2Y2ZA

Ligand-free form of tetr-like repressor simr
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
238
structure length
238
Chain Sequence
VSIWMHPEPAGRRSARSHRTLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE REPRESSOR SIMREG2
publication title Structures of the Tetr-Like Simocyclinone Efflux Pump Repressor, Simr, and the Mechanism of Ligand-Mediated Derepression.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Transcription
total genus 87
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y2zA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2y2zA02
3FKIJ 3HDDA 1TC3C 4C3IJ 4A3CJ 5HODA 3CCYA 1LE8B 5IOYA 2CQQA 3FISA 2L7FP 2HOTA 1GUUA 1UI5A 3BRUA 3CMYA 3NNRA 2G7SA 2WUIA 3M4OJ 4BKXA 1NK2P 4NN1A 1I3QJ 1TWHJ 3PO3J 3UKGA 2DA2A 3S2HJ 3JRFA 5H9TA 2W48A 1DU0A 2R93J 2UXHA 2PZ9A 1IV6A 3HM5A 3H3VK 3V6GA 2G7GA 3ZQHA 4JYKA 3S5RA 5J3LA 5EZGA 1Z77A 2WAQN 1O4XA 2XB0X 1NK3P 1UMQA 2DA7A 5J1UA 1LFUP 4ABZA 3ANGA 3QPLA 2DN0A 4JNNA 5CXIA 2KDZA 2DG8A 3HTAA 1ETWA 2QIBA 1Y1VJ 5J1YA 3BG9A 4ME9A 3COLA 2LP0A 3CDLA 4FE7A 1A6IA 1ENHA 1MH4A 1TWFJ 4XIDA 3I4NJ 1OFCX 4HKUA 1X2MA 1OCTC 3HOZJ 3BQYA 3MNLA 1NTCA 3HE0A 2L0KA 3IH3A 1I6HJ 2VKEA 5FKNA 3HTIA 2R5YA 1YRNA 4NDLA 5EYRA 1JTYA 4BY1J 2HOSA 3JRHA 2LR8A 3WHCA 4M3BA 2VKVA 3VVYA 3VOXA 2IEKA 1FTTA 4JX4A 3HKZN 5EDNA 3QPSA 2M2EA 4A3LJ 3OSGA 4C3HJ 2UXUA 2H8RA 2Y2ZA 1I50J 2R5YB 1RR7A 2LD5A 1YRNB 4A3DJ 4BBSJ 1ZR4A 5E3LA 4D5CA 1BA5A 5IP7J 4DZPA 3LNQA 3IH2A 3HGGA 4A3MJ 4IHXA 3LHQA 4QIWN 2K9NA 1ZGWA 5F1JA 3IV5A 1QVUA 1Z0XA 3PPBA 3RH2A 5FKMA 1VFCA 2NVXJ 1X2NA 3JRAA 2R92J 1WGXA 4XRMA 2QOPA 5AQCA 3VW2A 3LOCA 1APLC 2EZHA 1D5YA 1UI6A 3BR2A 1HLVA 1IDZA 1FIAA 3BTIA 4MK6A 3VUQA 3K7AJ 1JKRC 2PBXA 3KZ9A 1S7EA 2EH3A 2E1OA 3MN2A 1UG2A 2DA1A 3B6AA 3DPJA 2YVEA 3RD3A 4UUSB 3C2BA 4YZEA 4B4CA 2OI8A 3BR0A 3F0CA 2GUHA 4Y7NJ 4GFBA 3NARA 3FRQA 5M3MJ 1IRZA 2UXPA 2HXIA 3DEWA 2CJJA 5EGOB 2WB1N 5FKOA 4QTRA 2ECBA 2ME0A 2NVYJ 1MH3A 5EEAA 2MGQA 2ZCXA 3RZDJ 3BR3A 3E7QA 3G1OA 2LKXA 2LLKA 2HQ5A 2M9HA 4BY7J 3T6NA 1Q1VA 3ON2A 1LE8A 1ITYA 4XICA 3BTJA 2PMZN 3IH4A 2ZOYA 2MG4A 2CQXA 4D5FA 4BBRJ 2Y9YA 1W0TA 3HOYJ 2LK2A 5GPCA 1U9OA 4J19A 1IDYA 2GM4A 2G3BA 3JRGA 1IJWC 3S2DJ 1MBJA 5F0HA 2XPUA 2FD5A 2EBIA 3F1BA 4G12A 2K9QA 2X9DA 4JL3A 3NAUA 4GFKA 1MSEC 2DMPA 2MSYA 3O8HA 2ID6A 1LFBA 4DYCA 3BQZA 1ETQA 4JX5A 4A3KJ 1JKPC 1F36A 2IU5A 1JT6A 1OCPA 2DA4A 3LSRA 3TW7A 4DW6A 3JRDA 1AHDP 2DG7A 4X1EA 5C3EJ 4MFDA 2EZIA 2YS9A 4S0HB 4MIMA 3Q0VA 1POGA 2B63J 4MXMA 2AHQA 3HOVJ 2N8GA 2RHAA 1SGMA 4DYQA 3S1MJ 4GCLA 4RBOA 2HYTA 4AC6A 1RKTA 2JMWA 2R5ZA 2XSDC 2YVHA 1BJZA 3LSPA 2NVTJ 3A02A 2TCTA 5DTDA 1ETOA 1DU6A 3BR6A 2M8GX 3ON4A 2L7MP 3S1QJ 5F0FA 1ETYA 2O7OA 4X6AJ 1RETA 2NS8A 2YUSA 1OJLA 2LVSA 4JX6A 2LY9A 4LOCA 2R5ZB 1T56A 4KWAA 3HGYA 1TWCJ 1ETVA 2ID3A 3RZOJ 3AQTA 2E2IJ 2EQRA 2XRLA 3GZIA 1ETKA 5FKKA 2OF7A 2QKOA 3IUVA 1WH5A 1BL0A 3JREA 4V2GA 5D19A 2K9SA 2IBDA 3JR9A 1IUFA 3WHBA 2E2JJ 3A01B 2NOGA 4I6ZA 2O8KA 3C07A 5M5XJ 3CRJA 3O60A 1JUSA 2QCOA 3O8GA 3ZQGA 5IYCJ 2O9LA 1FTZA 4GFLA 2DA3A 5FLMJ 2LTPA 3Q0UA 4A3FJ 2E2HJ 2HKUA 5DAJA 2XPWA 1ETXA 4ICHA 3GEUA 4QSHA 2FJ1A 3E7LA 2L7ZA 3JRCA 1SANA 4JKZA 3OIOA 1W0UA 5F08A 4AC0A 2Y31A 1Y1WJ 2X48A 2XGCA 1UHSA 1JGGA 2ZB9A 2TRTA 2CUEA 3FIWA 5M5WJ 2CRGA 4ACIA 4MO7A 2XGDA 4UUSA 5M5YJ 3L1PA 1IG7A 5FMPA 1ZK8A 3S16J 2RAEA 3GTQJ 3HB9A 1B72B 3VW1A 2JA5J 1HCRA 4XK4A 2XB5A 4D7MA 1JTXA 5E3MA 4W1UA 2I10A 5GP9A 5EGOA 1H89C 2O7TA 4UUTA 5E3NA 2K40A 3GTKJ 3PASA 2M0CA 3D1NI 5HBUA 5EG0A 2E19A 5K7FA 5FGLA 1MBGA 4GCKA 3ANPA 2Y0SN 3JSJA 2DA6A 3FK7A 5C44J 4FTHA 4A3GJ 3GBGA 4AF5A 3GTPJ 4FCYA 3HIMA 3BR1A 5CXGA 2NP3A 2KT0A 2QF7A 3EGQA 1PUFA 3BTCA 2D5VA 2HI3A 1GV2A 2XPVA 5EG0B 1A5JA 5IOZA 1JUMA 2P81A 3QQAA 1U8BA 1K61A 3GTLJ 4BXXJ 3VVZA 1ZTRA 2V57A 3Q0WA 2FX0A 4XRSA 1WPKA 4IHVA 4Y52J 1ORKA 5IPAA 3TW6A 1MNMC 2NX4A 3VPRA 5EZHA 1PUFB 1H8AC 3VIBA 3DCFA 2MW8A 3LSGA 1XS9A 2YU9J 3ZQFA 4C2MJ 2UXOA 3LWJA 3CWRA 1XG1A 3GTMJ 3B81A 2QWTA 3P9TA 2EZLA 2ZCNA 2JJ7A 2NP5A 3FK6A 4FE4A 3VP5A 3BHQA 2GENA 1IC8A 3AQSA 3QBMA 5FKLA 3TP3A 5C4XJ 5GPAA 1G2HA 3RKQA 3S1NJ 3G1MA 4FISA 3BG5A 2Q24A 2GLOA 5J1RA 3VVXA 3S15J 3VOKA 3SFIA 4UDSA 3OSFA 1WCMJ 1JKOC 3SDGA 3NI7A 2ELKA 1RPWA 2CUFA 3G1LA 9ANTA 3ZQCA 1EF4A 1MBFA 4DYRA 2L9RA 4I76A 3A01A 2DMUA 3GTOJ 1HDPA 4JP0A 2F07A 4V2FA 1ZKGA 3OOUA 1FJLA 2DMQA 5K58A 2DA5A 4M6VA 3BT9A 5BNGA 1GDTA 2ME6A 4B1RA 4A3EJ 1RKWA 5HAWA 4HNVA 2Y9ZA 2D6YA 3HOUJ 2WGBA 2HXOA 4M3EA 1WH7A 2JWTA 1E3OC 2R7ZJ 2REKA 5D18A 2DJNA 5JLXA 3HOXJ 1F43A 3BNIA 4L62A 3GTJJ 2M34A 1GT0C 4GCTA 4MFEA 5K7ZA 5D1RA 3BTLA 4A3BJ 2EZKA 3MKLA 3EUPA 4A93J 1QRYA 2LFBA 2JN6A 4A69C 5JLWA 1MBKA 3S17J 2HDDA 1P7IA 2CU7A 3HOWJ 1FIPA 1RESA 4CGRA 5HSZA 3JRIA 3TP0A 4AUXA 2ZOZA 2ZCMA 1ZR2A 5EF6A 5K7HA 1HF0A 3V78A 1B72A 3NXCA 2COBA 2JA7J 1QPIA 1BW6A 2H1KA 2W53A 1R9TJ 3W6VA 2Y30A 1CQTA 1P7JA 2HOAA 2FBQA 4M3DA 3BR5A 3GTGJ 2XDNA 1B8IA 3TEDA 4XRSG 1MBHA 3LJLA 2GBYA 3NPIA 3QKXA 1JJ8C 3A03A 2JA8J 2X6OA 3MVPA 2HYJA 3H0GJ 1VF9A 1U78A 2G7LA 1K83J 4NELA 4D7NA 3S1RJ 4MLOA 2NVQJ 1JKQC 2VPRA 1HOMA 2GFNA 3HTJA 3B6CA 1B8IB 1T33A 3KKCA 3BG3A 1GV5A 3G56A 3BCGA 1AKHA 3S14J 1FEXA 2JA6J 5C4JJ 4RDUA 2DMTA 5C4YA 5IYBJ 4M3FA 3I4MJ 1QVTA 3HTHA 4CYCA 4A3IJ 4EEFG 1XC5A 2NS7A 4IEJA 3ZOBA 1JJ6C 1JUPA 3Q3SA 1H88C 1HDDC 1SFOJ 1U9NA 2R0QC 3HBLA 2DMNA 3KKDA 2UXIA 2WV1A 5F04A 1AKHB 3RQIA 1MBEA 3PO2J 2QTQA 1GVDA 1VNDA 1IGNA 3LSJA 3CJDA 1AU7A 1MSFC 3CQZJ 4CYCB 1VI0A 5FLVA 1X58A 3VW0A 4M3GA 4L5EA 5DS9A 5M3FJ 4AYBN 4IHWA 3M3YJ 4IHYA 5FHPA 3KNWA 3NRGA 1TWGJ 5CW8A 2AO9A 4PXIA 1TWAJ 4C3JJ 3ZQLA 4A3JJ 3PM1A 3SJMA 2JK3A 4W97A 2RASA 5F0CA 1WI3A 2VI6A 1ZQ3P 5EFYA 1JT0A 2OPTA 4B3AA 2XGEA 3HEFA 5IP6A 3K2AA 3G7RA 2IAIA 2VUMJ 3JRBA 2FQ4A 2OERA 4DZJA 5E3OA 3ZQIA 2DTZA 5IP9J 1BW5A 2G0EA 5F27A 5FJ8J 5IYDJ 2ECCA 3BJBA
chains in the Genus database with same CATH superfamily
2L54A 5ICCA 1TC3C 4C3IJ 1STZA 1MKMA 2R7DA 4BAYA 1E0EA 4EQQA 1HW2A 3IKTA 2M0MA 5D4SA 3FMSA 1B4AA 3C18A 4KN7X 5IOYA 2J5OA 5LBQA 1NG7A 3EDPA 4LJZF 4YG2F 3GLLA 1GUUA 1YO5C 1WJAA 5GAGJ 2QEXI 1IV8A 3UKGA 2DA2A 1EH8A 2HKXA 3M9AA 2W48A 2CSOA 3VTIA 1S9HA 3DXJF 2UXHA 2EIJH 3C2HA 2IS4A 1S7OA 4JYKA 1YS7A 4PJLA 3S5RA 5EZGA 2K3FA 2NS0A 2QLZA 1IO2A 4F7ZA 2VPLA 1U5TC 2XB0X 1NK3P 1MJBA 2DA7A 1LFUP 1B9MA 1HA8A 1I5ZA 4EM2A 3QPLA 5TISC 1PJRA 2KDZA 4CHUA 2W24A 4HV6A 5JVTA 1DDNA 2QIBA 3OYDA 1R5GA 3COLA 3CDLA 1RC9A 4UVBA 1MH4A 1KU2A 1MGTA 3I4NJ 3EUHA 3ZMDA 4A6EA 4HKUA 1FP1D 4DBRA 1NTCA 4ESBA 1I6XA 1JGSA 1MMGA 2IRFG 1I6HJ 3L00A 3BG6A 4G6DA 2JRMA 3E3VA 5FKNA 4HNTA 2XF6A 2EIKH 1BIAA 3JRHA 1S3JA 2OZ6A 1D8KA 3R0AA 4BQOA 1X3WB 4U7DA 2YSRA 2XAUA 3VOXA 2M4KA 4JX4A 3HKZN 1BOAA 2PJRA 1ZREA 2UXUA 2QGUA 1A6QA 2H8RA 2Y2ZA 4WX9A 4TV7A 4BE1A 1PVEA 1D1AA 2CO5A 4ETSA 2LD5A 4A3DJ 4UV8A 1VTNC 3FHNA 2VB6A 3TO7A 1FSEA 4IHSA 3HGGA 4YELA 2EFNA 3Q5FA 4IHXA 1EJ9A 3IRRA 5HLHA 2L9NA 4QIWN 1GXPA 4E7KA 1H9TA 2Y69H 1Z0XA 4A12A 2HZDA 3VYUB 1XCBA 1VFCA 4G7OF 3KETA 3H3ZA 2RN7A 3O3KA 2Y0MA 4IL6C 4BQAA 4XRMA 2QOPA 3CP8A 3AG2H 5DD8A 3VW2A 2DLLA 4O6JA 1APLC 5JHFA 4IOAF 3LA2A 3FXMA 4IRGA 5FFXA 3A2KA 1KA8A 2CW7A 1W4MA 4FQGA 1HLVA 2VIXA 1FIAA 3BTIA 4MK6A 5DV5A 2FXAA 2WAFA 3F3XA 3B6AA 3ZQQA 3BY6A 3DBHB 3RD3A 2BY2A 4YZEA 2OI8A 1PP8F 1RUNA 3F0CA 2GUHA 2NXNB 2VOPA 1XD7A 3NARA 4EV0A 5M3MJ 4OU0A 1ON2A 3HRTA 1FMVA 1Y56A 1T6SA 4BXFA 4CZCA 4QTRA 2R7WA 3HYIA 2KMUA 1BIBA 2Z2SB 4BNCA 4BUPA 2LY2A 4CGZA 1K6OA 3BR3A 3TL4X 2R7UA 3FM5A 3G1OA 3GEZA 4C2UA 2LDUA 4BY7J 2B0LA 2GOMA 3HC7A 2PMZN 2CQXA 1FBUA 2Y9YA 2MLGA 4U0WA 2GM4A 4XSXF 3CUOA 5F6FA 3RIRA 3S2DJ 1DP7P 3RCOA 2XPUA 3HRMA 3WU0A 4C9YA 5L3GA 1IC8A 3F1BA 4GFKA 1V54H 2DMPA 1LFBA 1S29A 3BQZA 2LREA 5B1BH 3W6JB 3I0TA 2IU5A 1JT6A 2R7RA 2DG7A 4M74A 4DW6A 3K9TA 4QLCU 4X1EA 5HLIA 3LSMA 3K70D 1POGA 2B63J 1X3ZB 2RHAA 1SGMA 2BXZA 4PZJA 2XUBA 5FRMA 2QVOA 4XLNF 5HS8A 5FB2A 2YVHA 1BJZA 3ERED 1Q1HA 1PUEE 2OA4A 2CV1A 3ON4A 2L7MP 1A36A 2QKMB 2Q8KA 2VE9A 1VZ0A 5IT9K 3HSFA 4N9HA 2EV6A 4ZTJA 3WE3A 1YI2I 4X6AJ 3RQ4A 5K5OA 3WE2A 4OIOF 3ERMA 2DT7B 2FOWA 1T56A 2GXBA 3OOPA 1J59A 4CZZA 3RZOJ 2EQRA 2C6YA 4EM1A 1I3AA 3GZIA 3C3WA 3HPHA 4P55A 3ZPLA 3IUVA 3CJTB 3JREA 1USSA 3BZ6A 1QA6A 3E6CC 3BZCA 1ZRCA 4I6ZA 3CRJA 2PMHA 2O8KA 5M5XJ 4F55A 4IXAA 4Y3OA 2O9LA 3SWHA 3PUFA 3L2VA 5FLMJ 3PSFA 4A3FJ 1IN5A 2HKUA 5E8IA 1TP4A 2V7FA 4BDYA 1ETXA 2W25A 1SD7A 3X2QH 1L0OC 1MJAA 2G7UA 4QSHA 1IAWA 2FJ1A 3GEUA 1TZLA 3H3UA 4RAGA 3BLYA 3VDXA 4GGGA 4JKZA 3K4LA 3HUGA 3OIOA 1BN5A 4H0EA 3TOAA 5E8GA 1Z7LA 2FRHA 2HPIA 5A2QZ 2JRTA 2DAOA 4LK1F 2RC4A 3WGGA 4XKCA 2XGCA 3KEOA 1T0FA 2W1OA 2ZB9A 1XB4A 4IO9F 2TRTA 2CUEA 1H9GA 2XHKA 4OIPF 4EGZA 2IS1A 4LLGF 5M5YJ 2F2EA 2XAQA 3S16J 1B72B 1T2KA 2VONA 1IN6A 2JVHA 4D7MA 5LD2C 3M8EA 2IA0A 2GXGA 1H89C 2OU2A 2V6EA 2K40A 3GTKJ 1S72I 2KDOA 5EG0A 3P9IA 3PQJA 3ANPA 4WXDA 3OYJA 1OMIA 3IWZA 5FGMA 1H0MA 2O0YA 2DA6A 3FK7A 1SFEA 3FWEA 4B8XA 2XAHA 4P96A 4M9ZA 3BR1A 4WF2A 1FMWA 5H6RA 5B1AH 3H5NA 2PEXA 2QF7A 3GUDA 3EGQA 2TDXA 3JTHA 4PJMA 5EG0B 1FP2A 1ZAOA 2V79A 2V6CA 4GCVA 3M1CA 1NHAA 5HNFA 4BXXJ 4XKVA 4XOTA 3WG9A 1F5TA 3Q0WA 2EWNA 3F8FA 2RQQA 3EUHC 2F6CA 3PJRA 3IP4B 1D1BA 1VQ9I 3TW6A 1MNMC 1V5EA 2MW8A 4P9UA 2CQNA 5B66C 2OUMA 4DOZA 3NRVA 4BEHB 1Z91A 1P4AA 4HAMA 5CVUA 3B81A 2QWTA 3P9TA 2ZCNA 1R1TA 3U1DA 1IZ1A 2NP5A 2EV0A 2GENA 3TP3A 5C4XJ 5JVGF 1D5VA 3C7JA 3BG5A 2P8TA 4KT5C 1D0YA 1TQIA 2ZXHA 2GLOA 4S04A 2HWVA 5J1RA 4LG0A 2W4SA 1WCMJ 4HLYA 1ZARA 3SDGA 3O6BB 3L2QA 5GADJ 1TBXA 2OZUA 3HJEA 4HF0A 4XOPA 1WHUA 4P9FA 1MBFA 2ESNA 2JSPA 3W3CA 3A01A 2P7CB 4KN4X 2F07A 2M30A 2FOKA 2QZ8A 1FLIA 3OOUA 4LG0B 1DGRM 1XTAA 4M9XA 1OYIA 3HOTA 3CCMI 3W2WA 3HOUJ 1WH7A 1E3OC 1V5GA 4FHTA 4L62A 2XIGA 3DKXA 5JLXA 1G59A 1Y39A 2EB7A 3KEYA 1MW7A 5DEQA 