2Y2XA

Crystal structure of pseudomonas aeruginosa opdk with vanillate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
387
structure length
374
Chain Sequence
b'GFLEDAKTDLVLRNYYFNRDFLVDEWAQGFILKFSSGYTPGTVGVGLDAIGLFGVKLNSNSELLPLHDDGRAADNYGRVGVAAKLRVSASELKIGEMLPDIPLLRYDDGRLLPQTFRGFAVVSRELPGLALQAGRFDAVSLRNSADMQDLSAWSAPTQKSDGFNYAGAEYRFNRERTQLGLWHGQLEDVYRQSYANLLHKQRVGDWTLGANLGLFVDRDDGAARAGEIDSHTVYGLFSAGIGLHTFYLGLQKVGGDSGWQSVYGSSGRSMGNDMFNGNFTNADERSWQVRYDYDFVGLGWPGLIGMVRYGHGSNATTKAGSGGKEWERDVELGYTVQSGPLARLNVRLNHASNRRSFNSDFDQTRLVVSYPLSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VANILLATE PORIN OPDK
molecule tags Membrane protein
source organism Pseudomonas aeruginosa pa01
publication title Pseudomonas Aeruginosa Opdk with Vanillate
rcsb
total genus 101
structure length 374
sequence length 387
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2y2xA01
3SZVA 3T20A 3SYSA 2Y0LA 1H6S1 1E54A 4AUIA 4D65A 4RJXA 1HXXA 4D64A 1HXTA 1OPFA 1MPFA 1PHOA 3VY8X 1GFOA 4LSFA 3SY7A 2J4UP 3VY9X 4FSOA 2J1NA 4FRTA 3T24A 2ZLDA 4FMSA 3SYBA 6PRNA 4LSHA 3NSGA 2XG6A 3K19A 1GFNA 3SZDA 3PORA 4BUMX 2FGRA 4KR8A 3WI4A 4FOZA 5FVNA 2XE5A 2FGQX 2K4TA 5PRNA 4C69X 2OMFA 3JTYA 4GCSA 4FSPA 2Y2XA 2PRNA 1GFMA 2ODJA 4D5UA 3FYXA 2XE2A 5DL8A 1PRNA 5JDPA 1GFQA 3HWBA 5DL6A 2XE3A 3POQA 3POUA 3VZUX 3WI5A 4FT6A 3T0SA 1OSMA 2PORA 3UU2A 4KR4A 4GCQA 2Y0HA 3O0EA 4GCPA 3VZTX 3VZWX 3SY9A 3EMNX 7PRNA 4LSIA 3HW9A 4RJWA 1GFPA 2QTKA 4JFBA 2O4VA 8PRNA 1HXUA 4FRXA 2XE1A 1BH3A 1BT9A 5DL5A 3PRNA 2Y0KA 4LSEA 5DL7A 2ZFGA 4KRAA 3POXA 3UPGA 3A2SX
chains in the Genus database with same CATH superfamily
