBPA 4LSUL 1BEYH 1QMUA 1U9KA 1WA2X 1MPAH 1MXDA 4KJPD 5I8OL 1KG0A 3STLA 5DFVD 4P2RB 4BQCA 5IHZB 1UJTA 1L6PA 4UNTA 1ITCA 4JN2B 2CMRH 4OGQC 2NY4D 4KHXH 2VM9A 1N67A 1XF2B 3PP4H 3H0TB 3D0LA 2EC9T 2GJZA 2WKOF 2WWKO 3QUYC 2PWGA 3ASWA 1UKTA 1LE9B 3SODB 5C0CE 1IL1A 4MMZB 5CBAB 4N6QA 4JR9L 2Y36L 3T6VA 2CIKA 1EO7A 4QCIB 4PU2A 3WFZA 5DRNB 3S3DB 2FWSA 3SDXF 2YO3A 2WYIA 3ARFC 3IKKA 3DK0A 5IBTH 4RWHA 5HGHA 1M6OA 2P4AB 3HC2A 5JQHC 4TQPA 2AABH 4PJ7F 5IG7A 1KXTB 1RUPH 2I60L 3FB6A 2HG5B 5LDUA 2CSPA 2E7CA 2P24B 2H6OA 2L7JA 4X0KA 3X1GA 4TVSa 2GTZA 4W1TA 1PY4A 4F3FA 4NSKA 4OKVB 3VACA 1QYGL 3S6CA 4Y7MA 5I9QB 4OLYH 4QXUL 3LPOA 3GK8L 4HEME 3OBAA 1G6RL 1OP4A 2XPYA 3IDMA 5C2BH 3O6LH 4LIQH 1RZKL 3NFPA 4QWWC 4ZQKB 3KCPB 1LE9A 3HPJA 4G5ZL 1KIUA 4JVPA 4K8RL 4WHTB 3CFEB 4NDMA 5CD3B 3MRGB 5JO5A 2IPUG 4IRZL 5EZIL 1VFAB 4PJBE 3TH3T 2JE8A 4MJID 2X2YA 3GHEL 2FB4L 3ZX1A 1Y18B 3HG5A 1V7MH 1WJ3A 1M71A 4PIRF 1ZTXH 4IBYA 1OM9A 3T6QC 3TH2T 3TIDB 3SY6A 1EGJA 5IMLB 3QDAA 4KDTC 4NKQB 2WWKT 4WHDA 2Q2LA 2NNFA 2NX5D 4RX4D 3VFUA 1F2XK 3KYMA 1XCQA 3K7UA 4GS7B 4KJQD 3DO7B 4X6FA 3BN3B 2AJUH 4NUPA 3BSZA 1OCOB 4DAGL 5IF0A 4PJXF 2FUTA 4ISVB 4J3OF 2EQDA 2FJFA 1P6AB 5E0FA 1AY1L 1QG3A 3N1PC 5AFAA 4P06A 3ZQXA 5FKAB 4AK2A 3WHXA 5I0DA 1CGSH 25C8H 4HEMA 4M4RB 2C7UB 4LGRB 5EC1B 4CVZB 2UZXB 3KBPA 1YEGH 2CO7B 2PXYB 3VH8G 3ZY7A 4BH8B 5F70A 4OI8A 3JSSA 4NKDA 1PD6A 2H45A 4Z7WB 1DE4A 1ZD6A 2IQAB 4U6HB 2ALAA 1XGTA 5IB5A 3F58L 3WFEH 5CU9A 1O7SA 3ROOA 1E4KA 3PHAA 2VN4A 4NERA 3V5HA 5FWQA 5IM7B 1RJYA 4PJHB 1EZVX 4PJEA 3FSZA 5FO7A 4PGDA 3SPHA 3HZMB 1UADC 1YEGL 4EIUA 4L5FE 3LXBA 4GUOA 1L5GA 1RZJH 1UEYA 4DP5X 1NCUA 1RZIA 3O45A 3TX4A 3QIUA 1MFEH 2IOMA 5HVHC 1AY1H 3OF6A 4PRNA 1CFMA 1JNJA 2E4TA 4JFDB 4JM0A 3CMOH 5FOBA 2X6VA 3G04B 3K8LA 3GI9H 5ABZA 1MLCA 5C0AA 1GVIA 3O2DA 4XN7A 3UZVA 3VFMB 5C0CD 4HCGA 4LHJB 5FYLE 4K71B 1FVEA 1R4XA 3DUSA 4UQ2B 3U82B 4Z3IA 5I18L 1ND0B 4K7FB 3DUUA 5I76B 4TVPL 4MBOA 3ZTJH 4EOWH 1AR1B 1MW1A 4H1LG 1RVFH 1IZJA 5KAQG 1PZ5B 4TS6A 2BVUA 3WD5L 1W80A 1M05B 5KBMA 1DQLH 1RZKC 2ZXGA 1VENA 1JPGB 5E7BA 5HHOA 1E4KC 4AUJA 3NJHA 4XOCA 4NHCH 4G6JH 5GGRA 1GJWA 3GSUA 1B2YA 5IFJB 2EDOA 3N43B 3L1FA 4XOAA 3ECWA 1KSRA 4RISH 1HKLL 4I48A 4XVTH 1JERA 3LKSB 4IEFA 5CINL 3PF2A 5FDYA 1BAGA 3D50A 1T6WA 1ESOA 3FU0A 3B37A 3EGDA 1JZ6A 4PV1C 2BP8A 5HDBB 1XEUA 2NY1D 3VQ2C 4ERSL 4NNXA 5IUSA 4OLYL 2FJFB 2GJ6E 3L3KB 3QK0A 1Q9KA 2DQDL 4OZ4B 5EIIG 5DO2D 1S6NA 2HUEA 2DWSA 2OSYA 3HC3L 3FC8A 3ALPA 1A3RL 3U1PA 3LS5L 2KZWA 3MRCA 4GW5B 3E9TA 5ID0B 3VU1A 1AZUA 2HN7A 2WB7A 3MCLL 3GGWA 3RVUC 1E8XA 3QR1A 2OMNA 2P8LA 5DK0B 3F3HA 5I8KL 2VISA 1RQ5A 4RFEA 1T7WA 3VXSD 3NGBC 4Q9BA 3VQ1C 3V4VB 4B9FA 4OLWH 3HB3B 3V8OA 3GZQA 3ME0B 2ED6A 3HAEH 3VA6A 4NIYE 2LHAA 3BIBX 4FXKA 3NSDA 3ESVF 2WVSA 2VXTH 3BWAA 3MLRL 1A1MB 5C0BD 3GKZA 3VFNB 1KPVB 3OJDA 3QFDB 4PI0A 4E42A 2VABB 1EZVY 1J05A 1SOQA 2QHRL 1BIIA 1M7UA 3DTXA 4PM1A 3W37A 3ZTCC 3EFDH 3RWHA 3VXQB 4HHWA 3EOYG 5EC2A 3UOAB 2DH3A 3GHBL 4FP8H 2FWOA 2R15A 5DJ8B 4MNQD 5CUSL 2HG5A 1YY8B 4N8CH 1CIDA 1WCBB 4FQ2L 1NMBL 3CFCL 1N5YH 3KJ4C 2HN7B 1BYNA 1F90L 4P5KB 4K94H 2AQSA 4OJYA 5I1JL 1OP9A 1BZ7B 5HHPB 3VI4E 1UA6L 3UTTA 4BKLA 3TESA 4JDZB 2FLMA 4NAMA 3UADA 2FSEB 5ICXB 4A6YA 1YMMB 3D2UB 3OAWA 4EO5A 3LRMA 3MLZH 4GKZB 4ZFFA 4PI2A 5T3ZE 1MJJA 3L08A 3WLWC 3K0YA 2ESVB 4MJIA 3KAAA 2IEPA 3QCUL 1MCSA 1JMZA 1UWFA 2A73A 2V3EA 3OJ2C 4P2RA 2B14A 3I6LE 2ZCKH 3LV3B 1P4BH 2CE6A 3WKML 4F15B 5EF0A 5DEZA 2R4SH 3MXWH 2WANA 4QUOA 4KNTA 4YXLH 2E9WA 4H8UA 4PUBH 1KT2A 5D2LA 5DJYA 1I4FA 1TPXC 3VFGH 4GKOA 1ZGLM 3DTUB 1B4RA 3QHZL 2W0KA 4Y1AB 1KBPA 2HT4D 2K8MA 3EW3B 5E6RB 3QFDA 3ZE1E 3IXAB 5D71L 1KWGA 4G3YL 3QCUH 1XF4A 2J88H 1KV3A 1NA8A 2VDMH 1I3GH 4IMLB 4RQQA 3VW3H 1G0XA 3EYVB 3PAYA 3E8UL 5AKSA 1ZT1A 1DHKA 4QJ4B 4ZS7L 5FW8A 4GRMA 3O2DL 1J0HA 1J1PH 3UMNA 3F2LA 4M61B 2QGBA 4MCZA 