1HKQA 1YW8A 2L4MA 3L7WA 5K7ZA 3BTLA 1OQYA 4IVNA 2DW4A 4ZYDA 4A3BJ 2XV4S 3K4JA 3RPQA 3HOSA 2M87A 5JLWA 1MBKA 2CMPA 3A4CA 4KIFA 3I56I 2CU7A 2CW8A 3QP6A 4WCGA 2WWYA 2WAEA 1OCCH 2ZCMA 4ZTFA 2BW3B 4DVYP 2P7VB 3V78A 6PAXA 3DTKA 3R0JA 1OR7A 2JA7J 4FT8A 3GXOA 2VT3A 1YX3A 1BW6A 2VBZA 3V42A 2IW5A 4XNFA 1R9TJ 2GIZA 2ZFWA 4RGRA 4KIBA 1IUYA 2QSHX 3MKZA 2IVMA 2XDNA 3R4KA 4KICA 2R7TA 1BI1A 3I54A 3FMRA 1WVRA 2P6TA 2FBKA 4V19K 2X6OA 3MVPA 2HYJA 4OAYA 2O5RA 4OOIA 2VXDA 3H0GJ 5D6EA 2G7LA 3PNVA 4F92B 4D7NA 4KDPA 1SD6A 1I1SA 1DP3A 3GFJA 4AYBA 1U5TA 3B6CA 3WTWC 1NG6A 4B3XA 3KKCA 1T95A 1QBJA 1GV5A 2LKPA 3U9GA 3D5LA 2E71A 1T98A 2P6SA 3ECHA 4E70A 1IW7F 2A6HF 2QKLB 4Y13A 1O3SA 2BZTA 4M3FA 3OIQA 3LA7A 4LIVA 3KP6A 4IEJA 4OAZA 3K1NA 1H88C 1U5TB 3BG7A 4RS8A 2R0QC 2DMNA 2UXIA 4RB2C 2D45A 3TGNA 4PFPA 4LB5A 2Y75A 1VNDA 2PFVA 3QPHA 3LSJA 4AIKA 2GAUA 5DM6F 1VI0A 2KPMA 3P9KA 5LGTA 1X58A 4QWQA 2QQ9A 4M3GA 5M3FJ 5ICEA 1QNTA 2KZVA 4NHJA 3M3YJ 3NRGA 1D0XA 2A07F 1TWGJ 2AO9A 2UXXA 3T8TA 3VYRB 1XGOA 3ZQLA 2RASA 2HOEA 3H9JA 3CDHA 1IRXA 5F0CA 2VI6A 4ZJZA 3MD2A 4AU7A 5IP6A 2VUMJ 1IF1A 2FQ4A 4DZJA 2Y48A 2E35A 3Q9SA 3WGHA 3ZQIA 4ICHA 2X1EA 2RKHA 5IP9J 4HG2A 2ECCA 4BHCA 4QPQA 5FO5A 2V4JC 4A5NA 3HDDA 4A3CJ 3VSKA 3QU6A 1DUXC 1TNSA 3DTEA 1ZGAA 4E7LA 2CQQA 2K86A 2L7FP 3ESWB 3NNRA 1SD4A 1NK2P 1I3QJ 2DXIA 2M45A 2XAJA 3JAMK 3S2HJ 2D1HA 2A3SA 3P5JA 4ASNA 4HA8A 2IA1A 1IV6A 4AM3A 4BJ5C 3HM5A 3HRUA 4GXOA 2G7GA 1E2XA 4UHTA 1XGMA 2V9VA 1Z77A 2KISA 4HDVA 4ENNA 1N25A 4RB3C 1W7PA 1FT9A 2KIMA 3LAPA 3W2VA 4RGSA 3DFGA 2EFQA 2BY0A 3KEQA 1R71A 4JNNA 5CXIA 3E6BA 3E5UA 4MGRA 1K4SA 5J1YA 4XLCA 2JZYA 2XC7A 2KJCA 4QPOA 1TWFJ 4E7ZA 3KE2A 4D1QA 2DO7A 2STTA 1TW3A 1OFCX 2FSWA 1X2MA 1W7PB 1TQMA 5EJCA 3UR3C 4S05A 2V1NA 3MNLA 3ZMUA 2L0KA 5ED4A 2E5NA 3HTIA 3PSIA 4HV5A 2DT6A 3VFZA 3ZN1A 3JAMZ 4NDLA 5EYRA 3V7SA 4KIGA 1BBYA 1RZ4A 2RQPA 2LR8A 3WHCA 4M6XA 1R36A 2HQRA 3VVYA 2JPBA 4YIFA 2QWWA 5EDNA 5EEHA 2FEZA 2M2EA 3ABMH 4A6DA 4KNYA 1Y0UA 2CW0F 2FNAA 3IRQA 1RR7A 4M9SA 4WXHA 4NC6A 5AIQA 4BBSJ 4HX8A 1XSXA 4D5CA 2GWRA 4Y17A 3LNQA 1RUOA 3BWGA 3IH2A 4A3MJ 1SVOA 1ZGWA 1T08B 1XDUA 4G7ZF 3FX3A 3PPBA 5FKMA 3RH2A 1D8JA 1X2NA 3I5UA 1G3YA 1X1CA 5AQCA 3E97A 5LLQA 3IHUA 3QYFA 2M5WA 3GZ6A 1D5YA 1UI6A 1O3RA 4NUBA 3SZGA 3EETA 3CUQC 3SXYA 4HF1A 4LB6B 2PBXA 2EH3A 2E1OA 3F72A 1EV7A 5LRRA 2VJ5A 2FA5A 2YVEA 4Z6YA 3AL0B 2W82A 1MD0A 1CGPA 3BDDA 3H36A 4GFBA 4G6TB 2VJIA 3ZRGA 4UY8I 2AS5F 1QHGA 2UXPA 3DEWA 2CJJA 2BHYA 2ECBA 5EEAA 2ZCXA 2LOOA 1MJ9A 2JVGA 5HVQC 3HRSA 2LLKA 1ZELA 3OV8A 2FJI1 3LA3A 4M71A 1Q1VA 2DFFA 3G4SI 3ON2A 2DI3A 3SEZA 3BTJA 4XICA 5BPDA 3PL8A 3I4PA 4Y15A 2K4JA 4OD5A 2LK2A 5GPCA 4E7HA 3GW2A 2XRNA 1I39A 2G3BA 3JRGA 3OS1A 1J9IA 2A6TA 1MBJA 4BL0B 3OYBA 4CYDA 2FD5A 1GLNA 2EBIA 3NEUA 4G12A 2X9DA 3TBIA 3NAUA 1OR7C 3QU3A 4DYCA 1K7AA 1ETQA 4A3KJ 5LHHA 1OCRH 3F9KA 3QOPA 3WODF 4U88A 4XORA 2DA4A 2BY1A 3TW7A 5LFAA 4YRVA 3GF2A 2EZIA 2YS9A 4S0HB 4Y33A 1YJWI 3Q0VA 2JSCA 3S1MJ 4GRIA 4HQEA 2HYTA 4AIHA 2VKDA 2CFOA 2NRAC 2BY3A 3QPTA 1D3YA 5L3FA 2XSDC 3CCLI 3CMMA 5B5EC 3A02A 5DTDA 1DU6A 1ETOA 2LNBA 2DFHA 1TQPA 1ETYA 2O7OA 3AG1H 3KZIC 3S3NA 2DDBA 1E3HA 2NS8A 2QQAA 3ZMSA 3CD6I 2MBFA 2A69F 2KFDA 1X1PA 1G3WA 2LY9A 4LOCA 1T8IA 1SFXA 1K78B 1ETVA 1Y6IA 3AG3H 4BH9A 5B3SH 4PCQA 2XRLA 3HSRA 3D5SC 4ESJA 4P1WA 2WY7Q 3OY9A 1UAAA 5D19A 2RNGA 4L18B 3JR9A 2D6YA 1IUFA 3WHBA 2E2JJ 1OPCA 2UV1A 3O60A 3E5QA 1JUSA 1R00A 5IYCJ 4GYIA 2EJRA 2DOAA 4GFLA 2E60A 2LTPA 1YITI 1FNNA 2E2HJ 5DAJA 1UG0A 2Z1DA 3SZPA 1XN7A 4XMYA 5DCMB 4B47A 3PNYA 2Z5UA 5H2FC 4LITA 2PG4A 5J6XA 4G8XA 1W0UA 4AD9A 2X6YA 2MH2A 3FBIB 1HW1A 2CUZA 2OV7A 2H94A 1Y1WJ 2X48A 5KCMA 1JGGA 4UB6C 3FIWA 2XKPA 3CLOA 3M8JA 3M8FA 4MO7A 5LHIA 1WWXA 5TGTA 4RAYA 1ZK8A 3OYLA 1XSVA 2Z33A 3FF5A 4I99C 3TOBA 3VW1A 3QYBA 2GA1A 5HLTA 2JA5J 2HQAA 1X19A 2PFBA 4XK4A 1HCRA 3K70C 1JTXA 4W1UA 2O7TA 3ZGKA 3E6MA 3VEPA 4AWXB 1B6AA 2M0CA 2E19A 3L09A 3J7AY 5D8LB 2Y0SN 2QSFX 1N75A 1FOYA 3MAJA 1SAXA 1SMTA 2M8EA 3OL4A 5C44J 2Z3YA 1FPQA 2QQBA 1ZLJA 2E1MB 3Q9VA 2W00A 3ZQ7A 5HDNA 2L02A 5CXGA 3BJ6A 1K6YA 2KT0A 4MQVA 4U87A 3UNGC 2VJJA 3BPXA 3BTCA 3PNTA 2XPVA 4BXUA 5E1ZB 1YS6A 1C0WA 4ENMA 4IQ4A 1E3PA 4XN3A 5IOZA 1U8BA 2E36A 3GTLJ 2O61A 3VVZA 5IY5H 1XGNA 3IL2A 2V57A 2FX0A 2AQEA 5J4VA 4XRSA 3HXLA 1ORKA 1RNLA 2HFHA 3DPTA 5IPAA 1H8AC 4M72A 2UXOA 3VUQA 5D4RA 3G73A 4XBFA 2BGCA 3ZQFA 3CF5F 1FY7A 5KVRA 1KZHA 1RIOH 3CWRA 4U9NA 4A0ZA 4BJTA 1YJ9I 2LY1A 1USTA 3GTMJ 4ZDLA 2B9SA 3V7CA 4HNUA 1IXRC 3KLOA 2H8WA 1WFXA 2A68F 4FE4A 3VP5A 1D0ZA 2G7HA 3AQSA 3QBMA 2DFIA 2MD0A 1R4NB 4AIDA 1X1AA 4FISA 3W2AA 2MD5A 3FXKA 4L5JA 2Q24A 1XCVA 1JHFA 3L2RA 1U2WA 3S15J 2K27A 3SFIA 4UDSA 2VL8A 3OYGA 1JKOC 3HTUA 2XASA 1FC3A 3PIPF 1LNWA 2A5YB 2CUFA 3G1LA 3ZQCA 5J40A 5A2QK 1BR2A 1LVKA 3MQ0A 3AL0C 2P5VA 2ZJ2A 1FOKA 2HPMA 1R58A 1HQCA 1HSJA 3DPUA 3ZP5A 3N05A 4LD5A 1ZKGA 4V2FA 1FJLA 2OAZA 3OS0A 2NNNA 2F5CA 4D0PA 3BT9A 2F5EA 4B1RA 5AONA 3KYLA 1RKWA 5FROA 4HNVA 2Y9ZA 5HAWA 4C2MA 1RI7A 2Z16A 1FZPB 4M73A 1F43A 1HW5A 1OLTA 4FETA 4RLQA 4BU2A 2F4OB 3NS4A 1QZEA 4EATA 1GT0C 4MFEA 5D1RA 1FYKA 2EPFA 4A93J 1QRYA 1GVJA 1LKXA 2QM3A 1S7AA 1V3FA 4ZYHA 2HDDA 1XSDA 3TP0A 1L3LA 3K4NA 1W5TA 5BOXA 4BS9A 3OR1C 5HS7A 1HF0A 2KLOA 1B72A 3V4GA 1E17A 3QODA 1WJDA 2VQLA 2W53A 3W6VA 2EV5A 1CQTA 1P7JA 1KQ0A 2FBQA 4KYWA 1MNDA 4M3DA 3F8BA 3IKVA 4HQMA 2DFEA 2W57A 1TNTA 5LGNA 4PGHA 3QKXA 4HYEA 3WTUC 4EJTA 3TMOA 3N97A 2JA8J 1J0RA 5ILUA 2IS2A 1X1BA 4XKWA 3SEQA 1RR8C 4YEJA 4MLOA 3OYAA 1S8NA 3JSPA 1HOMA 2HEOA 3HTJA 1Y8QB 2HTJA 4M6YA 1TLHB 3BG3A 3G56A 3QP5A 1ZG1A 5C4JJ 2KRHA 5C4YA 4L0ZB 1WZ2A 2H09A 1KQ8A 2V9KA 3I4MJ 5E18F 3HTHA 4CYCA 4A3IJ 4OMYA 2I8DA 2QQ8A 2NS7A 4HSRA 3ZOBA 3ZXSA 1JUPA 3E6DA 3Q3SA 4XLFA 2WC2A 1FX7A 1U9NA 3K6GA 1MDMA 2FE3A 3CLQA 1BR4A 2H6BA 2ZKZA 3CJNA 4A5MA 4ZH4F 3CCJI 4BEHA 5F04A 3RQIA 4UXNA 2JT1A 3D5RC 4NQWB 2A2FX 3J81K 1WKMA 1IGNA 3CJDA 4ESFA 4I98B 1ULYA 4EMSA 3H5AA 5GAHJ 4CYCB 1F1ZA 1KYZA 5FLVA 3VW0A 4HEA2 2ICWG 4HZFA 4IHWA 4HBLA 1B59A 3CJQB 1MDMB 1YLFA 1TWAJ 4CCKA 4C3JJ 4A3JJ 3KP2A 3AFHA 2HDWA 4PK4A 4A0YA 4XQFA 2DTRA 4II2A 2L4AA 3H1CA 1FBSA 1WI3A 2FU4A 3CO7C 1ZQ3P 1LDDA 2OPTA 4B3AA 1IRFA 3HEFA 4ZYAA 4F52A 4RB1A 2OERA 2E5ZA 1AOYA 3MKWB 2G0EA 5BQTA 3BJBA 3FKIJ 5JFRA 3QRFF 5HODA 1SAUA 2ELHA 3CCYA 2DPUA 4ZZLA 2DQLA 4ITVA 5BMZA 3R60A 1LE8B 2VOOA 3H9QA 3J81Z 2AXTC 2RDPA 4Q5SF 3CUQA 2HQNA 4CA0A 2WUIA 4BKXA 3A0HC 4NN1A 4FASD 3JRFA 2FBHA 3TKYA 3FDYA 5H9TA 2R3SA 2E7XA 2RGVA 3FXOA 1DU0A 4RM2A 2R93J 2PZ9A 2MC4A 4HX4A 4XRFA 2ZJPF 3I55I 2E1MC 3ASNH 4IOCF 5J4YA 3V6GA 3ZQHA 3K4MA 2WAQN 1O4XA 2M4GA 3U1KA 3CUQB 1AA7A 3HKZA 3F8CA 5J1UA 2BW3A 2VBYA 3ASOH 3TO9A 3GVAA 3ANGA 1ERDA 3CESA 4RMNA 1YW9A 3ULQB 2VC1A 5H20A 2DG8A 3HTAA 3HIFA 3E5XA 1Y1VJ 1RRJA 2DU9A 3WTXC 4FE7A 1A6IA 1ENHA 3K10A 3CMEI 4OD4A 4XIDA 1W1WE 3BPVA 4WK8F 3JCUC 2ZNZA 1QZYA 3HHGA 4G7HF 2VC0A 1OCTC 1W36C 2WA0A 3BQYA 3FHZA 3HOZJ 2ZC2A 3WG7H 1IN4A 2LG4A 1YRNA 2VODA 1BI0A 1JTYA 3IC7A 1BJAA 4BY1J 2HOSA 2ZY9A 1VQKI 1VQ6I 2H27A 1ZN2A 4EGYA 1B1BA 4MQ9F 2F4IA 3AG4H 2VKVA 2IEKA 4BYYA 3J80K 2B1EA 4Q48A 2Q2EA 2ZXIA 4MEYF 2WTEA 3DLAA 4JK1X 1YRNB 3DP7A 1JE8A 5E3LA 2QA4I 2O3FA 3FXUA 5IP7J 1GHCA 1Z6RA 5AIPA 1Z9CA 2K9NA 3GX4X 5FRNA 1R6RA 1QVUA 2BEOA 2Q2EB 2NVXJ 1ACIA 2CH0A 3JRAA 2R92J 3EYYA 5DDGA 1BR1A 3KZYA 3LOCA 2PMZA 4JBAA 2MLKA 3F21A 3VWBA 1FWZA 1QU3A 2CS3A 1IDZA 3GCMA 2K02A 2WY8Q 4N4NB 1S7EA 2X85A 3MN2A 2L9SA 3WTZA 2DA1A 3OYIA 2F5VA 3DPJA 1PYVA 3J80Z 1IRGA 4OIQF 3EUKL 4UUSB 3GFMA 1ZLKA 4B4CA 2DT5A 4KFCA 2WBMA 3BR0A 4Y7NJ 1V55H 3FRQA 3EQLF 2VN2A 1W5CC 2O8XA 2D2WA 2GZWA 2K4BA 2MA3A 3E1SA 3DF8A 5EGOB 2WB1N 2IXSA 2NVYJ 3OL3A 5FLXK 1LUJB 3RZDJ 1U6GA 3E7QA 2M7BA 5FFZA 2UUZA 2M9HA 3CTAA 5K1YA 3PFIA 2W85A 4XN0A 2MG4A 4D5FA 1KU9A 4BBRJ 1YOVB 1U9OA 4WXCA 1DPRA 1IDYA 1IJWC 4N9IA 3I3LA 5IT3A 4ZDPA 4ZYGA 1Z7UA 2K9QA 4JL3A 2V1XA 2MSYA 1MSEC 3I53A 3O8HA 2ID6A 3CC4I 1JKPC 1F36A 5ERIA 5ICGA 3JTGA 2G9WA 2P5KA 5D5VB 3CCEI 1OCPA 3JRDA 1AHDP 1V4RA 4MIMA 5L3EA 1EH6A 2AHQA 2KRFA 3B02A 3MEXA 4LGWA 3HOVJ 2N8GA 4DYQA 1Z3XA 4GCLA 3GZ5A 1RKTA 3OYMA 3LAJA 3R61A 4XKBA 5FLXZ 4WWCA 2MABA 2QSGX 2YX7A 4C2TA 3LSPA 2TCTA 3BR6A 3FXLA 2M8GX 3K1PA 2HKOA 3WTYC 3S1QJ 4YFNF 1P4XA 1IN8A 4CUGA 3G6EI 5ILVA 1PP7U 4UUVA 1OJLA 2ISYA 4G94A 2LVSA 4JX6A 4KWAA 2RV8A 3BC8A 2GA2A 2ID3A 5LHGA 3AQTA 2VT2A 1V5FA 4MHGA 3A0BC 2OF7A 2QKOA 1U0JA 2R7QA 1FBQA 1WH5A 1BL0A 1Z05A 4V2GA 1LB2A 3K0LA 5DM7F 2IBDA 2E7WA 2YX4A 4EJOA 1WJBA 2X4HA 2DYRH 4I02A 2Z99A 3ZQGA 2QCOA 2OCCH 3O8GA 4ENKA 3MCZA 3LSHA 3Q0UA 1X4OA 2DYSH 5JR3A 3OYEA 2XPWA 1KONA 2H6CA 2GIVA 3E7LA 2DOFA 1REPC 1SFKA 1R7JA 3LQRA 4N4OB 4E6KG 2L9VA 2ZFUA 3RKXA 4CICA 3DKYA 3QAHA 3U2RA 2M3AA 4RA2A 3ZMVA 5F08A 2V1DA 3F8MA 2FQ3A 2Y31A 5KAIC 4AC0A 2NNYA 3RPUA 3LSTA 2DJIA 1UHSA 4PUSA 1N77A 3DV8A 2XAFA 4ACIA 3L1PA 5FMPA 1IG7A 3HB9A 4IZZA 1MZBA 3TQNA 2XB5A 5E3MA 5GP9A 2I10A 2H1LA 1YIJI 1QQIA 1S6LA 3PASA 2W84A 5D5WB 1JI8A 3TDUC 5FGLA 1ZGJA 2W7NA 3ELKA 3BJAA 1OYYA 1U8RA 3R6SA 4FTHA 2EA2A 2UXNA 3GBGA 3DEEA 3GTPJ 1UCRA 3G3ZA 2B3WA 2KRCA 3K1MA 3H0DA 3HIMA 2I5UA 2CFXA 4BE2A 3OS2A 3MMYB 1PUFA 2D5VA 5EEGA 4UV9A 5K5RA 1GV2A 1K79A 2FF4A 3FXJA 1IXCA 1B9NA 1F9NA 1HC8A 3U21A 3I58A 4E7SA 2IGOA 2KIQA 5HS9A 1SD5A 1JUMA 2P81A 2XSJC 3DKWA 3QQAA 1K61A 3AKZA 1ZTRA 1FSHA 3CCVI 2KZGA 4XR6A 5H6QA 1MMDA 4Y52J 3W6KB 4OWRB 4HF2A 1WJ5A 3MFKA 4BDZA 1BI2A 2L7KA 1OYWA 2NX4A 3VPRA 5EZHA 1PUFB 1MMSA 2YU9J 1XS9A 3GZNB 1XG1A 3SHFA 1CF7A 4EM0B 5KK1A 4BACA 3P7NA 3F22A 4HPQA 3ABKH 5CLSA 5J8FA 2WAQA 1N78A 3BHQA 5FKLA 2ELJA 2LBFA 1G2HA 5DD4A 3RKQA 2XF7A 3JW4A 2JUGA 1K78A 2NAZA 2NOJB 4BHBA 4DQ2A 3VVXA 3HSEA 1CF7B 2X6WA 3CDIA 3OSFA 1SMYF 1UJ8A 2AQFA 3RI4A 3F6VA 5CVVA 4IRIA 1HXDA 1X3UA 3OWTA 1EF4A 