4AFKA 3SZVA 3PF1A 3T20A 2W81C 5G3AA 1MM4A 2Y0LA 1H6S1 4O49A 3SYSA 1E54A 4AUIA 2AXTO 2X27X 4D65A 5ADXK 2ERVA 4GHBA 4RJXA 1HXXA 4D64A 5T5FA 1HXTA 1OPFA 1MPFA 2KXPA 1PHOA 3A0BO 3VY8X 1S5LO 3TZGA 4G76A 2R4OA 5IYUA 3VE2A 4N58A 2R4PA 1GFOA 3AA6A 3DWNA 4B61A 3LK2A 3PQUA 4O3YA 3NJTA 3DA4A 4FZLA 3WU2O 2WJRA 4LSFA 2YPVA 3SY7A 3UAQA 1THQA 2J4UP 3AA7B 4N59A 3VY9X 4FSOA 2J1NA 1IZNB 2LHFA 2R88A 4FRTA 1T16A 5G26A 3T24A 2ZLDA 4AKRA 4E1TA 2M07A 1MM5A 2MNHA 3JCUO 4FMSA 4FUVA 3SYBA 4CTDA 6PRNA 2XTQA 4LSHA 3NSGA 2XMXA 2XG6A 4AKMA 3AA1A 3K19A 1GFNA 3C5OA 4PUXA 3SZDA 4O3WA 4AYID 4C00A 3PORA 3LK41 4BUMX 3KVDD 3PGSA 2FGRA 4KR8A 5E79O 2KC0A 4FOZA 3WI4A 5FVNA 2XE5A 4RL9A 2FGQX 2K4TA 4UB8O 5GTHO 4XNLA 1ZHTA 5PRNA 3RBHA 4C69X 1YS5A 2KDYA 2OMFA 3BRZA 3GP6A 3LK2B 4GCSA 2Y7SA 5EE2A 2GE4A 1QJ8A 4FSPA 3PGRA 2N2LA 4AYEC 4O4XA 2Y2XA 2PRNA 4O4UA 1GFMA 2KZ7B 2ODJA 2XTRA 3HOLA 1IZNA 2YNKA 5AFUK 2R4LA 5B5EO 4D5UA 1Q9GA 2IWWA 3AA0A 3FYXA 3AAAB 2XE2A 4N74A 2F1CX 5DL8A 1PRNA 3AAEB 4GF4A 3AA6B 3G7GA 4IL6O 4K3BA 5JDPA 1GFQA 4PR7A 1BXWA 4U9CA 5KAIO 5G38A 4F4BA 3LK42 1QJPA 3HWBA 3DWOX 5DL6A 2XE3A 1Q9FA 2K0LA 3PGUA 3POQA 4Z3TA 4QQ1A 3POUA 3VZUX 3WI5A 3AA7A 1ZHWA 5KAFO 2WVPA 2KZ7A 4FT6A 4C4VB 4E1SA 3T0SA 1OSMA 2PORA 4JCHA 2N2MA 2R89A 4C4VA 4RLCA 5ADXL 3UU2A 2F1TA 4K3CA 4AZLA 3QRAA 3DA3A 4UB6O 4AYMC 1P4TA 4O3ZA 2M06A 4KR4A 4GCQA 2X9KA 1QJ9A 2R4NA 2Y0HA 3O0EA 2MHLA 2WJQA 4FZMA 4XNKA 5GTIO 3VE1A 1G90A 1T1LA 4FZNA 3BRYA 3QRCA 1ZHXA 2KXPB 4FESA 4GCPA 4PJ0O 4O3XB 4FQEA 3VZTX 2JQYA 4AYNA 3HOEA 3VZWX 2IWVA 3SY9A 1ORMA 3EMNX 7PRNA 4LSIA 3AA0B 4N75A 3HW9A 4RJWA 5D5DA 1GFPA 4AYDC 5G39A 5TISO 3V8UA 1ZHZA 2QTKA 3KZIO 4JFBA 4KRAA 2O4VA 3AA1B 4RLBA 8PRNA 2R8AA 3LK3B 2W80C 2JMMA 1HXUA 3A0HO 5H2FO 3AAEA 4FRXA 4AKRB 2XE1A 1BH3A 1BT9A 5AFUL 3AAAA 5DL5A 3PRNA 2Y0KA 4LSEA 4G75A 5DL7A 5GV0A 1ZHYA 3BS0A 2F1VA 2LFUA 3PQSA 5B66O 2ZFGA 3JTYA 3POXA 3UPGA 3LK3A 3A2SX 3DZMA
chains in the Genus database with same CATH topology
