2Y22A

Human alphab-crystallin domain (residues 67-157)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
MEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSMSSDGVLTVNGPRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CRYSTALLIN B
publication title Crystal Structure of R120G Disease Mutant of Human Alphab-Crystallin Domain Dimer Shows Closure of a Groove
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 14
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y22A00
3QORA 3L1GA 4YDZA 1X5MA 4YL9A 4JUSA 3L1EA 2KMWA 3Q9QA 3QORB 3W1ZA 3EUDA 2Y1YA 3GLAA 2O30A 3J07A 5DS1A 4PCKA 2BOLA 3VQMA 4YLCA 4JUTA 1EJFA 2WJ7A 3VQLA 2K8QA 4ZJ9A 2Y22A 2CG9X 4M5TA 2JKIS 3L1FA 2N3JA 3AABA 5LUMA 4FEIA 3QORC 3N3EA 4YE0A 1GMEA 2WJ5A 4ELDA 2MNWA 4MJHA 2XCMC 2Y1ZA 3GT6A 3Q9PA 2KLRA 1RL1A 4M5SA 1WFIA 1WH0A 2N0KA 3QORD 4RZKA 4PBDA 3AACA 2RH0A 3GUFA 3IGFA 5DS2A 2CR0A 4I88A 1SHSA 4YLBA 1WGVA
chains in the Genus database with same CATH superfamily
1KBPA 2VE6B 4N0CD 3IFNL 3BZDA 1AXTH 3EO0A 2BSDA 1BBDL 1JD9A 3BVNA 3MC0A 3W1ZA 4IRSD 4K3EL 2A0LD 1I8UA 2OS7A 5J0BA 1BBJB 4RDBA 1OF0A 4FFYA 4GUPB 1QBLL 2IGFH 1MJ8H 1UJ3A 3I02B 4NQCB 3FOMB 3WNPA 1MHHA 4W93A 3UCRA 1PEWA 2VQTA 2FYYB 3Q9PA 1U91B 3VRIB 12E8L 3QFJA 4HS8L 1ILUA 5FO2A 3OXSB 3AXLA 3QEHA 1GHFH 3GLZA 3GXIA 1IFRA 3OZ9H 4JRYE 6FABL 5FA4B 3ESPA 3HZVB 3QORA 1DQTA 4YUEL 1EPFA 4J3VA 3D0AA 3GJEA 4I5BA 5KVDH 3JWDH 4F9PC 2B5IC 3ZE1F 1BLIA 3RU8H 4CGUB 1UKQA 2FQFA 5E08H 3VWJB 1ITBB 1NCBH 3WTSA 3HI5L 1PLAA 3I50H 5CR8A 1U2HA 5GGRY 4OCWH 3DBSA 1A7NL 1A9EA 2WW8A 2XICA 5A2IH 4I1RA 5SWZA 2SODB 4U1NA 4Y8DC 4U4BA 2GI7A 4KK6C 5CCKH 2BPBA 2IDTA 2MPAH 3FSVA 1JRHH 4FYTA 2C1PB 3EHBB 4GKNA 2BNRB 2NW2B 3O4LD 2QL1A 4ELMA 2EIDA 4G6AD 4N0YH 3B2PA 3D39B 4QWWC 2MSPA 5AG8A 1VDGA 5IB3B 1G6VK 3OKOB 4PRBB 4Y9CA 1WFIA 5HYIA 1HQ4A 5IHWA 5IFAH 4HPOH 3BMWA 2QADD 3A4DA 3FUHA 5FHAH 4L4TB 2P24B 3BAJA 1BQHA 5IB4B 4FNLH 2FX7H 2VOTA 2DICA 2Z64C 2NT0A 1I7ZB 1NEZB 1FJ1B 5AEAA 3O2VL 2Q76A 4UNVA 2BVPA 4KTEH 3MJ9H 1SDAB 2DTMH 2P28B 5CXPA 5KANI 2FRGP 2JK5B 1LE9A 3BKYL 4K15A 4JZOB 5TDPB 3TT3L 4L8CB 3IGUA 2JXMA 3NG5A 4NS0A 3UDWA 1XAKA 2J8UA 2JJUA 2JI3A 2B39A 4ZFZB 3S4SB 4CMHC 4J39A 3I75B 1I9RH 3JTTB 3TNNB 2DWDB 4UMGA 3UJJH 1ZGLM 4Z18A 1NCNA 4G6MH 5D1XD 1AQDA 4XZUB 2F19H 1OF2A 1L4IA 4PYHA 4NM4H 1J5CA 1UD5A 1KIRA 2WNKA 1MW1A 1XV8A 3O3BA 3H9HA 5E1IA 1WZKA 2WBWB 3C5ZD 3HKZA 3K6NA 1K8IA 5EU7E 3BYTA 5HJ3A 3LKRB 1DYZA 1OT1A 1SVZA 2AITA 5IQ7L 1YLBB 1NZRA 3KHQA 3QWOA 3QAZB 1ZT7A 5DHXB 2BIMA 3MACL 1TJIL 2G0LA 2ZZUT 2NT1A 3TBTA 4EVNB 4LCWA 4E5XB 2FB4H 5E56A 3V52L 4ZSOA 3Q43A 1G5GA 2YAFA 3KL5A 5FKAB 2L7EA 5GS2D 1HYSD 2FWSA 3DI2B 4M5TA 5DJYA 4ETYA 5LGKA 3GMNB 1SY6H 3AWEA 3MGAA 2R0KL 5IVZB 2XWZA 1IKNA 1PCSA 5G5DB 3K4ZA 4I4WA 3TN0A 5D7LE 4NQDA 5D1QD 4C4UA 4PWJA 5IHLB 2FECL 1Z5HA 5IROC 3ZMRA 2FJFB 4U2ZA 4M5ZH 3FUDA 2VW4A 2HJKB 5FUOH 2ZOLA 3H4FA 1R24B 4PRHD 4JDTH 4P0DA 1FQ9C 4H8UA 1E8ZA 1ZIAA 1P9MA 4JREC 3HG1B 3BCDA 4UOW1 5GISL 1IM3A 2X4QA 4FG4A 5DVKA 3ZTDC 1J8HB 4CN4A 5ACMA 4X8JA 4PJIE 2A9NH 4A1RA 1DZ0A 2HLAA 1BVKB 2D31A 2HVJA 2KQNA 4L4VA 5DD3L 4A7VA 3PXJA 5FUZH 1TUPA 4XMWA 4H0IA 2F7OA 5CAYB 4JM0A 5B39B 1RZJH 5TH2A 3T0EC 5AWNH 1GZQB 1RZFL 2XBDA 5FW7A 3W56A 3WXVL 5ABZA 3FCSA 4PJEA 2QLYA 1HESA 1MF2L 5DQ9A 5FGBC 4F2MB 2QSTA 2ZSVA 2HT4D 5DMGC 2UX6A 4O51A 1BEYL 1PFCA 3CFCL 5AKRA 1KXQA 1Q0XL 4IGBD 1I53A 5E95B 2M1KA 2DYPA 5D70L 4HCGA 5FPIA 3PRZA 1OGTB 4Q6IB 3MOBL 3RYMA 1GOGA 5B3SB 1S9YB 3L5WA 1X9LA 4OZGE 3ZHDA 4N2KA 2AEQL 5E2VH 2IADA 5D7JD 4W6YB 2JI1A 3CZKA 1WSST 5E2JA 3C08H 3EH3B 4UM9B 3C9NB 4ZFGH 3K2IA 4HKJA 4HFWA 4QRRD 3BPCA 4W6WB 3VRJA 4JM2B 4Z3JA 2ZX5A 4A7TA 1IFHH 3AXHA 2FSEA 2UXFA 3FTUA 4W1TA 3M7FB 2PW1B 3EOBB 4FQIL 3VVVA 3CVIL 1ZDSA 1FGVH 1S8DA 2BXZA 4F8QA 3ILEA 4C47A 3HJEA 5HD8D 3QUXC 4PIRF 1R3JA 1VIWA 4J6RH 1KGJA 3NFPA 2VDOL 5J11B 2D9CA 4UDUA 1G0XA 5HP5A 2LU5A 4RDQG 4QHMB 3VE0A 1UXWA 2N7BA 4NZ8A 1EEZA 3GEFA 5L2KB 3BSZH 5K9QG 1LO5B 4NZFA 3ULVL 3IDIA 1AAJA 3NIGE 2AQ2A 3WTWA 1YEJH 2W0FB 1D7FA 4BK8A 1WZLA 5I0WA 1L3WA 4GRWB 3GSUB 5DJDA 1KBGL 2HVKB 2UZYA 2WANA 2BM3A 5C97A 5E24E 4KVCH 3EW3B 1QSZA 4F27A 3KJ6L 3NQKA 5SWSE 5JHDE 3AB0C 4DSYA 4GI8A 4KY2A 4JKNA 2W60A 2WBJD 3SO3B 5IB5A 1V54B 3QQDB 2NY1C 1CFNB 1G7LB 1IO4C 1UCBH 1Q9KA 5ICXA 1C5DB 3GSVB 1OWWA 2NY6B 1X7QA 3TEXA 4U05A 1HXYA 2CO7A 4N5ED 4ANVA 2Q2LA 2DL9A 4B9PA 1TDQA 2XPGB 4N1EA 1WTGT 1UWGH 3U46B 1XEDA 4CW1B 1CG9B 4LVOB 3U1SH 1HK6A 1LEIB 3V8OA 3C5SB 2RA1A 3U9PL 3BISA 2BIOA 4YX2L 3BP6A 1EEUA 2AI0H 4OI9A 1N9PA 1LL1A 2IBZY 4NZRH 2W88A 2OYMA 3FQTA 3S5LG 5G4OA 2H1XA 1PNCA 4O2FA 3LN9A 2Z7ZA 3D0LA 1BZ9B 3LXBA 3QQ3B 4P5KA 1IM9B 4JJ5B 4N8UA 3L2MA 4KUCD 3K2MC 5J4MA 1J5IA 1XZ0B 1H5BC 1P1VA 4I18B 2BVYA 5IVXF 4PUBH 1XSIA 3QCTH 4A6YH 3ETBF 2JF1A 3CWGA 3WUWA 3W0WD 4M7JH 1DQDH 3D51A 1T1YB 1ZMYA 2XIIA 1YN7B 3HE6C 4ZS7H 3ARBA 2VLMD 4KXBA 4FQQB 4BIKA 4DW2H 5HHME 4R7XA 1G6RA 4G1EA 4JY4B 1A3LH 4N2MA 4Z8FL 5FUCC 1NGQH 4PP1C 2CIIB 3QW9A 3SGDI 5EF2A 2CJUH 4X4MA 2IANA 2HT3C 4DVRL 2XA3A 1BIIA 2CR3A 3BDYL 5KW9L 1EWHA 5IROA 1PX4A 1R34A 1E28A 