2IGKA 2LBFB 2DCEA 3BCAA 3K2ZA 2BBYA 2L9RA 3LFKA 3KP3A 5K5QA 2DMUA 2R7OA 1VQ7I 1HDPA 4I09A 4JP0A 3GTOJ 5CPRB 1S5LC 4BQQA 4KJZA 1UZCA 4AVPA 1XGSA 2IS6A 2L01A 2DA5A 2MC3A 3DWLE 1ZRFA 4A3EJ 5FD5A 1YIOA 1G8XA 5DCMA 1WJFA 1ON1A 4CSWA 3FMQA 3GYHX 3S3OA 1SFUA 1VQ4I 2A5WA 2JWTA 4M3EA 2VBWA 4L0YB 2R7ZJ 3CC7I 2REKA 1LPQA 1ZH5A 3BNIA 4IHTA 3PIOF 5D18A 2HR3A 1R5HA 4XONA 1J75A 1M1EB 4GCTA 3CJRB 3F6OA 1R23A 4UVAA 4D9JA 4GO1A 2ISZA 3IWFA 2EZKA 3MKLA 5CJ9A 2LFBA 3GMEA 3M1EA 3FXQA 4NNJA 1O7LA 2D1VA 4IX7A 4CGRA 1RESA 3EUAA 2ZOZA 2DBBA 2OQGA 5K7HA 3KIOA 2R7SA 2COBA 1O3QA 3FBNB 4P5OA 2HYFA 4XLAA 2E1CA 3L9FA 2H1KA 4DBQA 2Y30A 2LKSA 2M1BA 1UB9A 3BR5A 3GTGJ 1B8IA 2L5QA 2CGPA 2NVUB 3ONQA 1UHWA 4MNUA 1LEBA 3J7AO 5DUKA 3NPIA 5D6FA 1SVLA 2LYCA 3DBRB 3LL7A 4OIRF 2F4MB 5KNLA 3KYDB 2Q0OA 3B73A 1VF9A 1U78A 3BP8A 1XDSA 1WJCA 2ZO4A 1P2FA 3S1RJ 3S3MA 4PDKA 3KP4A 2DOEA 4Q4ZF 1T39A 1JKQC 1BC8C 3CMAI 2GFNA 1B8IB 1SEUA 2WB1A 2XKOA 3HHHA 2KIFA 4UB8C 3S14J 2JA6J 4RDUA 3O2PE 1U3EM 4NC7A 3V8LA 5IYBJ 2PJRB 2EK5A 4YFXF 3EYIA 1DQUA 2DPDA 4IRHA 4H4KC 4BJ6C 1QVTA 1ZG5A 3ISPA 2JTVA 2ZXWH 4EEFG 5KHDA 1JJ6C 1ONVA 5E17F 3G2BA 1HDDC 3RKWA 1SFOJ 2R7FA 3OYKA 2WV1A 3VOEA 2ZCWA 1MBEA 1P9QC 2GXAA 3PO2J 4R8HA 4KT6A 1G3TA 3L2CA 2K5CA 3GWZA 3CQZJ 3PUBA 1AU7A 4BQNA 4DGWB 4Z2YA 3RYPA 1VQNI 2O6GE 4L5EA 3T5XA 4AYBN 1YYVA 4IHYA 4XLHA 5FHPA 2HVQA 5CW8A 4PXIA 2LH9A 4YIIA 2F5FA 3VSLA 1HKSA 5CYVA 1KU3A 2V1UA 1QZZA 1J2XA 4E4HA 2VBXA 1R1UA 4B48A 2RVCA 1LQ1A 2HS5A 1JXSA 3LFUA 3H5RA 1R49A 5EFYA 1YFHA 2XGEA 2OBPA 3JRBA 4DIQA 2OCEA 4U7BA 2ZNYA 2BOLA 1BW5A 5IYDJ 5F27A 4PJ0C 4E7JA 3HZJA 4EJUA 4L9VA 4U9LA 1O7FA 2BYVE 4HW0A 5TJJA 4GDFA 4B43A 4IPAA 2FMYA 1TTYA 3FISA 1LVAA 5CKTA 2HOTA 1MMNA 2ZMEA 1UI5A 3BRUA 3CMYA 4CCJA 2G7SA 2BVLA 5HDKA 3M4OJ 3KP7A 2QBYA 1TWHJ 3PO3J 1FYLA 4CDGA 1YG2A 2PX9A 4I01A 2BHZA 3MKYB 2RNJA 3EPZA 3FKJA 3H3VK 4NBQA 4PSWA 1R1VA 5J3LA 2DQRA 2KL4A 5GTIC 2ZJQF 1IXSB 1ZRDA 2ZMEB 1UMQA 4ABZA 1I27A 2COMA 2OTLI 2DN0A 2QBYB 4LG3A 1W7PD 4RLFA 2KKOA 2HVRA 1ETWA 4CCOA 2CQKA 3BG9A 4ME9A 2LP0A 2L3DA 4J00A 1EA3A 1OCZH 3BZKA 3KZZA 3ZN0A 1MMAA 3RKYA 1WI9A 2FUG2 3HE0A 2KJBA 2YPRA 3IH3A 1A35A 2VKEA 1SC7A 3K69A 3OR2C 4EVIA 5DCFA 4RAZA 4XM3A 2R5YA 1VQ8I 4PFOA 4IKFA 1DPUA 3DQVC 2RREA 4IQJA 4CCNA 4M3BA 1R22A 4ENJA 2L2OA 1KGSA 3OYHA 1FTTA 1XPXA 2A05A 4OMZA 5ICFA 3QPSA 2HYGD 4A3LJ 2J5PA 3OSGA 2EFOA 3BOQA 5CVJA 4C3HJ 4G9YA 5IT9Z 4LFUA 4EJWA 1I50J 2ZXJA 2R5YB 1XMXA 1LFPA 1G4DA 3BJOA 4MTEA 1ZR4A 1BA5A 2PBIA 4UVCA 2PLYA 4DZPA 2HZTA 3F8NA 3IUOA 2KP6A 3LHQA 4R79A 3RJPA 5F1JA 2BV6A 3IV5A 3REOA 3RPUD 1MIJA 4NQWA 1P4WA 1X1DA 1J7KA 1YHQI 3H9GA 3SZTA 1WGXA 1X4PA 3HUGB 3P9CA 3VB2A 2GQQA 4OINF 2F48A 2EZHA 1JHHA 5D5XB 3BR2A 3NWSA 1OCOH 3K7AJ 2K9MA 1JKRC 3KZ9A 3ABUA 3MWMA 4F93B 1UG2A 2PI0A 2IGMA 1HSTA 2JQ7A 5TRDA 2LF8A 3C2BA 2CQ7A 2PQ8A 1FOWA 3S2WA 1TT0A 2VQGA 1ODDA 3DLLF 1IRZA 3DPLC 2XAGA 2EA4A 2HXIA 5LGUA 3DU5A 3WGIA 3GLXA 5FKOA 4J01A 2ME0A 1MH3A 1W5SA 2MGQA 3LSKA 4ON0A 3SDBA 3QOEA 4YFKF 2E1NA 4RAFA 3KCCA 2LKXA 3H35A 4LK0F 2HQ5A 1YX5A 3SFZA 3T6NA 1LE8A 1ITYA 5CQEA 1GXQA 2XVCA 5HDGA 2QUFA 3IH4A 2ZOYA 3ROUA 1VQMI 2K9LA 1Z3YA 1W0TA 1F4KA 5HLGA 3HOYJ 4R1HA 4J19A 4L5IA 2HVSA 2IT0A 3RTRA 5F0HA 2ZBKA 1QO0D 4IJAA 1ZYRF 3HG9A 2B7EA 1KU7A 3CCRI 4PJNA 2P4WA 4JX5A 1O57A 3ECOA 1WRJA 2M7AA 1EH7A 2OTJI 3AAFA 3ZMZA 3LSRA 5J47A 3CO6C 2YR2A 3CF2A 5C3EJ 4MFDA 2GOXB 4MXMA 3V7RA 4ZZDA 2EIMH 3F23A 1P6RA 4ANJA 4RBOA 4C30A 4AC6A 4AIJA 2JMWA 5CVRA 2R5ZA 4KA4A 2STWA 4A2UA 2JUCA 3K8PC 2NVTJ 3T8RA 4PJJA 2EILH 2R4GA 4JOMA 3IAS2 1ZHFA 5F0FA 1IN7A 4U0YA 1RETA 4BGDA 4X0GA 2WV0A 2YUSA 3PQKA 4BHPA 1LEAA 1R5ID 1TT5B 3S93A 2R5ZB 4RM3A 4RGUA 3HGYA 1TWCJ 5BS6A 1LJ9A 3C2GA 5JI6A 2E2IJ 2K7LA 4NB5A 1VQ5I 5F1RA 2X1DA 1ETKA 5FKKA 1LDKB 1Z67A 2K9SA 3KLNA 2LC2A 2IJLA 2HNHA 4UNOA 1UFMA 4FX0A 3A01B 2NOGA 3C07A 3OYCA 1HBXG 1VQPI 1FTZA 1QPMA 1TW2A 2DA3A 3T0YA 4HOBA 1Z6TA 1KQ9A 3RYRA 1XMAA 2BXYA 3KYCB 2L7ZA 2Y0SA 2OQRA 3JRCA 1SANA 3I64A 4G6QA 3S32A 5LRSA 1FOXA 1AWCA 4ZC3A 5JHUA 1R4MB 4PGGA 1KYWA 3GFIA 2P5LC 2X6XA 4K2EA 1BOBA 5F64A 3RDIA 3I71A 5GAEJ 3WU1B 2ACJA 1BM9A 3SYTA 5M5WJ 3PFYA 3M07A 2CRGA 3OIPA 2XGDA 4UUSA 1XMKA 2FBIA 1YTYA 4LMYA 4HX7A 2DODA 2RAEA 4KMUX 3GTQJ 4DJAA 2R7VA 2IP2A 2EFPA 3KP5A 4HSTA 5KAFC 3J7YJ 3E0JB 4L9TA 2CV2A 5EGOA 3V8JA 2BVMA 4UUTA 5E3NA 2ZMEC 3GO5A 3D1NI 5HBUA 2VLAA 3ML6A 4GCKA 5K7FA 1MBGA 4I0AA 4II3A 3V8KA 3JSJA 4KMFA 4A3GJ 2X0LA 4AF5A 5HOOA 4FCYA 3DU6A 3K4KA 2V26A 2ESHA 4HLXA 3WTSC 4B44A 4XLEA 2XF5A 2XDVA 1O3TA 3ABTA 3C1DA 2YVXA 4I2OA 2VQHA 2ETHA 1YW7A 4AVZA 4YIRX 2NP3A 2KHMA 3DTIA 4LLNA 2V9PA 1T38A 2LSOA 2HI3A 3HPGA 3CZ6A 4RGXA 5DUIA 1A5JA 1W36D 3K4BA 3ZCOA 3I9V2 2OD5A 5HNHA 3LSIA 5D5UB 1Y0NA 4GYGA 1WPKA 3FM3A 3MZ8A 5LEJA 4IHVA 2MH9A 4CXFA 2PJPA 1WSUA 3M7GA 3L2WA 1HKTA 1VQOI 2Z9OA 3JSOA 3VIBA 1PDNC 4HRIA 3DCFA 3LSGA 4C2MJ 1BI3A 3LWJA 1G6NA 2Q1ZB 5E1XA 5L3DA 4A0XA 5E20A 1QGPA 3N4MA 2VQCA 3J7ZI 2VKHA 2EZLA 2DK8A 2CG4A 4CCMA 1I1GA 2JJ7A 2OJED 3FK6A 2NYXA 1NH3A 3VYTB 4FX4A 3LQQA 3H92A 3LWFA 2JA2A 5BPIA 1YJNI 5GPAA 3HL2A 3KPHA 1YQAA 2WADA 2AXLA 3G1MA 3WTTC 4HDUA 3S1NJ 2MYSA 4ZYEA 5LEKA 1XX5A 4XL9A 2VE8A 3MZHA 2IA2A 3SQNA 2ZSHB 3MZYA 4IRVA 3VOKA 1OKRA 4I0BA 3FZVA 2YU3A 3VYSB 3NI7A 2ELKA 3CCSI 3LMMA 2ZSIB 2DDAA 1T0FC 1RPWA 1EKEA 1WQ2A 9ANTA 2A61A 2R7XA 2XROA 2LRDA 4MEXF 4DYRA 4I76A 1VQLI 1BC7C 4E7IA 3QWLA 5ILSA 4F91B 4Q47A 3HTSB 3COAC 3CCUI 2EINH 4XLPF 4U0VA 2DMQA 4MTDA 5K58A 4M6VA 3CP2A 1GDTA 5BNGA 2OC6A 2ME6A 4EJVA 2A6EF 2WGBA 2HXOA 2MFZA 2DJNA 3HOXJ 4KITB 1MNEA 1Z1DA 2K3PA 3GTJJ 1SVMA 2CWEA 2M34A 4CO8A 3A1YA 5D8KB 4BE0A 2E34A 3EUPA 2FMLA 2JN6A 4A69C 2KIUA 2O03A 3S17J 3T1BA 2KQRA 1P7IA 3HOWJ 1FIPA 5HSZA 3JRIA 4AUXA 2XGXA 1Z21A 1ZR2A 1FYMA 5EF6A 1YE9A 3NXCA 3OMYA 1G3SA 4O5VA 2UZKA 1QPIA 1A31A 2HTSA 2P0WA 2FNPA 4IF4A 2HOAA 2HU9A 4XSZF 2PMUA 3TEDA 4XRSG 4ZDOA 1MBHA 2QENA 4KISA 2GBYA 4CCLA 3LJLA 3ZMTA 1JJ8C 3A03A 1Y8RB 3QYEA 5L3BA 3TDZC 4PSXA 1K83J 3WTVC 2HDCA 4NELA 5CQGA 3KX2A 2CV0A 1QHHD 2VJ4A 3OYFA 2NVQJ 1UELB 2VPRA 2K85A 3ZR8X 1T33A 2F5DA 1ZG3A 5E1WA 5E79C 1UHMA 4I7HA 3BCGA 1AKHA 1FEXA 2CYYA 3TO6A 2DMTA 3G71I 4JQFA 2LF7A 2IPQX 4B09A 3NQOA 4KUMA 3OYNA 3VODA 3I59A 3K4CA 2UWMA 1DGWY 1J09A 4F3QA 4WIBA 4DNCA 1XC5A 4LLLA 1D1CA 3GFLA 4NC8A 3BROA 5CVIA 3D0SA 4RB0A 4CH7A 3HBLA 3KKDA 3NWTA 2ADUA 1AKHB 3S8PA 2BE5F 2QYOA 2X1CA 2QTQA 1GVDA 5DYMA 1K4TA 3I59B 1MSFC 1J5YA 2VASA 4O3MA 2IGNA 1WJEA 5DS9A 3IAM2 4L9JA 5FD6A 3DEUA 3CC2I 3RSNA 3KNWA 3L2UA 3CCQI 4N0BA 3PM1A 3WU2C 2EFWA 2JK3A 4W97A 5L3CA 3SJMA 3BCBA 1TL8A 3FXRA 5GTHC 2PN6A 2DK5A 2VXZA 1JT0A 1OISA 3KFWX 4L9NA 2LMDA 3K2AA 3G7RA 2IAIA 2HGCA 2X51A 1LDJA 2JPCA 1A04A 5E3OA 1P92A 2ZJRF 2DTZA 3ABLH 5J8CA 4LIUA 4Y4RA 3DBLB 5FJ8J 2CUJA
chains in the Genus database with same CATH topology
3FKIJ 3HDDA 1TC3C 4C3IJ 4A3CJ 5HODA 3CCYA 1LE8B 5IOYA 2CQQA 3FISA 2L7FP 2HOTA 1GUUA 1UI5A 3BRUA 3CMYA 3NNRA 2G7SA 2WUIA 3M4OJ 4BKXA 1NK2P 4NN1A 1I3QJ 1TWHJ 3PO3J 3UKGA 2DA2A 3S2HJ 3JRFA 5H9TA 2W48A 1DU0A 2R93J 2UXHA 2PZ9A 1IV6A 3HM5A 3H3VK 3V6GA 2G7GA 3ZQHA 4JYKA 3S5RA 5J3LA 5EZGA 1Z77A 2WAQN 1O4XA 2XB0X 1NK3P 1UMQA 2DA7A 5J1UA 1LFUP 4ABZA 3ANGA 3QPLA 2DN0A 4JNNA 5CXIA 2KDZA 2DG8A 3HTAA 1ETWA 2QIBA 1Y1VJ 5J1YA 3BG9A 4ME9A 3COLA 2LP0A 3CDLA 4FE7A 1A6IA 1ENHA 1MH4A 1TWFJ 4XIDA 3I4NJ 1OFCX 4HKUA 1X2MA 1OCTC 3HOZJ 3BQYA 3MNLA 1NTCA 3HE0A 2L0KA 3IH3A 1I6HJ 2VKEA 5FKNA 3HTIA 2R5YA 1YRNA 4NDLA 5EYRA 1JTYA 4BY1J 2HOSA 3JRHA 2LR8A 3WHCA 4M3BA 2VKVA 3VVYA 3VOXA 2IEKA 1FTTA 4JX4A 3HKZN 5EDNA 3QPSA 2M2EA 4A3LJ 3OSGA 4C3HJ 2UXUA 2H8RA 2Y2ZA 1I50J 2R5YB 1RR7A 2LD5A 1YRNB 4A3DJ 4BBSJ 1ZR4A 5E3LA 4D5CA 1BA5A 5IP7J 4DZPA 3LNQA 3IH2A 3HGGA 4A3MJ 4IHXA 3LHQA 4QIWN 2K9NA 1ZGWA 5F1JA 3IV5A 1QVUA 1Z0XA 3PPBA 3RH2A 5FKMA 1VFCA 2NVXJ 1X2NA 3JRAA 2R92J 1WGXA 4XRMA 2QOPA 5AQCA 3VW2A 3LOCA 1APLC 2EZHA 1D5YA 1UI6A 3BR2A 1HLVA 1IDZA 1FIAA 3BTIA 4MK6A 3VUQA 3K7AJ 1JKRC 2PBXA 3KZ9A 1S7EA 2EH3A 2E1OA 3MN2A 1UG2A 2DA1A 3B6AA 3DPJA 2YVEA 3RD3A 4UUSB 3C2BA 4YZEA 4B4CA 2OI8A 3BR0A 3F0CA 2GUHA 4Y7NJ 4GFBA 3NARA 3FRQA 5M3MJ 1IRZA 2UXPA 2HXIA 3DEWA 2CJJA 5EGOB 2WB1N 5FKOA 4QTRA 2ECBA 2ME0A 2NVYJ 1MH3A 5EEAA 2MGQA 2ZCXA 3RZDJ 3BR3A 3E7QA 3G1OA 2LKXA 2LLKA 2HQ5A 2M9HA 4BY7J 3T6NA 1Q1VA 3ON2A 1LE8A 1ITYA 4XICA 3BTJA 2PMZN 3IH4A 2ZOYA 2MG4A 2CQXA 4D5FA 4BBRJ 2Y9YA 1W0TA 3HOYJ 2LK2A 5GPCA 1U9OA 4J19A 1IDYA 2GM4A 2G3BA 3JRGA 1IJWC 3S2DJ 1MBJA 5F0HA 2XPUA 2FD5A 2EBIA 3F1BA 4G12A 2K9QA 2X9DA 4JL3A 3NAUA 4GFKA 1MSEC 2DMPA 2MSYA 3O8HA 2ID6A 1LFBA 4DYCA 3BQZA 1ETQA 4JX5A 4A3KJ 1JKPC 1F36A 2IU5A 1JT6A 1OCPA 2DA4A 3LSRA 3TW7A 4DW6A 3JRDA 1AHDP 2DG7A 4X1EA 5C3EJ 4MFDA 2EZIA 2YS9A 4S0HB 4MIMA 3Q0VA 1POGA 2B63J 4MXMA 2AHQA 3HOVJ 2N8GA 2RHAA 1SGMA 4DYQA 3S1MJ 4GCLA 4RBOA 2HYTA 4AC6A 1RKTA 2JMWA 2R5ZA 2XSDC 2YVHA 1BJZA 3LSPA 2NVTJ 3A02A 2TCTA 5DTDA 1ETOA 1DU6A 3BR6A 2M8GX 3ON4A 2L7MP 3S1QJ 5F0FA 1ETYA 2O7OA 4X6AJ 1RETA 2NS8A 2YUSA 1OJLA 2LVSA 4JX6A 2LY9A 4LOCA 2R5ZB 1T56A 4KWAA 3HGYA 1TWCJ 1ETVA 2ID3A 3RZOJ 3AQTA 2E2IJ 2EQRA 2XRLA 3GZIA 1ETKA 5FKKA 2OF7A 2QKOA 3IUVA 1WH5A 1BL0A 3JREA 4V2GA 5D19A 2K9SA 2IBDA 3JR9A 1IUFA 3WHBA 2E2JJ 3A01B 2NOGA 4I6ZA 2O8KA 3C07A 5M5XJ 3CRJA 3O60A 1JUSA 2QCOA 3O8GA 3ZQGA 5IYCJ 2O9LA 1FTZA 4GFLA 2DA3A 5FLMJ 2LTPA 3Q0UA 4A3FJ 2E2HJ 2HKUA 5DAJA 2XPWA 1ETXA 4ICHA 3GEUA 4QSHA 2FJ1A 3E7LA 2L7ZA 3JRCA 1SANA 4JKZA 3OIOA 1W0UA 5F08A 4AC0A 2Y31A 1Y1WJ 2X48A 2XGCA 1UHSA 1JGGA 2ZB9A 2TRTA 2CUEA 3FIWA 5M5WJ 2CRGA 4ACIA 4MO7A 2XGDA 4UUSA 5M5YJ 3L1PA 1IG7A 5FMPA 1ZK8A 3S16J 2RAEA 3GTQJ 3HB9A 1B72B 3VW1A 2JA5J 1HCRA 4XK4A 2XB5A 4D7MA 1JTXA 5E3MA 4W1UA 2I10A 5GP9A 5EGOA 1H89C 2O7TA 4UUTA 5E3NA 2K40A 3GTKJ 3PASA 2M0CA 3D1NI 5HBUA 5EG0A 