3ECBB 1QPPA 1VZIA 2W9DL 2OZ4A 2ZOUA 3QORA 4XZ4A 1ORQB 1QBLH 4PJCF 5JPMC 1JZFA 2J12B 2CPUA 3RWGB 1X5GA 3QNZA 4MJIB 3KWVA 4KVNL 1NMBH 1YG9A 3CFCH 3MZGB 4ZUSA 1HESA 4M43H 4F9LA 3V95A 3SDAA 3V6FA 4JFOB 4Z23A 4JDZA 2CNYA 4XO3A 2B1AH 4LAQL 1T1ZA 1IAKB 3FMGL 3PPEA 2OMBA 3O9WD 4D9RD 2XN9D 5D93C 2DQUH 5AD0B 4R9HA 4XCEB 1IC5L 1FNFA 1RIUH 4MAYB 4WI7A 3F00A 1PX4A 3DVFA 2F54B 1O5PA 4D9LH 4HS3A 2A83A 2JKRM 5LBSH 1CGWA 3MV7D 4BXVA 4ZMWA 1UH3A 5B8CB 3SHSA 4HKJB 5ICYA 5EORH 4JFHE 1R3LB 3D4CA 3LRSB 4TUOB 5TE4H 3U1QA 1ML0A 4HIXL 1A1MA 4D9QE 2CDGA 2FBRA 3BMWA 4Y5YA 2WLZA 3DUUB 2Q9OA 3K2UH 1A47A 4S11A 4UTAL 5E0QA 2D7TL 4FD0A 2WXPA 3WJLC 3MV7E 1ZPUA 4E0RA 4FGMA 3ABMB 3UABA 3LKQB 2Q3AA 1AI1H 3MV8D 1MRFH 4BFIA 3VRLF 5JW4N 5D72H 3EXLA 3UTQB 4X7CC 4ZK8A 4CKVX 4PJ9C 4URKA 2AEOA 4DGWC 1MAML 1FFTB 2ARJQ 1U3HC 1IQDB 3K2UL 1BZQK 1FL5A 1SJEB 1CGTA 3MLUL 5I2IA 2V5TA 3CPLA 3PIQB 3QCTL 4DP4X 2AJYH 2J6EL 1K6QL 1G7LA 5DHVA 1AC0A 4ELMF 2WM0A 1J1OH 3GSQB 1TIUA 4RA0C 5AW3B 3WMPA 3SYQA 2AANA 2V5MA 1AHWA 2HVKA 4XR8C 1L0QA 5HI5C 3AITA 4CILA 2X38A 3L3OB 4G59C 3PWNB 2IJ0C 3BPOC 4AC4A 4ZW3A 3O8XA 1C12B 3J07A 1RZFL 5FO9B 1OTSD 3QHFL 4G8FB 3X14A 4XPFH 3EGXA 1MIML 4PWKA 3KPRA 4P59L 4UM8B 3T2LA 4PLJC 1FYHB 3EFOB 4ZFOL 4FQQB 5D1QB 4OVUA 4GJTB 4TUKL 4CC4A 4F93B 1JWSB 2A5UA 2WKGA 5CFAA 1VJSA 3REWB 5GRVK 4ZDHB 5E24E 4GRLB 3NACL 1OANA 1QTYT 4CVXA 1S7RA 3F84A 4JFWA 3L7FB 3NYKA 5TQ2L 5EEZA 5DF0A 1GPOH 2VLLB 2ZSVA 3N5AA 3QUMA 5EN2A 4S0TD 3QQNA 3G9VA 3O3DB 3B2UD 4OKVA 5TGBA 3GSWA 4PG9B 4XMPL 5DLML 2W9DH 1XGYL 4B5EA 4QR7A 3WO4B 2G2NA 3U25A 3TZVD 1NPUA 1DUZB 3M17B 1FIGL 3H9SE 3WFDL 3CGTA 5AW2B 4RIRA 3U0TB 3O4OB 4MD0B 4DGIL 1WRFA 2Y2TA 2D2CC 3MRGA 4S0SD 5GGUB 3TVMB 5H35B 1ACZA 3DUHA 4KUCF 3L9EA 4L37A 4R26L 3GBMH 1KV7A 2NYYC 3RB7A 4BSWA 3L3KA 2PWHA 2W65A 1KBVA 5HHNA 1WWCA 1DZBA 2H26B 4XC1H 4FERA 4MAYD 3ULUD 5C0BB 2AJSL 2B4CC 3T65A 2BFVH 2X4OA 3QDMD 2EACA 2IH8A 4WV1B 3HMWH 1UXLA 1GY2A 3ZE2F 2RCSH 3LOWA 3N06B 4PJ9B 4MYWB 1DJWA 3FN0H 3P0VL 5F9WC 4LEBA 5C3LD 2YRPA 4CMHB 2Y1VA 2EO1A 4X8CA 4AG4H 1F18A 4FQIL 4N68A 1ETZA 2VNCA 2WUCL 3C87A 3QXVA 5DJ8A 3X12B 1HXMB 3ILQC 4KJYB 4HP5A 2BSSA 1CYWA 3FO2A 4Z0XA 4K4KA 4RWYH 5KANI 3GHEH 4HJTA 4Q56A 5I19H 4YHZL 1V3MA 1XMEB 3DSFH 2ZUSA 3EJJX 3GO1L 3RX5A 4ZPTA 4GW1B 3BN9C 3L3OC 3QQDB 1RZ7L 1HHKA 2Q1EA 4Z7QE 3RTQD 3GMQB 2CJSA 3KPOA 2LW3A 3KPLB 5MHSD 3AT8A 3WLWD 4JB9H 4L1TA 4DK3A 4YS4A 1TVDA 2EIKB 5C0NC 2ATPA 1SDDB 3MRLB 5KVGL 4PY7B 4GS7C 5DMKA 2JB6B 3RDTA 2H3NA 2BSRB 4R6UA 5FAAA 3FRPB 3ZDZE 4LLWB 2DL2A 2KPWA 2ZWKA 1PJWA 3DJZA 5IK3A 2LR4A 1DVYA 3T71A 4EUPB 4F37K 1HNGA 1ZLWH 1EAPB 1NLBL 4OTXH 4ZFOB 4JQXA 1MWAH 5BPPA 2F1EA 1TNNA 3Q43A 5I30L 3AAZA 1RHFA 3HR5B 3DX8A 2ENQA 1BLIA 1RLWA 2XZQH 4WO4D 1GGTA 2GIXA 2HX9A 3NK3A 2DIJA 3EHBC 4P2OA 4QXTB 1QUNA 1HEHC 4QTFA 1AP2A 3KWTA 1PYWB 3CQPA 1LM8V 1FGNL 4X5LA 1T20B 3C6SA 1WIOA 5EOTA 4J8RB 4X4XB 4LZKA 3SDDD 3VRIA 1E2ZA 4Z9KB 3IDYB 4MNGA 3QZWA 4H0IA 3LH9A 2XX0A 1KEGL 4F7TA 1BDYA 1UKSA 4JUSA 3BIAX 4PJFB 2XACC 2J55A 3AT0A 2C4FU 1WUNT 1FFRA 3LD8C 4U6XA 4AGOA 3T6XA 4Z76A 4CMHC 4X4ME 4G6ML 3T77A 1NAMH 5C0IA 2XWJA 4I0KA 3B4NA 2NTSP 2R29L 4PY7A 2Q5BA 2W0PA 4G1EA 4M62L 1BXAA 1BGXH 1QBMH 1ZHNA 3ARQA 1LO5A 2YEZB 1WLHA 2BIHA 5I16A 3QUYD 4Z18A 1QP1A 2IV8A 4HIIA 4P4RB 2OL3B 5ERWB 3DURB 4HIJB 2BNRD 1RMFH 1KTRL 1PAMA 5HYFA 4K3HA 1LD9A 4PJIF 2JKTM 4YDIL 4IHBA 5DWUL 4TF4A 4MDIB 2NR6D 3P1VA 4JKMA 1OCWL 3RVWC 5CFHA 1NUNB 1FO0L 5TDPB 5ESAA 2E56A 3ULSA 3GZPA 4M7ZB 1VGKA 2LU3A 5I1DA 5EC2B 1YNKL 1CQKA 2J8UF 3Q2LA 3S34H 1MEXH 3S96B 5H4ZA 1H9DA 1T0OA 2FX7H 4AJVA 3HE6C 3B3IA 1M7IA 2VC2B 3DVNB 2EYRB 2I9LB 5CJOH 4JRFA 5GIRB 3VD2A 3U30B 5E8NB 1I9IH 1K8IA 3VXUA 5ALCH 5B7MA 5GS2H 1T0MB 1LLAA 5D2LE 5C0RH 2VZ1A 3EJRA 1CGSL 25C8L 4FQCH 4NUJA 3TCTA 4N1EA 3W5NA 3MLZL 4F8LA 2GUOA 5I15H 2G5BA 3MJWA 4W68A 3UAEA 