4AFKA 3SZVA 3T20A 2W81C 1MM4A 2Y0LA 1H6S1 4O49A 3SYSA 1E54A 4AUIA 2X27X 4D65A 5ADXK 2ERVA 4GHBA 4RJXA 1HXXA 4D64A 5T5FA 1HXTA 1OPFA 1MPFA 2KXPA 1PHOA 3VY8X 3TZGA 4G76A 5IYUA 3VE2A 4N58A 3AA6A 1GFOA 4B61A 3LK2A 3PQUA 4O3YA 3DA4A 4FZLA 4LSFA 3SY7A 2YPVA 3UAQA 2J4UP 1THQA 3AA7B 4N59A 3VY9X 4FSOA 2J1NA 1IZNB 2LHFA 4AKRA 4FRTA 3T24A 5G26A 4E1TA 2ZLDA 2M07A 1MM5A 2MNHA 4FMSA 4FUVA 3SYBA 6PRNA 2XTQA 4LSHA 3NSGA 2XMXA 2XG6A 4AKMA 3AA1A 3K19A 1GFNA 3C5OA 4PUXA 3SZDA 4O3WA 4AYID 3PORA 3LK41 4BUMX 3KVDD 2FGRA 4KR8A 3WI4A 2KC0A 4FOZA 5FVNA 2XE5A 4RL9A 2FGQX 2K4TA 4XNLA 1ZHTA 5PRNA 3RBHA 4C69X 1YS5A 2KDYA 2OMFA 3LK2B 3GP6A 4GCSA 2Y7SA 5EE2A 2GE4A 1QJ8A 4FSPA 2N2LA 4AYEC 4O4XA 2Y2XA 2PRNA 4O4UA 1GFMA 2KZ7B 2ODJA 2XTRA 3HOLA 1IZNA 2YNKA 5AFUK 4D5UA 1Q9GA 3AA0A 3FYXA 3AAAB 2XE2A 5DL8A 1PRNA 3AAEB 4GF4A 3AA6B 3G7GA 5JDPA 1GFQA 1BXWA 4U9CA 4F4BA 3LK42 1QJPA 3HWBA 5DL6A 2XE3A 1Q9FA 2K0LA 3POQA 4Z3TA 4QQ1A 3POUA 3VZUX 3WI5A 3AA7A 1ZHWA 2KZ7A 4FT6A 4E1SA 3T0SA 1OSMA 2PORA 4JCHA 2N2MA 4RLCA 5ADXL 3UU2A 2F1TA 4AZLA 3QRAA 3DA3A 4AYMC 1P4TA 4O3ZA 2M06A 4KR4A 4GCQA 1QJ9A 2Y0HA 3O0EA 2MHLA 4FZMA 4XNKA 3VE1A 1G90A 4FZNA 3QRCA 1ZHXA 2KXPB 4FESA 4GCPA 4O3XB 3VZTX 4AYNA 3HOEA 3VZWX 3SY9A 1ORMA 3EMNX 7PRNA 4LSIA 3AA0B 3HW9A 4RJWA 5D5DA 1GFPA 4AYDC 3V8UA 1ZHZA 2QTKA 4JFBA 4KRAA 2O4VA 3AA1B 4RLBA 8PRNA 3LK3B 2W80C 2JMMA 1HXUA 3AAEA 4FRXA 4AKRB 2XE1A 1BH3A 1BT9A 5AFUL 3AAAA 5DL5A 3PRNA 2Y0KA 4LSEA 4G75A 5DL7A 5GV0A 1ZHYA 2F1VA 2LFUA 3PQSA 2ZFGA 3JTYA 3POXA 3UPGA 3LK3A 3A2SX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZV A;  3T20 A;  3SYS A;  2Y0L A;  1H6S 1;  1E54 A;  4AUI A;  4D65 A;  4RJX A;  1HXX A;  4D64 A;  1HXT A;  1OPF A;  1MPF A;  1PHO A;  3VY8 X;  1GFO A;  4LSF A;  3SY7 A;  2J4U P;  3VY9 X;  4FSO A;  2J1N A;  4FRT A;  3T24 A;  2ZLD A;  4FMS A;  3SYB A;  6PRN A;  4LSH A;  3NSG A;  2XG6 A;  3K19 A;  1GFN A;  3SZD A;  3POR A;  4BUM X;  2FGR A;  4KR8 A;  3WI4 A;  4FOZ A;  5FVN A;  2XE5 A;  2FGQ X;  2K4T A;  5PRN A;  4C69 X;  2OMF A;  3JTY A;  4GCS A;  4FSP A;  2Y2X A;  2PRN A;  1GFM A;  2ODJ A;  4D5U A;  3FYX A;  2XE2 A;  5DL8 A;  1PRN A;  5JDP A;  