2OMXA 1XF5A 3DWTA 3IWVA 4NNPL 2VC2B 1RK0B 2Z4QA 2Y07L 4QHLA 3OD3A 3CFDA 2PYEB 5B1BB 1HNGA 3O6LH 2XRAL 5LBSA 4Z3HA 1SOXA 3FAWA 2FCBA 5C8JA 1CR9H 1G4MA 3LEVL 1MRCH 5DO2C 5E00B 4IU2A 3FYEB 2YAOA 4NO3B 1AHKA 3KLLA 3UG4A 5FYKL 3WTYA 3BFQG 5HDBB 1PYWA 5JXAL 1SFHA 3RWDA 4IRJA 4ZX3A 1S3KH 3AU0A 1OD9A 1RXLA 1IBHA 1VFUA 2JKXA 3MBEB 2Q7NA 4LKCA 3VRLE 1DVFC 2CJSA 3QARA 4YE0A 1MNNA 1FL6B 2VL5A 35C8H 3KPLB 15C8H 4EDXA 2VDNH 1QQDB 2EE0A 4OD2B 2KYIA 1PVHA 2YRPA 1JNLH 3JUYA 1N5AA 3L4ZA 3IJEA 3T65A 1QLFA 1SQ2N 2DDQH 1R3KB 4WEBH 3IKCB 5E7BA 4Z7NF 4RRPM 2J5LB 3LRLA 4IQHA 2R69L 4DEPB 1ZT4A 3KWWB 4OFVA 4X6DB 4GSDH 2IH8A 2WXHA 3O81A 1DBAH 1YDPB 3GDCA 3D25B 1E7UA 1BVLA 2FO4A 4Y2DB 5ADOL 3HLAB 1DVXA 3UZQA 2DWYA 3TTSA 5C9JA 4EBQL 4UANA 3RGVD 4D0DA 3VD1A 4RVBA 1JWSB 2GT9A 4HMEA 2D2OA 3PABA 1FLRL 4MAUH 4Q4EA 1H19A 4GG6F 5FCUH 5EU4A 3WE6B 5L8KB 4FG6C 4FFZH 3NIFF 4UUJA 2VRQA 4M1CD 4WI0B 1H8SA 1JFQH 3RIAK 1D5XA 4PRID 3VI4E 4JCMA 3U1PA 5BZWA 1I9EA 3HZYB 5HHOB 1AGEB 1QATA 3MV9B 1UD4A 1TFHA 5DLLA 3R0NA 5F7YC 5AVXB 2F61A 4O9HL 2FATL 3QR2A 1VF5C 3GHBL 2BIPA 3C2SA 4XP9L 5EV7A 3AAZA 2HKFL 3FC8A 4U6VH 3UYRH 5FR3A 4L37A 3ZQWA 3UYPB 4Z7UE 3LRKA 4HQQH 3VNZA 1XF4B 3APMA 3D3VA 1DZBA 4LCCC 1BF8A 2H2PC 1QFHA 3GMPA 4HXBH 2ZKXA 3ZBMA 1PZ3A 4EDWH 3B1UA 2A74A 3MXWH 3UTSB 3X12B 3MRGB 1TU2A 4I9XA 5DD6A 3FT4A 5DD1L 4AQEA 4UM8A 1EEYB 3VXTA 1GC1L 3U2SB 2GJPA 2Y22A 3G6JF 4NRZB 3WL9B 1IAOA 1FYTB 1A7QH 3NGBB 5CSZB 5C0RH 5C0DA 1RK1A 5KSVB 3CHOA 1L5GA 4U3SB 3EFDL 5I6KA 2GUOA 2UZIH 2FQDA 3D33A 4M6MH 3RUGB 2PW2B 2IPKA 1XSOA 3MCKA 2WWOA 3OAYH 5D4IA 2YFOA 1H8LA 4J3WA 4XRCB 4NB7A 5J1AB 4PJ7F 5D4QA 2ARJQ 2NY4C 3MCLH 5AW2B 3UTTE 2PLTA 2R9HD 3QUKB 4K3JL 5ID0B 3F01A 4X9BA 1PKQA 2YAQA 5AVYB 4F1ZA 4R8WH 2ED8A 3O4OC 3BWZA 4O2EA 4L5FL 4R7NB 4U1HB 5LAPA 1H3UA 4LQFH 2UWEB 4OZFB 4MAYC 2BNQE 2Q20A 3TIDB 2BNUA 4NM8L 1XGPA 1EO5A 5DYFA 3IAQA 1EJ6A 5FWRA 2BP0B 3ZYZA 1UYWH 4KKLD 5D5MF 1GMIA 2R4SH 2EIMB 3I9GH 3ULUC 4MRCA 1PS3A 3EBAA 4NOFA 3MNWA 4JR9H 1N4XH 2F9BT 1OK8A 3VSQA 1QHPA 3OAYK 4UIKH 5GZOC 1Z0MA 1SJXA 4NC0B 5MEOA 2EO1A 3QNZA 4UT6H 5I9QB 4A2MA 3EIFA 2FL5B 3MLZL 1JDCA 4LPTA 4NWUL 3WXWL 5LNGA 5GS0H 1LGVA 4FTVA 2KZBA 3HE7C 5FAAA 3A0OA 3F12A 3GHPA 4CVZB 5D1ZA 3RKPA 3LJ3A 1S7XB 1OPGH 3CZFA 1F6AB 2VXTH 4NIYE 5DHMC 4PPTA 2H6UA 1RIHL 5D2NC 3SQOL 3JWOC 4OZHB 1WICA 4N1HB 1ZT1B 3ZE2F 3RFZB 5IW3A 1J1PH 2IAAC 3ILQC 2J6EA 1NCCL 4J8QA 4KUCF 5A43C 1JFHA 2WQUA 5JHAA 1PL3A 4NN6B 4EUPA 4Y4FB 3MRQB 1OKEA 1FZOA 1KYOK 3OL2A 3QIUD 1CDCA 3IBOA 4RFOH 1PY0A 3G08A 4NUPA 3GKWH 3QDGD 1DSFH 3BH9A 4DP2X 2CHWA 4HOXA 5HXMA 1S7TA 1TJMA 1A7RH 4Y16B 4I3SL 3OAUH 2J2ZA 1IAMA 2WQSA 3MGTB 4UTAA 2ZX6A 3PU7A 1JGDB 3F00A 3EJRA 4BD4A 5D7IF 4PGDA 1RHHB 2QVKA 5CWSA 3TWCH 3BVUA 2PWFA 1HVXA 4ZFFA 2QBWA 2HFTA 4WTXA 5DHVB 2IVFC 1MLBB 1LD9B 1P2CA 1XO8A 4RGMC 4GEJA 1N8OE 2CJTA 2X5PA 3D2UB 4OLYH 5KSBE 1ZD6A 5CBEB 3QZWB 5CUSH 4PJCA 3WFEH 2FT7A 1MHPH 4BZ2L 1IC4H 3WN5B 3B5GA 3SY0B 5DJ6A 5C08E 4PJ6A 1G7PA 3I9AA 3NABH 4BA0A 3LZFL 2ZCLH 1A7PL 3OLDA 1BPLB 3U0WH 1T89A 1PDKA 4MA7H 3FU7B 3S7GA 1SDDB 1VEMA 2NXYD 3NCJL 5DD5H 1NFIA 2MNJB 3SDXB 1EUTA 5HHPA 2YPLE 4ZDHA 2YK1L 1BIHA 1ORQA 3FFDB 3IMVA 4W68A 4RSYA 4U7MA 2F08A 4LASL 1TCRB 3NSJA 4K7FA 4U3XA 5AUMB 2DQEL 3HRPA 2HKAA 2IDQA 3HC3H 5I19H 5C2BL 5DCCA 2NSQA 5HPMA 2RB8A 3I2CL 1JWMA 4NNYA 1I8LC 3GIZH 4D0BA 2OCFD 1VADA 1MI5A 5DZ9A 4MDIB 1WA0X 5K39A 2VTFA 4JDVB 3BKJL 4AIXA 3QPQC 4JHWL 4PS4H 3KPNB 2H3NA 4FFYL 3S37L 3T0ED 4WI3A 5KJ7E 1QRND 3RB5A 1UZGA 2Z35B 1OB0A 4BSWA 3E6HB 1K3ZA 1FFRA 5F1OB 1SZNA 5GS1B 1QX1A 2LAAA 5DMGD 4HCRL 4N2AA 4XMKL 3KPSE 4KRPC 4PB9H 4QOKE 1YEFH 2VLJA 5IHUL 1JZ4A 4HWNA 5AYUH 1B9KA 4GUCA 2DQDL 5JIIA 4X8CA 5TE6H 1QZNA 1J8SA 2ISDA 3Q2VA 4YNYB 4PGJA 1F1GA 3EBGA 4P2YA 5H37G 1NIBA 4NT6A 1YO4A 1KJ2H 4E9TA 2QHRH 1NBCA 3QIWA 3UAJC 1KJ3L 1PF3A 2GC7C 3PL6B 3FTZA 4N2NA 5GQBA 3ZW3A 5GGTA 2ICEB 3U0PB 3THMH 4ERSH 4PGCB 1BFSA 3QUXD 5E8DL 1L7TH 3ATDA 2Y5QA 2V7NA 3NCMA 3S3JA 3QHFH 2JNZA 1U41A 2I5YL 5MP6H 3BX7C 1FNGB 5GZNC 1F90H 3KPRD 4OFYA 2YPKA 4CAGA 1WBYA 4ODWB 3EGSA 4GRWH 2DQMA 3A4EA 4LLVA 3FRUB 4RX4D 3L1OH 4BFIA 4HK0B 3UAAA 5IHZB 3V0EA 1H0DB 3UO8B 1YEHL 2PKDA 4MJ4A 1TYEB 2CHNA 4XP1L 4D9LH 4DAGL 2ZWYA 3MZGB 1HJCA 3ROOB 3LRMA 5GZOA 3O9WA 3GO1L 4PLJD 1HSBA 5AW8B 4UBDD 1Q72H 1T80A 4G6KL 4ZXBB 4G42A 2HTLD 1T03H 3O11A 4Y1AD 3HS0B 5ESAA 2YLKA 1NGZA 3A22A 4JFPB 5TK4A 2VR9A 4G8IA 1GGTA 1TYRA 2YHGA 5EZJB 3WJJC 1P4LB 3A6OA 3NSFA 2WXPA 1BD2D 3HVNA 5F7EL 1OAYL 1NAMA 2ITDB 3A5VA 2YC1B 2P8PB 5JZ7C 1VEPA 2P5EA 1MQKH 5D2NA 3IU3B 3E7JA 1S6NA 1OM9A 1T0OA 5AKVA 2F54A 4LOUC 4GT7A 4PGEB 4FFVD 3QJHA 1CLYL 2XV6B 3T0WA 1OP5H 1U8NB 4OJYA 5EDXA 1SEBB 4L3ED 1BVOA 1FFOA 4WY7L 3L48A 5F7DB 1T1XA 3MO1B 4PJFB 4WQOA 1FPTL 4PCSA 4B9YA 1AP2A 3K6FA 1E2ZA 3FUKA 1X6LA 4PS3A 2WZPA 4HAGA 2AAVA 3UYOD 4APXB 4YSCA 1MRFH 4XBMA 3PQYB 1G9NL 3FOLB 1QW9A 5EMYA 1F3JB 1XR8B 4MASA 1IBDA 1YECH 4YBQC 1AGCB 1EJOH 1U8CB 3BWAA 5BJTA 2QVIA 5T1KA 2V3DA 5F9AC 5CD3A 4J5VA 4XMPL 2BVQA 4HHAA 3UPAA 1AZVA 2V33A 3KPMB 2NXZC 3BPLB 2DTSA 1I8KB 3U79A 1VKXB 4N0UA 8CGTA 1TJHL 1OSZA 