5I1IL 4BQ6A 1HHIA 4ZX4A 3ZLQC 2OV0A 1NLDH 2WAQA 4I0PA 4AGQA 4L0YA 1NH6A 3KGTA 3EYUH 1JZDC 3TZVA 4CU6A 3TT3H 1IGIH 2GAZB 2EDKA 4G6MH 4HX1B 1WZ1L 3H9ZA 3JYCA 4G7YL 2OJ1A 1T7YA 4GG8B 1IQWL 1PLBA 2L7QA 4RZCA 3SE4C 2ZF8A 3UP1A 2NY2B 2NY3D 3RX9A 3EH4B 4A55A 2WHVA 3BH4A 4N8CL 4QRPB 5TDNB 1L7IH 1NPNA 1CTMA 1GOFA 2WYTA 3UAJD 1H19A 3VD3A 5H2BB 3QDJA 1MW2A 1A7BA 1F11A 3DNKA 3NFSL 4PJXE 1INEL 4DKDC 2NY7H 3BZDA 1OM3L 4UQEA 3BAXA 2XQYA 2HKHL 1K8IB 2OMWA 3CLFL 5I1DB 3BAIA 4HDIB 2B1HH 1FDLL 1P5VA 3G6JE 5DMIH 5K33A 1ETZB 4JQIA 4S1QL 4F7MB 3QEQB 4IKNA 2ICWI 2NY0D 1ZS8B 1V54B 3LQMA 5JOFA 1DVFA 4JM2D 3VG9B 2YWZA 3SDDB 1ZT4B 2BSDA 5F9JB 4DP0X 2IAMA 4QAMB 4MZ2A 1FVDB 4H88H 3F8UB 5EIVA 5LGHH 4PJ7E 5D7IF 3APMA 3DETC 4WWKC 2G4EA 1KULA 3RDTD 5KSVA 3AUWB 5LCVH 1B0RB 4JZOB 2A6JB 4UT7H 4FA6A 1I8LC 3GUFA 3O45B 5E8OB 3S2CA 5FUCC 2QKSA 1NBCA 2BERA 4M6NH 1OXYA 4AX3A 1CI5A 4LLYB 3VM7A 3BGFB 1AAJA 3MLXH 2O5ZL 3BE1L 5HDWA 5C0JA 1WS8A 3QIBD 2Q7NA 3QJOA 5GGVL 3MACH 4LHUG 2CDEB 5C0EB 1D7CA 5IW6B 2YEVB 3TU6A 3SGEH 3D8MA 2G5BB 1P4LB 1H15A 1IGMH 3LKOA 4LASH 3ATAA 1XCXA 1BAFL 2EXYD 4NRZA 2YLHA 3HI1B 4LU5L 4MQXD 4ICXA 5CBEB 4J3XA 1HX0A 1N8ZB 3BPNB 4LEXH 1PCXA 4AMXA 3IMUA 2WUCH 4AVJA 2BSTA 4FFWC 4XMXA 1T5WB 3ARUA 1HOEA 1D9KB 1I1FB 1MSPA 1NCOA 2NNCA 3HE7D 5JHDD 1S3KL 5AUMB 3VXRD 1PYWA 1EXUA 3I75A 3QRGL 4F57L 4XNXH 1ZLUH 2IVFC 3CZSA 4NN7C 4Y5VA 5B3SB 3QYNA 3MRMB 2YZ8A 1AG0A 2ATKA 5D1ZC 2WBJC 5CZVH 3I3EA 3WAJA 1KJ2B 4MVBC 1IM3B 3WE6A 2WD0A 4NNYA 3INUL 3GBML 3QXWA 3D0AA 2YRLA 1DP0A 2OP4L 1DN2A 3N1FC 5CO1A 2XWZA 3VXRE 1CR9L 4DUWA 2IADA 4UM9D 4LCVA 5DD1L 4KXDA 3AWGA 4F7PB 3SDAB 2IAMB 2ATPB 3RY6A 3V6FB 1DANU 2PO6A 4E36A 4GG8A 3CSYA 4RZCB 3O4LB 3ZYZA 2G9HB 2FUQA 4M4PA 5BVPH 2HLAA 3KPOB 5IW1A 1BX2B 1U95B 2ZNWA 4BQ8A 3QEUA 2NDGA 5DLMH 4KMTH 1B0RA 2RJMA 4OD1L 1S7VB 1KJMB 3FU6A 2DY2A 2JLLA 4WI4A 2F53D 3FB8B 3EBGA 2AK4A 1A1NB 1BQ5A 4QOKD 3D5OF 5AOZA 2XWRA 1PFCA 4PRHE 4MJHA 2C9SA 3BUPA 1C5CL 3PDGA 4JANB 4OLUL 4DEPC 4S2SB 5IEKA 3PJSB 3QQ4A 3DOHA 4X5RA 5D1ZA 1RPUA 1FI8C 4LGSB 2VLKE 1GIGH 3QEQA 5DHDA 2XI9A 2BIIA 2NR6A 5LAXA 2J43A 3QHFH 1S7SB 4DOHB 3CVCA 4KZEL 3LN5B 4PV8A 5DUMH 3BJ91 1IJNA 2IADB 2MQ3A 3C8HA 4TQHA 3IMTA 1WFUA 4JO2L 4U1JA 2WP3O 2HLEB 2JKJA 3C09B 1MJUH 2CK0L 4JG1H 1BAFH 1KZQA 3CN4A 3ETSA 2CDFA 1FZJA 2FBJH 2NNRA 3DJ9A 4PGJA 3R06A 1NL0L 3KXFD 4OVVA 2YFOA 5DRXA 4D8OA 1Y07A 1MZYA 3CN1A 3D2UA 3K6FA 3MJ6A 5AALA 1ZLDA 2VR8A 2O6FA 4YK4C 5T5NF 5KTEL 5H94B 2OTUB 2YGNA 4K5PA 2H26A 2PMZA 3ZDZB 3O3BB 2D9CA 4OQTL 3Q8BA 4JRXE 4JFEA 1PY0A 1U58B 2IANA 3MMEB 4GRLC 4JLRB 2E76C 2EUXA 4DKFH 5J1SC 3DX9B 3W9DA 5D8JL 3KCPA 4I1PA 1VGKB 2CGZA 1TO5A 1KWKA 2YC1B 4L4TB 1WAAE 3N85L 1A1OB 3V4VH 4H5SA 2XRAL 3F62A 4N1HB 4NFDA 4PJHF 4WUUA 3UROR 4O2FA 2J56A 2O5YH 2FQEA 1TZAA 3HPLA 5TQ0L 5E1AB 5ICUA 4PJIA 3SDCC 3K4AA 5AL0A 3MHZA 5J0BA 3ET9F 1S7UA 4HCRH 2LFGA 5B21A 1I9JH 2X3AA 1MI5E 1U3JA 3UPCA 3HBGA 3TZVB 4AIZA 2VDPL 4HAFA 1PPIA 3FH7A 1PNDA 5DI8A 5J3HD 1JOIA 3IRZA 5GISH 1IB5A 2X0WA 4JPKH 2C3VA 3QZMA 5EU3B 5L9DL 3WELA 2VSMB 2X42A 4U6VL 4YWGL 4Q74A 2XNAA 3KM2A 3VGDA 4F8NA 4N3TA 4MXWH 5DRWB 5KUMA 4I77H 1YC8A 5IGXH 5IK3B 4Q0XL 2ISDA 4JRXA 1T66C 3X1BA 3F6JA 5KTEH 1YEJH 2A6IA 4XRCA 4WKZA 1JPTL 3K8KA 4CVWA 2ADIB 1CT8A 5J12B 3HLAB 4LCWD 4L37B 2MOGA 1IGIL 3FQNB 2IAMC 1J1PL 3X13A 4P2CG 3DVGA 5EU4A 3RU8L 2OCJA 3GM0A 4K23H 3BVWA 3KPQA 4W93A 4ELKA 1OCRB 1PEWA 4XNQA 5AVVB 2N7AA 5IQLA 4ZBJA 4TYUA 3RKDD 4OZIA 4ZUWA 1U33A 2ZYIA 1IC7L 4G9FE 4N0YH 1EK3A 3WE1A 5H2BA 4O2FB 4R4NC 2H6UA 1PKQA 1YCSA 2J3SA 1KTDA 1I9IL 1OAJA 1Z5LB 2HJLA 2EDMA 4JFDD 3RGBA 4YDLB 3MROB 5KVEL 2CXKA 3LIZA 4JFQB 3WIIH 3I9IA 1IIIA 1OY3B 1RZ8B 3AJ7A 2ZCKL 3OC5A 2ICEA 4LVOC 2YBRB 4LPVA 3RB5A 3WMQA 2YD3A 2WWNA 1C5DB 2DLEA 1BQHB 1DLFH 2BOBB 4BFOA 4APXA 3VXRB 4UNVA 4JO1H 5E5MA 3QRBA 1FL6A 4KMQA 2K8QA 4P9ML 