2E19A 5K7FA 5FGLA 1MBGA 4GCKA 3ANPA 2Y0SN 3JSJA 2DA6A 3FK7A 5C44J 4FTHA 4A3GJ 3GBGA 4AF5A 3GTPJ 4FCYA 3HIMA 3BR1A 5CXGA 2NP3A 2KT0A 2QF7A 3EGQA 1PUFA 3BTCA 2D5VA 2HI3A 1GV2A 2XPVA 5EG0B 1A5JA 5IOZA 1JUMA 2P81A 3QQAA 1U8BA 1K61A 3GTLJ 4BXXJ 3VVZA 1ZTRA 2V57A 3Q0WA 2FX0A 4XRSA 1WPKA 4IHVA 4Y52J 1ORKA 5IPAA 3TW6A 1MNMC 2NX4A 3VPRA 5EZHA 1PUFB 1H8AC 3VIBA 3DCFA 2MW8A 3LSGA 1XS9A 2YU9J 3ZQFA 4C2MJ 2UXOA 3LWJA 3CWRA 1XG1A 3GTMJ 3B81A 2QWTA 3P9TA 2EZLA 2ZCNA 2JJ7A 2NP5A 3FK6A 4FE4A 3VP5A 3BHQA 2GENA 1IC8A 3AQSA 3QBMA 5FKLA 3TP3A 5C4XJ 5GPAA 1G2HA 3RKQA 3S1NJ 3G1MA 4FISA 3BG5A 2Q24A 2GLOA 5J1RA 3VVXA 3S15J 3VOKA 3SFIA 4UDSA 3OSFA 1WCMJ 1JKOC 3SDGA 3NI7A 2ELKA 1RPWA 2CUFA 3G1LA 9ANTA 3ZQCA 1EF4A 1MBFA 4DYRA 2L9RA 4I76A 3A01A 2DMUA 3GTOJ 1HDPA 4JP0A 2F07A 4V2FA 1ZKGA 3OOUA 1FJLA 2DMQA 5K58A 2DA5A 4M6VA 3BT9A 5BNGA 1GDTA 2ME6A 4B1RA 4A3EJ 1RKWA 5HAWA 4HNVA 2Y9ZA 2D6YA 3HOUJ 2WGBA 2HXOA 4M3EA 1WH7A 2JWTA 1E3OC 2R7ZJ 2REKA 5D18A 2DJNA 5JLXA 3HOXJ 1F43A 3BNIA 4L62A 3GTJJ 2M34A 1GT0C 4GCTA 4MFEA 5K7ZA 5D1RA 3BTLA 4A3BJ 2EZKA 3MKLA 3EUPA 4A93J 1QRYA 2LFBA 2JN6A 4A69C 5JLWA 1MBKA 3S17J 2HDDA 1P7IA 2CU7A 3HOWJ 1FIPA 1RESA 4CGRA 5HSZA 3JRIA 3TP0A 4AUXA 2ZOZA 2ZCMA 1ZR2A 5EF6A 5K7HA 1HF0A 3V78A 1B72A 3NXCA 2COBA 2JA7J 1QPIA 1BW6A 2H1KA 2W53A 1R9TJ 3W6VA 2Y30A 1CQTA 1P7JA 2HOAA 2FBQA 4M3DA 3BR5A 3GTGJ 2XDNA 1B8IA 3TEDA 4XRSG 1MBHA 3LJLA 2GBYA 3NPIA 3QKXA 1JJ8C 3A03A 2JA8J 2X6OA 3MVPA 2HYJA 3H0GJ 1VF9A 1U78A 2G7LA 1K83J 4NELA 4D7NA 3S1RJ 4MLOA 2NVQJ 1JKQC 2VPRA 1HOMA 2GFNA 3HTJA 3B6CA 1B8IB 1T33A 3KKCA 3BG3A 1GV5A 3G56A 3BCGA 1AKHA 3S14J 1FEXA 2JA6J 5C4JJ 4RDUA 2DMTA 5C4YA 5IYBJ 4M3FA 3I4MJ 1QVTA 3HTHA 4CYCA 4A3IJ 4EEFG 1XC5A 2NS7A 4IEJA 3ZOBA 1JJ6C 1JUPA 3Q3SA 1H88C 1HDDC 1SFOJ 1U9NA 2R0QC 3HBLA 2DMNA 3KKDA 2UXIA 2WV1A 5F04A 1AKHB 3RQIA 1MBEA 3PO2J 2QTQA 1GVDA 1VNDA 1IGNA 3LSJA 3CJDA 1AU7A 1MSFC 3CQZJ 4CYCB 1VI0A 5FLVA 1X58A 3VW0A 4M3GA 4L5EA 5DS9A 5M3FJ 4AYBN 4IHWA 3M3YJ 4IHYA 5FHPA 3KNWA 3NRGA 1TWGJ 5CW8A 2AO9A 4PXIA 1TWAJ 4C3JJ 3ZQLA 4A3JJ 3PM1A 3SJMA 2JK3A 4W97A 2RASA 5F0CA 1WI3A 2VI6A 1ZQ3P 5EFYA 1JT0A 2OPTA 4B3AA 2XGEA 3HEFA 5IP6A 3K2AA 3G7RA 2IAIA 2VUMJ 3JRBA 2FQ4A 2OERA 4DZJA 5E3OA 3ZQIA 2DTZA 5IP9J 1BW5A 2G0EA 5F27A 5FJ8J 5IYDJ 2ECCA 3BJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI J;  3HDD A;  1TC3 C;  4C3I J;  4A3C J;  5HOD A;  3CCY A;  1LE8 B;  5IOY A;  2CQQ A;  3FIS A;  2L7F P;  2HOT A;  1GUU A;  1UI5 A;  3BRU A;  3CMY A;  3NNR A;  2G7S A;  2WUI A;  3M4O J;  4BKX A;  1NK2 P;  4NN1 A;  1I3Q J;  1TWH J;  3PO3 J;  3UKG A;  2DA2 A;  3S2H J;  3JRF A;  5H9T A;  2W48 A;  1DU0 A;  2R93 J;  2UXH A;  2PZ9 A;  1IV6 A;  3HM5 A;  3H3V K;  3V6G A;  2G7G A;  3ZQH A;  4JYK A;  3S5R A;  5J3L A;  5EZG A;  1Z77 A;  2WAQ N;  1O4X A;  2XB0 X;  1NK3 P;  1UMQ A;  2DA7 A;  5J1U A;  1LFU P;  4ABZ A;  3ANG A;  3QPL A;  2DN0 A;  4JNN A;  5CXI A;  2KDZ A;  2DG8 A;  3HTA A;  1ETW A;  2QIB A;  1Y1V J;  5J1Y A;  3BG9 A;  4ME9 A;  3COL A;  2LP0 A;  3CDL A;  4FE7 A;  1A6I A;  1ENH A;  1MH4 A;  1TWF J;  4XID A;  3I4N J;  1OFC X;  4HKU A;  1X2M A;  1OCT C;  3HOZ J;  3BQY A;  3MNL A;  1NTC A;  3HE0 A;  2L0K A;  3IH3 A;  1I6H J;  2VKE A;  5FKN A;  3HTI A;  2R5Y A;  1YRN A;  4NDL A;  5EYR A;  1JTY A;  4BY1 J;  2HOS A;  3JRH A;  2LR8 A;  3WHC A;  4M3B A;  2VKV A;  3VVY A;  3VOX A;  2IEK A;  1FTT A;  4JX4 A;  3HKZ N;  5EDN A;  3QPS A;  2M2E A;  4A3L J;  3OSG A;  4C3H J;  2UXU A;  2H8R A;  2Y2Z A;  1I50 J;  2R5Y B;  1RR7 A;  2LD5 A;  1YRN B;  4A3D J;  4BBS J;  1ZR4 A;  5E3L A;  4D5C A;  1BA5 A;  5IP7 J;  4DZP A;  3LNQ A;  3IH2 A;  3HGG A;  4A3M J;  4IHX A;  3LHQ A;  4QIW N;  2K9N A;  1ZGW A;  5F1J A;  3IV5 A;  1QVU A;  1Z0X A;  3PPB A;  3RH2 A;  5FKM A;  1VFC A;  2NVX J;  1X2N A;  3JRA A;  2R92 J;  1WGX A;  4XRM A;  2QOP A;  5AQC A;  3VW2 A;  3LOC A;  1APL C;  2EZH A;  1D5Y A;  1UI6 A;  3BR2 A;  1HLV A;  1IDZ A;  1FIA A;  3BTI A;  4MK6 A;  3VUQ A;  3K7A J;  1JKR C;  2PBX A;  3KZ9 A;  1S7E A;  2EH3 A;  2E1O A;  3MN2 A;  1UG2 A;  2DA1 A;  3B6A A;  3DPJ A;  2YVE A;  3RD3 A;  4UUS B;  3C2B A;  4YZE A;  4B4C A;  2OI8 A;  3BR0 A;  3F0C A;  2GUH A;  4Y7N J;  4GFB A;  3NAR A;  3FRQ A;  5M3M J;  1IRZ A;  2UXP A;  2HXI A;  3DEW A;  2CJJ A;  5EGO B;  2WB1 N;  5FKO A;  4QTR A;  2ECB A;  2ME0 A;  2NVY J;  1MH3 A;  5EEA A;  2MGQ A;  2ZCX A;  3RZD J;  3BR3 A;  3E7Q A;  3G1O A;  2LKX A;  2LLK A;  2HQ5 A;  2M9H A;  4BY7 J;  3T6N A;  1Q1V A;  3ON2 A;  1LE8 A;  1ITY A;  4XIC A;  3BTJ A;  2PMZ N;  3IH4 A;  2ZOY A;  2MG4 A;  2CQX A;  4D5F A;  4BBR J;  2Y9Y A;  1W0T A;  3HOY J;  2LK2 A;  5GPC A;  1U9O A;  4J19 A;  1IDY A;  2GM4 A;  2G3B A;  3JRG A;  1IJW C;  3S2D J;  1MBJ A;  5F0H A;  2XPU A;  2FD5 A;  2EBI A;  3F1B A;  4G12 A;  2K9Q A;  2X9D A;  4JL3 A;  3NAU A;  4GFK A;  1MSE C;  2DMP A;  2MSY A;  3O8H A;  2ID6 A;  1LFB A;  4DYC A;  3BQZ A;  1ETQ A;  4JX5 A;  4A3K J;  1JKP C;  1F36 A;  2IU5 A;  1JT6 A;  1OCP A;  2DA4 A;  3LSR A;  3TW7 A;  4DW6 A;  3JRD A;  1AHD P;  2DG7 A;  4X1E A;  5C3E J;  4MFD A;  2EZI A;  2YS9 A;  4S0H B;  4MIM A;  3Q0V A;  1POG A;  2B63 J;  4MXM A;  2AHQ A;  3HOV J;  2N8G A;  2RHA A;  1SGM A;  4DYQ A;  3S1M J;  4GCL A;  4RBO A;  2HYT A;  4AC6 A;  1RKT A;  2JMW A;  2R5Z A;  2XSD C;  2YVH A;  1BJZ A;  3LSP A;  2NVT J;  3A02 A;  2TCT A;  5DTD A;  1ETO A;  1DU6 A;  3BR6 A;  2M8G X;  3ON4 A;  2L7M P;  3S1Q J;  5F0F A;  1ETY A;  2O7O A;  4X6A J;  1RET A;  2NS8 A;  2YUS A;  1OJL A;  2LVS A;  4JX6 A;  2LY9 A;  4LOC A;  2R5Z B;  1T56 A;  4KWA A;  3HGY A;  1TWC J;  1ETV A;  2ID3 A;  3RZO J;  3AQT A;  2E2I J;  2EQR A;  2XRL A;  3GZI A;  1ETK A;  5FKK A;  2OF7 A;  2QKO A;  3IUV A;  1WH5 A;  1BL0 A;  3JRE A;  4V2G A;  5D19 A;  2K9S A;  2IBD A;  3JR9 A;  1IUF A;  3WHB A;  2E2J J;  3A01 B;  2NOG A;  4I6Z A;  2O8K A;  3C07 A;  5M5X J;  3CRJ A;  3O60 A;  1JUS A;  2QCO A;  3O8G A;  3ZQG A;  5IYC J;  2O9L A;  1FTZ A;  4GFL A;  2DA3 A;  5FLM J;  2LTP A;  3Q0U A;  4A3F J;  2E2H J;  2HKU A;  5DAJ A;  2XPW A;  1ETX A;  4ICH A;  3GEU A;  4QSH A;  2FJ1 A;  3E7L A;  2L7Z A;  3JRC A;  1SAN A;  4JKZ A;  3OIO A;  1W0U A;  5F08 A;  4AC0 A;  2Y31 A;  1Y1W J;  2X48 A;  2XGC A;  1UHS A;  1JGG A;  2ZB9 A;  2TRT A;  2CUE A;  3FIW A;  5M5W J;  2CRG A;  4ACI A;  4MO7 A;  2XGD A;  4UUS A;  5M5Y J;  3L1P A;  1IG7 A;  5FMP A;  1ZK8 A;  3S16 J;  2RAE A;  3GTQ J;  3HB9 A;  1B72 B;  3VW1 A;  2JA5 J;  1HCR A;  4XK4 A;  2XB5 A;  4D7M A;  1JTX A;  5E3M A;  4W1U A;  2I10 A;  5GP9 A;  5EGO A;  1H89 C;  2O7T A;  4UUT A;  5E3N A;  2K40 A;  3GTK J;  3PAS A;  2M0C A;  3D1N I;  5HBU A;  5EG0 A;  2E19 A;  5K7F A;  5FGL A;  1MBG A;  4GCK A;  3ANP A;  2Y0S N;  3JSJ A;  2DA6 A;  3FK7 A;  5C44 J;  4FTH A;  4A3G J;  3GBG A;  4AF5 A;  3GTP J;  4FCY A;  3HIM A;  3BR1 A;  5CXG A;  2NP3 A;  2KT0 A;  2QF7 A;  3EGQ A;  1PUF A;  3BTC A;  2D5V A;  2HI3 A;  1GV2 A;  2XPV A;  5EG0 B;  1A5J A;  5IOZ A;  1JUM A;  2P81 A;  3QQA A;  1U8B A;  1K61 A;  3GTL J;  4BXX J;  3VVZ A;  1ZTR A;  2V57 A;  3Q0W A;  2FX0 A;  4XRS A;  1WPK A;  4IHV A;  4Y52 J;  1ORK A;  5IPA A;  3TW6 A;  1MNM C;  2NX4 A;  3VPR A;  5EZH A;  1PUF B;  1H8A C;  3VIB A;  3DCF A;  2MW8 A;  3LSG A;  1XS9 A;  2YU9 J;  3ZQF A;  4C2M J;  2UXO A;  3LWJ A;  3CWR A;  1XG1 A;  3GTM J;  3B81 A;  2QWT A;  3P9T A;  2EZL A;  2ZCN A;  2JJ7 A;  2NP5 A;  3FK6 A;  4FE4 A;  3VP5 A;  3BHQ A;  2GEN A;  1IC8 A;  3AQS A;  3QBM A;  5FKL A;  3TP3 A;  5C4X J;  5GPA A;  1G2H A;  3RKQ A;  3S1N J;  3G1M A;  4FIS A;  3BG5 A;  2Q24 A;  2GLO A;  5J1R A;  3VVX A;  3S15 J;  3VOK A;  3SFI A;  4UDS A;  3OSF A;  1WCM J;  1JKO C;  3SDG A;  3NI7 A;  2ELK A;  1RPW A;  2CUF A;  3G1L A;  9ANT A;  3ZQC A;  1EF4 A;  1MBF A;  4DYR A;  2L9R A;  4I76 A;  3A01 A;  2DMU A;  3GTO J;  1HDP A;  4JP0 A;  2F07 A;  4V2F A;  1ZKG A;  3OOU A;  1FJL A;  2DMQ A;  5K58 A;  2DA5 A;  4M6V A;  3BT9 A;  5BNG A;  1GDT A;  2ME6 A;  4B1R A;  4A3E J;  1RKW A;  5HAW A;  4HNV A;  2Y9Z A;  2D6Y A;  3HOU J;  2WGB A;  2HXO A;  4M3E A;  1WH7 A;  2JWT A;  1E3O C;  2R7Z J;  2REK A;  5D18 A;  2DJN A;  5JLX A;  3HOX J;  1F43 A;  3BNI A;  4L62 A;  3GTJ J;  2M34 A;  1GT0 C;  4GCT A;  4MFE A;  5K7Z A;  5D1R A;  3BTL A;  4A3B J;  2EZK A;  3MKL A;  3EUP A;  4A93 J;  1QRY A;  2LFB A;  2JN6 A;  4A69 C;  5JLW A;  1MBK A;  3S17 J;  2HDD A;  1P7I A;  2CU7 A;  3HOW J;  1FIP A;  1RES A;  4CGR A;  5HSZ A;  3JRI A;  3TP0 A;  4AUX A;  2ZOZ A;  2ZCM A;  1ZR2 A;  5EF6 A;  5K7H A;  1HF0 A;  3V78 A;  1B72 A;  3NXC A;  2COB A;  2JA7 J;  1QPI A;  1BW6 A;  2H1K A;  2W53 A;  1R9T J;  3W6V A;  2Y30 A;  1CQT A;  1P7J A;  2HOA A;  2FBQ A;  4M3D A;  3BR5 A;  3GTG J;  2XDN A;  1B8I A;  3TED A;  4XRS G;  1MBH A;  3LJL A;  2GBY A;  3NPI A;  3QKX A;  1JJ8 C;  3A03 A;  2JA8 J;  2X6O A;  3MVP A;  2HYJ A;  3H0G J;  1VF9 A;  1U78 A;  2G7L A;  1K83 J;  4NEL A;  4D7N A;  3S1R J;  4MLO A;  2NVQ J;  1JKQ C;  2VPR A;  1HOM A;  2GFN A;  3HTJ A;  3B6C A;  1B8I B;  1T33 A;  3KKC A;  3BG3 A;  1GV5 A;  3G56 A;  3BCG A;  1AKH A;  3S14 J;  1FEX A;  2JA6 J;  5C4J J;  4RDU A;  2DMT A;  5C4Y A;  5IYB J;  4M3F A;  3I4M J;  1QVT A;  3HTH A;  4CYC A;  4A3I J;  4EEF G;  1XC5 A;  2NS7 A;  4IEJ A;  3ZOB A;  1JJ6 C;  1JUP A;  3Q3S A;  1H88 C;  1HDD C;  1SFO J;  1U9N A;  2R0Q C;  3HBL A;  2DMN A;  3KKD A;  2UXI A;  2WV1 A;  5F04 A;  1AKH B;  3RQI A;  1MBE A;  3PO2 J;  2QTQ A;  1GVD A;  1VND A;  1IGN A;  3LSJ A;  3CJD A;  1AU7 A;  1MSF C;  3CQZ J;  4CYC B;  1VI0 A;  5FLV A;  1X58 A;  3VW0 A;  4M3G A;  4L5E A;  5DS9 A;  5M3F J;  4AYB N;  4IHW A;  3M3Y J;  4IHY A;  5FHP A;  3KNW A;  3NRG A;  1TWG J;  5CW8 A;  2AO9 A;  4PXI A;  1TWA J;  4C3J J;  3ZQL A;  4A3J J;  3PM1 A;  3SJM A;  2JK3 A;  4W97 A;  2RAS A;  5F0C A;  1WI3 A;  2VI6 A;  1ZQ3 P;  5EFY A;  1JT0 A;  2OPT A;  4B3A A;  2XGE A;  3HEF A;  5IP6 A;  3K2A A;  3G7R A;  2IAI A;  2VUM J;  3JRB A;  2FQ4 A;  2OER A;  4DZJ A;  5E3O A;  3ZQI A;  2DTZ A;  5IP9 J;  1BW5 A;  2G0E A;  5F27 A;  5FJ8 J;  5IYD J;  2ECC A;  3BJB A; 
