2Y2ZA

Ligand-free form of tetr-like repressor simr
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
238
structure length
238
Chain Sequence
VSIWMHPEPAGRRSARSHRTLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Tetr-Like Simocyclinone Efflux Pump Repressor, Simr, and the Mechanism of Ligand-Mediated Derepression.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Transcription
molecule keywords PUTATIVE REPRESSOR SIMREG2
total genus 87
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y2zA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2y2zA02
3BR1A 3HBLA 1B72B 2UXHA 3ON4A 2ME6A 3BRUA 1ZR2A 2G3BA 2R5ZB 3IUVA 2V57A 4ACIA 3HTJA 1LE8A 4HKUA 4W1UA 1IC8A 2VI6A 1UMQA 4YZEA 4CGRA 2QTQA 3ZQLA 4ABZA 3LOCA 2D6YA 1RKTA 2D5VA 2L7ZA 3LHQA 1AU7A 5IP7J 4IHWA 3QBMA 2WV1A 4W97A 2G7SA 3F0CA 1WH7A 4JYKA 5FKOA 1QPIA 4NN1A 5EGOA 3MVPA 5GPAA 1ZR4A 1SFOJ 5FMPA 2QOPA 3H0GJ 4IHXA 1I50J 1OJLA 3RH2A 3TW7A 3RD3A 4V2GA 3CMYA 2TCTA 1LFUP 4A3KJ 2EQRA 2R5YA 1JJ8C 1WH5A 1MSEC 3VP5A 2DA3A 3JR9A 4I76A 2DMPA 3F1BA 3B81A 1JTXA 4UUSA 1MNMC 2X48A 2ME0A 4JNNA 1Y1VJ 4MFEA 2XPUA 1ETXA 2DA6A 5IYBJ 2DN0A 1YRNB 4AF5A 5HAWA 4V2FA 1XS9A 5M5YJ 1P7IA 3W6VA 4QIWN 4FE4A 4BXXJ 2UXIA 4GCTA 2ELKA 3V6GA 3ZQGA 3LJLA 2X6OA 3HDDA 5D18A 4AUXA 1OFCX 2HDDA 4DYCA 2R0QC 4EEFG 5D19A 3VW1A 1GVDA 3K2AA 1IDZA 3CDLA 3HOUJ 1U9NA 3FISA 1SANA 2DTZA 2XGDA 3OIOA 2B63J 4RBOA 2DG8A 1MBKA 2CUEA 2DMQA 1T56A 3WHBA 1NK2P 5FGLA 2IBDA 1ETWA 2XB0X 1BA5A 5CXIA 2ZCNA 2R7ZJ 1ZK8A 1NK3P 2E19A 1R9TJ 4PXIA 2LLKA 3BNIA 4BKXA 3ZQCA 2O8KA 5FLVA 3LNQA 2G7GA 2M8GX 1JUMA 3GZIA 2KT0A 2VKEA 3NI7A 3Q3SA 4A3LJ 2JWTA 4QTRA 2EBIA 3GTKJ 2NOGA 5HBUA 3BQZA 4A3CJ 3IH2A 1HLVA 1DU0A 2R92J 1Q1VA 4GFLA 1AKHB 1QRYA 3M4OJ 1IGNA 2QKOA 1W0TA 5JLXA 3S1RJ 3HTHA 5CW8A 5K7ZA 2Y30A 3I4NJ 3VUQA 3HOYJ 3ZOBA 4D5CA 5IOYA 3G1LA 3S1QJ 1BW6A 5DS9A 1RESA 4DW6A 3GTQJ 3QPSA 4XRSA 5C44J 2MGQA 2EH3A 4XK4A 3HEFA 2XPWA 2CRGA 3NARA 4GFKA 2COBA 3BG3A 2ZOYA 5GPCA 1MH4A 4XICA 1K83J 3E7QA 4A3BJ 1ZTRA 3HM5A 3QPLA 3P9TA 1PUFB 1JTYA 2L7FP 2MG4A 3ANGA 1MBGA 1B8IA 3DEWA 1XC5A 4JKZA 5AQCA 3C2BA 2CUFA 3BG9A 3G1OA 4XRSG 2QF7A 2GBYA 4AYBN 2E2IJ 2JA7J 3HTIA 3BG5A 3BQYA 2GFNA 1BW5A 1FJLA 3K7AJ 4UDSA 3VW0A 3FKIJ 4J19A 2QCOA 4A93J 2IU5A 3KKDA 2CQQA 3S15J 2O7TA 1JKQC 4MO7A 3A02A 2K9QA 3E7LA 2CQXA 1VF9A 3CRJA 2LR8A 2DMUA 2JMWA 1BL0A 2HYTA 1NTCA 2DA5A 3L1PA 4A3GJ 3VOKA 2FBQA 3FK6A 4AC0A 2ZCMA 3EUPA 1JKOC 2M34A 1FTTA 2PZ9A 3HB9A 2HOSA 1ETKA 2HXOA 2W53A 3IH4A 3GTGJ 3TEDA 5FKMA 2NP3A 1B8IB 2XGCA 2OPTA 3PM1A 5HODA 5IYCJ 2L9RA 2W48A 1LE8B 2DJNA 1IG7A 2QIBA 5K7FA 1ZGWA 1TC3C 3CJDA 5M3MJ 2DA1A 3MN2A 2JA8J 4MK6A 1A5JA 3SDGA 4KWAA 4DYRA 1I6HJ 4B1RA 3A01A 2JA6J 3QQAA 4S0HB 2WB1N 2TRTA 5F0CA 3A03A 3JRDA 4MIMA 3JRCA 1IV6A 5FJ8J 2DA2A 3HGYA 3S14J 3S2HJ 1FIPA 5CXGA 4M6VA 1AHDP 3JRFA 3HIMA 4A3DJ 5EDNA 1F36A 3CCYA 4M3EA 3NRGA 3V78A 2LFBA 5J3LA 3RQIA 1TWGJ 4D5FA 3RKQA 3IH3A 4GFBA 3PO3J 5BNGA 5K7HA 3FIWA 2FJ1A 5HSZA 1X58A 2LTPA 3HKZN 3Q0VA 3TW6A 5C4YA 1MBHA 1GV2A 4BY7J 2XRLA 1GV5A 5FLMJ 4UUTA 1OCTC 5FHPA 3JREA 2JA5J 3GTOJ 4CYCA 3DCFA 4BBRJ 3DPJA 1MBFA 2Y9ZA 2WAQN 2DG7A 2RASA 3SFIA 3BCGA 2EZIA 4M3DA 4ME9A 1ORKA 2NS8A 2XB5A 4Y52J 2F07A 3MNLA 2I10A 3VW2A 2VPRA 2K9NA 4MLOA 2VKVA 1YRNA 3GTLJ 1TWAJ 2M9HA 2AHQA 2EZLA 3BR0A 3BTJA 3LSGA 5EZGA 2K40A 3BT9A 5EEAA 2L7MP 1G2HA 1ETQA 3B6AA 2CU7A 1GT0C 2HQ5A 3SJMA 2E2JJ 3JRGA 1MBJA 4JX4A 5M5XJ 1JJ6C 4IHVA 1QVUA 1RETA 4A3FJ 2XPVA 2LKXA 2Y0SN 2HOTA 2Y2ZA 1U78A 4JX6A 2FD5A 2IAIA 1UHSA 1WGXA 4CYCB 4C2MJ 4JP0A 2XSDC 4C3HJ 2ECCA 1K61A 1GDTA 1UI6A 2DA4A 3PPBA 2K9SA 5EF6A 5K58A 4AC6A 5IPAA 5M3FJ 5F08A 4D7MA 3GEUA 5D1RA 1H8AC 3RZOJ 4A3IJ 4X1EA 1H88C 4G12A 5IOZA 4BY1J 1ETYA 1TWFJ 1VI0A 3ANPA 2G7LA 4A69C 4FCYA 2YVHA 5IP6A 3GTPJ 2Q24A 3GTJJ 2NVQJ 3HOVJ 1UI5A 2DMNA 3BR2A 1AKHA 1ETOA 3OOUA 2NX4A 5F0FA 3G7RA 3S17J 4NELA 5JLWA 1MSFC 2HOAA 2X9DA 1H89C 2R5ZA 1HF0A 2UXOA 1JKRC 2ID6A 2NP5A 1U8BA 2Y31A 2KDZA 2O9LA 4JX5A 4B3AA 3B6CA 3PASA 3FK7A 2IEKA 3LSPA 4GCKA 3AQTA 2GM4A 2YU9J 3JRHA 5FKNA 4D7NA 2PBXA 2LP0A 1HDDC 4XRMA 5M5WJ 4DYQA 5EG0B 2UXUA 3TP0A 4MXMA 3BHQA 4RDUA 2N8GA 4IEJA 5EGOB 3BTCA 3S1NJ 1GUUA 3OSGA 5F1JA 2ECBA 5EG0A 3BJBA 3VVYA 2H1KA 2L0KA 2YUSA 5IYDJ 2FQ4A 1X2NA 3KNWA 3O8HA 4A3MJ 5C3EJ 3JRIA 3BR5A 1CQTA 5DAJA 1U9OA 1OCPA 3BR3A 3S1MJ 2G0EA 4L62A 4C3JJ 1WI3A 4JL3A 2QWTA 1RR7A 1ZQ3P 4M3BA 3HTAA 4M3GA 2GUHA 3CWRA 2GLOA 3VPRA 5J1YA 4ICHA 5C4XJ 4A3EJ 2WGBA 3S5RA 4IHYA 1FEXA 3QKXA 5J1RA 3VIBA 4I6ZA 3ZQFA 5GP9A 3HOZJ 3MKLA 2E2HJ 1P7JA 2EZKA 1ENHA 1JT0A 2CJJA 2RAEA 2GENA 4FTHA 1JT6A 4QSHA 1APLC 3G1MA 1D5YA 3LSJA 3LSRA 4NDLA 5EYRA 2XGEA 3CQZJ 1F43A 2FX0A 3M3YJ 1IRZA 1VNDA 2MW8A 1S7EA 3S16J 2R93J 2HI3A 2LVSA 1T33A 1ZKGA 2O7OA 1E3OC 1LFBA 2OI8A 1DU6A 2M2EA 2YVEA 3PO2J 1IDYA 3A01B 3G56A 5F27A 5FKLA 1BJZA 3OSFA 5E3LA 2HKUA 3NXCA 1Z0XA 1RKWA 3GTMJ 3AQSA 3EGQA 1HDPA 1JKPC 5E3MA 4X6AJ 