4KKNA 2EXTA 5F1IB 3FTGB 2AV7B 2R0ZH 4UM9A 1V3LA 3MUHL 3VJ6A 3UPRB 3LTVA 4XNUL 3ZE0E 3ECVA 1P0SE 2X4QA 5HJGA 3INUH 4L0ZA 1RV6X 2Z0BA 4X4XA 1MHEB 3NCEB 3F05A 4P3CH 5DMKB 2HFFA 4IKJA 5D2NE 4XVJH 5DVNA 2R1YA 3KVDD 5EULV 3O6KL 1ORSB 2HWZL 1U4FA 3FF8A 3GZOA 4M5ZL 1TR7A 1H8SA 5IY5B 1UH4A 5D93B 4EXKA 5J11C 1SMAA 3U7AA 1YPZA 1HWHB 2WSKA 3QEGL 4ODHL 4KGLA 5JIQA 4JDVA 5F89B 4P5TB 1HOCB 4F8PA 3QG6A 4YHNB 4HUXB 2Y7OA 4I8DA 1FG2A 4H26B 4NZ8A 4WUUB 3WUWG 1T2QH 1UT9A 1Y7VA 3KPNB 4WGVB 4ZMPA 2J57A 2IPKB 4PG9A 1QKZL 3VXSB 4O02H 3BEWB 3I02B 2WSPA 2BFGA 2FGZA 5FHBH 1MUJB 1RPQA 2W07B 3BAJA 4V1DB 4OJFH 4A04A 4MA8H 3FSAA 1N6QL 2P8MA 4ABUA 3UZVB 4KKZA 2BRQA 3EZ8A 1WITA 4HWBH 3K8MA 4S1DD 2EP6A 3L9YA 1NEZG 4ODXB 4GT7A 4PW9A 3HKFA 1S9YA 3FF7A 5D7EA 3VFWB 5HGBB 3CSYB 1MAMH 3CH1B 2IG2H 3IXTB 4NI6A 4M8UA 2FX9H 2W94A 3C8KB 3L3DB 5KYNA 3MUJA 3K6SB 4ENEC 4BHUI 1ZEAL 2PNDA 3AGWA 3GINA 1J7VR 3DA0A 2OMZB 3LQAL 3U1SH 3CDGB 4IYKA 5KSBB 4HWBA 4QRAA 4YZFE 2MCMA 1TLKA 1WT5A 2D3LA 2LTQC 5AAMA 3TNNB 2NNAB 3QZLA 2D7TH 5I1EH 4Q9QL 3HS8A 5GZND 4Y4FA 4DHLA 3QE5A 2XG4B 5F7DB 3GS0A 2IQ9H 3CDCA 2M1KA 2MCPH 5TE4L 2OBGA 3NIDF 2OS7A 1LEGB 4WDIB 1WIUA 3MRHB 1DO6A 2R23A 2YKKA 3CVHA 2IH1A 2OR9L 4L2YA 3QEHB 3QDJE 4GW4B 1GS7A 4X80H 1FFPB 1WC7A 1PD1A 3ZMRA 4ANUA 5BOPA 1FDLH 2YRZA 2SEBB 5KSAD 1IFGA 3ETBF 1AKJD 4UI2A 4R8WH 2MIZA 1E7UA 1NEZA 3LZQA 4J12A 4JO4H 5DEFB 5C70A 5HD8C 3VFRB 1ZLEA 2EDYA 1EUUA 2W65B 4ODTL 1INEH 2A0LD 2Z6FA 2D31B 1E5AA 4BE6A 4YDKL 3FQ4A 4TL4A 2EEDA 3EYOB 2QLVB 2BHUA 2VZ3A 4XVJL 4XVUC 3WEMA 4XZUB 2WNXA 2GIYA 4FZEL 3GB7B 5DA4A 5EO9A 3KE0A 3PXJA 5GZNC 2UZYB 3VTTA 1WFJA 1UT1A 3H4FA 4JPQA 2B2XL 4GT0A 1ADQH 3D3VA 3ZQWA 1F1DA 3SBQA 1UZ6F 1X9QA 4OF5A 2LLLA 2YOAA 4D7BA 2E27H 3R06B 2HB0A 5DRXB 2PR4H 1CXEA 2GUYA 1EWHA 4Z76B 1TMCB 3UBXB 4Q6IC 6FABH 3F58H 1IU1A 2Y3NA 4U1SB 4X4YB 2NY3B 2E7DA 4A7SA 2J88L 3W2DH 3W3BA 3PAVA 1KN4H 4UT9L 1LDSA 1MFUA 3AG3B 5C7XH 3MGTB 1F4XH 4MFHA 4UIKH 1GYVA 1JTTA 2H8PB 1FN4B 3FOLA 2HX7A 4MJ5A 1OCZB 1FH5H 4M8QA 2I25N 5CP3H 3VWJB 4AQ8C 4CUCA 1KXTA 3N41F 5CCJA 5IREA 1TTCA 2J4WL 1VPOL 4PBVC 3RWCB 2ATAA 1QEXA 1EEZB 3IB4A 2BNRE 3RDJA 2XBDA 4WENB 3RQ3A 1V10A 1UWXK 2HT4C 4YAQA 3L9BA 4YHLL 3VWKB 1FFOA 1NAMA 5TDOA 3PQYB 3P77B 3VDBA 2CGRH 4LLWA 5E1QA 2FVNA 1CB4A 1AMYA 5CP3A 4EI5A 4YGVB 2QPFA 1F6AB 1LQSR 2PYFB 3M7OA 2HH0L 3BGFC 5AENA 4OLVH 5JIDA 3RHWF 1W0WA 3OGCA 3NSCA 2UXFA 5IMMA 5GRXG 3IDJA 5IHHA 2UZYA 3GBDA 4O9HL 4FMVA 2IBZY 4XXWA 3TLRA 1SYSA 2F74A 4HJGA 2HFGH 1RZFH 1V7NH 3P3UA 4MXWL 4FP8L 1RP9A 5B1JC 4PJ8B 1VFBA 5E2TH 1X4ZA 2NUPB 3VFPA 1FZKA 3BO8A 2J8OA 4N2HA 1JNHB 1J1OL 3JWOC 1QYGH 4PRAB 3QIBB 2X0UA 1AXTH 2ZXWB 1JL8A 1NCJA 4NWTL 4F7TB 4Y5VB 1TYEB 4HUKB 1YQVH 2WK2A 3KLLA 2G75B 1IM9A 1WYJA 1I8IA 4PJDA 3PQYA 5AW4B 3Q6FA 3L3JB 2CHZA 4U0RB 2GT9B 3I3BA 3WHXB 3S96A 1E65A 3TCXA 1QFOA 5GS0C 3FU5A 5IB2A 4I88A 3RAJH 3D12B 3HKZA 1C12A 3GMRB 3MV9E 4W9ZA 4IRJB 1PG7L 3MJGX 2Y7SA 1SQMA 1SJXA 1OSYA 4WIQA 43CAB 3IGKA 2VWEC 2Z93B 5HGGS 1E4WH 3AGVA 3U9UA 4UYQA 4BSWB 4L8BB 2FO4A 4YZWA 1CUOA 1FO0A 2GKIA 4YXHL 5B1JA 3OKNA 1UWXH 3BP7A 1N0LB 2E6PA 5BJTB 2K7QA 3D34A 3DO7A 3CDYA 3O3EB 3RY6C 4JW3A 3IJSB 1OF0A 2HRHA 2ORBH 4FXGB 5ANMA 1AHMA 4ZFZA 4W70A 2J8UA 1A4AA 1IAIH 3N9GH 2JJVA 3GXIA 4TLTA 4D9LL 3BPCB 3KCWA 4QJ3B 4RISL 1XH0A 4ODSH 2IXQA 2HUHA 5L88H 4LHUA 3HJEA 4OIIH 1OAUH 4NHCL 1ROWA 1KTKE 1KXQA 1R47A 5L6YL 3KS0J 1M2VA 4NRYB 4OFYA 2OZ4L 1MHCA 3SKOB 5CLYA 1BREA 2BLFA 3VDCA 2B5IB 1AGEA 4OZIE 3U6RB 5DMGD 1NDMA 1F3JB 1CPUA 4BZ2H 2IPKA 1GGIH 2BNQB 1KCRH 3RWJB 4H7VA 5CZXD 3HMXA 2BRRH 1V27A 2YUWA 4G80B 2AQNA 4M5TA 3T0EC 4WHYG 5E8DH 1A6AB 2Q76B 2XXMB 4YBQC 3VFSB 1L9PA 4AJYV 1EHLH 1OSEA 4JY6B 5DJ2B 3LYRA 4QXTA 5IFJA 1JYNA 3EO1B 5DJZB 4P5MB 5KVFE 4D3CL 4TUJB 3CZFB 4LSPH 1MFEL 4HV8B 2EXWD 3FOMB 3GMOA 3GSXA 5J1AA 3WS3B 2P47B 4M7KH 1CFQA 3H9SB 