1GFQ A;  3HWB A;  5DL6 A;  2XE3 A;  3POQ A;  3POU A;  3VZU X;  3WI5 A;  4FT6 A;  3T0S A;  1OSM A;  2POR A;  3UU2 A;  4KR4 A;  4GCQ A;  2Y0H A;  3O0E A;  4GCP A;  3VZT X;  3VZW X;  3SY9 A;  3EMN X;  7PRN A;  4LSI A;  3HW9 A;  4RJW A;  1GFP A;  2QTK A;  4JFB A;  2O4V A;  8PRN A;  1HXU A;  4FRX A;  2XE1 A;  1BH3 A;  1BT9 A;  5DL5 A;  3PRN A;  2Y0K A;  4LSE A;  5DL7 A;  2ZFG A;  4KRA A;  3POX A;  3UPG A;  3A2S X; 
#chains in the Genus database with same CATH topology
 4AFK A;  3SZV A;  3PF1 A;  3T20 A;  2W81 C;  5G3A A;  1MM4 A;  2Y0L A;  1H6S 1;  4O49 A;  3SYS A;  1E54 A;  4AUI A;  2AXT O;  2X27 X;  4D65 A;  5ADX K;  2ERV A;  4GHB A;  4RJX A;  1HXX A;  4D64 A;  5T5F A;  1HXT A;  1OPF A;  1MPF A;  2KXP A;  1PHO A;  3A0B O;  3VY8 X;  1S5L O;  3TZG A;  4G76 A;  2R4O A;  5IYU A;  3VE2 A;  4N58 A;  2R4P A;  1GFO A;  3AA6 A;  3DWN A;  4B61 A;  3LK2 A;  3PQU A;  4O3Y A;  3NJT A;  3DA4 A;  4FZL A;  3WU2 O;  2WJR A;  4LSF A;  2YPV A;  3SY7 A;  3UAQ A;  1THQ A;  2J4U P;  3AA7 B;  4N59 A;  3VY9 X;  4FSO A;  2J1N A;  1IZN B;  2LHF A;  2R88 A;  4FRT A;  1T16 A;  5G26 A;  3T24 A;  2ZLD A;  4AKR A;  4E1T A;  2M07 A;  1MM5 A;  2MNH A;  3JCU O;  4FMS A;  4FUV A;  3SYB A;  4CTD A;  6PRN A;  2XTQ A;  4LSH A;  3NSG A;  2XMX A;  2XG6 A;  4AKM A;  3AA1 A;  3K19 A;  1GFN A;  3C5O A;  4PUX A;  3SZD A;  4O3W A;  4AYI D;  4C00 A;  3POR A;  3LK4 1;  4BUM X;  3KVD D;  3PGS A;  2FGR A;  4KR8 A;  5E79 O;  2KC0 A;  4FOZ A;  3WI4 A;  5FVN A;  2XE5 A;  4RL9 A;  2FGQ X;  2K4T A;  4UB8 O;  5GTH O;  4XNL A;  1ZHT A;  5PRN A;  3RBH A;  4C69 X;  1YS5 A;  2KDY A;  2OMF A;  3BRZ A;  3GP6 A;  3LK2 B;  4GCS A;  2Y7S A;  5EE2 A;  2GE4 A;  1QJ8 A;  4FSP A;  3PGR A;  2N2L A;  4AYE C;  4O4X A;  2Y2X A;  2PRN A;  4O4U A;  1GFM A;  2KZ7 B;  2ODJ A;  2XTR A;  3HOL A;  1IZN A;  2YNK A;  5AFU K;  2R4L A;  5B5E O;  4D5U A;  1Q9G A;  2IWW A;  3AA0 A;  3FYX A;  3AAA