3ARDC 4KV5F 1DQJA 4FQ1H 4OB5H 3BAXA 4HZLA 4F7KA 4V2CB 5IMLA 1JF5A 2VC2H 1WFJA 4J1UA 1ZLSL 2XBZA 3N9GL 4CSZA 5T1MB 2HT2C 3ZHLA 2HT3D 2QR0B 4YFEA 3FRPA 3F62A 4XC3L 2FIRT 1MNUL 2ZWKA 1FIGH 3FXIC 1HKLL 4IKNA 4MA1C 4PJHF 1R3IL 1A1NA 2F8VA 2A6DA 3N44B 4XBEH 4XPAH 3OG4B 3TO4D 1MCOL 3QUYB 3FHAA 4OGAC 4AKPA 4F7EA 2P7TB 5EUKB 4OKVB 5D93B 4JB9L 2VQ1B 3EZJB 4JPWH 5CEYB 1QI5A 1CVSC 3L2NA 4XC1L 1ND0B 3R06B 3OJDB 3HHSB 1AQMA 4P2RE 1W72L 3P30H 2IOOA 3JV5A 1KNOA 4JVWA 3RNQB 4EIUA 4P46B 2GG1A 2LAGB 5I1AA 4N1CA 1NBYA 2EABA 2NQCA 4F20A 5E9NA 3L08A 1M7IB 4QRSA 4Z7WE 2HPOA 1XB8A 3GSOB 1Y18A 4FLOA 4JPSA 4ZODA 5FB8B 5JXEC 3KLDA 1CLOL 1N64H 1R5VB 4C83B 3SYOA 5FC9A 4J3BA 3UOAB 1IKFH 1CDGA 3FT1A 3KVPA 1AOZA 2AQ3A 1T1WB 1ZA6A 4PG9A 3QRFM 3VXSD 2WLLA 3R4DA 4CC4C 4TTGA 1KB5B 3I9PA 1NGWA 2Z91B 3H0TA 2IWKA 4V1DB 4G43B 1DBBL 2MQ0A 1GS6X 4M61A 5ANMA 3QJUB 3QP3A 1KPVA 4AZUA 2C7FA 4Y5XB 4E9LA 5EIIA 1MH5B 2XZZA 4CW1A 2H3XC 3S3CB 2V9QA 4AVHA 3QUZC 4LK4A 3AQYA 4I87A 1LK3L 5AZEL 1NSNL 5T33H 3R7RA 4CSSA 1YJDH 3KWUA 2LLLA 4LXFA 3FK3A 4MD4B 4DVBB 4LVEA 4NCDA 3SCMC 2BP8B 2HFEA 3CXHK 3BJ91 1QSEA 3HUJA 3ARGC 5IM7B 2HJFB 4N3UA 4X4XA 4Z7QE 3O3EA 3UO1L 1VPOH 2AJZA 5D6CB 1CFSB 3MKKA 3LKOB 4LGRB 3VSTA 3ISWA 2X4OB 5DJZA 4M7LH 5B1CA 1HTYA 5ITFA 4ZPVA 1PD0A 1AMXA 3TEWA 3SKJH 1DBJH 1WZMA 1ZHLB 4IMKC 1NFAA 4PTUB 2E4FA 4IRZL 1TZAA 2CH8A 2L3BA 4NQEB 1NANH 2H2PD 3KL0A 4Z3EA 1RVFH 3VJ6A 2GY7B 5BRZA 3ZDYF 5K9JH 1IU1A 4L23A 5J6GB 2UYLB 3G5YA 4KRNA 2R2HB 4M8QB 3NA9H 1Q9LB 4B9KC 4XE0A 2CMRL 3L95B 1Q94B 1IZJA 3NN8A 1JYVA 4G9FD 1K8DA 1NINA 5I66A 5DJ8B 5CBAB 4LU5H 2AV1A 1ZE3H 2M2DA 4ENEC 3O8XC 1BZEA 3BEWB 4RIRA 2GIXA 4WDIA 1JF1B 2NY5C 2R15A 1NFDF 3A6BH 2OYPA 4I85A 5B8CC 3B2XA 5T1DH 1SHXA 4OZFH 1XMEB 1A6TA 2QQLL 1J05A 1KFAL 3D09A 1MRDH 3S34H 4NZTH 3GS7A 2FBJH 3LN5B 1U92A 5EHFA 1KB9K 3LZPA 4JG5A 1QBAA 3DMMC 1KB3A 2VXSH 3MRDA 3L4VA 3BGMA 3OGOE 2CXKA 4MAYD 1JIBA 1SYSA 5BVPH 3SQBA 4U1KA 2ODIA 2J4WL 4KZEL 4TNEA 2FJSA 3ULUD 3U7WL 3LB6C 4BZ1H 4XPGH 5EEUA 4N0RA 1KCKA 4QTFA 2LGNA 25C8L 1BSIA 4KJYA 1K2DB 3O6MH 4BKLB 1BFVL 1PD1A 1VGEH 4UMSA 5EZIL 1ULVA 1NANI 1YMMD 3MCYA 1CFTA 5LG1A 3DSNA 1G6RL 1PZCA 4UILL 4ALAH 1INEL 1CT8B 1TZOA 2YAMA 3LMJL 5EUOB 2VT0A 3HE7D 4LHUB 3QCUH 4M6NH 5IJKC 1S7WA 1XIWC 2R56L 3KPOB 3PWJB 3EJUA 4JG0H 4ODTH 4TUUA 4F5CE 4QLWA 4LSPH 3VFWA 4LEOA 1F4YL 1IQDA 4Z7VF 3U36B 2ZCHL 1QEWA 4HWEL 3QR0A 3VM7A 2BY0A 3FT2B 2WUBH 1GYVA 2IPUK 4L8DB 4M7KL 4WO4D 5GGSB 3QWNA 2ATPA 2G5BB 4BXVA 1U3ZA 1I8MB 3HI1B 1NBVL 4QXGL 4DP5X 3KYKL 4G3YL 2CRYA 1K72A 2ZE0A 5LBSL 1P6WA 5C9KA 4GUQA 1G4RA 5IFJA 3QJZA 2DEYX 4MX7A 5D1XE 5DD0H 4KNSA 1S9VA 3OKNA 4DGUA 2CO6A 2F58H 4L5FE 1V55B 3GSWA 5KANG 1XCQA 4XAWL 3TCLA 2C4XA 3FHQA 4H1LH 1D9KC 4ZMNA 4MCNA 1N59B 4KMTL 1WFTA 3QUMB 3VW3L 4PJBF 1OB1A 2DN7A 1ZHKA 4OD3L 1SHMA 3RPBA 2ESVB 1JZ5A 1MW0A 4IIQA 3TA4D 5DUML 3T4AB 4L0YA 3FB7A 1X4XA 2JJVA 3DYOA 1SF5A 4GKZB 3QFDB 4HHGA 2ZKWA 2FD6L 2P5WE 2BFVL 3P4NB 3F64A 5IQOA 3PNWB 1KTBA 2YN5A 2E86A 2ADGA 4YHKL 1C8QA 3PV7A 1MG3C 1N6VA 2VIRA 3RJOA 1PAMA 1P4BL 2B9AA 2J8OA 3TBCA 3RE0A 4Z7OB 2QLVB 1I7TB 4PJAB 3T08A 2AJ3A 4HSQA 4CC4A 3MA7A 1AZZC 3ENEA 1IV8A 4Q6KA 4LRIC 5LGJA 4DNLA 2AC0A 1KELH 2BZ7A 1TOXA 3LKSB 4OFDA 2Y7OA 4ZMWA 4M6OH 3GRWA 4PRHE 4UAOB 5I1KH 3FH7A 1AI1H 3E6FA 2KERA 1FSKC 2DPKA 4YXKL 4Z78A 4U1LB 1MFEH 4OBSA 5IVXA 1D7BA 2BZCA 3ZDXE 4JFXB 2CD0A 4NKDB 1O9VA 4YHLH 3HW7A 3DDGA 3OJVC 5HYJD 4ZRGA 1BXAA 1CYXA 3EBHA 5EH1A 5L6YL 4QGYA 4PTTB 5DGQA 2ICCA 3SCMA 3IMSA 1T0NA 3INUH 4WU5B 3TO2B 5IQMA 2BXYA 3AS3A 3FT3B 4I77H 4R2GC 5JIQA 3LPFA 1USQA 3AC0A 2CPUA 1HHIB 3SDDA 2DWEA 2VDMH 1PAZA 2QSCL 4FL4C 1TTRA 1HWWA 5INDB 2E7MA 3CFIC 3OKLA 5E9DB 3F8UB 3PWPB 5TPWL 5EPMA 1ACXA 1BM3L 1KCLA 4F7MB 3L54A 2DF3A 4JRLA 4KBPA 2AQ1A 2GKIA 1U3YA 3JQOB 4M1GL 4AYDC 4YR6B 4FNUA 2XWEA 4IMKA 2AHIA 1X3DA 2NY2C 2R0ZH 3CX5K 4S2SA 4EIZC 2OR9L 4ACPA 4QRRE 1EQWA 4NP4L 3H3PH 3HBQA 1OSYA 4FE9A 5KN5A 2RQ8A 2C5DC 1NGXA 3PJSA 3BT2L 4F91B 3GHEL 1RP8A 4OVVA 4GBXA 2VLKB 4P2QA 1WA2X 3QQ4B 3EO9H 3O0LA 2HZHA 4C57C 1M7DB 3UAJD 3O8XA 4Y19B 4HJUA 4CADA 4H0GA 1M9SA 2WGNB 4WNQB 3LSOB 4XXCC 4G2AA 3DX7B 4OD1H 1E4XL 4JGJA 4DQOH 2JIXB 2J1WA 1URLA 3F7VA 2MCPH 5KSAA 4UYQA 2X4SA 5EZPA 3UG5A 1IIKA 3OKMB 1WUNT 3HMXA 1U3JA 1EA9C 1IQWL 4OJAA 1KULA 3T77B 3RY6C 1EXGA 1LDPH 4RMUA 3ETBJ 5GZND 4PV8B 1YNTB 2ZOKA 1A1OA 1CE6B 2GEEA 5JNYB 2BSED 3VXNA 1ONQB 3FS9A 3WFZA 3BAYA 5I16B 1QBLH 2ZKHL 3V6FB 3H6JA 4GPVA 2OAAA 3R8BB 4JJHA 3DROB 4Q9RL 4E41B 3QNXA 2OL3L 3LNGA 2IH3A 3SYAA 2ATAA 3QIBB 1B4JH 3VG0L 4ONHB 4B41A 2R29H 3MRJB 2FNBA 2O5XL 5CMAA 4N68A 4DZ8A 1UM6L 5AFAA 2A4ZA 2A6JA 2AEPH 2BOCB 3VYNA 1NCAL 4GG6A 4QXVA 2DQIL 3KLKA 4E36A 1JPST 3QJFB 3FU8A 4GH7B 2CQVA 4NCC2 3QA3B 4YUEH 1CF8H 1HDMA 4QIRA 5AOIA 4OQTH 4WUUD 4AEHH 1UOVA 2FUQA 3TJHC 1MLCB 2QSVA 4ORZC 1G7IB 5IW6B 3DK0A 1OANA 1WD9A 1QUNB 3GBNL 3JWDC 4FLHA 4QRPE 4NXKA 5SWZE 1HQRA 2AJYL 5E1GA 2Q86B 2J6EL 4PJXB 3A67H 4LOUD 2JCCE 5SWQB 3MFGB 3P77B 2FYVA 4BXSV 4DP4X 1FZKA 1ORSA 5C09A 2D7OA 2JB6A 1L6PA 3CDGB 4HIHA 5GGUA 4F9LC 5CLYA 2ENPA 1PLCA 2OR7A 3K6SA 2ED6A 