4ZFZB 1NC4D 5HHVH 1IEAA 2P43B 2WIIB 2PCPB 4KY1L 4EN3D 2H2SC 2X6UA 4Y16D 2WGXA 2XNAB 1O7VA 3H7LA 5B39B 3JWNC 1QSED 4JPIB 3BGAA 4BSJA 3NFNA 5IQ7L 4K5MA 1FNSH 4ES9A 2XIDA 4NQTA 1PKOA 3D4GA 3R18A 4F7EB 1WEJL 2HLFD 2BXYA 4UDTB 5EZOH 3ESNA 1IC7H 3SEPA 3NCJH 4HU2A 4MBRA 4TSCL 2AQTA 3FSVA 1Q94A 3BLPX 1GAFL 3F5WA 1MCOH 1N0LA 4J3BA 3ZYOA 2BP0B 1UA6H 1WGVA 1ZHKB 2ZSWA 4YSOA 2X5PA 3RU8H 5AB1A 4DAGH 5KN5A 4MNGB 2CLZB 1TNMA 4Y5XB 4FQLH 4PRDA 4XMPH 5B22A 1A14L 1HZLA 3OKKB 4QY8B 3VD7A 2FR4B 2E0PA 4LDCA 2ARJB 3BHBB 3VYOA 1K8DB 1Z1WA 2AK1L 3HI6L 3TV3L 3SBWA 3TBSB 4HUVA 4A66A 5IB2B 4HQQH 5C0EA 1IAIM 1CURA 2EO9A 3R19A 4YDKH 2FJHA 5FWRA 1VFUA 1XV8A 1DJYA 3DX6B 5DK0A 4GPVA 3MQIA 5AOIA 4XP9L 4FKHA 4XCYB 1ZLVH 3AAZB 4YDVB 1IGML 4HK0B 4LLYA 1XB8A 4RESB 1VHPA 3CC5B 4LLAA 2AQQA 2ZKXA 5CILH 1QASA 4EQ3A 1ID2A 3DLQR 1AIFB 3UYPA 3VI3B 1Q8MA 1E43A 3MGOB 3ARDC 1LO5B 4HF5H 3GLAA 3GSNL 2QKIB 4HGWB 5ICZA 5DK3A 3X2QB 1JV2B 1FUNA 4H8WL 4HV8A 4LSSL 2X6MA 4JFPA 1SYSB 5I8KH 1P5UC 1QBAA 5HYJD 4MA1B 2XQBH 2Z31A 3C5ZD 1QFPA 3ARGC 4L8SB 4QF1B 5CWSA 3TN0B 4Z3EA 4ZZKA 3PRZA 2XZAH 3FUJA 3LEXB 2OMYB 4N2FA 4V2BA 1OAKL 4XO8A 1JWMA 4Y9BA 5DQJB 5D72L 1DQVA 5HGAA 4MNQA 2VR3A 3IN2A 5DD0H 2HFEB 6PAZA 1QRND 3ISYA 2DQDH 3DYPA 4P2QE 1OGAE 2Z0UA 4GI9A 1NGYB 1JZGA 4WTZG 1PZUB 5KVDL 1VACA 5CEZE 5CCHE 1WFOA 4IM8A 2ADGB 3ELQA 2B9AA 5F88A 3L5XL 4X98B 1NCAH 1GZQA 3JWNH 5T5NG 1WBYB 1MG3C 2XA3A 4TLSA 5ICYB 3PP4L 2DN7A 3F5WB 3WNJA 3IDNA 4X8JA 2DM2A 4ANVA 2EYSB 1JUFB 4M93C 3QZWG 4M8RA 2NY7L 4OJFL 3NABH 1HI6B 3SGEI 4ZFOA 5AVUB 3Q1SH 4HMCA 5HVFB 3SE9L 1U41A 4HX1A 1ZMYA 5D9SB 2YGQA 5L0QB 1O5DT 5FO7B 4QMEA 4OT1H 3BWUF 5KG9B 2UV3A 3CFKA 5GGSY 3TYFA 1P84J 3MDJA 2ZUVA 2AKRA 3II3A 1KLFB 2VDLH 2Q10A 3S35L 1YY9D 3O41B 4AYSA 1RXLA 2OMUB 4TNVK 2OLDA 2NSXA 2CR6A 4BH7A 4J39A 2BNUB 2CO6A 4HS8H 3EJZC 2EEBA 4H8QA 4TL5A 4X2UA 5IWLC 2VDLB 4ODVH 3TEXA 2H0EA 3WFBH 4M48H 1BV8A 2VLJD 3NJIA 1N26A 3ABLB 4LEOB 1LE5A 4WFFE 4MNQE 2DI7A 2VO8A 1GZQB 3KWXA 4DGVH 4R83A 3JV5A 5DYOB 4RAUB 3BW9B 5DRNA 4X5WB 3KYKH 3QIBA 5E1AA 1MEXL 4WSKA 4PRPB 5EEYA 1AXSA 3NPSC 2OJEB 3QJTB 4UT6H 2G60H 1QFHA 2GQHA 3VYPA 4YNYA 1WZLA 2E75C 4G3YH 4Z7NB 1BWWA 4AYDC 1YEIL 5KSBF 5JW5B 3FB6B 2VN3A 3FT0A 2Z35A 2Z8VC 3I9AA 3PLYA 3Q8FA 3QHZH 2I32A 3GSRA 3ARED 3WAKA 2J8UB 4N2BA 2ED8A 2QPDB 3P4MA 4U4BA 1A9VA 5CZXC 5JMRA 3QUMH 4QRPD 4P4KA 4TVUA 2VL5B 4N1CA 2PWFA 4A63A 1LEIB 5DS2A 1QAWA 1KB5H 5DTFB 5CR1A 2Y5TB 3QDMB 2JK5B 4XMLL 4Z7NF 1VADB 3TWCL 4IOIA 2HJFA 1AHKA 4Z7VA 3OXRA 1U42A 1KIPB 1EDQA 2GFBB 4TVPD 4FE9A 2D7MA 1S5HA 1AGCA 1GGIL 1UURA 2D73A 2P44B 3EF7A 4MDJB 2XICA 4XVOA 3S4SG 3NJKA 4A67A 1T04A 2W80C 3LN9A 4QRPE 3U0WH 1EZUA 3QUXA 4UNUA 4LQFL 3K6SA 5I1JH 5GIRA 4WW2C 2JB5L 3BCFA 1GGUA 4NZTH 4AJWA 5A6MA 5IFHL 5HYJE 3F64A 4KRPD 3NIGE 2XWTB 3NJNA 2QT6A 2Z7UA 4KTDL 2C3HA 1XR8B 2X88A 5A16B 3PY9A 1T5WA 1OGSA 5T3XD 3EO1A 2A7BA 5DJZA 5KYWA 4JFZL 2D03H 2P5WE 4UOZA 3MACL 5D4JA 4ELME 1TU2A 2OXGB 2WKOA 4ETQB 3IMSA 4ZUTB 4PLJD 1JGIA 3DTXB 5LJYH 2PYED 3L8QA 1MHEA 1PL3A 1OT2A 2AEQH 3GK8H 3UC0L 3MRFB 5KYYA 2BNQA 2YKLH 4Z95L 3P73B 3RWJA 4AW7A 4E2OA 4YE4H 1KIQB 2HKFL 4WI3A 5JNYA 5IEKB 5TF1L 2AVGA 1PCSA 2BZ7A 1XQ4A 3NSYA 5B8CC 2H1LM 2XZCH 4JK0D 3HAEG 3CZGA 4PN6A 3LZFH 3MRPB 4GSRA 4JFUA 2XLLA 2DQIL 4W9GC 3REVA 2DQ6A 4GIPD 4FA8A 3IDGA 4YHOL 5ABAA 5B3NA 4JRXD 4A2LA 2Y1ZA 5F0PB 1AMXA 2M26A 3B9VA 3OGCB 3IRCA 3F7VA 1T0NB 5K5YA 1IE5A 5LG1A 1A0QL 5CJ5A 4QRUA 4H88L 4IDJL 2NY3C 3HG1D 1CLYL 1MFMA 5ESQA 2W9LA 3HC4L 4GKZA 4ZFFB 2GK0B 3LIZL 3L5WA 1LO0H 3FSWA 4JGMA 3C5SB 5MEPB 3Q3GB 2YQGA 3MREB 3FUHA 2BZCA 1BQUA 2EDEA 5IOPA 3I2CL 3WNMA 4QXGH 4N8VG 3HC3H 1U3HB 4QHNA 3VMNA 4A2FA 4OY9A 3U4KA 5DWPA 4FA7B 4AQ8A 1XXDC 2ZKHL 3FFCB 3VWKA 2XVKA 2Y9RT 4OSUL 2PTTB 1C7SA 4MZ3A 4GSDH 1A7PH 2WZ6A 4FTVB 3WOVA 4I9WD 3KZ8A 3VCLA 2A9DA 4MCNA 2YQBA 1RK0A 4MJ6B 