3KZ9A 4LOCA 4MFDA 1ITYA 2ZOZA 3LWJA 3VVXA 1WPKA 3C07A 3HOWJ 3BR6A 2AO9A 2NS7A 1UG2A 2JN6A 2LD5A 1O4XA 3ON2A 2H8RA 3TP3A 1MH3A 1POGA 3HGGA 3JRAA 5FKKA 3ZQHA 1TWHJ 3GBGA 1QVTA 1EF4A 3VVZA 2NVYJ 1WCMJ 1FIAA 2LK2A 5IP9J 1A6IA 5J1UA 1ETVA 2JK3A 3O60A 3O8GA 4DZJA 3BTLA 1XG1A 3BTIA 2RHAA 3COLA 3NNRA 1Y1WJ 4HNVA 2E1OA 5EZHA 3ZQIA 2NVTJ 1IJWC 3HOXJ 2R5YB 2M0CA 2UXPA 3WHCA 1MBEA 1SGMA 3Q0WA 4GCLA 4L5EA 3KKCA 3HE0A 3NPIA 2DA7A 2VUMJ 5EFYA 4FE7A 4A3JJ 2PMZN 2MSYA 4UUSB 1HCRA 3Q0UA 2P81A 4M3FA 2Y9YA 1X2MA 3UKGA 1HOMA 3IV5A 1I3QJ 2HYJA 4B4CA 2NVXJ 2WUIA 1JUSA 2OERA 5DTDA 1B72A 2YS9A 1PUFA 1VFCA 5F04A 1JGGA 9ANTA 4C3IJ 2OF7A 5E3NA 2LY9A 5E3OA 3VOXA 2DMTA 4XIDA 2JJ7A 1RPWA 2ID3A 3FRQA 2XDNA 5C4JJ 3T6NA 2ZB9A 4FISA 1IUFA 2HXIA 1FTZA 5F0HA 3NAUA 4BBSJ 2ZCXA 2EZHA 3H3VK 1W0UA 1Z77A 5H9TA 4DZPA 3I4MJ 3JSJA 3S2DJ 1TWCJ 3D1NI 2REKA 4Y7NJ 3JRBA 1JUPA 3RZDJ
chains in the Genus database with same CATH superfamily
2CW0F 4G6QA 2ME6A 3BCAA 1ZG1A 3FXOA 1MJAA 1XX5A 1K79A 1IN4A 2WC2A 1IRXA 1LE8A 1A35A 2DFFA 4W1UA 4A2UA 2VI6A 1O3RA 4CDGA 4CGRA 5LBQA 3H9JA 3CJNA 4U7DA 4ABZA 3GW2A 1NG7A 3LOCA 4UY8I 5DYMA 1NH3A 3F3XA 3LHQA 2LOOA 2H09A 4EJUA 4RM3A 3TKYA 1AU7A 3D5LA 4LJZF 4L18B 4AIJA 1RRJA 1KQ0A 4W97A 2G7SA 4YFXF 4NN1A 4XSZF 1MNEA 5DV5A 5GPAA 4Y33A 1V5FA 4RB3C 5DD4A 1W5TA 1Z7LA 2TDXA 1OJLA 3OYCA 3OYDA 1MW7A 2K85A 3I59A 1SD4A 2KQRA 3RH2A 1T95A 4DBRA 1DP7P 4HDVA 3PJRA 1Z91A 3M07A 1JJ8C 1WH5A 2B0LA 1REPC 4FQGA 5DCFA 4L9VA 5D4SA 1EJ9A 3B81A 1R6RA 4UUSA 2L4AA 1MNMC 2STTA 4JNNA 5LGUA 1ETXA 1I39A 6PAXA 4NHJA 4I02A 2HQRA 2H6BA 3OWTA 3OYFA 1ZH5A 3DBHB 2GWRA 1P7IA 3AG1H 4PSXA 4QIWN 1F4KA 1XD7A 4PK4A 3JAMK 2ZO4A 1P9QC 2UXIA 3V6GA 1LVAA 5E1XA 3LJLA 2X6OA 3GFIA 2R0QC 1T0FC 4EEFG 1GVDA 5CVVA 2GA2A 4IRHA 3C2HA 1U9NA 3FISA 3CUQA 4ZDOA 4BUPA 2DG8A 1QHGA 3WHBA 2DMQA 1ZGJA 5IT9Z 2H94A 2BVLA 3MFKA 1YE9A 1BA5A 2ZCNA 3HOSA 2R7ZJ 4ENJA 2NVUB 1NK3P 2E19A 1YW9A 2LLKA 2QQAA 3BNIA 2BGCA 1SD7A 3DKXA 3ZQCA 1ZN2A 4HYEA 4YEJA 5LLQA 2O8KA 3VTIA 3M8FA 2VKEA 1VQKI 3PUBA 4EV0A 3MCZA 2NOGA 5CVJA 2EA4A 3FX3A 5HLIA 4EJWA 2F5DA 4CZCA 1DU0A 3VDXA 1XDUA 3CCMI 1AKHB 2QKOA 1W0TA 3ASNH 2NYXA 1OYYA 3HTHA 5CW8A 3VUQA 1YS6A 2MFZA 3G1LA 3K4NA 1BW6A 4DW6A 3QYFA 2FU4A 1AA7A 1ACIA 4LFUA 3WGIA 3IWFA 2V4JC 4BEHB 3ESWB 1FOKA 3BJAA 4X0GA 3GXOA 5DUKA 2DO7A 4HF0A 4XICA 3PIOF 3LSIA 5HLTA 2VKDA 3HM5A 3QPLA 1O7LA 1JTYA 3ANGA 3KIOA 4JKZA 3FHZA 2QVOA 3ZMUA 2E2IJ 4XRSG 2QF7A 3HUGA 4YFNF 3RTRA 4HLYA 3BQYA 3LQQA 2HKOA 2ZBKA 5CVUA 4WWCA 3G73A 4RA2A 5HVQC 2GFNA 3FKIJ 4J19A 4IO9F 3GYHX 4UV9A 4NC6A 2QBYB 1B6AA 1JKQC 3AFHA 4WF2A 4B09A 1SVLA 3COAC 2W85A 2GAUA 1BL0A 2HYTA 4CUGA 2DA5A 5FD5A 3IUOA 1V54H 4ZDPA 1YFHA 3FK6A 4AC0A 3G4SI 4EQQA 3QPHA 4F91B 1FTTA 3T8RA 3HB9A 3I4PA 1B4AA 1ETKA 1W7PB 2HXOA 3GTGJ 4N9HA 1EV7A 4UB8C 2Z1DA 4G9YA 4LB5A 2OPTA 5HODA 5IYCJ 3GF2A 2NRAC 2MBFA 2W48A 3BY6A 3HXLA 2JT1A 2CUJA 3CJDA 1ZAOA 5D6FA 3W2AA 2KRHA 1IN7A 2JA8J 3KYCB 1IXSB 3RYRA 2R7SA 1FT9A 2O03A 3SDGA 4IVNA 2YPRA 2VT2A 3CESA 1FYLA 5HNFA 3WTTC 2JA6J 2HGCA 4KISA 3RDIA 2XVCA 2WB1N 1VQPI 1KGSA 4F55A 3A03A 3JRDA 3OYKA 4MIMA 3JRCA 3HGYA 2DOEA 4YFKF 5CXGA 4UVBA 1U8RA 2KZGA 3JRFA 1G3WA 5EDNA 1PYVA 4PJ0C 4D5FA 1TWGJ 4GFBA 5HLGA 5H6RA 5BNGA 1DPRA 5HSZA 4CA0A 1X58A 3HKZN 2XRLA 3GO5A 2EINH 2MD0A 1SD6A 4OOIA 2B7EA 2L9NA 3JREA 5BPIA 1HQCA 4CCKA 2VC0A 2CH0A 4N9IA 1BI0A 3SQNA 2RASA 2EZIA 4Y52J 3H36A 2VPRA 2ISYA 2K9NA 4L0YB 1WJ5A 2LG4A 3K4LA 3ABMH 4M71A 4ASNA 3WU2C 1U0JA 2A61A 2AHQA 4CO8A 2V9PA 2W84A 2WTEA 3LSGA 4TV7A 5EZGA 3BT9A 3ECOA 1IN8A 4YIFA 1G2HA 4BAYA 3R6SA 2K7LA 3JRGA 2OCEA 2J5PA 3ELKA 1JJ6C 4H4KC 1R00A 1WQ2A 4HSTA 2M8EA 2VBXA 4BDZA 2Y2ZA 1PDNC 2QBYA 5JR3A 3HYIA 4JX6A 4GCVA 1UHSA 3K4BA 3ZGKA 2VJ5A 2IS4A 1O7FA 1WGXA 4C2MJ 4HX8A 4JP0A 3BG7A 5JI6A 3PL8A 3CCRI 3BJOA 2K86A 1MMSA 2XF5A 4ZZDA 2K9SA 3PPBA 2XIGA 4AC6A 2Q1ZB 4CCMA 5IPAA 5BMZA 1H8AC 4KIBA 1T38A 3Q9VA 1U5TC 1XGOA 1L3LA 1TWFJ 3J80K 1VI0A 4EJVA 2IGNA 3QU6A 4A69C 1MDMA 2KIQA 5IP6A 2Q24A 2NVQJ 2Q2EA 4LLLA 2DMNA 3BR2A 1WHUA 3OOUA 4O5VA 2NX4A 3V42A 3G7RA 3S32A 2O61A 2V1XA 3CJTB 3C2GA 3GZNB 3CF5F 4XONA 1RZ4A 2XKPA 2Y31A 2KDZA 3TO9A 3OL3A 2JQ7A 3B6CA 5L3GA 3FK7A 3PASA 3LSPA 3H35A 1HKSA 4L9TA 2R4GA 5GTHC 1SVMA 2VONA 2LP0A 1ERDA 4AVPA 1WRJA 1P4XA 2P8TA 4XRMA 5M5WJ 4EATA 4ETSA 1R4NB 3BPVA 2V1NA 3I53A 4P1WA 3WTZA 4HG2A 4CCJA 3EYYA 3ISPA 5F1JA 5EG0A 3VVYA 3F8BA 2EILH 2H1KA 2YUSA 2FQ4A 1X2NA 2AQEA 3O8HA 4A3MJ 2F48A 2PG4A 4RB1A 2EFQA 5DAJA 1I6XA 4EJTA 2G0EA 2AXLA 1VQLI 1WI3A 1TZLA 2EV0A 3S93A 3LQRA 4M3GA 2GUHA 5HDGA 1O3TA 3K4JA 3VPRA 3VSKA 4DGWB 2ZXJA 3P5JA 4A6EA 4BJ6C 2PJPA 4RGXA 5IT9K 2JPCA 3DPUA 4IHYA 1F5TA 3C1DA 2CWEA 2IJLA 2M4GA 2DU9A 3ZMZA 4QSHA 1APLC 3I0TA 1TTYA 3G1MA 2VQHA 3OYJA 3OOPA 3LSRA 4HW0A 2BY0A 1OYIA 3EDPA 3CP2A 3M3YJ 2DOFA 3KP4A 4II2A 1YITI 3FMSA 3S16J 3MWMA 5CPRB 5ED4A 2LVSA 2O7OA 2E1MB 1Z6TA 1S8NA 4F93B 3KCCA 4UVAA 