B;  2XE2 A;  4N74 A;  2F1C X;  5DL8 A;  1PRN A;  3AAE B;  4GF4 A;  3AA6 B;  3G7G A;  4IL6 O;  4K3B A;  5JDP A;  1GFQ A;  4PR7 A;  1BXW A;  4U9C A;  5KAI O;  5G38 A;  4F4B A;  3LK4 2;  1QJP A;  3HWB A;  3DWO X;  5DL6 A;  2XE3 A;  1Q9F A;  2K0L A;  3PGU A;  3POQ A;  4Z3T A;  4QQ1 A;  3POU A;  3VZU X;  3WI5 A;  3AA7 A;  1ZHW A;  5KAF O;  2WVP A;  2KZ7 A;  4FT6 A;  4C4V B;  4E1S A;  3T0S A;  1OSM A;  2POR A;  4JCH A;  2N2M A;  2R89 A;  4C4V A;  4RLC A;  5ADX L;  3UU2 A;  2F1T A;  4K3C A;  4AZL A;  3QRA A;  3DA3 A;  4UB6 O;  4AYM C;  1P4T A;  4O3Z A;  2M06 A;  4KR4 A;  4GCQ A;  2X9K A;  1QJ9 A;  2R4N A;  2Y0H A;  3O0E A;  2MHL A;  2WJQ A;  4FZM A;  4XNK A;  5GTI O;  3VE1 A;  1G90 A;  1T1L A;  4FZN A;  3BRY A;  3QRC A;  1ZHX A;  2KXP B;  4FES A;  4GCP A;  4PJ0 O;  4O3X B;  4FQE A;  3VZT X;  2JQY A;  4AYN A;  3HOE A;  3VZW X;  2IWV A;  3SY9 A;  1ORM A;  3EMN X;  7PRN A;  4LSI A;  3AA0 B;  4N75 A;  3HW9 A;  4RJW A;  5D5D A;  1GFP A;  4AYD C;  5G39 A;  5TIS O;  3V8U A;  1ZHZ A;  2QTK A;  3KZI O;  4JFB A;  4KRA A;  2O4V A;  3AA1 B;  4RLB A;  8PRN A;  2R8A A;  3LK3 B;  2W80 C;  2JMM A;  1HXU A;  3A0H O;  5H2F O;  3AAE A;  4FRX A;  4AKR B;  2XE1 A;  1BH3 A;  1BT9 A;  5AFU L;  3AAA A;  5DL5 A;  3PRN A;  2Y0K A;  4LSE A;  4G75 A;  5DL7 A;  5GV0 A;  1ZHY A;  3BS0 A;  2F1V A;  2LFU A;  3PQS A;  5B66 O;  2ZFG A;  3JTY A;  3POX A;  3UPG A;  3LK3 A;  3A2S X;  3DZM A; 
#chains in the Genus database with same CATH homology
 4AFK A;  3SZV A;  3T20 A;  2W81 C;  1MM4 A;  2Y0L A;  1H6S 1;  4O49 A;  3SYS A;  1E54 A;  4AUI A;  2X27 X;  4D65 A;  5ADX K;  2ERV A;  4GHB A;  4RJX A;  1HXX A;  4D64 A;  5T5F A;  1HXT A;  1OPF A;  1MPF A;  2KXP A;  1PHO A;  3VY8 X;  3TZG A;  4G76 A;  5IYU A;  3VE2 A;  4N58 A;  3AA6 A;  1GFO A;  4B61 A;  3LK2 A;  3PQU A;  4O3Y A;  3DA4 A;  4FZL A;  4LSF A;  3SY7 A;  2YPV A;  3UAQ A;  2J4U P;  1THQ A;  3AA7 