#chains in the Genus database with same CATH topology
 2L54 A;  5ICC A;  1TC3 C;  4C3I J;  1STZ A;  1MKM A;  2R7D A;  4BAY A;  1E0E A;  4EQQ A;  1HW2 A;  3IKT A;  2M0M A;  5D4S A;  3FMS A;  1B4A A;  3C18 A;  4KN7 X;  5IOY A;  2J5O A;  5LBQ A;  1NG7 A;  3EDP A;  4LJZ F;  4YG2 F;  3GLL A;  1GUU A;  1YO5 C;  1WJA A;  5GAG J;  2QEX I;  1IV8 A;  3UKG A;  2DA2 A;  1EH8 A;  2HKX A;  3M9A A;  2W48 A;  2CSO A;  3VTI A;  1S9H A;  3DXJ F;  2UXH A;  2EIJ H;  3C2H A;  2IS4 A;  1S7O A;  4JYK A;  1YS7 A;  4PJL A;  3S5R A;  5EZG A;  2K3F A;  2NS0 A;  2QLZ A;  1IO2 A;  4F7Z A;  2VPL A;  1U5T C;  2XB0 X;  1NK3 P;  1MJB A;  2DA7 A;  1LFU P;  1B9M A;  1HA8 A;  1I5Z A;  4EM2 A;  3QPL A;  5TIS C;  1PJR A;  2KDZ A;  4CHU A;  2W24 A;  4HV6 A;  5JVT A;  1DDN A;  2QIB A;  3OYD A;  1R5G A;  3COL A;  3CDL A;  1RC9 A;  4UVB A;  1MH4 A;  1KU2 A;  1MGT A;  3I4N J;  3EUH A;  3ZMD A;  4A6E A;  4HKU A;  1FP1 D;  4DBR A;  1NTC A;  4ESB A;  1I6X A;  1JGS A;  1MMG A;  2IRF G;  1I6H J;  3L00 A;  3BG6 A;  4G6D A;  2JRM A;  3E3V A;  5FKN A;  4HNT A;  2XF6 A;  2EIK H;  1BIA A;  3JRH A;  1S3J A;  2OZ6 A;  1D8K A;  3R0A A;  4BQO A;  1X3W B;  4U7D A;  2YSR A;  2XAU A;  3VOX A;  2M4K A;  4JX4 A;  3HKZ N;  1BOA A;  2PJR A;  1ZRE A;  2UXU A;  2QGU A;  1A6Q A;  2H8R A;  2Y2Z A;  4WX9 A;  4TV7 A;  4BE1 A;  1PVE A;  1D1A A;  2CO5 A;  4ETS A;  2LD5 A;  4A3D J;  4UV8 A;  1VTN C;  3FHN A;  2VB6 A;  3TO7 A;  1FSE A;  4IHS A;  3HGG A;  4YEL A;  2EFN A;  3Q5F A;  4IHX A;  1EJ9 A;  3IRR A;  5HLH A;  2L9N A;  4QIW N;  1GXP A;  4E7K A;  1H9T A;  2Y69 H;  1Z0X A;  4A12 A;  2HZD A;  3VYU B;  1XCB A;  1VFC A;  4G7O F;  3KET A;  3H3Z A;  2RN7 A;  3O3K A;  2Y0M A;  4IL6 C;  4BQA A;  4XRM A;  2QOP A;  3CP8 A;  3AG2 H;  5DD8 A;  3VW2 A;  2DLL A;  4O6J A;  1APL C;  5JHF A;  4IOA F;  3LA2 A;  3FXM A;  4IRG A;  5FFX A;  3A2K A;  1KA8 A;  2CW7 A;  1W4M A;  4FQG A;  1HLV A;  2VIX A;  1FIA A;  3BTI A;  4MK6 A;  5DV5 A;  2FXA A;  2WAF A;  3F3X A;  3B6A A;  3ZQQ A;  3BY6 A;  3DBH B;  3RD3 A;  2BY2 A;  4YZE A;  2OI8 A;  1PP8 F;  1RUN A;  3F0C A;  2GUH A;  2NXN B;  2VOP A;  1XD7 A;  3NAR A;  4EV0 A;  5M3M J;  4OU0 A;  1ON2 A;  3HRT A;  1FMV A;  1Y56 A;  1T6S A;  4BXF A;  4CZC A;  4QTR A;  2R7W A;  3HYI A;  2KMU A;  1BIB A;  2Z2S B;  4BNC A;  4BUP A;  2LY2 A;  4CGZ A;  1K6O A;  3BR3 A;  3TL4 X;  2R7U A;  3FM5 A;  3G1O A;  3GEZ A;  4C2U A;  2LDU A;  4BY7 J;  2B0L A;  2GOM A;  3HC7 A;  2PMZ N;  2CQX A;  1FBU A;  2Y9Y A;  2MLG A;  4U0W A;  2GM4 A;  4XSX F;  3CUO A;  5F6F A;  3RIR A;  3S2D J;  1DP7 P;  3RCO A;  2XPU A;  3HRM A;  3WU0 A;  4C9Y A;  5L3G A;  1IC8 A;  3F1B A;  4GFK A;  1V54 H;  2DMP A;  1LFB A;  1S29 A;  3BQZ A;  2LRE A;  5B1B H;  3W6J B;  3I0T A;  2IU5 A;  1JT6 A;  2R7R A;  2DG7 A;  4M74 A;  4DW6 A;  3K9T A;  4QLC U;  4X1E A;  5HLI A;  3LSM A;  3K70 D;  1POG A;  2B63 J;  1X3Z B;  2RHA A;  1SGM A;  2BXZ A;  4PZJ A;  2XUB A;  5FRM A;  2QVO A;  4XLN F;  5HS8 A;  5FB2 A;  2YVH A;  1BJZ A;  3ERE D;  1Q1H A;  1PUE E;  2OA4 A;  2CV1 A;  3ON4 A;  2L7M P;  1A36 A;  2QKM B;  2Q8K A;  2VE9 A;  1VZ0 A;  5IT9 K;  3HSF A;  4N9H A;  2EV6 A;  4ZTJ A;  3WE3 A;  1YI2 I;  4X6A J;  3RQ4 A;  5K5O A;  3WE2 A;  4OIO F;  3ERM A;  2DT7 B;  2FOW A;  1T56 A;  2GXB A;  3OOP A;  1J59 A;  4CZZ A;  3RZO J;  2EQR A;  2C6Y A;  4EM1 A;  1I3A A;  3GZI A;  3C3W A;  3HPH A;  4P55 A;  3ZPL A;  3IUV A;  3CJT B;  3JRE A;  1USS A;  3BZ6 A;  1QA6 A;  3E6C C;  3BZC A;  1ZRC A;  4I6Z A;  3CRJ A;  2PMH A;  2O8K A;  5M5X J;  4F55 A;  4IXA A;  4Y3O A;  2O9L A;  3SWH A;  3PUF A;  3L2V A;  5FLM J;  3PSF A;  4A3F J;  1IN5 A;  2HKU A;  5E8I A;  1TP4 A;  2V7F A;  4BDY A;  1ETX A;  2W25 A;  1SD7 A;  3X2Q H;  1L0O C;  1MJA A;  2G7U A;  4QSH A;  1IAW A;  2FJ1 A;  3GEU A;  1TZL A;  3H3U A;  4RAG A;  3BLY A;  3VDX A;  4GGG A;  4JKZ A;  3K4L A;  3HUG A;  3OIO A;  1BN5 A;  4H0E A;  3TOA A;  5E8G A;  1Z7L A;  2FRH A;  2HPI A;  5A2Q Z;  2JRT A;  2DAO A;  4LK1 F;  2RC4 A;  3WGG A;  4XKC A;  2XGC A;  3KEO A;  1T0F A;  2W1O A;  2ZB9 A;  1XB4 A;  4IO9 F;  2TRT A;  2CUE A;  1H9G A;  2XHK A;  4OIP F;  4EGZ A;  2IS1 A;  4LLG F;  5M5Y J;  2F2E A;  2XAQ A;  3S16 J;  1B72 B;  1T2K A;  2VON A;  1IN6 A;  2JVH A;  4D7M A;  5LD2 C;  3M8E A;  2IA0 A;  2GXG A;  1H89 C;  2OU2 A;  2V6E A;  2K40 A;  3GTK J;  1S72 I;  2KDO A;  5EG0 A;  3P9I A;  3PQJ A;  3ANP A;  4WXD A;  3OYJ A;  1OMI A;  3IWZ A;  5FGM A;  1H0M A;  2O0Y A;  2DA6 A;  3FK7 A;  1SFE A;  3FWE A;  4B8X A;  2XAH A;  4P96 A;  4M9Z A;  3BR1 A;  4WF2 A;  1FMW A;  5H6R A;  5B1A H;  3H5N A;  2PEX A;  2QF7 A;  3GUD A;  3EGQ A;  2TDX A;  3JTH A;  4PJM A;  5EG0 B;  1FP2 A;  1ZAO A;  2V79 A;  2V6C A;  4GCV A;  3M1C A;  1NHA A;  5HNF A;  4BXX J;  4XKV A;  4XOT A;  3WG9 A;  1F5T A;  3Q0W A;  2EWN A;  3F8F A;  2RQQ A;  3EUH C;  2F6C A;  3PJR A;  3IP4 B;  1D1B A;  1VQ9 I;  3TW6 A;  1MNM C;  1V5E A;  2MW8 A;  4P9U A;  2CQN A;  5B66 C;  2OUM A;  4DOZ A;  3NRV A;  4BEH B;  1Z91 A;  1P4A A;  4HAM A;  5CVU A;  3B81 A;  2QWT A;  3P9T A;  2ZCN A;  1R1T A;  3U1D A;  1IZ1 A;  2NP5 A;  2EV0 A;  2GEN A;  3TP3 A;  5C4X J;  5JVG F;  1D5V A;  3C7J A;  3BG5 A;  2P8T A;  4KT5 C;  1D0Y A;  1TQI A;  2ZXH A;  2GLO A;  4S04 A;  2HWV A;  5J1R A;  4LG0 A;  2W4S A;  1WCM J;  4HLY A;  1ZAR A;  3SDG A;  3O6B B;  3L2Q A;  5GAD J;  1TBX A;  2OZU A;  3HJE A;  4HF0 A;  4XOP A;  1WHU A;  4P9F A;  1MBF A;  2ESN A;  2JSP A;  3W3C A;  3A01 A;  2P7C B;  4KN4 X;  2F07 A;  2M30 A;  2FOK A;  2QZ8 A;  1FLI A;  3OOU A;  4LG0 B;  1DGR M;  1XTA A;  4M9X A;  1OYI A;  3HOT A;  3CCM I;  3W2W A;  3HOU J;  1WH7 A;  1E3O C;  1V5G A;  4FHT A;  4L62 A;  2XIG A;  3DKX A;  5JLX A;  1G59 A;  1Y39 A;  2EB7 A;  3KEY A;  1MW7 A;  5DEQ A;  1HKQ A;  1YW8 A;  2L4M A;  3L7W A;  5K7Z A;  3BTL A;  1OQY A;  4IVN A;  2DW4 A;  4ZYD A;  4A3B J;  2XV4 S;  3K4J A;  3RPQ A;  3HOS A;  2M87 A;  5JLW A;  1MBK A;  2CMP A;  3A4C A;  4KIF A;  3I56 I;  2CU7 A;  2CW8 A;  3QP6 A;  4WCG A;  2WWY A;  2WAE A;  1OCC H;  2ZCM A;  4ZTF A;  2BW3 B;  4DVY P;  2P7V B;  3V78 A;  6PAX A;  3DTK A;  3R0J A;  1OR7 A;  2JA7 J;  4FT8 A;  3GXO A;  2VT3 A;  1YX3 A;  1BW6 A;  2VBZ A;  3V42 A;  2IW5 A;  4XNF A;  1R9T J;  2GIZ A;  2ZFW A;  4RGR A;  4KIB A;  1IUY A;  2QSH X;  3MKZ A;  2IVM A;  2XDN A;  3R4K A;  4KIC A;  2R7T A;  1BI1 A;  3I54 A;  3FMR A;  1WVR A;  2P6T A;  2FBK A;  4V19 K;  2X6O A;  3MVP A;  2HYJ A;  4OAY A;  2O5R A;  4OOI A;  2VXD A;  3H0G J;  5D6E A;  2G7L A;  3PNV A;  4F92 B;  4D7N A;  4KDP A;  1SD6 A;  1I1S A;  1DP3 A;  3GFJ A;  4AYB A;  1U5T A;  3B6C A;  3WTW C;  1NG6 A;  4B3X A;  3KKC A;  1T95 A;  1QBJ A;  1GV5 A;  2LKP A;  3U9G A;  3D5L A;  2E71 A;  1T98 A;  2P6S A;  3ECH A;  4E70 A;  1IW7 F;  2A6H F;  2QKL B;  4Y13 A;  1O3S A;  2BZT A;  4M3F A;  3OIQ A;  3LA7 A;  4LIV A;  3KP6 A;  4IEJ A;  4OAZ A;  3K1N A;  1H88 C;  1U5T B;  3BG7 A;  4RS8 A;  2R0Q C;  2DMN A;  2UXI A;  4RB2 C;  2D45 A;  3TGN A;  4PFP A;  4LB5 A;  2Y75 A;  1VND A;  2PFV A;  3QPH A;  3LSJ A;  4AIK A;  2GAU A;  5DM6 F;  1VI0 A;  2KPM A;  3P9K A;  5LGT A;  1X58 A;  4QWQ A;  2QQ9 A;  4M3G A;  5M3F J;  5ICE A;  1QNT A;  2KZV A;  4NHJ A;  3M3Y J;  3NRG A;  1D0X A;  2A07 F;  1TWG J;  2AO9 A;  2UXX A;  3T8T A;  3VYR B;  1XGO A;  3ZQL A;  2RAS A;  2HOE A;  3H9J A;  3CDH A;  1IRX A;  5F0C A;  2VI6 A;  4ZJZ A;  3MD2 A;  4AU7 A;  5IP6 A;  2VUM J;  1IF1 A;  2FQ4 A;  4DZJ A;  2Y48 A;  2E35 A;  3Q9S A;  3WGH A;  3ZQI A;  4ICH A;  2X1E A;  2RKH A;  5IP9 J;  4HG2 A;  2ECC A;  4BHC A;  4QPQ A;  5FO5 A;  2V4J C;  4A5N A;  3HDD A;  4A3C J;  3VSK A;  3QU6 A;  1DUX C;  1TNS A;  3DTE A;  1ZGA A;  4E7L A;  2CQQ A;  2K86 A;  2L7F P;  3ESW B;  3NNR A;  1SD4 A;  1NK2 P;  1I3Q J;  2DXI A;  2M45 A;  2XAJ A;  3JAM K;  3S2H J;  2D1H A;  2A3S A;  3P5J A;  4ASN A;  4HA8 A;  2IA1 A;  1IV6 A;  4AM3 A;  4BJ5 C;  3HM5 A;  3HRU A;  4GXO A;  2G7G A;  1E2X A;  4UHT A;  1XGM A;  2V9V A;  1Z77 A;  2KIS A;  4HDV A;  4ENN A;  1N25 A;  4RB3 C;  1W7P A;  1FT9 A;  2KIM A;  3LAP A;  3W2V A;  4RGS A;  3DFG A;  2EFQ A;  2BY0 A;  3KEQ A;  1R71 A;  4JNN A;  5CXI A;  3E6B A;  3E5U A;  4MGR A;  1K4S A;  5J1Y A;  4XLC A;  2JZY A;  2XC7 A;  2KJC A;  4QPO A;  1TWF J;  4E7Z A;  3KE2 A;  4D1Q A;  2DO7 A;  2STT A;  1TW3 A;  1OFC X;  2FSW A;  1X2M A;  1W7P B;  1TQM A;  5EJC A;  3UR3 C;  4S05 A;  2V1N A;  3MNL A;  3ZMU A;  2L0K A;  5ED4 A;  2E5N A;  3HTI A;  3PSI A;  4HV5 A;  2DT6 A;  3VFZ A;  3ZN1 A;  3JAM Z;  4NDL A;  5EYR A;  3V7S A;  4KIG A;  1BBY A;  1RZ4 A;  2RQP A;  2LR8 A;  3WHC A;  4M6X A;  1R36 A;  2HQR A;  3VVY A;  2JPB A;  4YIF A;  2QWW A;  5EDN A;  5EEH A;  2FEZ A;  2M2E A;  3ABM H;  4A6D A;  4KNY A;  1Y0U A;  2CW0 F;  2FNA A;  3IRQ A;  1RR7 A;  4M9S A;  4WXH A;  4NC6 A;  5AIQ A;  4BBS J;  4HX8 A;  1XSX A;  4D5C A;  2GWR A;  4Y17 A;  3LNQ A;  1RUO A;  3BWG A;  3IH2 A;  4A3M J;  1SVO A;  1ZGW A;  1T08 B;  1XDU A;  4G7Z F;  3FX3 A;  3PPB A;  5FKM A;  3RH2 A;  1D8J A;  1X2N A;  3I5U A;  1G3Y A;  1X1C A;  5AQC A;  3E97 A;  5LLQ A;  3IHU A;  3QYF A;  2M5W A;  3GZ6 A;  1D5Y A;  1UI6 A;  1O3R A;  4NUB A;  3SZG A;  3EET A;  3CUQ C;  3SXY A;  4HF1 A;  