3CC7I 2M45A 2M0MA 2CQNA 2M2EA 4EGYA 3EYIA 3QYEA 3PO2J 1K6YA 2LH9A 3A01B 3G56A 4U88A 4OD4A 5LGNA 1WVRA 4N4NB 1Z0XA 4BJTA 2G7UA 4YG2F 1HDPA 5K5OA 4LOCA 1AWCA 4XLAA 5HOOA 1R7JA 1FP1D 3H9QA 1N75A 3ABKH 4BACA 1MMAA 4QPQA 3CO7C 1O4XA 3DEEA 2DJIA 3OYHA 2H8RA 2XASA 1POGA 1J75A 1ZRCA 3KEQA 1QVTA 3J80Z 3ZN1A 1IN6A 1FIAA 1OCZH 1BR2A 2JK3A 3Q5FA 1FNNA 2PBIA 4P9UA 2KLOA 2R7WA 3COLA 4HF2A 3NNRA 3L2VA 3LL7A 4ENNA 1J2XA 4HNVA 1XCVA 2V6CA 1IRGA 5EZHA 3K1MA 3WODF 5FLXK 1SGMA 3Q0WA 4P96A 2LDUA 3NPIA 2DA7A 1R5GA 1XN7A 4BXUA 3HTSB 2VUMJ 2P7VB 1HCRA 4HX4A 3Q0UA 4M3FA 4QWQA 1P4WA 2DLLA 1XSVA 2H6CA 1D0ZA 1W7PA 2KRCA 2X6YA 4B4CA 3HRTA 5J6XA 2OERA 2DYRH 1BIBA 3QPTA 5F04A 4MEYF 2UZKA 1JGGA 4C3IJ 2X0LA 5FD6A 2LY9A 4RGUA 2O3FA 4HV5A 4JBAA 2WADA 1A6QA 2IA0A 3DEUA 3EUHC 3OMYA 2V7FA 3DKWA 4HOBA 2FUG2 4FT8A 1MGTA 1H9TA 1BI1A 1QHHD 3D0SA 1SVOA 3V7RA 1FMWA 3PUFA 5F0HA 2VBZA 3NAUA 4CSWA 1W0UA 2KJBA 2BXZA 3JSJA 2HFHA 3D1NI 3JRBA 1X4PA 3C3WA 1D5VA 1ZR2A 3L2QA 3F9KA 1F9NA 1S5LC 5CKTA 3V8LA 2ICWG 4ACIA 4RMNA 3HTJA 5F6FA 3OS0A 4HKUA 4L5IA 4XLFA 3E5XA 5TJJA 2CUZA 3HZJA 2QTQA 3GZ5A 1H0MA 2HWVA 2FOWA 3OYMA 1RKTA 1QPMA 2OZUA 3KZYA 2L7ZA 2HVQA 5HS7A 3I5UA 3ERED 1B9NA 2XAQA 4BHCA 4BE1A 5J8FA 2WV1A 4JYKA 1FWZA 3IRRA 4AIKA 1IW7F 3NEUA 4KICA 5ILVA 1SFOJ 2GXGA 3LFKA 1UHWA 2EIMH 5FMPA 3TOBA 5GAHJ 3E6BA 2HS5A 1E2XA 1I50J 3RSNA 4CCNA 2WV0A 2HQAA 5B5EC 3RD3A 3CMYA 2K9LA 2EIKH 2OTJI 2ADUA 3H5AA 2HDWA 1PJRA 2FNAA 4M6YA 2VOOA 1MSEC 2XHKA 2DA3A 1Y8QB 4I76A 2DMPA 3F1BA 5DUIA 4Q4ZF 1J9IA 5K1YA 3CCEI 3HRMA 2K4BA 1B9MA 2Z2SB 4G7ZF 2JTVA 1WWXA 1YRNB 2P5LC 1KU9A 2K9MA 2XAHA 3O2PE 4FE4A 2IRFG 3FHNA 4L0ZB 3E3VA 2HYFA 3ZQGA 2X85A 3CZ6A 3RQ4A 3HDDA 5BS6A 2QZ8A 3DTKA 4DYCA 5D19A 3ZCOA 2NXNB 2BEOA 3K2AA 3I3LA 4UUVA 1Z67A 2BYVE 3HOUJ 1SANA 1VQ9I 2XGDA 1MBKA 4JOMA 3CMMA 2EB7A 4CHUA 2FXAA 1K7AA 2L7KA 5FGLA 2HOEA 2IBDA 5L3CA 4OIRF 4ENKA 1G4DA 5CXIA 4M9ZA 2D1HA 2VOPA 3M9AA 2MD5A 2Y69H 1HKQA 1LKXA 3RJPA 3I56I 1DGWY 2YSRA 3FM5A 3KP2A 1XMAA 3R0JA 4BQAA 3RI4A 4HSRA 2MC4A 2E7XA 3L7WA 1GXPA 4Q5SF 2QUFA 3LA2A 2JWTA 1Q1HA 5LRSA 4NQWA 2R7QA 1BOAA 1U2WA 2UXXA 1QA6A 2CW7A 3RYPA 2R92J 4GFLA 2EFWA 1QRYA 4I99C 1IGNA 3H3UA 4Y4RA 5JLXA 1ON2A 2XAFA 4ESFA 1N78A 3HOYJ 3V8JA 4D5CA 4P55A 3GTQJ 3S2WA 4XRSA 1QZZA 1S7AA 2QYOA 5C44J 2MGQA 2EH3A 4N4OB 3HEFA 1UZCA 2VE8A 2XPWA 1UELB 2COBA 3BG3A 4YIIA 3BZ6A 1PVEA 1G6NA 2WBMA 1XSXA 3TQNA 1K83J 1LFPA 1X19A 2L02A 5E1ZB 4A3BJ 3N97A 2M4KA 3K70D 2P5VA 1XC5A 2F4MB 3DEWA 3OL4A 4N0BA 3TL4X 3JW4A 3G1OA 3PNYA 2BHYA 3GWZA 3VFZA 5JFRA 4UDSA 3K7AJ 3ABLH 5CJ9A 3K70C 4GRIA 3OS1A 3KKDA 5FGMA 1KYWA 5CQGA 4EVIA 3TDUC 2CQXA 1K78A 1TL8A 1HSTA 3FBIB 3GVAA 1VF9A 2DOAA 2DMUA 3WE2A 3W6KB 5D8KB 3U1DA 4ZC3A 5B3SH 2ZCMA 1DDNA 1JKOC 2VLAA 2M34A 2RKHA 2E35A 2KHMA 5L3BA 4F52A 4ZYGA 2XROA 4WX9A 2HOSA 3E97A 1J0RA 3U1KA 2W53A 3DFGA 4IX7A 2BY3A 3MMYB 5FKMA 1BR1A 4F7ZA 2DT7B 3PM1A 1OISA 4UB6C 2L9RA 3KLOA 3RIRA 2QIBA 5KAFC 1FMVA 2HPIA 4KN7X 2CGPA 3H3ZA 2XF6A 4LGWA 5M3MJ 2QSFX 2DA1A 4KT5C 3IL2A 5GAGJ 1A5JA 1D0YA 1W36D 5E79C 3LSTA 3P7NA 4DYRA 1I6HJ 2RC4A 2O8XA 1ON1A 4A12A 2I5UA 4IPAA 2ZSIB 2B1EA 5E18F 4KA4A 4LD5A 1IV6A 4UHTA 1D8JA 2FMYA 1FIPA 3O3KA 4D1QA 1YS7A 3H92A 3VOEA 1ZRFA 2QSGX 1F36A 3V78A 3SWHA 4OU0A 1R1UA 2K3FA 1Y6IA 2RDPA 2V1DA 3SEZA 3RKQA 3PO3J 2ZMEB 1B59A 5K7HA 2QWWA 4E7JA 5C4YA 2R7RA 1GV2A 4WXDA 5J4YA 5FHPA 2R7TA 3LAJA 4PZJA 2JA5J 1IRFA 3GTOJ 4PCQA 4O6JA 3DPJA 1MBFA 2BW3B 3PSFA 4G7HF 4HDUA 2Y9ZA 1Z7UA 1FOWA 4IXAA 4M3DA 4ME9A 1WJFA 2F4OB 3L09A 5IT3A 3U2RA 5ICEA 3EQLF 1R36A 4MLOA 2KISA 3DP7A 1TWAJ 5LFAA 2AQFA 3BTJA 3CJRB 2BHZA 2K40A 3UR3C 2L7MP 2XAUA 1ETQA 2QQ8A 3IHUA 2HQ5A 3SJMA 3I58A 4CH7A 1QBJA 4KITB 1MBJA 4YIRX 4IHVA 3OYBA 1QVUA 3R60A 4MEXF 4A3FJ 2XPVA 5EEHA 2LKXA 3V7SA 2Z33A 2HOTA 1GXQA 2FD5A 2XGXA 2A69F 2DTRA 2G7HA 4DVYP 3HTUA 1LNWA 2O6GE 1LQ1A 1J09A 1ZYRF 2R7DA 4C3HJ 2XSDC 5FLXZ 3PFIA 4D7MA 1VQ5I 1WJCA 1IXRC 1W5CC 5B1BH 3REOA 2BZTA 4BY1J 3X2QH 5JHUA 5KVRA 3ANPA 2R3SA 3HOVJ 1FOYA 4KMUX 2VBYA 1KU3A 1YO5C 1AKHA 1ETOA 4R1HA 4BGDA 2VQGA 5KHDA 2FBKA 5F0FA 3LSMA 4NELA 3JTHA 3JTGA 2D45A 4P5OA 5E17F 1MSFC 1N25A 3FF5A 1S3JA 5E8IA 1HF0A 4G8XA 3HPHA 3Q9SA 2MLKA 5E20A 1VZ0A 2E34A 3CLOA 4MHGA 2O9LA 4B3AA 2KDOA 2CMPA 2XAJA 4PJNA 3AQTA 2NNNA 3MEXA 1YJNI 4D7NA 4ESBA 2A6HF 2Y0MA 2A68F 3CJQB 1U5TA 4PGHA 4AVZA 3CCQI 4IOCF 3HJEA 3TP0A 1W5SA 3AL0C 5LEKA 2IVMA 3BHQA 2N8GA 3BTCA 4WCGA 1XGSA 1ZLJA 3DU5A 5JHFA 3OSGA 2ECBA 2ACJA 2M87A 4U0WA 2HTJA 3CDHA 5D5WB 2L0KA 3HUGB 5IYDJ 3KNWA 5C3EJ 3FMRA 2JUGA 3JRIA 4XKCA 1MJBA 5TGTA 3BR3A 2ZFUA 3K2ZA 5LGTA 1JXSA 2QM3A 1RR7A 2FA5A 4M3BA 3J7YJ 4I0BA 3HTAA 4KNYA 5DEQA 2YR2A 3R61A 1QU3A 4ICHA 4EM2A 2ZXIA 4KFCA 4ZH4F 3BPXA 4OIOF 4MQVA 3MKLA 4G6TB 2EZKA 1IAWA 2RVCA 1JT0A 2RAEA 5D5XB 2GENA 4AWXB 4WXHA 1I3AA 2LNBA 3QAHA 3CQZJ 1PP8F 2FX0A 2ELHA 2XUBA 1VNDA 1KU2A 1WJEA 5BPDA 3GMEA 2HVSA 2R93J 2A05A 4I98B 1Z6RA 