1WD8A 1MI5D 2X1OA 2PN5A 4LBEB 1KCLA 4ZPVA 4IK6A 4BWWA 3PWUB 1U3ZA 1VEOA 3BUQA 3NIFB 3ULVE 1MWAA 5KS9E 4U1IA 1LMKA 5DZNA 2GY5A 2XV2A 2XVLA 1FRGL 4YHPA 3ZZLA 3U36B 1PTZA 1ZXQA 4N8VB 4LQFH 3GM8A 5D7LB 1MY7A 2VAAB 3EYUL 4FL4B 1VF5C 2H32A 3H1ZA 3DI3B 1SPDA 2AV7A 4PV9B 5I8CB 4OR1A 3U7WH 2B59B 4HJEA 5I1IH 4U1KB 3IT8D 4AG4L 5K9OB 1URLA 2YQ2A 5BS0A 1R5IB 1SOSA 3FB5B 3L1EA 2NUPA 4ZO9A 3VFPB 1NTDA 5DYFA 2P42B 3CXDH 4LSRH 2GEQA 3ARXA 4JY4B 4RMRA 1CYXA 2VW6A 4KO7A 4ZXBA 5BO1H 3DKHA 4RAVA 3EZJB 3W38A 1E0OB 4WJ5B 3FONA 3GJEB 5IQNA 4AIZB 4JFXA 1WZMA 4IBTA 4JLRA 3Q1EA 3APCA 4K94C 5K1JA 5FYJL 1U8KB 4U1HB 3QYMA 4LDLB 3BVNB 5FYKD 2R9HC 3MGOA 2FO1A 4HISA 4XT1C 3OTTA 1AANA 2YS4A 4LVOB 2R1WA 1WHOA 1XFPA 4HIHB 5DC4B 2CJUH 2AJVH 3HVDA 4QLRA 2E6JA 4PJGA 4NZJA 1JZEA 5CGMA 3RFZB 1MFDH 2Y7MA 1PQZA 3SJVE 1M3JA 3IM1A 3EOBA 4ZUUB 3NZSA 1A6VL 1A2YB 4DUXA 2IH1B 2ZP0T 4LSPL 2XA8L 2AEIT 4AGLA 2YXVA 3EOTL 4RFNB 1QUNB 4FDWA 3NCYS 1Z9PA 4Y5YC 2WYHA 2V8MA 4I9XA 2DDQL 2VN5A 5EPMA 1EO5A 3ULUF 2L7UA 1KXHA 1UM6L 3E3QC 3EG9A 2L7EA 1MREL 5D1QC 5FM5M 5B3JF 1M6OB 1WS7A 2VLME 2XYCA 1L3NA 2QBWA 5GJTH 5CZVL 4NOBA 5CN1A 1TFPA 3C75A 5FA4B 5F7DA 3Q9QA 4ODUB 2OMZA 1V3KA 3QIWA 3U2JA 3RTQB 4J3SA 1H3XA 4FFYA 2YXWA 4KPHH 4BGLA 3FXIC 5GS3A 4PJXA 1CGVA 2KLTA 3T8XB 2CPCA 3FHEA 4R2GB 3QDME 5L2JA 2NQDA 3BDXA 1RJLA 1K4DB 3NDZE 4IKKA 3U4BH 1D5IH 4QRUB 4BFJA 4X80L 1BW8A 2ZYRA 4GUPA 3VI4A 3V2AR 3D7PA 4Z77B 2PO6C 3AXIA 5D6CB 2G2RA 3CBKB 4FFYH 4P3DB 4DIXA 3D69B 5BJTA 3T8MA 3G5YA 3BAKA 3CHRA 1DQQA 4E41B 2QLYA 3TPUB 5GS1A 5J89A 3CLEL 3O2WL 4L9LB 2EUZA 4JJ5A 3FU9A 4K5NA 2FHCA 2XN1A 4KZ0A 5D70H 3MNZA 1E4WL 5F97E 1FYTE 2OTWB 4UV4L 4FTDA 4FS0A 3VA2C 1Z0NA 5C09A 3G7TA 4LDOB 3T3PF 2A4ZA 2FQDA 5AKRA 2H9GA 4LCCA 4XI5C 3SE3C 3HZYA 5FA4A 2FX8H 4P2QB 2BDNL 3TIEB 4NKOB 3DGCR 4MJ6A 4CW1A 4C83A 1EXUB 4M4RA 4CVZA 3AZUA 1F8TL 4FG6C 4DN3L 3ZPDA 1LE5B 1JN6A 4W9KC 2F1BA 5AW0B 3KPPA 3V55A 4OI7A 4Y4HC 3U2SA 1W0VB 4KRLB 1A6PA 3LQAC 5E4OA 3C08H 2Y23A 3G6AB 3IBOA 4LPYA 4ONGL 4WCYL 5ITFA 2J6WA 1RURL 2CIIA 1SVZA 2EVIA 2AJ3A 3F7LA 4GAAA 4H8WH 4JDEB 3I6KB 4X5XB 5FYJD 3TEUA 5LGJA 1LO2L 2XX1A 3UBXA 4JAMA 3OXRB 2VMDA 4KK9D 3GSNH 3L2MA 3MR9B 4QJ5B 4B60A 4P2YA 4XB7A 2VXQH 4EIGB 2X1QA 4OQ1A 1RZ7H 1QFWH 2B1HL 5F0MB 5H35A 3D85B 4HPOL 2DKSA 1G1YA 3Q05A 1T0NA 1GW6A 2WNKA 2BWIA 5D6CA 3IXTA 2YFNA 2DZEA 4GXFA 3P30L 4ZTOH 4Q9RH 1NAKL 2TRHA 4P07A 5ESQB 1GKEA 4P46D 2LU4A 1NKOA 2YSTA 4IRZA 1S8DB 1MQ8A 4OU3A 4E9LA 3GUTA 4BIKA 3JWDC 3BVDB 4NKOA 4CW1B 1YRKA 4PD4J 1JDDA 5J6HA 3HI6H 3SIKA 2Y22A 2R7EA 2GJJA 4Y4HD 1BF8A 1WA0X 1XTLA 3SJVD 4BZYA 2A9NH 3BVVA 1PX8A 1NGYA 1D5XB 2ITCA 2MJWA 1MW3A 1U91B 1Y6NR 3VD9A 3BEVB 4P2OD 3QXDA 3WTTA 5K9JL 3ARVA 2EIEA 2BWDA 3MAWA 3U0PB 5MENB 3LKPA 1E5CA 3G5YB 4G6KL 3JBG7 1F4HA 4N6RB 4HHAB 3FT2B 3LMJH 1AFVL 3PWVB 4UDUA 4X6EB 4XXWC 3DWTA 4XMKH 1KN2L 1SHMA 1KJ3L 2A6IB 2MKWA 2R2EB 4U2YA 3O3BA 5B38G 4BFNA 2XU9A 5E6UB 3D85A 1EEYA 3UTTD 1J1XL 3CVIH 3IJHB 5IBLD 1H3GA 2X1WL 1JYVA 4QHMA 4LPWA 3LH2L 3Q8AA 1TZGH 4GXUM 2OA9A 4LLVB 4Z3TA 1ZIAA 4ATTA 2Z8WC 3EJCA 5FGRA 1FIGH 3S34L 4ATWA 2VDOB 5IOPB 1P4BL 5ISZE 2B2XH 3QWRA 4M1GH 4NZUH 2HAZA 1UVQB 1YUHB 3VXMA 1FL5B 2E6QA 3C60C 5EO9B 3F7KA 2H3NB 3FO1B 4IOFD 3TWYA 4ZAKB 3ZE1F 3SPVA 1IO4C 1CDJA 3F01A 5EDXA 3WEAA 5D4IA 4AIOA 5I71C 3E2HC 4I87A 3ARDD 3WTXA 4PJIB 2I07A 3M17A 3BUIA 4HUWB 3QW9A 4OCMC 5BQ7A 2CRIA 4CSSA 5GSRB 4RGOL 3DRTB 4Q6IA 3QZPA 4PAZA 2XN9A 3RI5F 3P2BA 1D5MB 3AQZA 4Z6AT 1LQBC 4M62H 1HC1A 5AVZB 5IUCA 2VQ1B 1G1KA 2V7HA 1YC7A 4R97B 3TP4A 1M9SA 1MFNA 1P9MC 1XGPA 2JWYA 4GUCA 3IU3B 1AXSB 5HHOE 3V4UL 5LWYL 4HLEA 4NNPL 1JWSA 1S8DA 4M8QB 5CP7A 3VGBA 1NCHA 1Q94B 2RTTA 3P3RA 4R0LB 1M2VB 4NRYA 2J2ZB 4RGOH 5ETUB 3CX2A 4KC3B 3AG1B 2EZ0D 3T0XA 5KWYC 4HC1H 2OMUA 2HFFB 4HUNB 1KGCD 1CT8B 3LSOB 1ROCA 1KGJA 4Q52A 1P53A 2C9QA 4Z7UB 3AQDA 