4LB6 B;  2PBX A;  2EH3 A;  2E1O A;  3F72 A;  1EV7 A;  5LRR A;  2VJ5 A;  2FA5 A;  2YVE A;  4Z6Y A;  3AL0 B;  2W82 A;  1MD0 A;  1CGP A;  3BDD A;  3H36 A;  4GFB A;  4G6T B;  2VJI A;  3ZRG A;  4UY8 I;  2AS5 F;  1QHG A;  2UXP A;  3DEW A;  2CJJ A;  2BHY A;  2ECB A;  5EEA A;  2ZCX A;  2LOO A;  1MJ9 A;  2JVG A;  5HVQ C;  3HRS A;  2LLK A;  1ZEL A;  3OV8 A;  2FJI 1;  3LA3 A;  4M71 A;  1Q1V A;  2DFF A;  3G4S I;  3ON2 A;  2DI3 A;  3SEZ A;  3BTJ A;  4XIC A;  5BPD A;  3PL8 A;  3I4P A;  4Y15 A;  2K4J A;  4OD5 A;  2LK2 A;  5GPC A;  4E7H A;  3GW2 A;  2XRN A;  1I39 A;  2G3B A;  3JRG A;  3OS1 A;  1J9I A;  2A6T A;  1MBJ A;  4BL0 B;  3OYB A;  4CYD A;  2FD5 A;  1GLN A;  2EBI A;  3NEU A;  4G12 A;  2X9D A;  3TBI A;  3NAU A;  1OR7 C;  3QU3 A;  4DYC A;  1K7A A;  1ETQ A;  4A3K J;  5LHH A;  1OCR H;  3F9K A;  3QOP A;  3WOD F;  4U88 A;  4XOR A;  2DA4 A;  2BY1 A;  3TW7 A;  5LFA A;  4YRV A;  3GF2 A;  2EZI A;  2YS9 A;  4S0H B;  4Y33 A;  1YJW I;  3Q0V A;  2JSC A;  3S1M J;  4GRI A;  4HQE A;  2HYT A;  4AIH A;  2VKD A;  2CFO A;  2NRA C;  2BY3 A;  3QPT A;  1D3Y A;  5L3F A;  2XSD C;  3CCL I;  3CMM A;  5B5E C;  3A02 A;  5DTD A;  1DU6 A;  1ETO A;  2LNB A;  2DFH A;  1TQP A;  1ETY A;  2O7O A;  3AG1 H;  3KZI C;  3S3N A;  2DDB A;  1E3H A;  2NS8 A;  2QQA A;  3ZMS A;  3CD6 I;  2MBF A;  2A69 F;  2KFD A;  1X1P A;  1G3W A;  2LY9 A;  4LOC A;  1T8I A;  1SFX A;  1K78 B;  1ETV A;  1Y6I A;  3AG3 H;  4BH9 A;  5B3S H;  4PCQ A;  2XRL A;  3HSR A;  3D5S C;  4ESJ A;  4P1W A;  2WY7 Q;  3OY9 A;  1UAA A;  5D19 A;  2RNG A;  4L18 B;  3JR9 A;  2D6Y A;  1IUF A;  3WHB A;  2E2J J;  1OPC A;  2UV1 A;  3O60 A;  3E5Q A;  1JUS A;  1R00 A;  5IYC J;  4GYI A;  2EJR A;  2DOA A;  4GFL A;  2E60 A;  2LTP A;  1YIT I;  1FNN A;  2E2H J;  5DAJ A;  1UG0 A;  2Z1D A;  3SZP A;  1XN7 A;  4XMY A;  5DCM B;  4B47 A;  3PNY A;  2Z5U A;  5H2F C;  4LIT A;  2PG4 A;  5J6X A;  4G8X A;  1W0U A;  4AD9 A;  2X6Y A;  2MH2 A;  3FBI B;  1HW1 A;  2CUZ A;  2OV7 A;  2H94 A;  1Y1W J;  2X48 A;  5KCM A;  1JGG A;  4UB6 C;  3FIW A;  2XKP A;  3CLO A;  3M8J A;  3M8F A;  4MO7 A;  5LHI A;  1WWX A;  5TGT A;  4RAY A;  1ZK8 A;  3OYL A;  1XSV A;  2Z33 A;  3FF5 A;  4I99 C;  3TOB A;  3VW1 A;  3QYB A;  2GA1 A;  5HLT A;  2JA5 J;  2HQA A;  1X19 A;  2PFB A;  4XK4 A;  1HCR A;  3K70 C;  1JTX A;  4W1U A;  2O7T A;  3ZGK A;  3E6M A;  3VEP A;  4AWX B;  1B6A A;  2M0C A;  2E19 A;  3L09 A;  3J7A Y;  5D8L B;  2Y0S N;  2QSF X;  1N75 A;  1FOY A;  3MAJ A;  1SAX A;  1SMT A;  2M8E A;  3OL4 A;  5C44 J;  2Z3Y A;  1FPQ A;  2QQB A;  1ZLJ A;  2E1M B;  3Q9V A;  2W00 A;  3ZQ7 A;  5HDN A;  2L02 A;  5CXG A;  3BJ6 A;  1K6Y A;  2KT0 A;  4MQV A;  4U87 A;  3UNG C;  2VJJ A;  3BPX A;  3BTC A;  3PNT A;  2XPV A;  4BXU A;  5E1Z B;  1YS6 A;  1C0W A;  4ENM A;  4IQ4 A;  1E3P A;  4XN3 A;  5IOZ A;  1U8B A;  2E36 A;  3GTL J;  2O61 A;  3VVZ A;  5IY5 H;  1XGN A;  3IL2 A;  2V57 A;  2FX0 A;  2AQE A;  5J4V A;  4XRS A;  3HXL A;  1ORK A;  1RNL A;  2HFH A;  3DPT A;  5IPA A;  1H8A C;  4M72 A;  2UXO A;  3VUQ A;  5D4R A;  3G73 A;  4XBF A;  2BGC A;  3ZQF A;  3CF5 F;  1FY7 A;  5KVR A;  1KZH A;  1RIO H;  3CWR A;  4U9N A;  4A0Z A;  4BJT A;  1YJ9 I;  2LY1 A;  1UST A;  3GTM J;  4ZDL A;  2B9S A;  3V7C A;  4HNU A;  1IXR C;  3KLO A;  2H8W A;  1WFX A;  2A68 F;  4FE4 A;  3VP5 A;  1D0Z A;  2G7H A;  3AQS A;  3QBM A;  2DFI A;  2MD0 A;  1R4N B;  4AID A;  1X1A A;  4FIS A;  3W2A A;  2MD5 A;  3FXK A;  4L5J A;  2Q24 A;  1XCV A;  1JHF A;  3L2R A;  1U2W A;  3S15 J;  2K27 A;  3SFI A;  4UDS A;  2VL8 A;  3OYG A;  1JKO C;  3HTU A;  2XAS A;  1FC3 A;  3PIP F;  1LNW A;  2A5Y B;  2CUF A;  3G1L A;  3ZQC A;  5J40 A;  5A2Q K;  1BR2 A;  1LVK A;  3MQ0 A;  3AL0 C;  2P5V A;  2ZJ2 A;  1FOK A;  2HPM A;  1R58 A;  1HQC A;  1HSJ A;  3DPU A;  3ZP5 A;  3N05 A;  4LD5 A;  1ZKG A;  4V2F A;  1FJL A;  2OAZ A;  3OS0 A;  2NNN A;  2F5C A;  4D0P A;  3BT9 A;  2F5E A;  4B1R A;  5AON A;  3KYL A;  1RKW A;  5FRO A;  4HNV A;  2Y9Z A;  5HAW A;  4C2M A;  1RI7 A;  2Z16 A;  1FZP B;  4M73 A;  1F43 A;  1HW5 A;  1OLT A;  4FET A;  4RLQ A;  4BU2 A;  2F4O B;  3NS4 A;  1QZE A;  4EAT A;  1GT0 C;  4MFE A;  5D1R A;  1FYK A;  2EPF A;  4A93 J;  1QRY A;  1GVJ A;  1LKX A;  2QM3 A;  1S7A A;  1V3F A;  4ZYH A;  2HDD A;  1XSD A;  3TP0 A;  1L3L A;  3K4N A;  1W5T A;  5BOX A;  4BS9 A;  3OR1 C;  5HS7 A;  1HF0 A;  2KLO A;  1B72 A;  3V4G A;  1E17 A;  3QOD A;  1WJD A;  2VQL A;  2W53 A;  3W6V A;  2EV5 A;  1CQT A;  1P7J A;  1KQ0 A;  2FBQ A;  4KYW A;  1MND A;  4M3D A;  3F8B A;  3IKV A;  4HQM A;  2DFE A;  2W57 A;  1TNT A;  5LGN A;  4PGH A;  3QKX A;  4HYE A;  3WTU C;  4EJT A;  3TMO A;  3N97 A;  2JA8 J;  1J0R A;  5ILU A;  2IS2 A;  1X1B A;  4XKW A;  3SEQ A;  1RR8 C;  4YEJ A;  4MLO A;  3OYA A;  1S8N A;  3JSP A;  1HOM A;  2HEO A;  3HTJ A;  1Y8Q B;  2HTJ A;  4M6Y A;  1TLH B;  3BG3 A;  3G56 A;  3QP5 A;  1ZG1 A;  5C4J J;  2KRH A;  5C4Y A;  4L0Z B;  1WZ2 A;  2H09 A;  1KQ8 A;  2V9K A;  3I4M J;  5E18 F;  3HTH A;  4CYC A;  4A3I J;  4OMY A;  2I8D A;  2QQ8 A;  2NS7 A;  4HSR A;  3ZOB A;  3ZXS A;  1JUP A;  3E6D A;  3Q3S A;  4XLF A;  2WC2 A;  1FX7 A;  1U9N A;  3K6G A;  1MDM A;  2FE3 A;  3CLQ A;  1BR4 A;  2H6B A;  2ZKZ A;  3CJN A;  4A5M A;  4ZH4 F;  3CCJ I;  4BEH A;  5F04 A;  3RQI A;  4UXN A;  2JT1 A;  3D5R C;  4NQW B;  2A2F X;  3J81 K;  1WKM A;  1IGN A;  3CJD A;  4ESF A;  4I98 B;  1ULY A;  4EMS A;  3H5A A;  5GAH J;  4CYC B;  1F1Z A;  1KYZ A;  5FLV A;  3VW0 A;  4HEA 2;  2ICW G;  4HZF A;  4IHW A;  4HBL A;  1B59 A;  3CJQ B;  1MDM B;  1YLF A;  1TWA J;  4CCK A;  4C3J J;  4A3J J;  3KP2 A;  3AFH A;  2HDW A;  4PK4 A;  4A0Y A;  4XQF A;  2DTR A;  4II2 A;  2L4A A;  3H1C A;  1FBS A;  1WI3 A;  2FU4 A;  3CO7 C;  1ZQ3 P;  1LDD A;  2OPT A;  4B3A A;  1IRF A;  3HEF A;  4ZYA A;  4F52 A;  4RB1 A;  2OER A;  2E5Z A;  1AOY A;  3MKW B;  2G0E A;  5BQT A;  3BJB A;  3FKI J;  5JFR A;  3QRF F;  5HOD A;  1SAU A;  2ELH A;  3CCY A;  2DPU A;  4ZZL A;  2DQL A;  4ITV A;  5BMZ A;  3R60 A;  1LE8 B;  2VOO A;  3H9Q A;  3J81 Z;  2AXT C;  2RDP A;  4Q5S F;  3CUQ A;  2HQN A;  4CA0 A;  2WUI A;  4BKX A;  3A0H C;  4NN1 A;  4FAS D;  3JRF A;  2FBH A;  3TKY A;  3FDY A;  5H9T A;  2R3S A;  2E7X A;  2RGV A;  3FXO A;  1DU0 A;  4RM2 A;  2R93 J;  2PZ9 A;  2MC4 A;  4HX4 A;  4XRF A;  2ZJP F;  3I55 I;  2E1M C;  3ASN H;  4IOC F;  5J4Y A;  3V6G A;  3ZQH A;  3K4M A;  2WAQ N;  1O4X A;  2M4G A;  3U1K A;  3CUQ B;  1AA7 A;  3HKZ A;  3F8C A;  5J1U A;  2BW3 A;  2VBY A;  3ASO H;  3TO9 A;  3GVA A;  3ANG A;  1ERD A;  3CES A;  4RMN A;  1YW9 A;  3ULQ B;  2VC1 A;  5H20 A;  2DG8 A;  3HTA A;  3HIF A;  3E5X A;  1Y1V J;  1RRJ A;  2DU9 A;  3WTX C;  4FE7 A;  1A6I A;  1ENH A;  3K10 A;  3CME I;  4OD4 A;  4XID A;  1W1W E;  3BPV A;  4WK8 F;  3JCU C;  2ZNZ A;  1QZY A;  3HHG A;  4G7H F;  2VC0 A;  1OCT C;  1W36 C;  2WA0 A;  3BQY A;  3FHZ A;  3HOZ J;  2ZC2 A;  3WG7 H;  1IN4 A;  2LG4 A;  1YRN A;  2VOD A;  1BI0 A;  1JTY A;  3IC7 A;  1BJA A;  4BY1 J;  2HOS A;  2ZY9 A;  1VQK I;  1VQ6 I;  2H27 A;  1ZN2 A;  4EGY A;  1B1B A;  4MQ9 F;  2F4I A;  3AG4 H;  2VKV A;  2IEK A;  4BYY A;  3J80 K;  2B1E A;  4Q48 A;  2Q2E A;  2ZXI A;  4MEY F;  2WTE A;  3DLA A;  4JK1 X;  1YRN B;  3DP7 A;  1JE8 A;  5E3L A;  2QA4 I;  2O3F A;  3FXU A;  5IP7 J;  1GHC A;  1Z6R A;  5AIP A;  1Z9C A;  2K9N A;  3GX4 X;  5FRN A;  1R6R A;  1QVU A;  2BEO A;  2Q2E B;  2NVX J;  1ACI A;  2CH0 A;  3JRA A;  2R92 J;  3EYY A;  5DDG A;  1BR1 A;  3KZY A;  3LOC A;  2PMZ A;  4JBA A;  2MLK A;  3F21 A;  3VWB A;  1FWZ A;  1QU3 A;  2CS3 A;  1IDZ A;  3GCM A;  2K02 A;  2WY8 Q;  4N4N B;  1S7E A;  2X85 A;  3MN2 A;  2L9S A;  3WTZ A;  2DA1 A;  3OYI A;  2F5V A;  3DPJ A;  1PYV A;  3J80 Z;  1IRG A;  4OIQ F;  3EUK L;  4UUS B;  3GFM A;  1ZLK A;  4B4C A;  2DT5 A;  4KFC A;  2WBM A;  3BR0 A;  4Y7N J;  1V55 H;  3FRQ A;  3EQL F;  2VN2 A;  1W5C C;  2O8X A;  2D2W A;  2GZW A;  2K4B A;  2MA3 A;  3E1S A;  3DF8 A;  5EGO B;  2WB1 N;  2IXS A;  2NVY J;  3OL3 A;  5FLX K;  1LUJ B;  3RZD J;  1U6G A;  3E7Q A;  2M7B A;  5FFZ A;  2UUZ A;  2M9H A;  3CTA A;  5K1Y A;  3PFI A;  2W85 A;  4XN0 A;  2MG4 A;  4D5F A;  1KU9 A;  4BBR J;  1YOV B;  1U9O A;  4WXC A;  1DPR A;  1IDY A;  1IJW C;  4N9I A;  3I3L A;  5IT3 A;  4ZDP A;  4ZYG A;  1Z7U A;  2K9Q A;  4JL3 A;  2V1X A;  2MSY A;  1MSE C;  3I53 A;  3O8H A;  2ID6 A;  3CC4 I;  1JKP C;  1F36 A;  5ERI A;  5ICG A;  3JTG A;  2G9W A;  2P5K A;  5D5V B;  3CCE I;  1OCP A;  3JRD A;  1AHD P;  1V4R A;  4MIM A;  5L3E A;  1EH6 A;  2AHQ A;  2KRF A;  3B02 A;  3MEX A;  4LGW A;  3HOV J;  2N8G A;  4DYQ A;  1Z3X A;  4GCL A;  3GZ5 A;  1RKT A;  3OYM A;  3LAJ A;  3R61 A;  4XKB A;  5FLX Z;  4WWC A;  2MAB A;  2QSG X;  2YX7 A;  4C2T A;  3LSP A;  2TCT A;  3BR6 A;  3FXL A;  2M8G X;  3K1P A;  2HKO A;  3WTY C;  3S1Q J;  4YFN F;  1P4X A;  1IN8 A;  4CUG A;  3G6E I;  5ILV A;  1PP7 U;  4UUV A;  1OJL A;  2ISY A;  4G94 A;  2LVS A;  4JX6 A;  4KWA A;  2RV8 A;  3BC8 A;  2GA2 A;  2ID3 A;  5LHG A;  3AQT A;  2VT2 A;  1V5F A;  4MHG A;  3A0B C;  2OF7 A;  2QKO A;  1U0J A;  2R7Q A;  1FBQ A;  1WH5 A;  1BL0 A;  1Z05 A;  4V2G A;  1LB2 A;  3K0L A;  5DM7 F;  2IBD A;  2E7W A;  2YX4 A;  4EJO A;  1WJB A;  2X4H A;  2DYR H;  4I02 A;  2Z99 A;  3ZQG A;  2QCO A;  2OCC H;  3O8G A;  4ENK A;  3MCZ A;  3LSH A;  3Q0U A;  1X4O A;  2DYS H;  5JR3 A;  3OYE A;  2XPW A;  1KON A;  2H6C A;  2GIV A;  3E7L A;  2DOF A;  1REP C;  1SFK A;  1R7J A;  3LQR A;  4N4O B;  4E6K G;  2L9V A;  2ZFU A;  3RKX A;  4CIC A;  3DKY A;  3QAH A;  3U2R A;  2M3A A;  4RA2 A;  3ZMV A;  5F08 A;  2V1D A;  3F8M A;  2FQ3 A;  2Y31 A;  5KAI C;  4AC0 A;  2NNY A;  3RPU A;  3LST A;  2DJI A;  1UHS A;  4PUS A;  1N77 A;  3DV8 