2NNYA 2LBFA 2YVEA 2B9SA 4L9JA 1TNTA 3T1BA 3CCJI 1UAAA 2Y0SA 4ENMA 2FBHA 3FDYA 3OSFA 3HG9A 4CCOA 2WWYA 2M30A 4U0YA 3SYTA 3ZPLA 1RC9A 3A0BC 1JKPC 3VVXA 4M6XA 3E6DA 2HR3A 3PSIA 2X1EA 4PDKA 4NUBA 2JVGA 3ON2A 3HGGA 2MLGA 5FKKA 5HS8A 3VVZA 5JVGF 2NVYJ 4GO1A 2CW8A 4Y3OA 3F8NA 4Y13A 3QP6A 4XLEA 3E0JB 4IQJA 3O8GA 2AXTC 2KFDA 1Y0NA 3OR2C 5EJCA 3BTIA 2P5KA 2FQ3A 5FO5A 5E1WA 4OIPF 1EH8A 2BXYA 5L3DA 2EFOA 2MYSA 2W7NA 1FYMA 2E1OA 3HIMA 3ZQIA 2VN2A 2VASA 3HOXJ 1IJWC 2LRDA 2M0CA 3WHCA 1MBEA 2NVTJ 4RAZA 4GCLA 3U9GA 3DLAA 2FJI1 5K5QA 3OIQA 3TBIA 1USTA 1S6LA 3I9V2 1HKTA 4FE7A 3CCVI 1KONA 4HA8A 1R49A 2XV4S 2Y9YA 4D0PA 3IV5A 1I3QJ 3LA7A 3OYAA 4FETA 2MA3A 2L54A 3FWEA 3DF8A 2L2OA 2WA0A 2NVXJ 5K5RA 2KIUA 1B72A 1BR4A 3KYDB 1UJ8A 1VFCA 3C18A 2JRMA 5KCMA 5CYVA 1XMXA 2HZDA 1OR7A 3F8FA 3WTVC 1TBXA 4XNFA 1KQ8A 1TP4A 2DMTA 4XKBA 3OR1C 1I1GA 2CSOA 5BOXA 1T39A 3S8PA 3RPUD 2FEZA 1RUOA 4C2TA 3ZP5A 4FISA 4IRIA 3HSFA 4BNCA 2VIXA 1BJAA 2QENA 1VQ4I 4K2EA 2ZCXA 2EZHA 3H3VK 4I09A 4EMSA 2GXBA 2R7OA 4XORA 2LREA 1KU7A 5FFXA 3MKWB 2DDAA 4IQ4A 1YTYA 1MIJA 3I4MJ 1R58A 1MJ9A 2REKA 3TO6A 2KZVA 1DGRM 5B1AH 1JUPA 2H27A 1LPQA 3ONQA 3HBLA 1B72B 2LKPA 4AIDA 4XBFA 4P9FA 3F8CA 2R5ZB 1D1AA 2V57A 1TQMA 1DUXC 1G3TA 2QKLB 1JI8A 3ABUA 1UMQA 3K10A 5E8GA 4C2UA 3AL0B 1KZHA 1VQNI 4BJ5C 4DIQA 1QGPA 3GEZA 3QU3A 1V5GA 5IP7J 4E7KA 1U3EM 3ZQQA 5FRNA 4RGSA 1W7PD 1XSDA 3KPHA 5FKOA 4YELA 2ZC2A 3MVPA 3WG9A 5EGOA 2M7AA 4NQWB 1ZR4A 1WSUA 3ULQB 2CG4A 3M1CA 3F21A 2DODA 1XCBA 2H8WA 2JPBA 4HZFA 1T2KA 2QGUA 3TW7A 2DYSH 1EH6A 5J4VA 5CQEA 5KAIC 2G9WA 4A3KJ 3OS2A 2DDBA 5A2QZ 2DFHA 1XTAA 3VYRB 3G71I 2FE3A 2X1DA 3IAS2 3M8EA 4PJMA 1USSA 4UVCA 3SZGA 2OC6A 1HA8A 2HZTA 3JR9A 4E7IA 2GIVA 3RPUA 3FXRA 3AG3H 4G6DA 3F6VA 3GZ6A 1K6OA 5D5VB 1Y1VJ 4MFEA 2XPUA 2X6WA 2DN0A 5HAWA 4PJLA 5DDGA 3BJ6A 4V2FA 5M5YJ 1BC7C 3W6VA 3TDZC 3BOQA 4C2MA 2L3DA 2HYGD 1VQ7I 4GCTA 1P4AA 3G6EI 5D18A 1OFCX 5A2QK 2HDDA 3VW1A 3CUQB 3TMOA 1FBSA 3DLLF 1IDZA 1J5YA 3AG4H 2BVMA 2LYCA 3V8KA 2I8DA 3OIOA 5H6QA 2RN7A 2CUEA 3H9GA 1T56A 4E7SA 1V55H 1NK2P 5AIPA 1EKEA 2M7BA 3P9IA 2KIMA 2LKSA 4C9YA 1ETWA 3RKXA 1P2FA 3BDDA 1V3FA 1ZK8A 4I0AA 4YRVA 1GVJA 4RB2C 2XSJC 3AKZA 4PXIA 1QZEA 1Z05A 4BKXA 5FLVA 1IN5A 3KEYA 3LNQA 4KMFA 4CZZA 2M8GX 4UV8A 3K4CA 3GZIA 2KT0A 5DD8A 1D1CA 1MMNA 3NI7A 1YOVB 2EBIA 1X3WB 2PMHA 1MDMB 4I7HA 2L5QA 3GTKJ 5HBUA 3BQZA 1X3UA 4A3CJ 3IH2A 2BY1A 5L3FA 1Q1VA 1CGPA 3EUKL 3M4OJ 4NBQA 2K27A 4XOPA 2ZFWA 3S1RJ 1KA8A 1G59A 2Y30A 3I4NJ 3ML6A 2FBIA 2UV1A 2RQPA 1K4SA 1WZ2A 3H5RA 3J7AY 3S1QJ 3D5RC 1RESA 2C6YA 3QPSA 5AIQA 4XLNF 4B43A 4DJAA 2DFIA 4XK4A 1BM9A 2Q8KA 5LRRA 1BN5A 1CF7A 3WTUC 1R5ID 2ZOYA 5GPCA 5ICCA 1MH4A 4R79A 2DBBA 3WE3A 3E7QA 3JSPA 1ZTRA 1TW2A 2E36A 4WXCA 3P9TA 1PUFB 2L7FP 2VPLA 1MBGA 3H1CA 2A6EF 1B8IA 4I2OA 5AQCA 4U7BA 2GOMA 3C2BA 3MKZA 3BG9A 3HTIA 4AYBN 1E0EA 3OY9A 3ECHA 4A5NA 1BW5A 3HPGA 4LITA 2L9VA 1FJLA 3VW0A 4NC8A 2CQKA 3H0DA 2QCOA 3CMEI 3AAFA 4A93J 1YW8A 2CQQA 3S15J 2IU5A 3CP8A 5DCMB 3A02A 2K9QA 3KYLA 2E7WA 2OV7A 3OYNA 5ICGA 2JMWA 2M5WA 2A6TA 3F8MA 3KFWX 4A3GJ 1OCCH 3J81K 2L01A 1V4RA 2CS3A 3EUPA 2QEXI 1FBQA 4ESJA 2DFEA 4ZYEA 1TT5B 3WU1B 2ISZA 1HW5A 3TEDA 1TQIA 4E70A 1YI2I 1B8IB 3TGNA 4E7ZA 1VTNC 2LSOA 2XGCA 3AG2H 3EPZA 3DTIA 2EIJH 5K7FA 1MNDA 1ZGWA 2ZJRF 1TC3C 2A5YB 1BI3A 2COMA 4IKFA 4RS8A 2CV2A 4B47A 3J81Z 4OINF 2IS1A 3A01A 3BZKA 1J7KA 3QQAA 2P4WA 4BL0B 2TRTA 4ZTFA 2W25A 1U6GA 3DBLB 2EJRA 1RR8C 1NHAA 4XMYA 3SZTA 3NWTA 2R7XA 3CDIA 3S14J 3S2HJ 4RLFA 1TQPA 1TNSA 2DI3A 4XSXF 4GDFA 2QQBA 4A3DJ 3CCYA 4M3EA 2PEXA 2A3SA 2LFBA 5J3LA 1G3SA 3IH3A 3W2VA 2HNHA 3FIWA 3MZHA 2XDVA 3TW6A 2F5CA 1S72I 4FHTA 1GV5A 5FLMJ 2JUCA 2K5CA 5KK1A 4CYCA 3DCFA 4BBRJ 5CVIA 4XKWA 1E3HA 2STWA 1A04A 5ILSA 2YX7A 2PJRB 1UFMA 2WAQN 2DG7A 3BCGA 3SFIA 2FSWA 1FPQA 3GX4X 3QOPA 3K4MA 3WTWC 2NS8A 2XB5A 4EM0B 2F07A 3VW2A 4JK1X 2BE5F 2PFVA 3IP4B 4HAMA 3GTLJ 3T5XA 2M9HA 2D1VA 3BZCA 5EEAA 1G8XA 4MQ9F 2DCEA 3B6AA 2M3AA 4M73A 2LY2A 4U0VA 2E2JJ 4A0XA 4JX4A 5M5XJ 3HHGA 4I01A 1W4MA 2K3PA 5TRDA 2QQ9A 4R8HA 4XM3A 1OR7C 2O5RA 1U78A 1ZRDA 3FXLA 2IAIA 3V4GA 1HW2A 4HRIA 3HSEA 1SD5A 1GDTA 2DA4A 2F2EA 2L9SA 4OAZA 1WJDA 3WG7H 1T6SA 2Z16A 3OIPA 1K78B 3A4CA 2K4JA 4HV6A 4XN3A 5D6EA 5F08A 5M3FJ 3GUDA 4M74A 2VQCA 3GEUA 1UCRA 3RZOJ 1H88C 2IGOA 1X1PA 4G12A 1ETYA 2VE9A 2G7LA 4XLCA 2VB6A 1ODDA 3DPTA 1PP7U 4GYGA 3SXYA 2V26A 4LB6B 5KNLA 4M9XA 2E60A 5DM7F 3J7ZI 3HRSA 3S17J 3IKTA 1E17A 2P6SA 4XRFA 3VYSB 2ZNZA 2BOLA 4GXOA 2R5ZA 2ID6A 2NP5A 5AONA 2Z9OA 2WY7Q 4XLPF 4V19K 2NAZA 3CC4I 5FRMA 1X4OA 1TT0A 2IEKA 3CLQA 5L3EA 2GM4A 2CFXA 2EV5A 3TOAA 2DAOA 5FKNA 3VSLA 1O57A 1SMTA 1HDDC 2YU3A 4MGRA 5EG0B 2CV0A 3OV8A 4E4HA 4F92B 4MXMA 4IEJA 3LMMA 1BBYA 2OQGA 2V9VA 3P9KA 3L2UA 4OWRB 3BR5A 1K4TA 3ABTA 3QP5A 1CQTA 1U9OA 3S1MJ 4L62A 1SAXA 4C3JJ 4XQFA 3ZN0A 4KDPA 1ZQ3P 4IRGA 2GXAA 1R22A 2GLOA 1WFXA 1VQOI 2OBPA 2M1BA 2HU9A 1I5ZA 3FKJA 3GLLA 2WGBA 