4Y0GA 2NY1B 4HSAC 4IRSB 4AUYA 4EKXA 1N64L 1N5AA 5MHSE 2DQEH 4U0QB 2JVUA 1FJ1A 2IO5A 3L4ZA 2FSEA 4PTTB 5DQ9B 1VAHA 2R1WB 3H55A 3NJMA 4S1RH 3N1MC 1H8OA 1MQKL 2N7SA 2OKMA 3L7EA 5IJBC 4TLKA 2XZZA 1HJCA 4PGBB 1DFXA 2APWA 4XP6H 3SYOA 3QISA 1SEBA 4QT5A 2X3BA 1TZGL 4AYGA 2XKUA 3OB0H 4OCRH 4R2GD 2N4IA 2PR9A 4I0PD 5D2NC 4P5MA 2O5XL 5DC0A 5IVXE 4S1SH 2EDXA 4N0FA 4LDEB 3SD2A 3QQ9C 4GO6B 4AYID 2WCPA 2OMXA 3UX9B 3IN0A 1BLNB 4IIQB 3E38A 5I17B 4JANA 3CFBA 3DROB 1A7QL 2VJ0A 1P1ZB 4OJDH 1NFIB 1AXTL 2PW2B 4Q4EA 1C08A 2VH5H 1NL0H 1IEBA 3MRNB 3WIFB 5KS9B 4N2DA 4WFGD 1NJ9B 1U8CA 2DH2A 1BYOA 4JG1L 4OFPA 3DMMA 4BCXA 2YBGA 5DHEA 4Z0XB 4HZ1A 5BQ7B 2MNUA 2EEXA 4N3UA 2P45B 1RVFL 3TASA 2FECL 3HZ3A 3X3FL 2D4FA 2J44A 3AQYA 5GS1C 4ZZFA 4KROD 3EOAB 4ZUUA 3ZHFA 3UTTE 3F7VB 4CSTA 1A6ZA 3BD3A 3WLBB 1A6TA 3HR5A 5F9OH 3UG3A 3ARRA 4OFVA 2OX5A 1SN5A 2NY2D 3PG2A 5I1GH 4P3WA 4HXBL 4N0CC 4QHPA 3CZNA 4OF0A 4XCCH 5LGJB 1IAKA 2IWGA 2N3JA 4I0PC 2P9RA 4H8PA 4Z78B 1PU0A 3GIVA 1KYAA 3BP7B 4FLOA 5J13C 5FO2A 3KLQA 4ZS7H 1GZPB 4AKPA 4PHXA 4EXPX 1E40A 2MHAA 4QRTA 5DQDL 5J11B 3M1BB 4TPRL 4FG0A 3FN0L 4YDVA 1QACA 5DI8B 1TJHL 2XDHA 1KUMA 4C57C 2V33A 4W9DC 5C9JB 3CDZB 2ZONA 4N9OB 2DMKA 1E2VA 5DA0B 3CHQA 4BHUA 4Y9EA 1JK8A 5E00A 3VCLB 4QHLB 2XXFA 1U8CB 4XCYA 3O4OC 3LY6A 3N0PB 2Z9TA 3FJTA 2NY1C 3HB3D 1WTGT 3JUYA 5I82A 3OD3A 3WY3A 2OTPA 3MNZB 5SWQA 1IBFA 3L2NA 4N90D 3QQDA 1D3CA 1OTSC 1Q9OA 3H2WA 1U8HA 1QBBA 2ADGA 4YHPB 2IAMD 4GXUN 3GBNL 2DTMH 2EJ1A 2ZJSL 4HS8L 2V9RA 3TO4D 4UMSA 3RZCD 3GMLA 2OMTA 4ZMQA 5E03A 1SHWA 3JXAA 1U8LA 1ADQL 3GJFK 1U8NA 1NC2B 1Q72H 2WXNA 1F90H 3WDHA 1S3KH 3ARGA 1L4IA 4L8SA 5CWSB 4AXWB 2DLTA 4HYTB 5GGTL 5I74B 5DSCA 3HIZA 3IDIA 4LKXB 5TQ2H 5JW4M 5ID0A 3VVWA 1P7HL 1WP6A 5DRWA 2VM3A 1JGLH 3QHTC 4NBZB 4FYQA 5FKPA 5HHXL 5IIEA 2ROYA 4K2UL 1G7PB 3B43A 3LNHA 5LQBL 4OZGF 3KNBB 4N87A 5C0DB 1L9NA 5KVDE 3DOSB 2I26N 2VIRB 5F7EH 4HBCL 1BJMA 3SDCD 5D9SA 5GGVH 4Q58C 3QAZB 1QWNA 3SQBA 3UYRH 4UAOC 1KGWA 4NKIL 4LPUA 3SPCA 4PP1D 1D5RA 1NM9A 5AVYB 3AU1B 5JORB 3CZFA 2G5RA 1QLEB 4IBQA 4KNSA 1R0AH 3NP3A 2JCCF 4BH7B 2OJEA 3RVWD 3IDYC 3QEQE 2BWQA 3O3DA 3WNOA 2E74C 2Z34A 2X6AA 3SE4A 4ONOA 3DXAE 1TCRB 4NJAL 1RIHL 2EE2A 2NY4B 1IJ9A 5GGQH 4Y4KC 2V4LA 3A6CL 2WCGA 5IB1A 1U8OB 3FCUB 4FLSA 3VYNA 1D7BA 3CBRA 3IRPX 5I73B 4PREA 3MLVL 1ZEAH 4EAEA 3LRKA 2FHBA 4XBPA 4ZAKA 1BQLH 2PO6B 3TBYB 4K9EC 3H9YA 2WXHA 1AGBA 3FFDB 4PMEA 4UTBA 3QULB 2XV6B 2NNXA 4JRYB 5T5FL 5DRZB 3QUZA 4LF3B 1HKLH 4XVTL 5D70L 4WSJA 2LV4A 4PW3A 2EIDA 1CDYA 3O2WH 3CLEH 2J72A 4X9FA 5CILL 4RETB 4AV0A 1ULVA 4LLVA 4E9WA 2V9TA 1UCBH 3ES6B 4E68A 5FOJA 5IROC 4FNLL 2WWMC 3IJHA 3P54A 4LT7A 4ZMLA 2W5PA 4YAQB 2V7NB 1H3TA 3SGKA 1A7NL 1HEZB 3UIYA 4YPGA 3F83A 1P5UA 2UY7B 5D5MA 4KQ3L 4CBZA 1OWWA 5L7XH 3GSRB 5I74C 5T1KB 3MRIB 3P11H 1QVOB 3GSOA 1QLRB 5CJBA 4JM2F 2F18A 3BC9A 3PE9A 5AWNH 1E28B 1KB5L 2ZG3A 3DX2A 4JPSA 1V8HA 5J5EA 4L0PB 1AS8A 5J12C 3D30A 3WKQA 3UTSA 5D1XB 1XBRA 4R2GC 3FB7B 3IVKB 2H0JA 1EFXA 2DWDB 2DF3A 4N2NA 4UB0L 5BQDA 1SDYA 1T03L 3BDYL 1LK3H 4JREB 4A7GA 2ILLA 3ML9A 3LRSA 4TUOA 5GS1B 2AITA 3PU7A 1NCIA 3O2DH 2IGFL 3GTVA 5HVWA 2KLRA 1E4JA 3ZT5A 1A6VH 4HJGB 4L3FA 2A9CA 5BRQA 1QFWM 4AZUA 3HG3A 32C2A 3QULA 1EX0A 1HI6A 2Z92B 3TPKA 1MFDL 4WWOA 1VFBB 4ODWA 4Y88A 3HZVA 3VAEA 1CR9H 1HWWA 1KLUA 2HT2D 4KY1H 5J13B 5C0ND 2Q8AL 1CD9B 3QA3A 3W0WB 4WK0B 4CC1A 3U79A 4MB4A 3GMMA 1IBDA 3C2AH 4GRWF 5FYLH 2YXMA 2NY4C 1FV1A 5JHLL 1ZKAA 2VDNB 1AS6A 1R75A 5ANHA 3LXAA 2G3XA 4K7PX 5FFOA 4UAHA 3BYYA 3D08A 3FU8A 4WJKB 3BN9D 3RL1A 2CLRA 1E9OB 3MNVB 1DJZA 4YIQB 2P80A 1R3LA 3H2PA 5A2BA 2FSDA 3X1FA 5IROD 1TOXA 2G0LA 1HH6B 4ZPVB 3O6FD 3U0PA 3I6GA 1AP2B 4KFMA 1OSZB 1JGEA 4EF3A 3MOAH 2VB5A 2OJZL 4JG0H 3MOQA 3AMKA 2YMXL 1W16A 3NZHH 1X5YA 4PRHD 2WC7A 4K9EH 4XN8A 2VLJA 1V7ML 2FB4H 3K2IA 4HKZB 4K94L 2DWTA 1PQZB 3H53A 3NABL 5IMOA 