A;  2XAF A;  4ACI A;  3L1P A;  5FMP A;  1IG7 A;  3HB9 A;  4IZZ A;  1MZB A;  3TQN A;  2XB5 A;  5E3M A;  5GP9 A;  2I10 A;  2H1L A;  1YIJ I;  1QQI A;  1S6L A;  3PAS A;  2W84 A;  5D5W B;  1JI8 A;  3TDU C;  5FGL A;  1ZGJ A;  2W7N A;  3ELK A;  3BJA A;  1OYY A;  1U8R A;  3R6S A;  4FTH A;  2EA2 A;  2UXN A;  3GBG A;  3DEE A;  3GTP J;  1UCR A;  3G3Z A;  2B3W A;  2KRC A;  3K1M A;  3H0D A;  3HIM A;  2I5U A;  2CFX A;  4BE2 A;  3OS2 A;  3MMY B;  1PUF A;  2D5V A;  5EEG A;  4UV9 A;  5K5R A;  1GV2 A;  1K79 A;  2FF4 A;  3FXJ A;  1IXC A;  1B9N A;  1F9N A;  1HC8 A;  3U21 A;  3I58 A;  4E7S A;  2IGO A;  2KIQ A;  5HS9 A;  1SD5 A;  1JUM A;  2P81 A;  2XSJ C;  3DKW A;  3QQA A;  1K61 A;  3AKZ A;  1ZTR A;  1FSH A;  3CCV I;  2KZG A;  4XR6 A;  5H6Q A;  1MMD A;  4Y52 J;  3W6K B;  4OWR B;  4HF2 A;  1WJ5 A;  3MFK A;  4BDZ A;  1BI2 A;  2L7K A;  1OYW A;  2NX4 A;  3VPR A;  5EZH A;  1PUF B;  1MMS A;  2YU9 J;  1XS9 A;  3GZN B;  1XG1 A;  3SHF A;  1CF7 A;  4EM0 B;  5KK1 A;  4BAC A;  3P7N A;  3F22 A;  4HPQ A;  3ABK H;  5CLS A;  5J8F A;  2WAQ A;  1N78 A;  3BHQ A;  5FKL A;  2ELJ A;  2LBF A;  1G2H A;  5DD4 A;  3RKQ A;  2XF7 A;  3JW4 A;  2JUG A;  1K78 A;  2NAZ A;  2NOJ B;  4BHB A;  4DQ2 A;  3VVX A;  3HSE A;  1CF7 B;  2X6W A;  3CDI A;  3OSF A;  1SMY F;  1UJ8 A;  2AQF A;  3RI4 A;  3F6V A;  5CVV A;  4IRI A;  1HXD A;  1X3U A;  3OWT A;  1EF4 A;  2IGK A;  2LBF B;  2DCE A;  3BCA A;  3K2Z A;  2BBY A;  2L9R A;  3LFK A;  3KP3 A;  5K5Q A;  2DMU A;  2R7O A;  1VQ7 I;  1HDP A;  4I09 A;  4JP0 A;  3GTO J;  5CPR B;  1S5L C;  4BQQ A;  4KJZ A;  1UZC A;  4AVP A;  1XGS A;  2IS6 A;  2L01 A;  2DA5 A;  2MC3 A;  3DWL E;  1ZRF A;  4A3E J;  5FD5 A;  1YIO A;  1G8X A;  5DCM A;  1WJF A;  1ON1 A;  4CSW A;  3FMQ A;  3GYH X;  3S3O A;  1SFU A;  1VQ4 I;  2A5W A;  2JWT A;  4M3E A;  2VBW A;  4L0Y B;  2R7Z J;  3CC7 I;  2REK A;  1LPQ A;  1ZH5 A;  3BNI A;  4IHT A;  3PIO F;  5D18 A;  2HR3 A;  1R5H A;  4XON A;  1J75 A;  1M1E B;  4GCT A;  3CJR B;  3F6O A;  1R23 A;  4UVA A;  4D9J A;  4GO1 A;  2ISZ A;  3IWF A;  2EZK A;  3MKL A;  5CJ9 A;  2LFB A;  3GME A;  3M1E A;  3FXQ A;  4NNJ A;  1O7L A;  2D1V A;  4IX7 A;  4CGR A;  1RES A;  3EUA A;  2ZOZ A;  2DBB A;  2OQG A;  5K7H A;  3KIO A;  2R7S A;  2COB A;  1O3Q A;  3FBN B;  4P5O A;  2HYF A;  4XLA A;  2E1C A;  3L9F A;  2H1K A;  4DBQ A;  2Y30 A;  2LKS A;  2M1B A;  1UB9 A;  3BR5 A;  3GTG J;  1B8I A;  2L5Q A;  2CGP A;  2NVU B;  3ONQ A;  1UHW A;  4MNU A;  1LEB A;  3J7A O;  5DUK A;  3NPI A;  5D6F A;  1SVL A;  2LYC A;  3DBR B;  3LL7 A;  4OIR F;  2F4M B;  5KNL A;  3KYD B;  2Q0O A;  3B73 A;  1VF9 A;  1U78 A;  3BP8 A;  1XDS A;  1WJC A;  2ZO4 A;  1P2F A;  3S1R J;  3S3M A;  4PDK A;  3KP4 A;  2DOE A;  4Q4Z F;  1T39 A;  1JKQ C;  1BC8 C;  3CMA I;  2GFN A;  1B8I B;  1SEU A;  2WB1 A;  2XKO A;  3HHH A;  2KIF A;  4UB8 C;  3S14 J;  2JA6 J;  4RDU A;  3O2P E;  1U3E M;  4NC7 A;  3V8L A;  5IYB J;  2PJR B;  2EK5 A;  4YFX F;  3EYI A;  1DQU A;  2DPD A;  4IRH A;  4H4K C;  4BJ6 C;  1QVT A;  1ZG5 A;  3ISP A;  2JTV A;  2ZXW H;  4EEF G;  5KHD A;  1JJ6 C;  1ONV A;  5E17 F;  3G2B A;  1HDD C;  3RKW A;  1SFO J;  2R7F A;  3OYK A;  2WV1 A;  3VOE A;  2ZCW A;  1MBE A;  1P9Q C;  2GXA A;  3PO2 J;  4R8H A;  4KT6 A;  1G3T A;  3L2C A;  2K5C A;  3GWZ A;  3CQZ J;  3PUB A;  1AU7 A;  4BQN A;  4DGW B;  4Z2Y A;  3RYP A;  1VQN I;  2O6G E;  4L5E A;  3T5X A;  4AYB N;  1YYV A;  4IHY A;  4XLH A;  5FHP A;  2HVQ A;  5CW8 A;  4PXI A;  2LH9 A;  4YII A;  2F5F A;  3VSL A;  1HKS A;  5CYV A;  1KU3 A;  2V1U A;  1QZZ A;  1J2X A;  4E4H A;  2VBX A;  1R1U A;  4B48 A;  2RVC A;  1LQ1 A;  2HS5 A;  1JXS A;  3LFU A;  3H5R A;  1R49 A;  5EFY A;  1YFH A;  2XGE A;  2OBP A;  3JRB A;  4DIQ A;  2OCE A;  4U7B A;  2ZNY A;  2BOL A;  1BW5 A;  5IYD J;  5F27 A;  4PJ0 C;  4E7J A;  3HZJ A;  4EJU A;  4L9V A;  4U9L A;  1O7F A;  2BYV E;  4HW0 A;  5TJJ A;  4GDF A;  4B43 A;  4IPA A;  2FMY A;  1TTY A;  3FIS A;  1LVA A;  5CKT A;  2HOT A;  1MMN A;  2ZME A;  1UI5 A;  3BRU A;  3CMY A;  4CCJ A;  2G7S A;  2BVL A;  5HDK A;  3M4O J;  3KP7 A;  2QBY A;  1TWH J;  3PO3 J;  1FYL A;  4CDG A;  1YG2 A;  2PX9 A;  4I01 A;  2BHZ A;  3MKY B;  2RNJ A;  3EPZ A;  3FKJ A;  3H3V K;  4NBQ A;  4PSW A;  1R1V A;  5J3L A;  2DQR A;  2KL4 A;  5GTI C;  2ZJQ F;  1IXS B;  1ZRD A;  2ZME B;  1UMQ A;  4ABZ A;  1I27 A;  2COM A;  2OTL I;  2DN0 A;  2QBY B;  4LG3 A;  1W7P D;  4RLF A;  2KKO A;  2HVR A;  1ETW A;  4CCO A;  2CQK A;  3BG9 A;  4ME9 A;  2LP0 A;  2L3D A;  4J00 A;  1EA3 A;  1OCZ H;  3BZK A;  3KZZ A;  3ZN0 A;  1MMA A;  3RKY A;  1WI9 A;  2FUG 2;  3HE0 A;  2KJB A;  2YPR A;  3IH3 A;  1A35 A;  2VKE A;  1SC7 A;  3K69 A;  3OR2 C;  4EVI A;  5DCF A;  4RAZ A;  4XM3 A;  2R5Y A;  1VQ8 I;  4PFO A;  4IKF A;  1DPU A;  3DQV C;  2RRE A;  4IQJ A;  4CCN A;  4M3B A;  1R22 A;  4ENJ A;  2L2O A;  1KGS A;  3OYH A;  1FTT A;  1XPX A;  2A05 A;  4OMZ A;  5ICF A;  3QPS A;  2HYG D;  4A3L J;  2J5P A;  3OSG A;  2EFO A;  3BOQ A;  5CVJ A;  4C3H J;  4G9Y A;  5IT9 Z;  4LFU A;  4EJW A;  1I50 J;  2ZXJ A;  2R5Y B;  1XMX A;  1LFP A;  1G4D A;  3BJO A;  4MTE A;  1ZR4 A;  1BA5 A;  2PBI A;  4UVC A;  2PLY A;  4DZP A;  2HZT A;  3F8N A;  3IUO A;  2KP6 A;  3LHQ A;  4R79 A;  3RJP A;  5F1J A;  2BV6 A;  3IV5 A;  3REO A;  3RPU D;  1MIJ A;  4NQW A;  1P4W A;  1X1D A;  1J7K A;  1YHQ I;  3H9G A;  3SZT A;  1WGX A;  1X4P A;  3HUG B;  3P9C A;  3VB2 A;  2GQQ A;  4OIN F;  2F48 A;  2EZH A;  1JHH A;  5D5X B;  3BR2 A;  3NWS A;  1OCO H;  3K7A J;  2K9M A;  1JKR C;  3KZ9 A;  3ABU A;  3MWM A;  4F93 B;  1UG2 A;  2PI0 A;  2IGM A;  1HST A;  2JQ7 A;  5TRD A;  2LF8 A;  3C2B A;  2CQ7 A;  2PQ8 A;  1FOW A;  3S2W A;  1TT0 A;  2VQG A;  1ODD A;  3DLL F;  1IRZ A;  3DPL C;  2XAG A;  2EA4 A;  2HXI A;  5LGU A;  3DU5 A;  3WGI A;  3GLX A;  5FKO A;  4J01 A;  2ME0 A;  1MH3 A;  1W5S A;  2MGQ A;  3LSK A;  4ON0 A;  3SDB A;  3QOE A;  4YFK F;  2E1N A;  4RAF A;  3KCC A;  2LKX A;  3H35 A;  4LK0 F;  2HQ5 A;  1YX5 A;  3SFZ A;  3T6N A;  1LE8 A;  1ITY A;  5CQE A;  1GXQ A;  2XVC A;  5HDG A;  2QUF A;  3IH4 A;  2ZOY A;  3ROU A;  1VQM I;  2K9L A;  1Z3Y A;  1W0T A;  1F4K A;  5HLG A;  3HOY J;  4R1H A;  4J19 A;  4L5I A;  2HVS A;  2IT0 A;  3RTR A;  5F0H A;  2ZBK A;  1QO0 D;  4IJA A;  1ZYR F;  3HG9 A;  2B7E A;  1KU7 A;  3CCR I;  4PJN A;  2P4W A;  4JX5 A;  1O57 A;  3ECO A;  1WRJ A;  2M7A A;  1EH7 A;  2OTJ I;  3AAF A;  3ZMZ A;  3LSR A;  5J47 A;  3CO6 C;  2YR2 A;  3CF2 A;  5C3E J;  4MFD A;  2GOX B;  4MXM A;  3V7R A;  4ZZD A;  2EIM H;  3F23 A;  1P6R A;  4ANJ A;  4RBO A;  4C30 A;  4AC6 A;  4AIJ A;  2JMW A;  5CVR A;  2R5Z A;  4KA4 A;  2STW A;  4A2U A;  2JUC A;  3K8P C;  2NVT J;  3T8R A;  4PJJ A;  2EIL H;  2R4G A;  4JOM A;  3IAS 2;  1ZHF A;  5F0F A;  1IN7 A;  4U0Y A;  1RET A;  4BGD A;  4X0G A;  2WV0 A;  2YUS A;  3PQK A;  4BHP A;  1LEA A;  1R5I D;  1TT5 B;  3S93 A;  2R5Z B;  4RM3 A;  4RGU A;  3HGY A;  1TWC J;  5BS6 A;  1LJ9 A;  3C2G A;  5JI6 A;  2E2I J;  2K7L A;  4NB5 A;  1VQ5 I;  5F1R A;  2X1D A;  1ETK A;  5FKK A;  1LDK B;  1Z67 A;  2K9S A;  3KLN A;  2LC2 A;  2IJL A;  2HNH A;  4UNO A;  1UFM A;  4FX0 A;  3A01 B;  2NOG A;  3C07 A;  3OYC A;  1HBX G;  1VQP I;  1FTZ A;  1QPM A;  1TW2 A;  2DA3 A;  3T0Y A;  4HOB A;  1Z6T A;  1KQ9 A;  3RYR A;  1XMA A;  2BXY A;  3KYC B;  2L7Z A;  2Y0S A;  2OQR A;  3JRC A;  1SAN A;  3I64 A;  4G6Q A;  3S32 A;  5LRS A;  1FOX A;  1AWC A;  4ZC3 A;  5JHU A;  1R4M B;  4PGG A;  1KYW A;  3GFI A;  2P5L C;  2X6X A;  4K2E A;  1BOB A;  5F64 A;  3RDI A;  3I71 A;  5GAE J;  3WU1 B;  2ACJ A;  1BM9 A;  3SYT A;  5M5W J;  3PFY A;  3M07 A;  2CRG A;  3OIP A;  2XGD A;  4UUS A;  1XMK A;  2FBI A;  1YTY A;  4LMY A;  4HX7 A;  2DOD A;  2RAE A;  4KMU X;  3GTQ J;  4DJA A;  2R7V A;  2IP2 A;  2EFP A;  3KP5 A;  4HST A;  5KAF C;  3J7Y J;  3E0J B;  4L9T A;  2CV2 A;  5EGO A;  3V8J A;  2BVM A;  4UUT A;  5E3N A;  2ZME C;  3GO5 A;  3D1N I;  5HBU A;  2VLA A;  3ML6 A;  4GCK A;  5K7F A;  1MBG A;  4I0A A;  4II3 A;  3V8K A;  3JSJ A;  4KMF A;  4A3G J;  2X0L A;  4AF5 A;  5HOO A;  4FCY A;  3DU6 A;  3K4K A;  2V26 A;  2ESH A;  4HLX A;  3WTS C;  4B44 A;  4XLE A;  2XF5 A;  2XDV A;  1O3T A;  3ABT A;  3C1D A;  2YVX A;  4I2O A;  2VQH A;  2ETH A;  1YW7 A;  4AVZ A;  4YIR X;  2NP3 A;  2KHM A;  3DTI A;  4LLN A;  2V9P A;  1T38 A;  2LSO A;  2HI3 A;  3HPG A;  3CZ6 A;  4RGX A;  5DUI A;  1A5J A;  1W36 D;  3K4B A;  3ZCO A;  3I9V 2;  2OD5 A;  5HNH A;  3LSI A;  5D5U B;  1Y0N A;  4GYG A;  1WPK A;  3FM3 A;  3MZ8 A;  5LEJ A;  4IHV A;  2MH9 A;  4CXF A;  2PJP A;  1WSU A;  3M7G A;  3L2W A;  1HKT A;  1VQO I;  2Z9O A;  3JSO A;  3VIB A;  1PDN C;  4HRI A;  3DCF A;  3LSG A;  4C2M J;  1BI3 A;  3LWJ A;  1G6N A;  2Q1Z B;  5E1X A;  5L3D A;  4A0X A;  5E20 A;  1QGP A;  3N4M A;  2VQC A;  3J7Z I;  2VKH A;  2EZL A;  2DK8 A;  2CG4 A;  4CCM A;  1I1G A;  2JJ7 A;  2OJE D;  3FK6 A;  2NYX A;  1NH3 A;  3VYT B;  4FX4 A;  3LQQ A;  3H92 A;  3LWF A;  2JA2 A;  5BPI A;  1YJN I;  5GPA A;  3HL2 A;  3KPH A;  1YQA A;  2WAD A;  2AXL A;  3G1M A;  3WTT C;  4HDU A;  3S1N J;  2MYS A;  4ZYE A;  5LEK A;  1XX5 A;  4XL9 A;  2VE8 A;  3MZH A;  2IA2 A;  3SQN A;  2ZSH B;  3MZY A;  4IRV A;  3VOK A;  1OKR A;  4I0B A;  3FZV A;  2YU3 A;  3VYS B;  3NI7 A;  2ELK A;  3CCS I;  3LMM A;  2ZSI B;  2DDA A;  1T0F C;  1RPW A;  1EKE A;  1WQ2 A;  9ANT A;  2A61 A;  2R7X A;  2XRO A;  2LRD A;  4MEX F;  4DYR A;  4I76 A;  1VQL I;  1BC7 C;  4E7I A;  3QWL A;  5ILS A;  4F91 B;  4Q47 A;  3HTS B;  3COA C;  3CCU I;  2EIN H;  4XLP F;  4U0V A;  2DMQ A;  4MTD A;  5K58 A;  4M6V A;  3CP2 A;  1GDT A;  5BNG A;  2OC6 A;  2ME6 A;  4EJV A;  2A6E F;  2WGB A;  2HXO A;  2MFZ A;  2DJN A;  3HOX J;  4KIT B;  