4KROB 5IKCA 4JRWA 1M6OB 1NCWL 3G6DL 4O4YL 5I5JA 2W91A 1B90A 1KLFA 1VFMA 2OZ4H 2XJLA 4UTAL 3G6JA 4E0RA 3TZVC 3GBMH 4ZO8A 2FHCA 2XN9D 2DAVA 3VX1A 5I71C 4TNVF 3ERXA 3OC5A 3ATEA 4Q0XL 4AW4A 4I88A 5EIQA 5TQ0L 1L6ZA 3ZQ9A 3HG2A 4CNIB 4QMEA 2OQJB 3VFNB 3EOTH 3KYMA 1HL5A 4MJIB 2WNGA 3S3DB 4LLUB 1L9QA 1LTXA 4HUKB 1MDAA 3ABKB 3RY4A 3V6OA 3S88L 1M1XB 1JGEA 3OPUA 4PJ7A 3S8FB 4XN5A 1AQKH 3GWJA 1GZHC 4DN3H 4D9RE 3ARDD 3BGFB 5DSCA 4ES8A 3CSYB 5C0JA 4AIOA 4ZX5A 2PWHA 2EDOA 5DHEA 3HTLX 1KCRL 2K7PA 3B5TA 1PZ2A 1BVZA 4JFFB 1E6OH 1YMHB 1ZEAL 3TT3H 2JWYA 4JO3H 1NBZA 2BCMA 1G7MA 1UZ8A 1GYUA 1T7VA 4HU2A 4QHUA 5D5MA 1EAPA 5TDOA 3UFIA 4OCSL 4M02A 1T5XA 5FYJH 5AZ2L 4OGAD 5F71A 1JK8A 3SPVA 2C3VB 3QJVB 4Y89A 3FU3A 1J0YA 1J5DA 3OHMB 4NKOA 1BA9A 1MFDH 1ZA3A 4JM2F 1DBMH 2E27L 3PUCA 2VDLL 4XNYL 3SBWA 3QRGH 4IOFD 4M5SA 4GKLA 4YBHA 1BCIA 2GJ6D 1I1FB 2E8ZA 3D06A 3J2PA 3QEGL 2X6VA 4UQ2B 3MLRH 4AQ1C 8PAZA 5T3XH 3NOIA 4K8RH 1U8IB 1INQA 1W0WB 4AQ8C 5LCVA 3C6LB 2H32A 3LKQB 4HBQA 1SXCA 4IBUA 3N04A 3V5DB 3MACH 1TJIH 1FVDB 1QPPA 5JXED 2ZUSA 4JPQA 4RETB 2VZVA 3K6IA 2QGCA 3V0FA 3UZEA 3BVTA 4GMSL 1R5WB 4XOBA 4HJ0D 4NQDE 5KBKA 4GRWF 4ORGB 4KX8A 1D5MA 1KXVC 1N18A 3QPXL 3T3ME 4ICWA 1FFNA 5FDWB 1Q90A 2IF7A 4NLHA 5FYJU 2CR0A 1U95A 4WTZA 3TESA 2D3LA 2IXQA 4YS4A 5KG9A 3D52A 3BRFA 2IMMA 2AW2A 5I1HL 3P4OB 3AS2A 3NIDE 1CK0H 2O30A 1J9RA 3GJFA 3QXAB 4U1MA 4RWYL 4BINA 2HRHA 3D85D 1ZOXA 3KLAA 3MKGA 4PRIE 5AALA 5DJXB 4X4YA 1DUYB 1TIUA 2WIIA 4K07A 4L4VE 4TUKH 3WEAA 3QI9A 5DUPH 5CEZD 1KZQA 4M29A 4HWZA 2VN3A 1WFNA 3KCPB 5F7HA 4JGNA 3D12B 3RY6A 2LOEA 1IBGH 5ILTL 3UIYA 4U1SA 2H9GB 4UDTA 5DD3H 3AGVA 4XPFL 4PJEE 1J0KA 3ARGD 4KITB 1NCDL 5LXGH 5DK0A 3M45A 5HGAA 4ZX4A 1ZK5A 3GXNA 4P2OC 1KXQE 3SKMA 1I1CA 1PZ5B 3B8YA 1RZJC 5C0BD 3OB0H 5I8OH 3Q0HA 4ZW3A 1VGKA 2BCKB 1AGFB 2K8QA 2W07B 4JZNA 3CFCH 5KYUA 4XTRC 1BGXL 4GP5B 4KKPA 3TBSA 1CD0A 3M07A 5D70H 1UJ3B 1KTKE 2Y0SA 1WAAF 1WZAA 1MHHB 3LZLA 4B6ZA 3QH3A 4M8RA 3GXTA 5HYSA 4GY4A 4JO4L 1M6UA 3MOAL 2BRQA 2APTA 2VR3A 3V7AE 4HWUA 5K9OA 3IFLH 2JKWA 5B3JF 1NAML 3QEHB 3ZSTA 1LLAA 1GRWA 4L0ZA 2X4RB 5CZXD 3JWNH 3ASWA 2O6DA 4JUSA 1AGDA 4BFGA 5IJVA 5LVEA 3JWOL 4P4KD 5HHVH 3QORB 5TDNA 5A7EA 4PGZA 4YHIA 1OWRM 4AGMA 4XCFH 4RZCA 4NJAL 2WUCL 3D30A 4ILDA 2XTJB 2B59A 1X7TA 4OT1L 1H9DA 3A4FA 1U93B 2DBLL 4F9LA 4WHYH 3U9WA 3CXDL 2XWJA 1ECYA 4W9FC 5I24A 2JB5L 4NPYA 4FNPA 3SPGA 2C9RA 2Y2TA 2QMJA 3D0VA 3JUZA 3DMMD 1LNUA 2PYFB 2AJSL 4JY5H 3ULVH 5DI8A 1UM5H 1RUPH 3UEZA 1LO3H 3K4AA 1GPOH 3P9MB 1A9VA 2X1XR 3NYKA 4HIEB 3OMAB 2AFNA 3BAEH 3FQXB 4AM0A 1MY7A 1QI3A 1T6BX 3ULSB 2N4IA 1KBGH 2OMUB 3MAWA 4TVPD 3ZL4H 3L4YA 2P3YA 1ED3A 3MLUH 3QXWA 1GVIA 3UBXG 5EB9A 5HDBF 2YUVA 1YPZA 4AWJC 5DZOA 5J3HC 1QFWM 1ZXQA 4JRFA 3SDYH 2YAHA 3X14B 5HVWA 2P44B 1GZHA 2A6IA 5GRXG 3WDJA 1DTUA 3LD8C 3TBVB 1AVAA 2FT6A 3ZDZB 4LSVH 2DJMA 1XIWD 5FYLL 4Y4HD 4HGMA 1P7KA 1V27A 3MA9H 1XGTB 1HYRC 1NMCC 3SE8L 5KVEH 4KK8C 3RVVD 4X7SL 3MJ9A 5C0CB 3RZCA 3EJTA 1Q0YH 5FW6A 4R3SA 3V8CA 4KOBA 3WO4C 4JFYB 4FMFA 1YEWA 3V4PA 4IOSD 3T0DA 2FO1A 1A02N 1SF3A 3NZUA 1AFVH 2EDEA 3H8NA 4F80A 4AK2A 3ML8A 5E8NB 4CILA 3QUMH 3AVEA 4Y1SA 3OAZH 1KSRA 1GCFA 4LCIH 5IIEA 3OC8A 4F33A 3EYUL 3GBLA 4ODUB 3QG7L 3VA2C 2JLPA 1D9KD 3OM3B 3EADA 1SLVA 4H5SB 3GRGA 3VFMA 4JRYB 2F53A 3C5JA 1XR9A 5TF1H 1Q9OA 1G7JB 3P3UA 2Q3AA 2B15A 5GSVB 1MVUB 1D5IL 4M48L 1JN6B 3MRNA 1AZNA 4LARL 4OCRL 4A37A 3QVAA 4JFZH 5D96C 5JUEL 1JWUA 3CK0H 4NO0A 4HETA 5F97E 1I1AB 1MKFA 1RZKL 4UQ3A 1MFBH 4FZEH 3LNEA 3BUIA 4H0LC 4KO7A 1A7BA 4PRPA 1FE8H 3GXFA 3ZTJH 4GXVH 3OR7A 1OE2A 3O45B 2VLRA 1QSFD 3BDYH 3Q6FA 2GSIA 2APFA 3FSOA 1HX0A 1NEZG 2WLIB 4UB0H 1DEEA 1Y1DA 5DJYB 5EFIB 5DRZA 1ZGLA 1RAMA 1FDLH 2I27N 3F58L 2R1YB 4F8TA 2W81C 1WYJA 2Y07H 1FL3A 4YVUA 3B2VH 4AITA 1L9OA 2G60L 4FQXB 1BREA 5DHDA 3VFPB 2V5YA 3HAEA 4G70B 1LHZA 1A6VL 3KL3A 2ENJA 2F1EA 1SN2A 1U3HB 5CLXA 2J43A 3WY3A 1PCXA 1MZZA 1O6SA 1QFWI 2J57A 4FCHA 1RU9L 2XQBH 2Y72A 1VLXA 4TNWK 3TASA 1KWKA 4MYWB 1S5HA 3S4SG 3T0EE 1PTZA 4K9JA 2EKSA 1TZGL 4XCCL 3B9KA 5ERWB 5KUMA 2VRKA 1A0QH 5I1LB 4PJ9A 2EE2A 3F7LA 2ZONA 3VXRD 1AIFB 4X6CB 4YDIL 3K72A 1U21A 2DWXA 3RTQB 1A6AB 1XB6A 1JNNL 4L8BA 4XNMB 1E30A 4PJHA 1ET8A 3TH4T 4BYHA 5JW4Q 4PJ8D 3L7FA 4K55A 2UWEF 3L9RB 4HX1A 3DIFA 5KZCD 4WAFA 3DO7B 5EOQL 3EFOA 2VO5A 3B3IB 3ZKND 2GJZA 2YXVA 4QO1A 3VQLA 2EVHA 4O02L 3GBDA 4FADA 4HHWA 2GITA 2HJLB 3IDXL 5IFHL 3SKNA 2IPTH 3S8WA 3HC0A 3DGGA 1TQCB 2DM7A 2ROXA 4M5YH 2IADB 3QJQB 5DS8B 2IG2L 4KZCA 4YIQA 2XX1A 2VWEC 4A39A 5JQ6L 1DFBL 5GGQH 3NACH 4HUUA 4HWBL 4OUUB 4PU2A 3AWFA 3KPRE 3WNOA 1IT9H 4OF8A 4MAZA 3CFEB 3EDJA 5MHSD 4MDRA 5AQ0A 3PAYA 4JO2H 1KGCD 1UVQB 1VB9A 4OZHF 3VXMB 1ZTXH 3FCGA 4X80L 5DFVD 5DVMA 1PZUB 1J8KA 1VACB 2H26B 2EH8L 4ZZFA 5C6TL 1FYHB 3AW5A 1TJGL 2OSLB 2PPEA 3BDXA 1P5VA 3PGFL 4Y8AA 4YSRA 2I60H 4RGNB 2XG5A 5EBWB 4XB8A 1RY7B 2R0WH 4O9HH 5C3IA 2WXLA 3PWUB 2D7PA 1HKFA 3D3VE 4OTXL 4MQSB 4KY1L 5D7LB 1WBZB 1YUKB 2MFNA 3MGOA 1FH5H 3DGCR 2G9HA 2DQTL 5SV3A 5I1CL 1EFXA 2IALB 2X4TA 1EXHA 5DMKB 1AKJD 1BD2E 2O1AA 3C12A 2D7QA 3T3PE 5DJDB 1CLZL 5D9SA 5IHHA 4GB9A 3LPGA 