1YJWI 3S5RA 3CCUI 1FEXA 3QKXA 3MZYA 5J1RA 3VIBA 4I6ZA 3CUOA 3HOZJ 1P7JA 1VQ6I 1ENHA 1A31A 2KKOA 1Y8RB 3KP6A 2FNPA 3DTEA 3SEQA 3LSJA 2LMDA 2P0WA 4NDLA 1UB9A 4WK8F 2DQLA 2XGEA 4CCLA 3I55I 2ZSHB 3KLNA 1LEBA 1PUEE 1S29A 1BI2A 4OD5A 3LSKA 3FM3A 4HQMA 2HI3A 5J8CA 3M8JA 4BE2A 1ONVA 1Y39A 1ZKGA 4PUSA 3GCMA 4PFPA 1E3OC 3K8PC 5F64A 2OI8A 1ZHFA 2OU2A 4CICA 1SFUA 1Y0UA 1R71A 1IDYA 2JSPA 2PFBA 3DWLE 5F27A 1BJZA 2EFNA 4HNTA 2ZMEC 3MQ0A 2DK8A 2HKUA 1D3YA 2VL8A 2ZJQF 3NXCA 4FASD 1RKWA 2PX9A 3AQSA 3BCBA 3EGQA 3W2WA 4X6AJ 1T08B 3KZ9A 4MFDA 1ITYA 3DQVC 4KJZA 2W57A 3HOWJ 3JAMZ 2AO9A 2NS7A 1R1VA 1UG2A 1YLFA 1D1BA 3TP3A 1MH3A 3GLXA 2QKMB 3FXKA 3LA3A 3L00A 1XGNA 3K1PA 3BROA 1M1EB 2LK2A 5IP9J 1A6IA 2XKOA 2OQRA 1LDJA 3OYLA 4IL6C 2QSHX 4OAYA 3OYGA 2OAZA 1LDDA 4KUMA 1AOYA 3W3CA 4WIBA 4HPQA 2IA2A 2X6XA 3A1YA 3WGGA 2R5YB 1ULYA 4IHSA 1I1SA 3KKCA 1R23A 3HE0A 2EWNA 3L9FA 2LY1A 4KYWA 3DV8A 2OUMA 2ZXHA 4A3JJ 4UUSB 2ELJA 1CF7B 1X2MA 3UKGA 2DPDA 1HOMA 4BEHA 2FF4A 4OIQF 4IHTA 3HRUA 2UWMA 2WUIA 1JUSA 1XMKA 5DTDA 2YS9A 1PUFA 2VJIA 5B66C 4DBQA 9ANTA 1Y56A 1HBXG 2OF7A 5E3NA 4LIUA 2VT3A 1G3YA 2IP2A 5E3OA 3VOXA 1YG2A 2RNJA 2FRHA 3BG6A 1A36A 1RPWA 2ID3A 3FRQA 4ZJZA 1WJAA 3VYUB 3F6OA 2XDNA 2VXZA 1STZA 1YHQI 3DXJF 2ZB9A 3ROUA 1IUFA 5CLSA 4ZYDA 3B02A 4XOTA 5HDNA 2DPUA 2P6TA 3ERMA 4BBSJ 1MMDA 1YX5A 1SFKA 5D8LB 4II3A 1Z77A 3JSOA 3BWGA 3J7AO 5LHHA 3S2DJ 5J40A 4B48A 3W6JB 5HLHA 3HOTA 4QLCU 2LC2A 1Z3YA 4NC7A 2RQQA 3TO7A 3BR1A 3JCUC 2MC3A 3I64A 3WTYC 1Z9CA 3E6MA 2UXHA 3NQOA 3BRUA 1FOXA 3ON4A 4XN0A 1ZELA 2G3BA 3F22A 3IUVA 4ZTJA 3D5SC 4B44A 3FXJA 1IC8A 2P7CB 2PJRA 4YZEA 3K6GA 2LBFB 1Z1DA 3ZMTA 3ZQLA 3MD2A 4KIGA 2D6YA 1MZBA 4U9NA 3CTAA 3KETA 2D5VA 1U5TB 4PJJA 1YYVA 5HS9A 2R7FA 4BS9A 3GFLA 2VKHA 4IHWA 3QBMA 4FX0A 3F0CA 1WH7A 1QPIA 3MZ8A 2OJED 3CO6C 3K0LA 3I59B 2GA1A 1FBUA 3S3OA 2QOPA 1JHFA 3H0GJ 2PN6A 4BQOA 4IHXA 1UHMA 4GYIA 4V2GA 2E1MC 2V6EA 2TCTA 3FXMA 1LFUP 1FLIA 2EQRA 1OLTA 1QZYA 4AU7A 5D5UB 2R5YA 3VP5A 1IXCA 4AYBA 2UXNA 1WKMA 1XDSA 2EK5A 1JTXA 2XRNA 3FXQA 5FFZA 2X48A 4HF1A 2ME0A 5IYBJ 4CXFA 2DA6A 3SZPA 4AF5A 2Q0OA 4MTDA 1XS9A 3K69A 2MABA 3E1SA 3I71A 2OZ6A 3DBRB 2LF8A 1SMYF 4BXXJ 2YVXA 1HSJA 2CYYA 2ELKA 4PGGA 4LLGF 1FYKA 2EV6A 5LD2C 2D2WA 4RAGA 4AUXA 1HC8A 1ZG3A 3B73A 2RREA 1KYZA 1O3QA 3R4KA 2W00A 4PSWA 1FSEA 3T8TA 3CDLA 4A5MA 1DP3A 2QA4I 2DTZA 2X4HA 4F3QA 5FROA 4RBOA 1T98A 2B63J 4M72A 4RGRA 4BQNA 1P92A 4EJOA 3KP5A 3KP3A 2E1NA 4IZZA 4UXNA 1X1DA 2XB0X 1J59A 1W1WE 3E6CC 4NNJA 1IO2A 1R9TJ 1R5HA 3UNGC 2NOJB 4AIHA 1BIAA 1LEAA 2G7GA 4HEA2 1JUMA 3HL2A 4IOAF 2KJCA 3KE2A 3HKZA 3Q3SA 4A3LJ 4QTRA 2ZMEA 2VBWA 1R1TA 2KP6A 1NG6A 1HLVA 2HDCA 4ZZLA 3HC7A 3IKVA 3CMAI 1T8IA 1B1BA 5K7ZA 4EGZA 2OD5A 3ZOBA 4Q48A 4XLHA 5IOYA 3NS4A 4HNUA 3PFYA 5DS9A 2OA4A 3IAM2 5HNHA 3M1EA 4RAFA 1SFXA 1P6RA 2AS5F 3E5UA 4IRVA 3T0YA 2DT5A 5F1RA 2CRGA 2K02A 3NARA 4GFKA 1QQIA 1YX3A 2VQLA 1OQYA 2CFOA 5ICFA 1GHCA 4HLXA 2MG4A 2PMUA 5LEJA 3HHHA 4BDYA 2CUFA 2JA7J 2GBYA 3VEPA 4FX4A 3PQJA 3BG5A 2IXSA 3KX2A 3CCLI 2CO5A 2HVRA 2UUZA 1F1ZA 2O7TA 4ZDLA 4MO7A 3E7LA 3E5QA 1FZPB 1W36C 2ZCWA 3CRJA 1FP2A 2LR8A 5LHIA 1NTCA 3L1PA 3QYBA 2GZWA 3VOKA 1JE8A 2FBQA 2RNGA 1ZGAA 1R4MB 2OTLI 4DNCA 2PZ9A 4KIFA 3KZIC 1ZARA 1D0XA 1IZ1A 2Y48A 3A0HC 3FBNB 3IH4A 3IWZA 2NP3A 2VC1A 2HPMA 4DOZA 1Z3XA 4IF4A 2DJNA 3G2BA 4OMZA 1LE8B 3EETA 2E5NA 1IG7A 1TLHB 2J5OA 2KIFA 3MN2A 2NS0A 4MK6A 2IW5A 4AD9A 3QRFF 4KWAA 4BXFA 5GAEJ 1UG0A 1VQ8I 4B1RA 4IJAA 3PQKA 4S0HB 5F0CA 2IT0A 4G94A 1YIJI 2BY2A 4BQQA 5FJ8J 3BP8A 2DA2A 1WJBA 3M7GA 4M6VA 4BHBA 1AHDP 2ZY9A 5EEGA 4E6KG 4Q47A 3K1NA 2A07F 3DKYA 2L4MA 3NRGA 3RQIA 1ZLKA 1H9GA 3ZQ7A 3G3ZA 4M9SA 5D4RA 4RAYA 4EM1A 5CVRA 2FJ1A 4J01A 1QO0D 5H20A 2LTPA 3Q0VA 3QODA 1MBHA 1XGMA 4BY7J 1JHHA 2X1CA 3HSRA 4L5JA 4UUTA 4B8XA 1OCTC 1LB2A 3V7CA 4UNOA 3ZR8X 4HX7A 3GFJA 4ZYAA 1E3PA 2KPMA 3QOEA 2IPQX 2ZXWH 3EUAA 2R7VA 4RLQA 1JGSA 1ORKA 4KN4X 3MNLA 4AM3A 2I10A 2EA2A 2VKVA 1HXDA 3NRVA 1YRNA 1QNTA 4ITVA 2EZLA 2R7UA 1I27A 1MMGA 2KMUA 2XAGA 3BR0A 3ZMDA 2ZJ2A 3FXUA 2PLYA 2ESNA 1ZREA 2HEOA 4A0ZA 2CU7A 2XC7A 1GT0C 1HW1A 4L9NA 5BQTA 2QLZA 4B3XA 4RB0A 2W1OA 1SEUA 1T0FA 2WAEA 1RETA 4HBLA 2Y0SN 2GQQA 2HKXA 2RV8A 1OYWA 3WU0A 4CYDA 1MD0A 2Z3YA 4CYCB 2DK5A 4LK0F 3VODA 2F5VA 2ECCA 2XF7A 2GOXB 3C7JA 5J47A 1K61A 1UI6A 5DCMA 2JA2A 2ZNYA 5EF6A 3A2KA 5K58A 2X51A 5D1RA 4LK1F 2PI0A 1TW3A 3SDBA 1OCOH 3CF2A 4J00A 4A3IJ 4O3MA 4X1EA 5HDKA 5IOZA 2Q2EB 4RM2A 4FCYA 2Z5UA 3VYTB 2YVHA 3GTPJ 1O3SA 1RNLA 4DQ2A 3GTJJ 1UI5A 4Y15A 4E7LA 3BLYA 2E71A 3K4KA 3MKYB 3U21A 1X1CA 1FX7A 3RKYA 3OYEA 5LHGA 4C30A 4A6DA 5JLWA 2HOAA 3S3MA 2X9DA 1H89C 1EA3A 1FSHA 2A2FX 2F5EA 2UXOA 1BOBA 2IGKA 4Y17A 3CCSI 1JKRC 1U8BA 4U9LA 2V9KA 4LMYA 1GLNA 4JX5A 1MKMA 3ZMVA 2IS2A 1FY7A 4GCKA 2YU9J 4BHPA 3WGHA 4S05A 2W82A 3JRHA 2PBXA 2KRFA 4KT6A 2F5FA 4DYQA 2UXUA 1SC7A 4ANJA 1LVKA 4RDUA 5EGOB 3S1NJ 2LF7A 1GUUA 3KZZA 2RGVA 1RI7A 