1MNE A;  1Z1D A;  2K3P A;  3GTJ J;  1SVM A;  2CWE A;  2M34 A;  4CO8 A;  3A1Y A;  5D8K B;  4BE0 A;  2E34 A;  3EUP A;  2FML A;  2JN6 A;  4A69 C;  2KIU A;  2O03 A;  3S17 J;  3T1B A;  2KQR A;  1P7I A;  3HOW J;  1FIP A;  5HSZ A;  3JRI A;  4AUX A;  2XGX A;  1Z21 A;  1ZR2 A;  1FYM A;  5EF6 A;  1YE9 A;  3NXC A;  3OMY A;  1G3S A;  4O5V A;  2UZK A;  1QPI A;  1A31 A;  2HTS A;  2P0W A;  2FNP A;  4IF4 A;  2HOA A;  2HU9 A;  4XSZ F;  2PMU A;  3TED A;  4XRS G;  4ZDO A;  1MBH A;  2QEN A;  4KIS A;  2GBY A;  4CCL A;  3LJL A;  3ZMT A;  1JJ8 C;  3A03 A;  1Y8R B;  3QYE A;  5L3B A;  3TDZ C;  4PSX A;  1K83 J;  3WTV C;  2HDC A;  4NEL A;  5CQG A;  3KX2 A;  2CV0 A;  1QHH D;  2VJ4 A;  3OYF A;  2NVQ J;  1UEL B;  2VPR A;  2K85 A;  3ZR8 X;  1T33 A;  2F5D A;  1ZG3 A;  5E1W A;  5E79 C;  1UHM A;  4I7H A;  3BCG A;  1AKH A;  1FEX A;  2CYY A;  3TO6 A;  2DMT A;  3G71 I;  4JQF A;  2LF7 A;  2IPQ X;  4B09 A;  3NQO A;  4KUM A;  3OYN A;  3VOD A;  3I59 A;  3K4C A;  2UWM A;  1DGW Y;  1J09 A;  4F3Q A;  4WIB A;  4DNC A;  1XC5 A;  4LLL A;  1D1C A;  3GFL A;  4NC8 A;  3BRO A;  5CVI A;  3D0S A;  4RB0 A;  4CH7 A;  3HBL A;  3KKD A;  3NWT A;  2ADU A;  1AKH B;  3S8P A;  2BE5 F;  2QYO A;  2X1C A;  2QTQ A;  1GVD A;  5DYM A;  1K4T A;  3I59 B;  1MSF C;  1J5Y A;  2VAS A;  4O3M A;  2IGN A;  1WJE A;  5DS9 A;  3IAM 2;  4L9J A;  5FD6 A;  3DEU A;  3CC2 I;  3RSN A;  3KNW A;  3L2U A;  3CCQ I;  4N0B A;  3PM1 A;  3WU2 C;  2EFW A;  2JK3 A;  4W97 A;  5L3C A;  3SJM A;  3BCB A;  1TL8 A;  3FXR A;  5GTH C;  2PN6 A;  2DK5 A;  2VXZ A;  1JT0 A;  1OIS A;  3KFW X;  4L9N A;  2LMD A;  3K2A A;  3G7R A;  2IAI A;  2HGC A;  2X51 A;  1LDJ A;  2JPC A;  1A04 A;  5E3O A;  1P92 A;  2ZJR F;  2DTZ A;  3ABL H;  5J8C A;  4LIU A;  4Y4R A;  3DBL B;  5FJ8 J;  2CUJ A; 
#chains in the Genus database with same CATH homology
 3FKI J;  3HDD A;  1TC3 C;  4C3I J;  4A3C J;  5HOD A;  3CCY A;  1LE8 B;  5IOY A;  2CQQ A;  3FIS A;  2L7F P;  2HOT A;  1GUU A;  1UI5 A;  3BRU A;  3CMY A;  3NNR A;  2G7S A;  2WUI A;  3M4O J;  4BKX A;  1NK2 P;  4NN1 A;  1I3Q J;  1TWH J;  3PO3 J;  3UKG A;  2DA2 A;  3S2H J;  3JRF A;  5H9T A;  2W48 A;  1DU0 A;  2R93 J;  2UXH A;  2PZ9 A;  1IV6 A;  3HM5 A;  3H3V K;  3V6G A;  2G7G A;  3ZQH A;  4JYK A;  3S5R A;  5J3L A;  5EZG A;  1Z77 A;  2WAQ N;  1O4X A;  2XB0 X;  1NK3 P;  1UMQ A;  2DA7 A;  5J1U A;  1LFU P;  4ABZ A;  3ANG A;  3QPL A;  2DN0 A;  4JNN A;  5CXI A;  2KDZ A;  2DG8 A;  3HTA A;  1ETW A;  2QIB A;  1Y1V J;  5J1Y A;  3BG9 A;  4ME9 A;  3COL A;  2LP0 A;  3CDL A;  4FE7 A;  1A6I A;  1ENH A;  1MH4 A;  1TWF J;  4XID A;  3I4N J;  1OFC X;  4HKU A;  1X2M A;  1OCT C;  3HOZ J;  3BQY A;  3MNL A;  1NTC A;  3HE0 A;  2L0K A;  3IH3 A;  1I6H J;  2VKE A;  5FKN A;  3HTI A;  2R5Y A;  1YRN A;  4NDL A;  5EYR A;  1JTY A;  4BY1 J;  2HOS A;  3JRH A;  2LR8 A;  3WHC A;  4M3B A;  2VKV A;  3VVY A;  3VOX A;  2IEK A;  1FTT A;  4JX4 A;  3HKZ N;  5EDN A;  3QPS A;  2M2E A;  4A3L J;  3OSG A;  4C3H J;  2UXU A;  2H8R A;  2Y2Z A;  1I50 J;  2R5Y B;  1RR7 A;  2LD5 A;  1YRN B;  4A3D J;  4BBS J;  1ZR4 A;  5E3L A;  4D5C A;  1BA5 A;  5IP7 J;  4DZP A;  3LNQ A;  3IH2 A;  3HGG A;  4A3M J;  4IHX A;  3LHQ A;  4QIW N;  2K9N A;  1ZGW A;  5F1J A;  3IV5 A;  1QVU A;  1Z0X A;  3PPB A;  3RH2 A;  5FKM A;  1VFC A;  2NVX J;  1X2N A;  3JRA A;  2R92 J;  1WGX A;  4XRM A;  2QOP A;  5AQC A;  3VW2 A;  3LOC A;  1APL C;  2EZH A;  1D5Y A;  1UI6 A;  3BR2 A;  1HLV A;  1IDZ A;  1FIA A;  3BTI A;  4MK6 A;  3VUQ A;  3K7A J;  1JKR C;  2PBX A;  3KZ9 A;  1S7E A;  2EH3 A;  2E1O A;  3MN2 A;  1UG2 A;  2DA1 A;  3B6A A;  3DPJ A;  2YVE A;  3RD3 A;  4UUS B;  3C2B A;  4YZE A;  4B4C A;  2OI8 A;  3BR0 A;  3F0C A;  2GUH A;  4Y7N J;  4GFB A;  3NAR A;  3FRQ A;  5M3M J;  1IRZ A;  2UXP A;  2HXI A;  3DEW A;  2CJJ A;  5EGO B;  2WB1 N;  5FKO A;  4QTR A;  2ECB A;  2ME0 A;  2NVY J;  1MH3 A;  5EEA A;  2MGQ A;  2ZCX A;  3RZD J;  3BR3 A;  3E7Q A;  3G1O A;  2LKX A;  2LLK A;  2HQ5 A;  2M9H A;  4BY7 J;  3T6N A;  1Q1V A;  3ON2 A;  1LE8 A;  1ITY A;  4XIC A;  3BTJ A;  2PMZ N;  3IH4 A;  2ZOY A;  2MG4 A;  2CQX A;  4D5F A;  4BBR J;  2Y9Y A;  1W0T A;  3HOY J;  2LK2 A;  5GPC A;  1U9O A;  4J19 A;  1IDY A;  2GM4 A;  2G3B A;  3JRG A;  1IJW C;  3S2D J;  1MBJ A;  5F0H A;  2XPU A;  2FD5 A;  2EBI A;  3F1B A;  4G12 A;  2K9Q A;  2X9D A;  4JL3 A;  3NAU A;  4GFK A;  1MSE C;  2DMP A;  2MSY A;  3O8H A;  2ID6 A;  1LFB A;  4DYC A;  3BQZ A;  1ETQ A;  4JX5 A;  4A3K J;  1JKP C;  1F36 A;  2IU5 A;  1JT6 A;  1OCP A;  2DA4 A;  3LSR A;  3TW7 A;  4DW6 A;  3JRD A;  1AHD P;  2DG7 A;  4X1E A;  5C3E J;  4MFD A;  2EZI A;  2YS9 A;  4S0H B;  4MIM A;  3Q0V A;  1POG A;  2B63 J;  4MXM A;  2AHQ A;  3HOV J;  2N8G A;  2RHA A;  1SGM A;  4DYQ A;  3S1M J;  4GCL A;  4RBO A;  2HYT A;  4AC6 A;  1RKT A;  2JMW A;  2R5Z A;  2XSD C;  2YVH A;  1BJZ A;  3LSP A;  2NVT J;  3A02 A;  2TCT A;  5DTD A;  1ETO A;  1DU6 A;  3BR6 A;  2M8G X;  3ON4 A;  2L7M P;  3S1Q J;  5F0F A;  1ETY A;  2O7O A;  4X6A J;  1RET A;  2NS8 A;  2YUS A;  1OJL A;  2LVS A;  4JX6 A;  2LY9 A;  4LOC A;  2R5Z B;  1T56 A;  4KWA A;  3HGY A;  1TWC J;  1ETV A;  2ID3 A;  3RZO J;  3AQT A;  2E2I J;  2EQR A;  2XRL A;  3GZI A;  1ETK A;  5FKK A;  2OF7 A;  2QKO A;  3IUV A;  1WH5 A;  1BL0 A;  3JRE A;  4V2G A;  5D19 A;  2K9S A;  2IBD A;  3JR9 A;  1IUF A;  3WHB A;  2E2J J;  3A01 B;  2NOG A;  4I6Z A;  2O8K A;  3C07 A;  5M5X J;  3CRJ A;  3O60 A;  1JUS A;  2QCO A;  3O8G A;  3ZQG A;  5IYC J;  2O9L A;  1FTZ A;  4GFL A;  2DA3 A;  5FLM J;  2LTP A;  3Q0U A;  4A3F J;  2E2H J;  2HKU A;  5DAJ A;  2XPW A;  1ETX A;  4ICH A;  3GEU A;  4QSH A;  2FJ1 A;  3E7L A;  2L7Z A;  3JRC A;  1SAN A;  4JKZ A;  3OIO A;  1W0U A;  5F08 A;  4AC0 A;  2Y31 A;  1Y1W J;  2X48 A;  2XGC A;  1UHS A;  1JGG A;  2ZB9 A;  2TRT A;  2CUE A;  3FIW A;  5M5W J;  2CRG A;  4ACI A;  4MO7 A;  2XGD A;  4UUS A;  5M5Y J;  3L1P A;  1IG7 A;  5FMP A;  1ZK8 A;  3S16 J;  2RAE A;  3GTQ J;  3HB9 A;  1B72 B;  3VW1 A;  2JA5 J;  1HCR A;  4XK4 A;  2XB5 A;  4D7M A;  1JTX A;  5E3M A;  4W1U A;  2I10 A;  5GP9 A;  5EGO A;  1H89 C;  2O7T A;  4UUT A;  5E3N A;  2K40 A;  3GTK J;  3PAS A;  2M0C A;  3D1N I;  5HBU A;  5EG0 A;  2E19 A;  5K7F A;  5FGL A;  1MBG A;  4GCK A;  3ANP A;  2Y0S N;  3JSJ A;  2DA6 A;  3FK7 A;  5C44 J;  4FTH A;  4A3G J;  3GBG A;  4AF5 A;  3GTP J;  4FCY A;  3HIM A;  3BR1 A;  5CXG A;  2NP3 A;  2KT0 A;  2QF7 A;  3EGQ A;  1PUF A;  3BTC A;  2D5V A;  2HI3 A;  1GV2 A;  2XPV A;  5EG0 B;  1A5J A;  5IOZ A;  1JUM A;  2P81 A;  3QQA A;  1U8B A;  1K61 A;  3GTL J;  4BXX J;  3VVZ A;  1ZTR A;  2V57 A;  3Q0W A;  2FX0 A;  4XRS A;  1WPK A;  4IHV A;  4Y52 J;  1ORK A;  5IPA A;  3TW6 A;  1MNM C;  2NX4 A;  3VPR A;  5EZH A;  1PUF B;  1H8A C;  3VIB A;  3DCF A;  2MW8 A;  3LSG A;  1XS9 A;  2YU9 J;  3ZQF A;  4C2M J;  2UXO A;  3LWJ A;  3CWR A;  1XG1 A;  3GTM J;  3B81 A;  2QWT A;  3P9T A;  2EZL A;  2ZCN A;  2JJ7 A;  2NP5 A;  3FK6 A;  4FE4 A;  3VP5 A;  3BHQ A;  2GEN A;  1IC8 A;  3AQS A;  3QBM A;  5FKL A;  3TP3 A;  5C4X J;  5GPA A;  1G2H A;  3RKQ A;  3S1N J;  3G1M A;  4FIS A;  3BG5 A;  2Q24 A;  2GLO A;  5J1R A;  3VVX A;  3S15 J;  3VOK A;  3SFI A;  4UDS A;  3OSF A;  1WCM J;  1JKO C;  3SDG A;  3NI7 A;  2ELK A;  1RPW A;  2CUF A;  3G1L A;  9ANT A;  3ZQC A;  1EF4 A;  1MBF A;  4DYR A;  2L9R A;  4I76 A;  3A01 A;  2DMU A;  3GTO J;  1HDP A;  4JP0 A;  2F07 A;  4V2F A;  1ZKG A;  3OOU A;  1FJL A;  2DMQ A;  5K58 A;  2DA5 A;  4M6V A;  3BT9 A;  5BNG A;  1GDT A;  2ME6 A;  4B1R A;  4A3E J;  1RKW A;  5HAW A;  4HNV A;  2Y9Z A;  2D6Y A;  3HOU J;  2WGB A;  2HXO A;  4M3E A;  1WH7 A;  2JWT A;  1E3O C;  2R7Z J;  2REK A;  5D18 A;  2DJN A;  5JLX A;  3HOX J;  1F43 A;  3BNI A;  4L62 A;  3GTJ J;  2M34 A;  1GT0 C;  4GCT A;  4MFE A;  5K7Z A;  5D1R A;  3BTL A;  4A3B J;  2EZK A;  3MKL A;  3EUP A;  4A93 J;  1QRY A;  2LFB A;  2JN6 A;  4A69 C;  5JLW A;  1MBK A;  3S17 J;  2HDD A;  1P7I A;  2CU7 A;  3HOW J;  1FIP A;  1RES A;  4CGR A;  5HSZ A;  3JRI A;  3TP0 A;  4AUX A;  2ZOZ A;  2ZCM A;  1ZR2 A;  5EF6 A;  5K7H A;  1HF0 A;  3V78 A;  1B72 A;  3NXC A;  2COB A;  2JA7 J;  1QPI A;  1BW6 A;  2H1K A;  2W53 A;  1R9T J;  3W6V A;  2Y30 A;  1CQT A;  1P7J A;  2HOA A;  2FBQ A;  4M3D A;  3BR5 A;  3GTG J;  2XDN A;  1B8I A;  3TED A;  4XRS G;  1MBH A;  3LJL A;  2GBY A;  3NPI A;  3QKX A;  1JJ8 C;  3A03 A;  2JA8 J;  2X6O A;  3MVP A;  2HYJ A;  3H0G J;  1VF9 A;  1U78 A;  2G7L A;  1K83 J;  4NEL A;  4D7N A;  3S1R J;  4MLO A;  2NVQ J;  1JKQ C;  2VPR A;  1HOM A;  2GFN A;  3HTJ A;  3B6C A;  1B8I B;  1T33 A;  3KKC A;  3BG3 A;  1GV5 A;  3G56 A;  3BCG A;  1AKH A;  3S14 J;  1FEX A;  2JA6 J;  5C4J J;  4RDU A;  2DMT A;  5C4Y A;  5IYB J;  4M3F A;  3I4M J;  1QVT A;  3HTH A;  4CYC A;  4A3I J;  4EEF G;  1XC5 A;  2NS7 A;  4IEJ A;  3ZOB A;  1JJ6 C;  1JUP A;  3Q3S A;  1H88 C;  1HDD C;  1SFO J;  1U9N A;  2R0Q C;  3HBL A;  2DMN A;  3KKD A;  2UXI A;  2WV1 A;  5F04 A;  1AKH B;  3RQI A;  1MBE A;  3PO2 J;  2QTQ A;  1GVD A;  1VND A;  1IGN A;  3LSJ A;  3CJD A;  1AU7 A;  1MSF C;  3CQZ J;  4CYC B;  1VI0 A;  5FLV A;  1X58 A;  3VW0 A;  4M3G A;  4L5E A;  5DS9 A;  5M3F J;  4AYB N;  4IHW A;  3M3Y J;  4IHY A;  5FHP A;  3KNW A;  3NRG A;  1TWG J;  5CW8 A;  2AO9 A;  4PXI A;  1TWA J;  4C3J J;  3ZQL A;  4A3J J;  3PM1 A;  3SJM A;  2JK3 A;  4W97 A;  2RAS A;  5F0C A;  1WI3 A;  2VI6 A;  1ZQ3 P;  5EFY A;  1JT0 A;  2OPT A;  4B3A A;  2XGE A;  3HEF A;  5IP6 A;  3K2A A;  3G7R A;  2IAI A;  2VUM J;  3JRB A;  2FQ4 A;  2OER A;  4DZJ A;  5E3O A;  3ZQI A;  2DTZ A;  5IP9 J;  1BW5 A;  2G0E A;  5F27 A;  5FJ8 J;  5IYD J;  2ECC A;  3BJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...