4Q9QH 1CFMA 1HHJA 1KC5H 5F88B 1CYWA 3PFUA 3HPJB 4LNRA 1DQMH 3KBPA 4NAJA 2DV6A 2B1AL 4FKKA 3EFDH 4XI5C 4PJIB 4PCYA 5SX4I 3ARFB 3VWJC 1F4WH 2LQRA 4J3OH 4I48B 5AVSB 4AIEA 1LEGA 4FCAA 4HA1A 2ADJB 4I9WD 4PJDF 4LSTL 4X7TA 2X41A 2YXFA 4K3JH 5B1AB 4NGHL 2GFBA 3OHXB 3MLYH 3LOWA 3O6KL 2XXCB 3OQRA 5HHXL 3APDA 4GNKB 4NHCL 4BKTC 3SDXF 4LSUL 4KZDL 4ZMQA 3EJCA 2AK4A 4IDJL 4OZGB 2CBMA 2NUPB 3LRGA 3TZVD 3WIAA 3BKCL 1T3FA 1A8ZA 5ALBL 4JPVL 4M3HA 4B0MB 4A6YA 4YC2C 1LWJA 3FF8A 5C0ND 1AE6L 2DQGL 5FUCE 1QPKA 1JHLL 4YZFE 4NSKB 4IU3B 1KLGA 2OXHB 4ELKA 1A7OL 4ZTPH 2Z93B 1NFDA 1P4IH 3MBWA 2V17L 3A6CL 4JGUA 4XP5H 3V4VA 5ALCH 3U2JA 5I8EB 1NOFA 3QZLA 4JFDA 4LMQE 1ETZB 5GS0C 1GXEA 4JCWA 1AJ7L 1BW8A 1XL6A 1LK2A 3GI8L 3L5XH 5BZXA 1I9IH 1YUHB 5T1LD 3SD5A 1GGIL 4PY7B 5DC0A 1BJ8A 4YDZA 2XFXB 1TETL 3GZKA 3WAJA 1PY9A 4F7TB 5ADPH 1NCCH 4H4NA 1E3ZA 2VUKA 3VGEA 3R19A 4DN4L 3NIGB 1R4XA 1XGUB 3VUAA 5L88H 3DV6B 1SQMA 3QDJB 2YS4A 1FZJB 1MCEA 4OFPA 4EMZA 5CEZL 4FG2A 4NKIH 1T21B 3H9SD 3NZ8A 4LVNB 1T66C 5SWSB 5JHDB 1AO7A 3CFJB 1U30A 3VTAA 1VFAB 3II2A 3W39B 1LILA 2DMHA 3N42B 4I3SH 4S0SD 4RFNC 2HP4A 2X40A 1W9XA 5F7FA 4ZBJA 3HN5A 1I8IB 4N4YB 1UTDA 1MCDA 4UNTA 2C1OA 2P8MB 1M05A 3MNZB 2N1TE 4IRJB 3RWDB 4QRUB 4Z7VA 2FJGA 1A4KA 3WKQA 1Z3GH 2P8LA 3N6YA 1X7SA 3GC3A 4BSJA 5KVFL 1RZ7L 3HS8A 5ELIA 3VXSE 4KAQH 1RLWA 4MNQD 3EO1A 3HC2A 4A68A 3MV11 2Q7YA 1IGYA 5I82A 2K9FB 1SEQL 2ZSWA 3MREB 4BWTA 1YY8B 4UIMB 4FA7B 2RGSA 5ESQA 2V7HB 4OIFA 4JN1H 1E3XA 1F3RB 4Z9KB 1BEXA 3DKHA 5JPNB 4HALA 3CC5A 3IJ9A 3O3DB 5GHWH 4RQQB 4AUJA 2KC0A 5IMKB 1J18A 1HE8A 1BVLB 1ZVHA 2NY5L 4FF9A 4NO2B 2Y1ZA 5D2LB 4FNTA 3HFML 4RFEA 5I0DA 5DTFA 2X2HA 4JKPH 4C56D 4X5QA 3DNKA 1ZS8A 4MA8H 3CFUA 4EPSA 2YKLH 5HY9B 1MI5E 2VE6A 3HMXL 2PXYC 4OIIL 3HG3A 2O5ZH 4MJ5B 2ITFA 3D4ZA 5HHMB 2ZP0T 2PTTB 1JHTB 1BBJA 3HC4H 5HJDA 1RUKH 4Y7MA 4GUPA 5CZVH 3WEMA 4OZ4B 3I02A 4NQCA 1D5RA 1RUML 1KTJA 1WHOA 3DOIA 1HE7A 4R4BB 2CK0H 4DPBX 5F1NB 1JE6A 1VA9A 3C6SB 4MS8C 3SJVB 2FYYA 4TVPL 4PJFF 1U91A 1TYJA 4P2OD 3VRIA 2R2BB 3VH8B 5EF1A 2NY3B 5MERB 2YXWA 1P5UB 3OXSA 4AX3A 3NCEB 4E9YA 1Y7VA 3FO1B 3DETC 4MMXC 1JGUH 1X5JA 3FN9A 5FA4A 5ABAA 4MQXD 3HZVA 3AAZB 1DDHA 2XY1A 2DQDH 1UWEL 4HPYL 3B4NA 2VM9A 1ZK9A 1MFAH 4OIBA 3J8F7 3AMLA 1OW0C 3GMPB 4JM2C 1ID5I 2JTYA 3JT0A 4LAJH 5CLWA 1KEGL 1WFUA 1OT2A 4ES9A 3VWJA 3OF6D 3VD4A 4NQSB 4BRJA 2YEQA 3JBG7 1U3NA 3HLKA 5IP4A 3VXQB 4I3RL 4YHMH 2CUMA 2KPNA 2B4CH 4MTMA 1T5WB 5J11C 5MEND 5EBMB 5CD5D 5T5FL 3WLBB 1R75A 3DBXB 3R4RA 2W0KA 3VFRB 2O6CA 1I31A 2C1PA 2A7BA 3N1FC 2BNRA 1RP9A 2NW2A 3BCFA 2XVKA 4R5VA 1NEUA 3ECVA 4HT1H 4TSCL 2R27A 3TV3L 1JF6A 5JW3L 3S5YA 3OQ3B 2B3IA 2V3EA 3MLWL 3FSZA 2VDPB 3ULUE 3IFOB 4G8FB 1JD7A 2JKIS 5C70A 5IB3A 1JS4A 3OKOA 4PRBA 2AABL 2RQEA 3DX1A 4DAGH 2GBTA 1I8AA 4MYPA 1S5IL 3DPBB 3EZ8A 3RRQA 1YMME 2VM4A 4L4TA 5DEJA 2WVTA 4R84A 5IB4A 3GO1H 1NLDL 2VDKB 2ICWJ 3MVSA 1RFDH 1J9SA 4I0KA 3DX4A 4HIJB 1F13A 4G6KH 2EXSA 5J3HD 4QKTA 4Q4IA 1I7ZA 3SZKC 1YEGH 2R0LL 1NEZA 1FJ1A 1K6QL 4K7PY 4KNTA 2OKMA 4Q2ZB 4UU9B 4HU8A 5DA0B 5D2NE 5MEOB 3QNZB 3ARED 2NY6C 3CHPA 2CLRB 2JK5A 4X0NA 2F54E 4JZOA 5E99L 1FIEA 2CDGB 5TDPA 1E4WL 3VI4B 4L8CA 1CS6A 4XZ4A 4KK8D 3BE1H 2LU4A 3TPKA 5EEVA 1QR1B 1UA6H 2XG4B 4ZFZA 3S4SA 4W9ZA 3OR6B 1CGSH 3I75A 1O9WA 3JTTA 3TNNA 4KHXL 3F04A 3KE0A 2ADFH 2DWDA 5IEKA 3ILPB 2JVUA 4F7PB 3CG8A 1BHGA 4Z7UB 4HLEA 4HV8B 1R5IB 3FONB 4GMTL 1I1RA 4XZUA 5T3ZL 1WG3A 2FBRA 3TBYB 1ADQA 5D7SH 3JZYA 2ZOUA 1GGYA 3KEHA 4AGNA 1E9OB 1KBVA 3LKRA 4Z1PA 5DURB 2E6PA 3FAXA 3IT8D 3AT9A 5AVQB 1MEXH 3CSBA 1S9XB 5LCVL 1PLGH 3Q7JA 3T6WA 4E5XA 4EVNA 4LF3B 3NA4A 4N0UE 4WGVB 4IHBA 3MXVH 5IWLA 4WI4A 2FX8L 4MBOA 4PGDB 5FKAA 5MEQB 4W9KC 1OE1A 3BH8B 2AK1L 5FYLE 2OK0L 4RAUB 3U1QA 3GMNA 3ROLB 1TJHH 3AG1B 5IVZA 3SODB 3K74B 1P2CB 4HKZB 5FDYA 5FM8A 1F1DA 2KZKA 5G5DA 2WLZA 3RDTB 3QNFA 2NY0D 1U4EA 3IWUA 4NKQB 2Z65C 2FJFA 3H4HA 2K70A 3MLVL 4GQ9H 2HJKA 3X3GL 2B2XL 1F4XL 4OF7A 4P5TB 4URKA 5FOBB 1TTUA 3N0PB 3BUDA 4LLYB 1R24A 4FYRA 1D5BB 1KCVL 5FV2A 5JORB 2WBXA 3HG1A 4U7SA 3DRTA 4PWEA 1J8HA 3F5WB 3FFCD 4GFTB 3ZGHA 4MXQD 2Z1PA 2VZ1A 1N3NB 1Z6JT 4GOSA 1W8OA 4LVHB 1NH6A 2Y7MA 3B2UC 5JHBA 5B39A 1GZQA 1GW0A 4LPVA 1Q1PA 5F9OH 2WAQA 2A9BA 1AXTL 4F2MA 3QG6B 4GEIA 1MCBA 2V37A 2VN6A 3VMPA 3GS0A 4OY9A 1JXFA 4PWFA 2E5EA 2VH5L 4NRXB 1ILSA 5E6IC 4H1LG 2IGFL 1MJ8L 3VWKB 4AZ8B 5KJRH 1KIQB 4Q6IA 3HR5B 2Y1YA 3TONA 3HB3B 3DV4B 2H0JA 1S9YA 4QRQA 2J5LC 2L7UA 3VMNA 4M7ZB 4ABVA 3CFNA 4DGWC 1CGXA 1TEGA 1GHFL 2HSIA 4FXKB 4ZOEA 2BVEA 1ID2A 5ANME 3OZ9L 1H9VA 1VZGA 3QZWG 4Y2DC 5F8QC 4JM2A 4R5TA 2X3AA 1WEJH 2PW1A 3EOBA 1PX3A 3DXAD 4IBLT 3S48A 5HYQB 1KN2H 1JTTA 2EDKA 1OTTC 5KVDL 3JWDL 4XMZA 4L9LB 5HTSA 4Q9CA 3QCVH 5AENA 4JDZB 3Q8EA 3RU8L 2VITB 4MA3B 2BO0A 4XP4H 5EUOF 5E08L 3MODH 4ODBD 2QQQA 4QHMA 4BWUA 3I50L 2VM3A 4OCWL 1BZOA 5L2KA 3HUJE 4CVUA 1Z66A 1JMZA 3DJRA 1LO5A 4XPBH 1YJDC 5CCKL 2YPVA 1Q4NX 4I13B 2WGXA 2MPAL 1JRHL 3G9AB 2RH0A 2W0FA 4IBVA 4OW6A 4KRLB 3CAFA 2E8YA 3CC1A 5HYJA 2ZXEB 5C08B 3GRBA 3GSUA 2HVKA 4F93B 1WBYB 4N0YL 4GQPH 4JK0D 1BAFH 1A5FH 4PN6A 3SGKA 2HTKC 4W81A 3TGXA 