3F72A 3BJBA 1S9HA 4HQEA 3K9TA 1LDKB 2FOKA 3GFMA 3I54A 1D8KA 4MNUA 2VJ4A 2V1UA 1OCPA 4E7HA 4ZYHA 1KQ9A 1SAUA 4S04A 4JL3A 3CUQC 2QWTA 3R0AA 5GADJ 2BW3A 3L2CA 3CWRA 1IUYA 5J1YA 4LIVA 5C4XJ 4BH9A 1YW7A 4A3EJ 3LFUA 3WTSC 2OCCH 1VQMI 2WAQA 3ZQFA 4JQFA 4ON0A 5GP9A 1SFEA 1OPCA 3LWFA 2E2HJ 2A5WA 3LAPA 2VXDA 2CJJA 4A0YA 2EPFA 4FTHA 1JT6A 2H1LA 4XKVA 4G7OF 2E5ZA 2F4IA 1D5YA 5DM6F 4BYYA 4LG0B 3PIPF 1XB4A 2JVHA 3MAJA 2JSCA 2CQ7A 5EYRA 4Z2YA 2IS6A 1F43A 3FMQA 3KP7A 3S3NA 3HIFA 1IRZA 3DPLC 2MW8A 3P9CA 1S7EA 4D9JA 1S7OA 3BC8A 4BE0A 3H5NA 3CC2I 1N77A 1T33A 3FZVA 1RIOH 1X3ZB 4OMYA 1LFBA 1DU6A 2KL4A 2O0YA 2MH2A 3ZRGA 5FKLA 1IV8A 2HTSA 5E3LA 4CGZA 2DW4A 4BU2A 1YIOA 3GTMJ 3KEOA 5E3MA 2IA1A 2ZOZA 3LWJA 1WPKA 3C07A 2FMLA 3O6BB 3BR6A 2ZJPF 3F23A 3WTXC 2JN6A 2LD5A 1IF1A 3L2WA 1LJ9A 4MTEA 3JRAA 1OCRH 3PNTA 1EF4A 2WB1A 1TWHJ 3GBGA 3ZQHA 4Z6YA 1DPUA 4LG3A 1WCMJ 4GGGA 5J1UA 3ZMSA 2YX4A 1ETVA 2W24A 2WAFA 3O60A 4PFOA 4DZJA 3BTLA 2DQRA 1XG1A 2RHAA 4H0EA 3EUHA 4QPOA 2VODA 1Y1WJ 3CD6I 2JRTA 1FC3A 2UXPA 1YQAA 5FB2A 4NB5A 1BC8C 3ZXSA 4L5EA 2F6CA 5IY5H 5EFYA 5ERIA 2Z99A 3ASOH 3RKWA 2PMZN 2MSYA 3LSHA 2MH9A 2P81A 2E1CA 2Y75A 2B3WA 2HYJA 3RPQA 5TISC 2ESHA 5H2FC 2W4SA 2ETHA 1EH7A 1DQUA 3NWSA 1X1AA 3L2RA 5ILUA 3N05A 3N4MA 1WI9A 2JZYA 2DXIA 2V79A 4XR6A 3RCOA 4XIDA 2JJ7A 2HQNA 1ZG5A 5GTIC 1C0WA 2PQ8A 2CV1A 2BBYA 4LLNA 5C4JJ 3T6NA 1XPXA 2GIZA 4U87A 3OYIA 1Z21A 1L0OC 2WY8Q 2HXIA 1OMIA 3DU6A 3IRQA 1RUNA 3SFZA 1FTZA 2EFPA 5JVTA 3PNVA 3VWBA 1OKRA 4LG0A 1YJ9I 2ZKZA 5H9TA 1X1BA 1LUJB 3QWLA 2VJJA 2BV6A 4DZPA 1V5EA 1TWCJ 3VB2A 4XL9A 2IGMA 4Y7NJ 2PMZA 3IC7A 2DT6A 3SHFA 3RZDJ
chains in the Genus database with same CATH topology
3BR1A 3HBLA 1B72B 2UXHA 3ON4A 2ME6A 3BRUA 1ZR2A 2G3BA 2R5ZB 3IUVA 2V57A 4ACIA 3HTJA 1LE8A 4HKUA 4W1UA 1IC8A 2VI6A 1UMQA 4YZEA 4CGRA 2QTQA 3ZQLA 4ABZA 3LOCA 2D6YA 1RKTA 2D5VA 2L7ZA 3LHQA 1AU7A 5IP7J 4IHWA 3QBMA 2WV1A 4W97A 2G7SA 3F0CA 1WH7A 4JYKA 5FKOA 1QPIA 4NN1A 5EGOA 3MVPA 5GPAA 1ZR4A 1SFOJ 5FMPA 2QOPA 3H0GJ 4IHXA 1I50J 1OJLA 3RH2A 3TW7A 3RD3A 4V2GA 3CMYA 2TCTA 1LFUP 4A3KJ 2EQRA 2R5YA 1JJ8C 1WH5A 1MSEC 3VP5A 2DA3A 3JR9A 4I76A 2DMPA 3F1BA 3B81A 1JTXA 4UUSA 1MNMC 2X48A 2ME0A 4JNNA 1Y1VJ 4MFEA 2XPUA 1ETXA 2DA6A 5IYBJ 2DN0A 1YRNB 4AF5A 5HAWA 4V2FA 1XS9A 5M5YJ 1P7IA 3W6VA 4QIWN 4FE4A 4BXXJ 2UXIA 4GCTA 2ELKA 3V6GA 3ZQGA 3LJLA 2X6OA 3HDDA 5D18A 4AUXA 1OFCX 2HDDA 4DYCA 2R0QC 4EEFG 5D19A 3VW1A 1GVDA 3K2AA 1IDZA 3CDLA 3HOUJ 1U9NA 3FISA 1SANA 2DTZA 2XGDA 3OIOA 2B63J 4RBOA 2DG8A 1MBKA 2CUEA 2DMQA 1T56A 3WHBA 1NK2P 5FGLA 2IBDA 1ETWA 2XB0X 1BA5A 5CXIA 2ZCNA 2R7ZJ 1ZK8A 1NK3P 2E19A 1R9TJ 4PXIA 2LLKA 3BNIA 4BKXA 3ZQCA 2O8KA 5FLVA 3LNQA 2G7GA 2M8GX 1JUMA 3GZIA 2KT0A 2VKEA 3NI7A 3Q3SA 4A3LJ 2JWTA 4QTRA 2EBIA 3GTKJ 2NOGA 5HBUA 3BQZA 4A3CJ 3IH2A 1HLVA 1DU0A 2R92J 1Q1VA 4GFLA 1AKHB 1QRYA 3M4OJ 1IGNA 2QKOA 1W0TA 5JLXA 3S1RJ 3HTHA 5CW8A 5K7ZA 2Y30A 3I4NJ 3VUQA 3HOYJ 3ZOBA 4D5CA 5IOYA 3G1LA 3S1QJ 1BW6A 5DS9A 1RESA 4DW6A 3GTQJ 3QPSA 4XRSA 5C44J 2MGQA 2EH3A 4XK4A 3HEFA 2XPWA 2CRGA 3NARA 4GFKA 2COBA 3BG3A 2ZOYA 5GPCA 1MH4A 4XICA 1K83J 3E7QA 4A3BJ 1ZTRA 3HM5A 3QPLA 3P9TA 1PUFB 1JTYA 2L7FP 2MG4A 3ANGA 1MBGA 1B8IA 3DEWA 1XC5A 4JKZA 5AQCA 3C2BA 2CUFA 3BG9A 3G1OA 4XRSG 2QF7A 2GBYA 4AYBN 2E2IJ 2JA7J 3HTIA 3BG5A 3BQYA 2GFNA 1BW5A 1FJLA 3K7AJ 4UDSA 3VW0A 3FKIJ 4J19A 2QCOA 4A93J 2IU5A 3KKDA 2CQQA 3S15J 2O7TA 1JKQC 4MO7A 3A02A 2K9QA 3E7LA 2CQXA 1VF9A 3CRJA 2LR8A 2DMUA 2JMWA 1BL0A 2HYTA 1NTCA 2DA5A 3L1PA 4A3GJ 3VOKA 2FBQA 3FK6A 4AC0A 2ZCMA 3EUPA 1JKOC 2M34A 1FTTA 2PZ9A 3HB9A 2HOSA 1ETKA 2HXOA 2W53A 3IH4A 3GTGJ 3TEDA 5FKMA 2NP3A 1B8IB 2XGCA 2OPTA 3PM1A 5HODA 5IYCJ 2L9RA 2W48A 1LE8B 2DJNA 1IG7A 2QIBA 5K7FA 1ZGWA 1TC3C 3CJDA 5M3MJ 2DA1A 3MN2A 2JA8J 4MK6A 1A5JA 3SDGA 4KWAA 4DYRA 1I6HJ 4B1RA 3A01A 2JA6J 3QQAA 4S0HB 2WB1N 2TRTA 5F0CA 3A03A 3JRDA 4MIMA 3JRCA 1IV6A 5FJ8J 2DA2A 3HGYA 3S14J 3S2HJ 1FIPA 5CXGA 4M6VA 1AHDP 3JRFA 3HIMA 4A3DJ 5EDNA 1F36A 3CCYA 4M3EA 3NRGA 3V78A 2LFBA 5J3LA 3RQIA 1TWGJ 4D5FA 3RKQA 3IH3A 4GFBA 3PO3J 5BNGA 5K7HA 3FIWA 2FJ1A 5HSZA 1X58A 2LTPA 3HKZN 3Q0VA 3TW6A 5C4YA 1MBHA 1GV2A 4BY7J 2XRLA 1GV5A 5FLMJ 4UUTA 1OCTC 5FHPA 3JREA 2JA5J 3GTOJ 4CYCA 3DCFA 4BBRJ 3DPJA 1MBFA 2Y9ZA 2WAQN 2DG7A 2RASA 3SFIA 3BCGA 2EZIA 4M3DA 4ME9A 1ORKA 2NS8A 2XB5A 4Y52J 2F07A 3MNLA 2I10A 3VW2A 2VPRA 2K9NA 4MLOA 2VKVA 1YRNA 3GTLJ 1TWAJ 2M9HA 2AHQA 2EZLA 3BR0A 3BTJA 3LSGA 5EZGA 2K40A 3BT9A 5EEAA 2L7MP 1G2HA 1ETQA 3B6AA 2CU7A 1GT0C 2HQ5A 3SJMA 2E2JJ 3JRGA 1MBJA 4JX4A 5M5XJ 1JJ6C 4IHVA 1QVUA 1RETA 4A3FJ 2XPVA 2LKXA 2Y0SN 2HOTA 2Y2ZA 1U78A 4JX6A 2FD5A 2IAIA 1UHSA 1WGXA 4CYCB 4C2MJ 4JP0A 2XSDC 4C3HJ 2ECCA 1K61A 1GDTA 1UI6A 2DA4A 3PPBA 2K9SA 5EF6A 5K58A 4AC6A 5IPAA 5M3FJ 5F08A 4D7MA 3GEUA 5D1RA 1H8AC 3RZOJ 4A3IJ 4X1EA 1H88C 4G12A 5IOZA 4BY1J 1ETYA 1TWFJ 1VI0A 3ANPA 2G7LA 4A69C 4FCYA 2YVHA 5IP6A 3GTPJ 2Q24A 3GTJJ 2NVQJ 3HOVJ 1UI5A 