B;  4N59 A;  3VY9 X;  4FSO A;  2J1N A;  1IZN B;  2LHF A;  4AKR A;  4FRT A;  3T24 A;  5G26 A;  4E1T A;  2ZLD A;  2M07 A;  1MM5 A;  2MNH A;  4FMS A;  4FUV A;  3SYB A;  6PRN A;  2XTQ A;  4LSH A;  3NSG A;  2XMX A;  2XG6 A;  4AKM A;  3AA1 A;  3K19 A;  1GFN A;  3C5O A;  4PUX A;  3SZD A;  4O3W A;  4AYI D;  3POR A;  3LK4 1;  4BUM X;  3KVD D;  2FGR A;  4KR8 A;  3WI4 A;  2KC0 A;  4FOZ A;  5FVN A;  2XE5 A;  4RL9 A;  2FGQ X;  2K4T A;  4XNL A;  1ZHT A;  5PRN A;  3RBH A;  4C69 X;  1YS5 A;  2KDY A;  2OMF A;  3LK2 B;  3GP6 A;  4GCS A;  2Y7S A;  5EE2 A;  2GE4 A;  1QJ8 A;  4FSP A;  2N2L A;  4AYE C;  4O4X A;  2Y2X A;  2PRN A;  4O4U A;  1GFM A;  2KZ7 B;  2ODJ A;  2XTR A;  3HOL A;  1IZN A;  2YNK A;  5AFU K;  4D5U A;  1Q9G A;  3AA0 A;  3FYX A;  3AAA B;  2XE2 A;  5DL8 A;  1PRN A;  3AAE B;  4GF4 A;  3AA6 B;  3G7G A;  5JDP A;  1GFQ A;  1BXW A;  4U9C A;  4F4B A;  3LK4 2;  1QJP A;  3HWB A;  5DL6 A;  2XE3 A;  1Q9F A;  2K0L A;  3POQ A;  4Z3T A;  4QQ1 A;  3POU A;  3VZU X;  3WI5 A;  3AA7 A;  1ZHW A;  2KZ7 A;  4FT6 A;  4E1S A;  3T0S A;  1OSM A;  2POR A;  4JCH A;  2N2M A;  4RLC A;  5ADX L;  3UU2 A;  2F1T A;  4AZL A;  3QRA A;  3DA3 A;  4AYM C;  1P4T A;  4O3Z A;  2M06 A;  4KR4 A;  4GCQ A;  1QJ9 A;  2Y0H A;  3O0E A;  2MHL A;  4FZM A;  4XNK A;  3VE1 A;  1G90 A;  4FZN A;  3QRC A;  1ZHX A;  2KXP B;  4FES A;  4GCP A;  4O3X B;  3VZT X;  4AYN A;  3HOE A;  3VZW X;  3SY9 A;  1ORM A;  3EMN X;  7PRN A;  4LSI A;  3AA0 B;  3HW9 A;  4RJW A;  5D5D A;  1GFP A;  4AYD C;  3V8U A;  1ZHZ A;  2QTK A;  4JFB A;  4KRA A;  2O4V A;  3AA1 B;  4RLB A;  8PRN A;  3LK3 B;  2W80 C;  2JMM A;  1HXU A;  3AAE A;  4FRX A;  4AKR B;  2XE1 A;  1BH3 A;  1BT9 A;  5AFU L;  3AAA A;  5DL5 A;  3PRN A;  2Y0K A;  4LSE A;  4G75 A;  5DL7 A;  5GV0 A;  1ZHY A;  2F1V A;  2LFU A;  3PQS A;  2ZFG A;  3JTY A;  3POX A;  3UPG A;  3LK3 A;  3A2S X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...