4X99B 5CSBA 1EIBA 3GFUA 3M6DA 1TTBA 3RG1C 4GSXA 2EQDA 2HUEA 3QQDA 5IFAL 2YPLB 1NCTA 1UOKA 1CFNA 1E27B 1ZV2A 4HPOL 3WS3B 3KLHC 5FHAL 1C5DA 4WUUE 2E9GA 3BVWA 3GNMH 5IW1B 4FAAB 1W2KT 1V3MA 3NQIA 4FNLL 3AGWA 2FX7L 3WAKA 2UY6B 3RHWK 3TXAA 3NDZE 1R6VA 1RPKA 4FLQA 2NX5D 2EIKB 2IOIA 3LNIA 3KXFD 4Y9BA 5CP7B 4UF7C 3L6FB 4OLUL 4KTEL 2W9DH 2JLLA 3U46A 2QDVA 1CG9A 3FN3A 3MJ9L 2DTML 4XO8A 5E51A 2JI2A 1NIEA 1LEIA 1WWWX 3C5SA 3WMSA 5DMIL 5MEPB 2D7NA 2VSKB 1LO0H 2XZCH 3FO2B 4XMUA 1AS8A 2P5EB 5ID1B 2B1HL 3T8MA 1ZE3C 2NNXA 2GIMA 3VFUA 5LHDA 1BZ9A 1WH0A 3QQ3A 1X5AA 1IM9A 4JJ5A 4WFHD 3UH8A 3ZMEA 5BW7C 1WAAA 5JHLA 1I9RL 1XZ0A 3KPSB 4QOKB 1QTSA 2GBUA 4O2CB 4I18A 1ZS2A 3L3OA 4PAZA 2P49B 3UJJL 3D39D 4N2CA 4G6ML 5C92A 3LPPA 5KOVC 4C4KT 4NM4L 2CO4A 3C60B 1MELA 1T1YA 1YN7A 5I9QC 3NTCH 1NDMB 1PNDA 3WS6C 2LE9A 1J8RA 4JY4A 4IS6A 1JMXA 1Z0NA 3GIVA 5DWPA 4AYMC 5DJ0B 1LP9E 4BQ6A 2CIIA 1G6RH 1I3GH 3SSGA 2GSMB 5ISZB 4AG4H 2DJSA 1G1OA 4DP1X 2FB4L 3T71A 3M86A 4OQ1A 1IAKB 1SXAA 3ZYIA 3W82A 3BPNB 3M1BB 2P4AB 1BZ7B 4GO8A 3REWB 4G8GB 4GRMB 1F4YH 1S7SB 2ZXCA 1SY6L 2PMZA 2ZCHH 3ARSA 3H9ZA 1DQJB 1RK0A 3RFZC 5B7FA 4NIKB 4M7KH 2PYEA 2XQYG 4NN6C 1DVZA 5FK9B 1CICD 3MRBB 2BVOB 1CIDA 2HX9A 3MR9B 5E00A 2Q87A 4M5ZL 4NO3A 4YDVB 1UEMA 1LDSA 1YRKA 5E4EB 2R23B 1B9ZA 4PJ5D 2I9TB 2GJ6E 4Y16C 4HPHA 1MHCB 5ITBH 4JBSA 3DHPA 5TF0A 1T66D 1RZQA 4KMTH 3MBEA 3W81A 2O6EA 5GRZA 2EADA 2RALA 2A9NL 2YGNA 1NGPL 1FL6A 3RIFK 3KPLA 4KKNA 4FFTA 1HN1A 3DA0A 4R4FH 2FZ3A 2K6WA 4DP0X 1QQDA 2FD6H 4OD2A 1RZJL 3UTZA 4F15B 5AWNL 3MV8B 2ZPKH 2G3XA 4RA3A 5CP3A 4DCQB 1RJZB 2D4FA 4WK2B 1YNTF 1OTUC 2UXVA 2VDOB 1R3KA 1SJHB 3IKCA 3TEYA 2YGOA 4XVUC 3KPPB 2YARA 1EGJA 2D3NA 3M1CA 3TVMC 2XN9A 4FQPA 1LJMA 1YDPA 4CMMB 3D25A 1MIEH 2NQ3A 3O6FB 5G4NA 4AYBA 1VAHA 2YD5A 3HLAA 3T6QC 2IV9A 3M46A 5E2VL 4H7VA 1KEMH 1HWHB 1JWSA 5D71H 5EOCJ 3C08L 1ZA6B 4ZFGL 2DQCH 1HNYA 4MD0B 4C4BA 3LPWA 4IOIB 1DN0B 4CVXB 5EULV 1IFHL 2N0KA 3MV01 5CEZE 1ACZA 4TYUA 3WMQA 3IMTA 2EDRA 5EIIB 4LSDA 5I26A 1F6LL 4WI0A 1S78D 4J6RL 5L6YH 2C9UA 5AVTB 2O5YH 1GY1A 1AGEA 5HHOA 2PXYD 4KKQA 3MV9A 1OAJA 1NUGA 3L3HB 3TNMB 4PJXF 4A7QA 2XWCA 1DJIA 5C0BE 3BSZL 4JKMA 5DMJB 1BM3H 3D50A 5KVFE 1TPXB 2X1WL 2B0SH 3FQNB 3PP4H 3UYPA 2RD0A 1XF4A 2IO5A 4ISVB 5FO9A 5GS1C 4WK4B 3RVTC 4N22A 4ANXA 3QWRA 2BIHA 1I85A 3UTSA 3X12A 3MRGA 4KVCL 1U8LA 2XVLA 2LR4A 3IMUA 4HCFA 1TKWB 4R90H 1O7SA 1EEYA 1TZIB 2WN2A 3U2SA 1X5ZA 2DLFH 4NP4H 3L2LA 4NRZA 3WL9A 5ITFB 4YSSA 5CSZA 1FYTA 3VGAB 3POCA 3B34A 1F5WA 4M03A 1QD0A 1RPQA 5A7BA 4U3SA 5KSVA 3QUHA 3WDIA 2D7MA 4DKEH 3STZB 3UGUA 1UCBL 3RUGA 2PW2A 2B08A 3TH3T 3QDMB 2DQ6A 4B9CA 2J55A 4P2RB 3M1OA 4XRCA 5DC9B 5J1AA 2GAZB 2XIBA 2PPFA 4C59B 1F42A 4NZJA 4R6UA 1N5YH 2I26N 1Z9PA 5L9DH 3I3BA 2VRAA 1UWGL 5ID0A 3U1SL 2EDLA 4UOJA 4HUNB 1IFGA 2VDPH 4L29B 4R7NA 4U1HA 2AQRA 4FKEA 3P0GB 1FLTX 2PCFB 2UWEA 2AI0L 2VKXA 4OZFA 1FWXA 1EVTC 4AUUA 4NZRL 3IFPB 1JGVH 5JDJA 3CVCA 4R9HA 3TIDA 4TVPE 5I1DB 3WFDH 1ITCA 2BP0A 4DIXA 4FHBD 4W9IC 2WK2A 4QJ3B 3SDCB 1G9EA 1CVRA 2ZKHH 4UQIM 4PUBL 5DT1H 3QCTL 3WS6A 1J9CT 4Q52A 4A6YL 2FL5A 4ZXBC 4GG6E 1SYSB 2EXWC 4BZ1A 4G71B 1Z2KA 4DPCX 4M7JL 3TBWB 1UM6H 3DIDA 3ORJA 4JE4B 4CVZA 1ETB1 4YK4B 1S7XA 4ZS7L 3FZUC 2DQIH 4ZFOL 1F6AA 3LRHA 5D7HA 5TK2A 3TCTA 4DW2L 4WJKB 2AANA 2QTEA 3TF4A 1IBFA 2QVTA 2N7AA 1FNHA 1NGQL 4IRSB 1D3CA 1K4DB 4OZHA 1IEBB 4CDGC 1A6PA 2DYRB 1ZT1A 3RFZA 4F8LA 4N90D 2APBA 3LRSB 3BKMH 1S7WB 3GBNH 3D5OF 5AW6B 1JPEA 2AVFA 3H6AA 5DZPA 4Y4FA 3MRQA 2J6EH 2EDQA 3MV7D 4YDKL 2ADYA 2EH7H 1NJ9B 1NKOA 1SBSL 4EUPH 1K4CB 2IDSA 1ZWIB 2L7JA 4FDWA 4M6AA 3TA3C 4DETA 2TSBA 3O6LL 4GO9A 3JWNG 4O58H 1Z3RA 1CR9L 4F92B 1MRCL 2WBKA 3MGTA 1JGDA 1TMCB 5LDUA 3DARA 3QEQD 4Z95H 1K5WA 3FUNA 4PV9B 1S3KL 1ZGLP 2O5NA 4NUJB 3M7OA 1FFPB 5DHVA 3E1ZA 1R19A 1ZHKB 4IYKA 1MLBA 1LD9A 4WHYG 4N2BA 4PJ7E 3QR1A 2HH0H 3D2UA 5CBEA 1J86A 3AMKA 3QZWA 2WSDA 35C8L 5LLIC 15C8L 2GTWB 1N6UA 3IBEA 3BPLC 1LM8V 2Q8BH 3WN5A 1FNEB 2OCJA 3D2TA 3SY0A 5FLUA 7FABH 1QSFE 1OGAD 4OIAA 4MJHA 1JNLL 3IDMB 3O4LB 2QKIC 2DDQL 4WEBL 1EHLL 2QELA 5BS0D 3FU7A 3HBGA 1SDDA 4GSDL 3EJJX 4LHUG 1JDAA 3SDXA 3ZYJA 2X2YA 5KEZA 1BMWA 1DBAL 3CCHB 3D48R 4M9PA 3FFDA 5AL0A 4Z77B 4PW4A 2EE6A 5CZRA 1TCRA 2VMCA 3QUYC 4WWKC 2ETWA 2QADB 4BK5C 5I18L 4YLCA 2P48B 5AUMA 2G2NA 4DPAX 4F3FB 4OCSH 5T3ZE 2QJDA 5D93C 4MAUL 2J71A 1XXDC 3CFTA 4AVIA 5FCUL 1LO4H 1IZKA 1BXVA 2J56A 5DU7A 4MDIA 3R8QA 3U4EB 3VXRE 1TO4A 4FFZL 4XNYH 4JDVA 4ODVH 2YD4A 1RSYA 4P46C 3G5XA 3KPNA 4BQBA 1NLBH 1KJMB 2NZ1A 1JFQL 3MQIA 2Z35A 2C7UB 3NRQA 3E6HA 3UJIH 2X6AA 2YN3A 3WOVA 3HFFA 2BWDA 2QFPA 5D4JA 2QHLA 2KLTA 2M26A 1DE4B 2AF2A 5E6ID 3IJHB 5EPMB 4K8RC 4WI5A 1MSPA 2DY2A 3DVNB 4U6VL 2DQFB 1TQUA 4OR1A 3W2DH 3JTBA 4HQQL 4ANUA 4GAYB 5F70A 4HEPA 4L0PB 4YNYA 1OTSD 4QJ5B 1M7XA 1C16B 5D1XB 3MXWL 4Z0XB 2ZQKA 3F85A 4WSJA 2WXIA 4XNUH 4Y5XC 5C0RL 1ZXKA 2FHBA 3C5ZB 3PL6A 2PO6C 2ICEA 3ILDA 4HZAA 3U0PA 4PGCA 3ZTEA 1OTTD 5LJYH 1OCOB 1MFCL 2UZIL 5I1HH 5GGTH 4G83A 4QTIL 4M6ML 2E7LC 1NL0H 5A2JH 3RL1B 2Z4TA 4HW6A 5E8OB 3ZTJG 1KYFA 4A66A 1QKZH 4LBEB 3V2AR 1JTPA 2JJSC 2TRYA 9CGTA 2APWA 