2DMNA 3BR2A 1AKHA 1ETOA 3OOUA 2NX4A 5F0FA 3G7RA 3S17J 4NELA 5JLWA 1MSFC 2HOAA 2X9DA 1H89C 2R5ZA 1HF0A 2UXOA 1JKRC 2ID6A 2NP5A 1U8BA 2Y31A 2KDZA 2O9LA 4JX5A 4B3AA 3B6CA 3PASA 3FK7A 2IEKA 3LSPA 4GCKA 3AQTA 2GM4A 2YU9J 3JRHA 5FKNA 4D7NA 2PBXA 2LP0A 1HDDC 4XRMA 5M5WJ 4DYQA 5EG0B 2UXUA 3TP0A 4MXMA 3BHQA 4RDUA 2N8GA 4IEJA 5EGOB 3BTCA 3S1NJ 1GUUA 3OSGA 5F1JA 2ECBA 5EG0A 3BJBA 3VVYA 2H1KA 2L0KA 2YUSA 5IYDJ 2FQ4A 1X2NA 3KNWA 3O8HA 4A3MJ 5C3EJ 3JRIA 3BR5A 1CQTA 5DAJA 1U9OA 1OCPA 3BR3A 3S1MJ 2G0EA 4L62A 4C3JJ 1WI3A 4JL3A 2QWTA 1RR7A 1ZQ3P 4M3BA 3HTAA 4M3GA 2GUHA 3CWRA 2GLOA 3VPRA 5J1YA 4ICHA 5C4XJ 4A3EJ 2WGBA 3S5RA 4IHYA 1FEXA 3QKXA 5J1RA 3VIBA 4I6ZA 3ZQFA 5GP9A 3HOZJ 3MKLA 2E2HJ 1P7JA 2EZKA 1ENHA 1JT0A 2CJJA 2RAEA 2GENA 4FTHA 1JT6A 4QSHA 1APLC 3G1MA 1D5YA 3LSJA 3LSRA 4NDLA 5EYRA 2XGEA 3CQZJ 1F43A 2FX0A 3M3YJ 1IRZA 1VNDA 2MW8A 1S7EA 3S16J 2R93J 2HI3A 2LVSA 1T33A 1ZKGA 2O7OA 1E3OC 1LFBA 2OI8A 1DU6A 2M2EA 2YVEA 3PO2J 1IDYA 3A01B 3G56A 5F27A 5FKLA 1BJZA 3OSFA 5E3LA 2HKUA 3NXCA 1Z0XA 1RKWA 3GTMJ 3AQSA 3EGQA 1HDPA 1JKPC 5E3MA 4X6AJ 3KZ9A 4LOCA 4MFDA 1ITYA 2ZOZA 3LWJA 3VVXA 1WPKA 3C07A 3HOWJ 3BR6A 2AO9A 2NS7A 1UG2A 2JN6A 2LD5A 1O4XA 3ON2A 2H8RA 3TP3A 1MH3A 1POGA 3HGGA 3JRAA 5FKKA 3ZQHA 1TWHJ 3GBGA 1QVTA 1EF4A 3VVZA 2NVYJ 1WCMJ 1FIAA 2LK2A 5IP9J 1A6IA 5J1UA 1ETVA 2JK3A 3O60A 3O8GA 4DZJA 3BTLA 1XG1A 3BTIA 2RHAA 3COLA 3NNRA 1Y1WJ 4HNVA 2E1OA 5EZHA 3ZQIA 2NVTJ 1IJWC 3HOXJ 2R5YB 2M0CA 2UXPA 3WHCA 1MBEA 1SGMA 3Q0WA 4GCLA 4L5EA 3KKCA 3HE0A 3NPIA 2DA7A 2VUMJ 5EFYA 4FE7A 4A3JJ 2PMZN 2MSYA 4UUSB 1HCRA 3Q0UA 2P81A 4M3FA 2Y9YA 1X2MA 3UKGA 1HOMA 3IV5A 1I3QJ 2HYJA 4B4CA 2NVXJ 2WUIA 1JUSA 2OERA 5DTDA 1B72A 2YS9A 1PUFA 1VFCA 5F04A 1JGGA 9ANTA 4C3IJ 2OF7A 5E3NA 2LY9A 5E3OA 3VOXA 2DMTA 4XIDA 2JJ7A 1RPWA 2ID3A 3FRQA 2XDNA 5C4JJ 3T6NA 2ZB9A 4FISA 1IUFA 2HXIA 1FTZA 5F0HA 3NAUA 4BBSJ 2ZCXA 2EZHA 3H3VK 1W0UA 1Z77A 5H9TA 4DZPA 3I4MJ 3JSJA 3S2DJ 1TWCJ 3D1NI 2REKA 4Y7NJ 3JRBA 1JUPA 3RZDJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR1 A;  3HBL A;  1B72 B;  2UXH A;  3ON4 A;  2ME6 A;  3BRU A;  1ZR2 A;  2G3B A;  2R5Z B;  3IUV A;  2V57 A;  4ACI A;  3HTJ A;  1LE8 A;  4HKU A;  4W1U A;  1IC8 A;  2VI6 A;  1UMQ A;  4YZE A;  4CGR A;  2QTQ A;  3ZQL A;  4ABZ A;  3LOC A;  2D6Y A;  1RKT A;  2D5V A;  2L7Z A;  3LHQ A;  1AU7 A;  5IP7 J;  4IHW A;  3QBM A;  2WV1 A;  4W97 A;  2G7S A;  3F0C A;  1WH7 A;  4JYK A;  5FKO A;  1QPI A;  4NN1 A;  5EGO A;  3MVP A;  5GPA A;  1ZR4 A;  1SFO J;  5FMP A;  2QOP A;  3H0G J;  4IHX A;  1I50 J;  1OJL A;  3RH2 A;  3TW7 A;  3RD3 A;  4V2G A;  3CMY A;  2TCT A;  1LFU P;  4A3K J;  2EQR A;  2R5Y A;  1JJ8 C;  1WH5 A;  1MSE C;  3VP5 A;  2DA3 A;  3JR9 A;  4I76 A;  2DMP A;  3F1B A;  3B81 A;  1JTX A;  4UUS A;  1MNM C;  2X48 A;  2ME0 A;  4JNN A;  1Y1V J;  4MFE A;  2XPU A;  1ETX A;  2DA6 A;  5IYB J;  2DN0 A;  1YRN B;  4AF5 A;  5HAW A;  4V2F A;  1XS9 A;  5M5Y J;  1P7I A;  3W6V A;  4QIW N;  4FE4 A;  4BXX J;  2UXI A;  4GCT A;  2ELK A;  3V6G A;  3ZQG A;  3LJL A;  2X6O A;  3HDD A;  5D18 A;  4AUX A;  1OFC X;  2HDD A;  4DYC A;  2R0Q C;  4EEF G;  5D19 A;  3VW1 A;  1GVD A;  3K2A A;  1IDZ A;  3CDL A;  3HOU J;  1U9N A;  3FIS A;  1SAN A;  2DTZ A;  2XGD A;  3OIO A;  2B63 J;  4RBO A;  2DG8 A;  1MBK A;  2CUE A;  2DMQ A;  1T56 A;  3WHB A;  1NK2 P;  5FGL A;  2IBD A;  1ETW A;  2XB0 X;  1BA5 A;  5CXI A;  2ZCN A;  2R7Z J;  1ZK8 A;  1NK3 P;  2E19 A;  1R9T J;  4PXI A;  2LLK A;  3BNI A;  4BKX A;  3ZQC A;  2O8K A;  5FLV A;  3LNQ A;  2G7G A;  2M8G X;  1JUM A;  3GZI A;  2KT0 A;  2VKE A;  3NI7 A;  3Q3S A;  4A3L J;  2JWT A;  4QTR A;  2EBI A;  3GTK J;  2NOG A;  5HBU A;  3BQZ A;  4A3C J;  3IH2 A;  1HLV A;  1DU0 A;  2R92 J;  1Q1V A;  4GFL A;  1AKH B;  1QRY A;  3M4O J;  1IGN A;  2QKO A;  1W0T A;  5JLX A;  3S1R J;  3HTH A;  5CW8 A;  5K7Z A;  2Y30 A;  3I4N J;  3VUQ A;  3HOY J;  3ZOB A;  4D5C A;  5IOY A;  3G1L A;  3S1Q J;  1BW6 A;  5DS9 A;  1RES A;  4DW6 A;  3GTQ J;  3QPS A;  4XRS A;  5C44 J;  2MGQ A;  2EH3 A;  4XK4 A;  3HEF A;  2XPW A;  2CRG A;  3NAR A;  4GFK A;  2COB A;  3BG3 A;  2ZOY A;  5GPC A;  1MH4 A;  4XIC A;  1K83 J;  3E7Q A;  4A3B J;  1ZTR A;  3HM5 A;  3QPL A;  3P9T A;  1PUF B;  1JTY A;  2L7F P;  2MG4 A;  3ANG A;  1MBG A;  1B8I A;  3DEW A;  1XC5 A;  4JKZ A;  5AQC A;  3C2B A;  2CUF A;  3BG9 A;  3G1O A;  4XRS G;  2QF7 A;  2GBY A;  4AYB N;  2E2I J;  2JA7 J;  3HTI A;  3BG5 A;  3BQY A;  2GFN A;  1BW5 A;  1FJL A;  3K7A J;  4UDS A;  3VW0 A;  3FKI J;  4J19 A;  2QCO A;  4A93 J;  2IU5 A;  3KKD A;  2CQQ A;  3S15 J;  2O7T A;  1JKQ C;  4MO7 A;  3A02 A;  2K9Q A;  3E7L A;  2CQX A;  1VF9 A;  3CRJ A;  2LR8 A;  2DMU A;  2JMW A;  1BL0 A;  2HYT A;  1NTC A;  2DA5 A;  3L1P A;  4A3G J;  3VOK A;  2FBQ A;  3FK6 A;  4AC0 A;  2ZCM A;  3EUP A;  1JKO C;  2M34 A;  1FTT A;  2PZ9 A;  3HB9 A;  2HOS A;  1ETK A;  2HXO A;  2W53 A;  3IH4 