3VQMA 1J05B 5AB0A 3ZDYF 2FK9A 2Z3FA 1NIEA 4LOFA 1OAYL 5C08E 4C47A 1RY7B 3U0WL 4TVPE 4R4FL 5FFGA 1UC6A 4PP2B 3V4PB 1JFHA 3P4MB 2VDNL 4GH7B 4JFFB 3ZBMA 1AGBB 3FFDA 3IBEA 1JXKA 1XDTT 3ZKNC 4JRYD 1XGRB 5HGDB 1JD7A 2XFXB 1CN4A 4P23B 4XMLH 3L2LA 1JHTA 1AR1D 2IWFA 4H25A 3HPJB 3DX4A 4HKXA 3MR9A 3FAXA 3TBSA 1UGNA 4FABL 2AXGA 3HS0C 3WY4A 4RMUA 3V6ZB 1FORL 3RPIB 4KJWC 5D96C 4KUCD 2WNWA 5KW9H 2HT2C 2DI8A 3ULUL 3S37H 4WHYH 1XF3A 2EUVA 1KTDB 1Z5LA 3HA0A 3BT2H 5K9QI 2Z4QA 1ILSA 3JQOB 1YO4A 4DERA 4R0LC 1RP8A 3CZKA 1SYVB 1NWPA 3ZE1B 2AK4E 5E00B 5E51A 2ADJA 1RU9H 1E28A 1RHHA 1XX9C 3ZW3A 5AG8A 3OR6A 4P2AA 4WV1A 2YD9A 2A74A 3Q44A 2XKSA 3T09A 3B3BA 3BESR 3BDYH 3NJLA 4KKLD 3RFZA 2IANB 3MMEA 4JX0A 4XP9H 4ZFQA 2QPEB 2Q3ZA 2OK0H 3VH8B 2G75A 2EIMB 1YEDA 4PJBB 4PBDA 1XB3A 3GMPA 5IB3B 3BGMB 3C60B 5DK2A 1T21A 3KH3A 3OKLB 5EH1A 2AVFA 3FTGA 5K9KB 3MJ9A 1KIPA 3RKPA 5HYSA 4PTTA 2UY6B 4LLDB 2EDDA 4HMDA 4A1RA 2VDLL 4F2MA 3NEXA 1BVNT 4F58L 1A14H 3VXRA 3KM1A 4OLVL 1I8KB 4NRXA 4MSWA 1PZCA 3MX0B 3IDXL 3WD5H 5AB9A 2YMXH 4G8AC 2C5DC 3P9WB 3N40F 2D0GA 5E6IC 3E8VA 5EG6C 3UTSE 5DRZA 1EH9A 1GAFH 4H4NA 3FULA 4JGNA 4CDGC 1ASPA 1KCWA 3RBGA 2W81C 5KZCD 3WU1A 4FQCL 1GY1A 1UD6A 1WD9A 4JKLA 1R17A 3FZUD 1GIGL 3AG2B 4POZC 2CLZA 4Y5XA 5B1CA 1OGTB 3MA7A 5A43C 4WV1C 3QQ4B 5D1ZB 5J9PA 3RJQB 2VXSH 4NNXB 3RPKA 4XXCC 4RMQA 3QDGA 4HK3J 3FHQA 2MTPA 2GY7B 4FYTA 1YPZB 2AW2A 2ED7A 2YPLD 3SCMA 3U7YL 1P5VB 1WFTA 1DE4B 1GS8A 3A24A 4Z7QF 4NN5B 1AQHA 5F0LB 2EE3A 4DSYA 3S3CB 2G60L 3QO0B 2IF7A 5DJDA 2F74B 4LVNB 3WDJA 2HA1A 1JNNL 3AB0B 3FQTB 2ADIA 2QKIC 3HMXH 4NZFA 5IV2A 1SEBB 4QT5B 2CO6B 3WFDH 1WZKA 5HGHB 3SQOL 1RMFL 2G0KA 3MXVH 4WF7A 1IBHA 4V2CB 4XAKD 3NH7H 2NY6D 5MEPA 2N0MA 1RLBA 4LPXA 4YK4B 3ES6A 2O6EA 3WFBL 2NNAA 3D48R 4KRPC 4R5XA 3KVPA 3LVTA 7PCYA 1TKWB 1ZA3B 2WINA 3EH3B 3QFJD 1TJGH 4GYBA 4QRQA 1TZHB 1R3IL 3GSXB 1KCRL 1HQRB 1XCWA 3DGGB 3LRGA 3WS3A 4WJ5A 4PGCA 4Z0BH 4BFIB 1ZK5A 2ZX8A 1TITA 1UXSA 5ISZA 4XN9A 3L45A 5LG6A 5EZLA 4Y2DA 1D5BB 1LVEA 2R69H 4HH9B 5DS8B 1E5UI 3FPXA 2Z35B 3QXUA 1QLEH 3NTCH 4MX7A 2CO2A 3T4AC 2C1PA 4NT6B 4XN5A 5JPNA 3CX5J 2F58H 2Y72A 2R0KH 2AF2A 1YJDH 1SN0A 5L2KD 5SWQB 4X5QA 4QRSB 1JNLH 1EFXB 2DWDA 1JYXA 3ZT7A 2MOQA 5DEFA 1IBGL 4JFED 3BLBA 1WISA 2F61A 1IIKA 2WLLB 2AGJH 1KJVA 4YH6A 5IOKA 1HILB 1HK6A 4N20A 1XGUA 4ONHA 3REWA 1HCYA 1HL8A 1F58H 4IGBD 3MFFB 4M00A 3WKNA 1F4WL 2DLIA 3FBQA 1QVOA 3GSOB 3P9MA 1W15A 1H6EA 2ZJSH 5ES4B 1TKWA 2PF6A 4CADB 1N4XH 2IAND 3FN3A 4WTQA 4DKEH 1P5UB 4CAGA 2P7TB 4P4KC 3MRCB 5EZOL 2VLRA 3IDUA 3X11A 5M95B 2BX5A 2OI9B 3K81A 2CR3A 4OCYL 4YO0B 3BVNA 4FQ1L 1FA4A 2HRPH 3L4CA 3ZOAA 3VVVA 3P4LA 1L6ZA 4QRBA 4ZMAT 2BVEA 3BLKA 2XT1B 4BQBA 5KBLA 4U6HA 2RHEA 2X89D 4NXKA 4RA3A 5A3IC 1E9PA 2Y7QA 2Y3AA 3I9GL 3LQZB 4C59B 5LGHL 5E5MB 2BY1A 4F7CB 4DTGH 4X50A 2JKXA 3OJVC 4WW2A 1R5IA 3D06A 4YFDB 2W0FB 1HH6A 3B6SA 2WLLA 8PAZA 4N6RA 1CJYA 4I0CC 3ECBA 4KQ4H 4M7LL 1HNYA 3MO1A 4G71B 2VABA 4A7TA 2CKBA 3WMSA 2FH6A 3FO9A 4TNGA 4JPWH 4R90L 2APFA 4OAWB 4Z8FH 2XFGB 2YXFA 3PQYD 5CCKH 1FFOB 1NAMB 4X6DA 1JZ7A 1I31A 3LB6C 4WKXA 4AQAB 4LCCC 5DJ0A 1MCNA 3SKJL 1W72A 3W1ZA 1XVSA 4H8WC 3CDGA 5KSBA 4JMXA 3B9EA 1FYTA 1WBZA 3GDBA 4HUWA 1SNRA 4JDVB 1G9MH 2E86A 2WXMA 4NN5C 4MXQC 4Q8BA 1ODUA 3HS0A 3PGFH 3ZKQD 1A8ZA 2DD8L 2F7IA 2VN7A 1UACL 4M6OH 5C0AE 3V0HA 1B6DA 3QUXB 5CSBA 4V1DE 3ZRCC 3DV4A 5ELIA 1E9PB 2Y7QB 4Z7OB 2ICWA 5FM8A 1CFTB 4XAKE 2O5NA 2GFBA 2AV1A 2IH9A 2CHNA 5I0YA 4EZMA 3N9GL 2GSIB 2VDRB 1VDGA 4PTUB 3ILPA 3V0DA 3HCVB 2ORBL 3ILEA 4DZ8A 1J9RA 3UACA 1MNUL 1U2YA 1J1XH 3CVIL 4UBDD 4QTHB 2VLRD 5FHAH 1NBZB 5D7JB 3W2DL 1DSFL 1E27B 4MRBA 1Q1JL 5FCUL 5EEVA 4FG2A 1NWOA 5BMFH 5SWSD 1KCKA 1KEML 3TXAA 1UYWH 1SOKA 5F9WB 3FUDA 2WQSA 4XOEA 1FC1A 2HTLC 3PWPD 4HFUH 1KG0B 2DIBA 3HN5A 4LOUD 5MP6H 4CC4C 4DP9X 2JQZA 3U2IA 5IMLA 4L4VA 3GPSA 1CXLA 1U8OA 2FJUB