4ODWA 3MCLL 3GTTA 3GEWB 3FRUA 3GMRB 3BZEB 3P11H 1ET7A 4HK0A 5IHZA 1H0DA 4DQAA 3GSQA 3SBRA 4YOKA 5F44A 1E5ZA 2CA3A 3L1EA 4R8WL 5D1QB 3BT0A 5DJCB 5E03A 2YGPA 4LQFL 3O2WH 4QRTB 1OHQA 5DDHB 2MCAA 1AXSB 3ROOA 4JPKH 4Z7NB 1AR1D 1N0LB 1UM4H 4XN1A 4AKOA 4ZXBA 3QXVA 1BV8A 1UYWL 2V5TA 3GT6A 4PRHB 1CGYA 2R4SL 4IJ3B 3HS0A 1VCAA 5J12C 1BZ8A 5EU6D 4JFPA 1UT1A 4TUOB 4UIKL 3JVGA 1J5OL 1P4LA 2R29A 4UT6L 4A2HA 1HYSC 2A73B 2XQYA 2ITDA 4QJ4B 3L4CA 2YC1A 2P8PA 3S35X 3ZT7A 5GS0L 4RLDA 3MHZA 5KVDE 3IU3A 1NAMH 1K5NB 3HVDA 4W9DC 4PJ8A 4M43H 5C0GB 1OPGL 1Q9WA 4PGEA 3PYCA 1RD6A 4I9WE 4BWWA 4OQTA 4P3DB 1Y6MR 1MXDA 1XGQB 3JWNC 1W16A 3HZKB 5I2IB 4E9WA 1U8NA 3EJZC 5J7CC 4CSTA 3OSKA 1SEBA 1DQIA 1EJ8A 5F7DA 3MO1A 2OP4H 1AYRA 1UADC 2L0DA 4PJFA 1J1PL 5A2CA 1KIPB 3WV0A 4X5PA 4JHVA 3P1VA 1BQUA 2ZOTA 3B56A 2X1PA 3FMGH 3MROB 4HH9B 1E2VA 1XEUA 2PUQT 3AY4C 4UQ9A 4APXA 2EUWA 4RFOL 3FB8B 5D7JB 1SUJA 2QPEB 2ZUUA 3FOLA 1ADQL 1F3JA 5IOPB 4HG4K 1DSFL 1ORSB 1XR8A 3SDAD 4CL7A 3L3KA 1IGFH 4QRRB 1U8CA 3BLKA 4V33A 4ZMZA 1JYWA 4QDGA 1A7RL 1NUFA 1BQ5A 1XFPA 2QPFA 4I7ZC 3E8VA 3OAUL 5KBLA 1QTPA 2Y06H 1YPZE 3EYQC 3ULVC 3IU4H 2OZ4A 3U4BH 4OZIE 1X9RA 4BFFA 5EG6C 3TWCL 3CZUB 3EJYC 4ONGH 4K23H 3KPMA 1VKXA 1I8KA 2BRRH 1UXMA 1YYLH 1T6VN 4GUOA 4OLYL 5KVGH 2BK8A 5CUSL 3WFEL 2HVBA 1MHPL 1J0JA 2OFQA 2QR0A 3VQMA 3CBRA 5DFAA 4FHKA 3MRCB 1N70A 4H20H 4YMPA 5D6DA 3X2QB 3R7QA 4PG2C 4Z3FA 3NABL 4J2QA 5F96H 5C6WH 2X09A 4Y4KD 5EBLB 2ZCLL 5JDSB 1BQKA 3G3LA 3MRKB 4AM0Q 1NPUA 2EAEA 4JQXC 3SYCA 4DF9A 1RKRA 4EN3C 3K8MA 3O3AB 2P7TA 5EUKA 3OLGA 4YFLI 5AAMC 2VISB 2YO3A 4ZI8A 5DD5L 5CFAA 2AERT 2VQ1A 2WBJB 5CEYA 2WYHA 1ND0A 3R06A 3WY1A 4DKFH 5L2JB 5T8IA 3OJDA 4AYSA 3HHSA 4PLOB 4HS6B 1MAKA 4G6FD 3NCYS 2FECI 4J3OG 3RNQA 2QKSA 3T4AC 5I19L 3HC3L 3UZVB 3ETTA 4P46A 1B6DA 1IGJB 4P23C 4QHNB 1JZ3A 1TO5A 5GGRB 3V95A 3GIZL 1ZA3B 3BHBB 1OD7A 1M7IA 3IPFA 3L7EB 4ZO7A 4KTGA 5IBUB 3GSOA 1KBKA 1UZ6E 4WEMB 1KJVA 5FB8A 4PJGB 1CDYA 3BP7B 1R5VA 3WY4A 4C83A 5JUEH 4PRPE 5IK3B 4F8NA 2Y2YA 1RZKH 4H25A 1T1WA 1O7VA 2JCCB 4LOEA 4XVUD 4PIBA 3GGWB 3X3FH 4U3HA 3TVMD 2Z7YA 4FQCH 3X1NA 1KB5A 4PB9L 1ZLUH 1YEFL 3ZE2B 2Z91A 3MUUA 3PY9A 3BZFB 4G43A 3T8XB 5B7EA 1G0YR 5TE6L 4Y5XA 2AEWA 2ZUXA 1JCKA 2WXJA 1MH5A 6PAZA 4PR5B 3QSKB 2AKRB 4HOMA 3UTQB 5TJWK 2DI8A 1F3DJ 5FGSA 2BOBB 3NJKA 3FQRB 1EDYA 2XWRA 4WFGE 3W0WB 2IMNA 2F5BH 3AG2B 4K5MA 3UMNA 2H0PA 3GTNA 2E7LA 4AC2A 1WVZA 4JFEE 2HFGH 3DSFL 4MD4A 4DVBA 3TP4A 1F41A 2BP8A 2JJSA 1W0VB 3WO3B 2X4UB 1AIZA 1L7TL 5D7IB 4PJIF 4YSAA 3N0AA 2VKWA 5LDSA 1AQHA 3QO0B 4XR8C 2UV3A 5IM7A 3B9EA 5LQBH 2YPVL 3ULUH 1ZLUK 3QHFL 4NN7B 1TZGH 2XCMC 3SYPA 4Z23A 1UXSB 4WNJA 1IGMH 1F90L 1L9TA 5D6CA 4KI5C 3WIHA 3N55A 1CFSA 1DQKA 4HKXA 2Y3AA 2E9JA 1R47A 1WCBB 2X4OA 2VAAB 2YLHA 1XXFC 3L1OL 4CA4A 1EZLA 3L3IB 4JFSA 4U1SB 4Y9GA 5FF6B 1D6VL 2XT1B 1ZHLA 4PTUA 1M2VB 4NQEA 4D9LL 3ZHNA 3S35H 2EDXA 5SX5H 9PCYA 1J1XH 1GOHA 2Y7LA 3T2OA 2FQGA 2DEWX 2J25A 5J6GA 1HZKA 2UYLA 2R2HA 4M8QA 4WW1B 1Q9LA 2WTOA 4OZGF 4S1RH 3L95A 1T03L 4ONOA 4L8SB 3LZNA 4RAHA 3L9YA 4JQVA 4ZAKD 4X9HA 1FI8C 1EZVY 5CBAA 3QH3B 1UEYA 3KWVA 1WO2A 3BEWA 4GIAA 2J1XA 4ZMPA 4AEIH 5CF3A 1MQKL 3L5HA 1JF1A 3Q3GB 1T6WA 1VZIA 3ELAT 5C0AD 2H6OA 2YBRB 4JN2A 4BEIA 4ETQB 4G1MB 4H8HA 3ABMB 1OP3H 2VN4A 5KWYC 3WCYA 4YHIB 1CC3A 3ESUF 2Z8SA 3LN5A 3ELQA 3DIVA 1GGUA 2YGVA 3FUJA 2RJMA 3GM8A 43C9B 1M4KA 2P80A 4OLVH 2CUIA 3T0AA 3E2HC 4WGKA 5D4HA 5L4FA 3VD3A 3NIGF 3UTTD 4IBYA 1MRFL 1BYNA 3LY6A 4C56A 2ARWA 1CXFA 3FL7A 5M94B 3RGVB 1WDAA 1KTCA 4WTQA 4FMKA 1YECL 7PCYA 3QIBC 1K2DA 3QPKA 2J3SA 1EJOL 4BKLA 2YD7A 5IREA 4N9GB 2XTSA 2WD0A 2EDDA 4I0PD 3N42F 3LH9A 3D69B 3PAUA 2BNQD 4K4KA 5EUOA 1OP3K 1T4WA 4LHUA 3PWJA 3KPOA 4MCYB 2VJXA 3FBKA 3RI5F 1A22B 4PRIB 3KWTA 1NDTA 3IJSB 5C07D 3U36A 4ZX6A 4FQ1L 3BW9B 3DUSB 2IH1B 1XT5A 3FT2A 5GGSA 3ES6B 2G5BA 2VC2L 3LXAA 5I75B 2GHWB 3E3QC 3HI1A 4GAJH 3DDFA 2I69A 1FIGL 1GCYA 4ESKA 3PIQB 2PP9A 4J3OC 2HMIC 4FI8A 4WI7A 4MCMA 3CVHB 4MWFB 3LS5H 4BZYA 4LSTH 4MJJA 2LV4A 4K3GA 4KROC 4XBEL 5KAQF 3TA3D 1HSAB 2IDCA 1N59A 2OTWB 3CU7A 1J5HA 4YVNA 3QUMA 2WZ5A 5EC1B 3V4PB 4B96A 2Y6SC 2AK4E 5J13C 4NUQA 2VDQH 2ESVA 3T4AA 3PQYD 2CO3A 3EDKA 1E8XA 3ASOB 4JPWL 3EDEA 4ODSH 2DI9A 5IIEB 1BPVA 4GKZA 4JNXA 5DA4A 5D2LF 3P30L 1N8ZB 2XC8A 3P4NA 1FA4A 2VW7A 3BKCH 5J6HB 4NENB 3CSTA 3DTDA 1PJ9A 3PNWA 1U8OB 2OJ1A 3L5IA 1XR9B 4OFQA 2HYMA 4A2DA 4URTB 3GB7B 3NP4A 1TQTA 1Z9OA 1P0SE 2WYZA 3N91A 2LTQB 3OKDB 4GRLC 1IE4A 3QC6X 3BGFC 1I7TA 4J8RB 4M4PA 4A7GA 3SHSA 4B9IA 2BHFA 1N64L 2BS8A 4R83A 4KJWD 2JJTA 1JWUB 1OY3B 3CD4A 1IKFL 3LKSA 4ZOAA 4TSBH 3CZEA 3L3GB 4U1LA 1B4RA 2ZOWA 4QTHB 3GRWH 3VFVA 4JFXA 1BQHG 1MCJA 3N85H 4NKDA 4J2XA 3CSFA 2NOYA 1NCJA 4J27A 3HRZC 4WWKD 5FM5O 1OAXH 3S0PA 3MJ8B 5J9PB 2OMVB 3N1MC 4PTTA 2BHUA 3TO2A 1NGYB 3FT3A 1BG1A 5T33L 1T83C 1COBA 1U8PB 1FL3B 4QXWA 1VENA 1HHIA 1F11B 4F8PA 1YJDL 4FN0A 1XF2B 5INDA 1DANT 2KDGA 3HAEB 4NCC1 5E9DA 3GDBA 4WIQA 3PWPA 4U0QB 1NDGB 4F7MA 1L0XA 1RIUL 1BJ1J 5CR1A 3QQXA 1IC1A 3VRLF 1S5HB 1ZHBB 2M83A 4Y2NA 4YR6A 3C6LC 1LMIA 2P46B 3FTWA 1VPOL 2DH3A 3HEIB 3MMEB 3QIUB 2ADIB 2EVFA 4JY6B 4M7LL 2Z0UA 4OFIA 3SGEH 3AWGA 2HPTA 3QDGB 3ABZA 3SKJL 1DBJL 3HN3A 1SEQH 5TTRA 4PJHB 4WRLA 1PSKH 3QQ9C 3BVVA 1RVFL 5K9JL 5FO7B 2VLKA 3FN0H 4KGLA 4MB4A 2ITCB 3QQ4A 3T2LA 5JOEA 2DLEA 2VWEE 3EFOB 3NA9L 1M7DA 2Z31C 5SV4A 1CFQB 1TSHA 4Y19A 4WNQA 3Q8BA 4HOZA 3Q2LA 3LSOA 1FCCA 3SGJA 2PO6D 3DX7A 1IBBA 2XFGB 4HBCH 1IAIH 4HGWB 2VLLB 3EKCA 2N01B 1FNSH 4JHAL 4RMWA 3SKNB 3K5SA 4GW5A 3OKMA 1HU8A 1PW3A 2ZX8A 4PS7A 2EEDA 2DOCA 2A9MH 3ZRSA 5I1GH 3A6BL 1YNTA 4PV8A 2B77A 5T1JA 3L3DA 4OIIH 3VI4F 5T1DL 1CE6A 4NQCE 4ZW7A 3S34L 5JNYA 1ONQA 3J07A 1ASQA 1MRDL 2EIZB 4PHXA 2FBJL 4AJVA 2OJEB 5KYYA 3KH3A 1G43A 3DROA 3LXUX 4BFNA 4E41A 2NXYB 5A3ID 3ZIMA 4GQQA 3QIBA 1AKPA 4Z7UF 4ONHA 5BVPL 3MRJA 1UJ3C 3LXCA 3VD5A 2BOCA 4XOEA 3WHXA 4LESA 4JREB 4XPGL 4BZ1L 3QJFA 4UT9H 2NX5E 1EBPA 3O6ML 4XBGB 2WCPA 1VGEL 3KXFE 3QA3A 4HPYH 2XWBB 3X1EA 4FP8L 3KDPB 4S0HA 4ALAL 5AW0B 4QRBA 1QP1A 2NNRA 1MLCA 2WNWA 4KQ3H 1G7IA 5IW6A 3QCUL 3QORC 1QUNA 2F1BA 4M6NL 4R26H 5DF0A 3VX0A 2Q86A 3T0EB 3KM2A 4PJXA 3UAFA 1QRNB 1R0AH 4MMYB 5SWQA 4R4ND 1KGXA 3P77A 3QZPA 3RURA 3X17A 4I3RH 3KNBB 3L13A 2WUBL 3P2TA 4PB0L 3CDGA 3VACA 5IMMB 4XVTH 2B4CC 3N43F 4E9XA 3CHQA 3D39E 1DJHA 1QRKA 5DD0L 2NNCA 1GOFA 2F58L 3MUGB 3PHAA 1DUZB 4EEEA 2ZYHA 1DANU 5IJCC 2F7IA 1PGRB 3CTTA 3NJFA 3RLSA 4YXHH 4L4TE 1MCWW 4YPJA 1JPTH 2F8IA 5LGYA 1I9JH 3BD5A 2OQJA 3CQQA 3CZLA 4MJIA 3ZDYB 2EDNA 3ULVD 3QYMA 3MCG1 4LLUA 3KYOB 1O7DC 3QUXB 1M1XA 3VD2A 4TULH 1T3FB 1A14H 3IGLA 2R0LH 3CSYA 4N8VB 3KPRB 3MTRA 4KXCA 2A99A 1W6WA 3B9DA 4ADIA 3TIEB 3WKYA 4JFFA 4XNBA 1YMHA 4UZGA 4WCYH 3MNVB 1V8HA 3K46A 1KELL 3CE1A 4PVNA 2X4NB 3GLEA 1IVTA 4EN3D 1XCWA 4M6OL 1RULH 4PJ5E 5I1KL 2V2TB 2C3VA 4XWOC 1MFEL 1A6ZB 3UDWC 4EZJA 5JYLA 4OFKA 4Y1AB 4YHLL 4DP9X 2ZYIA 1JHKH 4ZJ9A 5I8CB 1DJGA 4B5EA 2KUTA 3QXDB 1BD2B 3L3JB 3T3PB 1ERNA 3S3SA 2BSSB 1I1FA 3INUL 4BCZA 4J3UA 4I77L 3O2DH 1VZHA 3DJSA 2VGLM 4P23D 1HEZA 4UQ2A 1NIAA 4WV1B 1ES0B 1W0WA 2VDML 1NKGA 3C6LA 5I1EH 3LKQA 2CWRA 3VXOB 1SGKA 4Z0BH 3V5DA 1FVDA 5LCVH 1CD9B 2CUHA 2H32H 3KJ4C 2NPLX 4KPHH 4L3EB 1QTYT 5KSBF 3NJLA 4MKTA 1HOCA 1U6AH 2WQ8A 4FOMA 3P0VH 3Q5OA 2AK1H 3NZSA 4LFHD 4ORGA 3TEUA 2CRMA 2R0ZL 2P8LB 2D3VA 3BESR 4X6BA 1XD0A 4BCXA 1UJTA 1UASA 2G2RB 3H3PL 5A16B 4LPCA 3WUWG 3IETB 4ZNEE 1H5BB 2HLEB 4EQ3A 1E8YA 4PS8A 3BVXA 2ZSWB 5LXVA 4APQD 5FOJA 1ZTMA 1SMAA 4JO1H 4DGVH 3P4OA 3QXAA 2B2XH 5ESQB 1C8PA 1HOEA 2A4CA 4RMVA 4LAQH 2WYTA 3EO9L 4EZLA 5DJXA 4A55A 1V7MH 1DUYA 3GJFH 5EA0H 4P07A 4ABQA 1GZPA 4PJBB 4C8XA 1H3PH 3CLWA 1U3HC 4KXAA 3KCPA 5E7FA 5C7ZA 5FM5M 1USZA 4OD1L 2HX8A 2H9GA 5EWIH 3RWEB 3SE9H 4NOBA 3IAGC 2MCPL 3FUMA 3H42H 5FFOA 4LGPB 1K3IA 1P1ZA 1QHOA 2DQUH 5FYKD 1AH1A 1ZS8B 1LDPL 4JRXD 2VABB 3P3SA 3MLSH 1PZ5A 4TLTA 5KS9E 3RTQC 2BHYA 3IK2A 1FRGH 2BCKA 1AGFA 1L9MA 2W07A 3KBHE 3U82B 4JS7A 4FTDA 2ICWB 2VH5H 4LLWB 4YFLF 3TO4B 2IBZX 4NDMB 4HMDA 3J7HA 4J4PC 1G1KA 4HFUH 4XN4A 3GJFK 2K78A 3BWUF 2QDWA 4YXLH 3F6JA 3S96B 1B4JL 5BVJB 2R29L 1FL5B 3WJMB 3K71B 2EO7A 2FGZA 2UVFA 5CNHA 5I1IH 2X4RA 2AEPL 3D8MA 1ZSDB 1TQCC 2I25N 4LBAA 1TVDA 1DDHB 3H9YA 3H1ZA 3PJLA 1DL7H 1CF8L 3IDYB 5EZLB 3IDJA 4OQTL 2OMBA 4AEHL 3IJ7A 2N59A 5C3LD 1U93A 1JPGB 5F3HB 3CDZB 3A67L 3IAPA 2VXQA 3ZKMD 3CN1A 4WUKH 3FPXA 5IBLC 2OMWB 4ZYKB 1S7VB 3HG4A 2PYFA 4OF5A 3VXSB 4GRWE 1U4FA 2WXFA 5T5NF 1QLRB 5JQHC 2L4OA 3P9MA 1EO7A 4RGNC 1YEKL 4HIEA 2GTQA 2FHFA 1E43A 1FVEB 1H8OA 1S2EA 2WOBA 3FQXA 5CGYD 2OMUA 3ULSA 2VNCA 1F97A 1SHWA 2YD3A 4PCKA 2OZ4L 2EZ0D 1ZY9A 3GBML 1FAKT 5L0QC 3X14A 3B5HA 4EI0A 3TBVA 1BF5A 2E7CA 3EOTL 4XN8A 2NCMA 3VH8G 4HJJH 2X89A 5I74B 4G5AA 4AY0A 2DMGA 3OBAA 2CGRH 4N90E 4CKQA 3L9EA 1X9UA 3ZHKA 1AQKL 1XGTA 4TS6A 1CDBA 4DN3L 3P2DA 2WXQA 4QUOA 5C0CA 3ARFC 3MV7E 2L7QA 2LFEA 1ROCA 3CVHH 4OLUH 4JFYA 4AV0A 4NKMB 1YQ2A 3AJ7A 5AW1B 5H94B 5FS5A 5DMIH 5E8NA 3OWRA 3V4PH 3T1FB 3WFBL 2D03H 1E6OL 4YHOH 4J3OD 2B1HH 3VXUD 3VGHA 4JO3L 4LCCB 4X50A 4H40A 3CPLA 2X1OA 2X44D 1WAAE 4ODUA 5BMFH 2JSFA 2NZ9C 3KPQB 4P04A 5JIPA 1QEXA 3HPLB 3QEQE 4XPHL 4JFQB 2DWTA 3RZWA 5FYJL 4H5SA 3AQZA 1A2YB 4JRYA 2Y6SD 3UL4A 1JZ7A 2XVBA 4PSRA 3DUHA 3U30B 5IEKB 4QXTB 1G7JA 1MFDL 4TOYH 1DBML 1CLCA 4G9FB 4ZTOH 4UWQB 5GSVA 1MVUA 1ZRUA 1EDQA 1W6LA 4AW7A 3KMDA 3QRGL 2G3NA 4WHCA 2OM5A 4N9OB 3RWFA 1JN6A 1TZ8A 1E9QB 5HI4C 4AC4A 2EDFA 2IAMD 1OGAE 3S5LB 1YNLH 2ROYA 3BEVB 3BYYA 4TQEH 1JZ2A 1GTNA 4X5WA 1I1AA 1NC4D 3MLRL 5B38B 5T3XL 4K8RL 2EICA 3GK8H 5IT2H 5ESVB 1AG6A 2EXYC 1ODAA 2K3HA 5BS0E 4GRLD 1XH0A 3NP3A 3ME0A 3ZTNH 2CLZB 3ARBC 3O45A 4E68A 3QJXA 2P5WD 3PV6A 5HI5D 2IWGA 4OF0A 2E9WA 2Y5TB 3B3BA 2J21A 2WLIA 4MAYB 2HLFC 4L3CB 5EFIA 3B2MA 2BP5M 5KBDA 3CZGA 2R1YA 2FEEI 1P7QD 2DM4A 4OGZA 1T7XA 4YBLB 5HSFA 2ALAA 4JJOA 2IFFH 2DQJH 4FQXA 3VFPA 3S36X 2JH2A 4XCYB 3VGBA 2ZCKH 1U3HA 4OV6F 3UMTA 3GMQB 3HAEH 1D6EB 1YMMB 1CK0L 1NC2D 2X0VA 1BWWA 1HINH 4X7CC 3HE7B 4DKAA 4TUKL 5ERWA 3DRTB 4NC2B 1EK3A 5DUPL 3NJMA 5I1LA 2R2CA 1XH2A 1PZBA 2K45A 4AKQA 5F6IB 2DWSA 1IBGL 1AIFA 1NGPH 4X6CA 4EUPG 2NNAB 3RTQA 4IRJC 1A6AA 4WO4B 4XNMA 1U0QA 2VMEA 2A1WH 2ZG1A 4WFFE 4TNWF 3IPBA 2VCOA 3VI3E 4Z7WF 5LXGL 2W59A 2E9BA 3OPZH