A;  3GTG J;  3TED A;  5FKM A;  2NP3 A;  1B8I B;  2XGC A;  2OPT A;  3PM1 A;  5HOD A;  5IYC J;  2L9R A;  2W48 A;  1LE8 B;  2DJN A;  1IG7 A;  2QIB A;  5K7F A;  1ZGW A;  1TC3 C;  3CJD A;  5M3M J;  2DA1 A;  3MN2 A;  2JA8 J;  4MK6 A;  1A5J A;  3SDG A;  4KWA A;  4DYR A;  1I6H J;  4B1R A;  3A01 A;  2JA6 J;  3QQA A;  4S0H B;  2WB1 N;  2TRT A;  5F0C A;  3A03 A;  3JRD A;  4MIM A;  3JRC A;  1IV6 A;  5FJ8 J;  2DA2 A;  3HGY A;  3S14 J;  3S2H J;  1FIP A;  5CXG A;  4M6V A;  1AHD P;  3JRF A;  3HIM A;  4A3D J;  5EDN A;  1F36 A;  3CCY A;  4M3E A;  3NRG A;  3V78 A;  2LFB A;  5J3L A;  3RQI A;  1TWG J;  4D5F A;  3RKQ A;  3IH3 A;  4GFB A;  3PO3 J;  5BNG A;  5K7H A;  3FIW A;  2FJ1 A;  5HSZ A;  1X58 A;  2LTP A;  3HKZ N;  3Q0V A;  3TW6 A;  5C4Y A;  1MBH A;  1GV2 A;  4BY7 J;  2XRL A;  1GV5 A;  5FLM J;  4UUT A;  1OCT C;  5FHP A;  3JRE A;  2JA5 J;  3GTO J;  4CYC A;  3DCF A;  4BBR J;  3DPJ A;  1MBF A;  2Y9Z A;  2WAQ N;  2DG7 A;  2RAS A;  3SFI A;  3BCG A;  2EZI A;  4M3D A;  4ME9 A;  1ORK A;  2NS8 A;  2XB5 A;  4Y52 J;  2F07 A;  3MNL A;  2I10 A;  3VW2 A;  2VPR A;  2K9N A;  4MLO A;  2VKV A;  1YRN A;  3GTL J;  1TWA J;  2M9H A;  2AHQ A;  2EZL A;  3BR0 A;  3BTJ A;  3LSG A;  5EZG A;  2K40 A;  3BT9 A;  5EEA A;  2L7M P;  1G2H A;  1ETQ A;  3B6A A;  2CU7 A;  1GT0 C;  2HQ5 A;  3SJM A;  2E2J J;  3JRG A;  1MBJ A;  4JX4 A;  5M5X J;  1JJ6 C;  4IHV A;  1QVU A;  1RET A;  4A3F J;  2XPV A;  2LKX A;  2Y0S N;  2HOT A;  2Y2Z A;  1U78 A;  4JX6 A;  2FD5 A;  2IAI A;  1UHS A;  1WGX A;  4CYC B;  4C2M J;  4JP0 A;  2XSD C;  4C3H J;  2ECC A;  1K61 A;  1GDT A;  1UI6 A;  2DA4 A;  3PPB A;  2K9S A;  5EF6 A;  5K58 A;  4AC6 A;  5IPA A;  5M3F J;  5F08 A;  4D7M A;  3GEU A;  5D1R A;  1H8A C;  3RZO J;  4A3I J;  4X1E A;  1H88 C;  4G12 A;  5IOZ A;  4BY1 J;  1ETY A;  1TWF J;  1VI0 A;  3ANP A;  2G7L A;  4A69 C;  4FCY A;  2YVH A;  5IP6 A;  3GTP J;  2Q24 A;  3GTJ J;  2NVQ J;  3HOV J;  1UI5 A;  2DMN A;  3BR2 A;  1AKH A;  1ETO A;  3OOU A;  2NX4 A;  5F0F A;  3G7R A;  3S17 J;  4NEL A;  5JLW A;  1MSF C;  2HOA A;  2X9D A;  1H89 C;  2R5Z A;  1HF0 A;  2UXO A;  1JKR C;  2ID6 A;  2NP5 A;  1U8B A;  2Y31 A;  2KDZ A;  2O9L A;  4JX5 A;  4B3A A;  3B6C A;  3PAS A;  3FK7 A;  2IEK A;  3LSP A;  4GCK A;  3AQT A;  2GM4 A;  2YU9 J;  3JRH A;  5FKN A;  4D7N A;  2PBX A;  2LP0 A;  1HDD C;  4XRM A;  5M5W J;  4DYQ A;  5EG0 B;  2UXU A;  3TP0 A;  4MXM A;  3BHQ A;  4RDU A;  2N8G A;  4IEJ A;  5EGO B;  3BTC A;  3S1N J;  1GUU A;  3OSG A;  5F1J A;  2ECB A;  5EG0 A;  3BJB A;  3VVY A;  2H1K A;  2L0K A;  2YUS A;  5IYD J;  2FQ4 A;  1X2N A;  3KNW A;  3O8H A;  4A3M J;  5C3E J;  3JRI A;  3BR5 A;  1CQT A;  5DAJ A;  1U9O A;  1OCP A;  3BR3 A;  3S1M J;  2G0E A;  4L62 A;  4C3J J;  1WI3 A;  4JL3 A;  2QWT A;  1RR7 A;  1ZQ3 P;  4M3B A;  3HTA A;  4M3G A;  2GUH A;  3CWR A;  2GLO A;  3VPR A;  5J1Y A;  4ICH A;  5C4X J;  4A3E J;  2WGB A;  3S5R A;  4IHY A;  1FEX A;  3QKX A;  5J1R A;  3VIB A;  4I6Z A;  3ZQF A;  5GP9 A;  3HOZ J;  3MKL A;  2E2H J;  1P7J A;  2EZK A;  1ENH A;  1JT0 A;  2CJJ A;  2RAE A;  2GEN A;  4FTH A;  1JT6 A;  4QSH A;  1APL C;  3G1M A;  1D5Y A;  3LSJ A;  3LSR A;  4NDL A;  5EYR A;  2XGE A;  3CQZ J;  1F43 A;  2FX0 A;  3M3Y J;  1IRZ A;  1VND A;  2MW8 A;  1S7E A;  3S16 J;  2R93 J;  2HI3 A;  2LVS A;  1T33 A;  1ZKG A;  2O7O A;  1E3O C;  1LFB A;  2OI8 A;  1DU6 A;  2M2E A;  2YVE A;  3PO2 J;  1IDY A;  3A01 B;  3G56 A;  5F27 A;  5FKL A;  1BJZ A;  3OSF A;  5E3L A;  2HKU A;  3NXC A;  1Z0X A;  1RKW A;  3GTM J;  3AQS A;  3EGQ A;  1HDP A;  1JKP C;  5E3M A;  4X6A J;  3KZ9 A;  4LOC A;  4MFD A;  1ITY A;  2ZOZ A;  3LWJ A;  3VVX A;  1WPK A;  3C07 A;  3HOW J;  3BR6 A;  2AO9 A;  2NS7 A;  1UG2 A;  2JN6 A;  2LD5 A;  1O4X A;  3ON2 A;  2H8R A;  3TP3 A;  1MH3 A;  1POG A;  3HGG A;  3JRA A;  5FKK A;  3ZQH A;  1TWH J;  3GBG A;  1QVT A;  1EF4 A;  3VVZ A;  2NVY J;  1WCM J;  1FIA A;  2LK2 A;  5IP9 J;  1A6I A;  5J1U A;  1ETV A;  2JK3 A;  3O60 A;  3O8G A;  4DZJ A;  3BTL A;  1XG1 A;  3BTI A;  2RHA A;  3COL A;  3NNR A;  1Y1W J;  4HNV A;  2E1O A;  5EZH A;  3ZQI A;  2NVT J;  1IJW C;  3HOX J;  2R5Y B;  2M0C A;  2UXP A;  3WHC A;  1MBE A;  1SGM A;  3Q0W A;  4GCL A;  4L5E A;  3KKC A;  3HE0 A;  3NPI A;  2DA7 A;  2VUM J;  5EFY A;  4FE7 A;  4A3J J;  2PMZ N;  2MSY A;  4UUS B;  1HCR A;  3Q0U A;  2P81 A;  4M3F A;  2Y9Y A;  1X2M A;  3UKG A;  1HOM A;  3IV5 A;  1I3Q J;  2HYJ A;  4B4C A;  2NVX J;  2WUI A;  1JUS A;  2OER A;  5DTD A;  1B72 A;  2YS9 A;  1PUF A;  1VFC A;  5F04 A;  1JGG A;  9ANT A;  4C3I J;  2OF7 A;  5E3N A;  2LY9 A;  5E3O A;  3VOX A;  2DMT A;  4XID A;  2JJ7 A;  1RPW A;  2ID3 A;  3FRQ A;  2XDN A;  5C4J J;  3T6N A;  2ZB9 A;  4FIS A;  1IUF A;  2HXI A;  1FTZ A;  5F0H A;  3NAU A;  4BBS J;  2ZCX A;  2EZH A;  3H3V K;  1W0U A;  1Z77 A;  5H9T A;  4DZP A;  3I4M J;  3JSJ A;  3S2D J;  1TWC J;  3D1N I;  2REK A;  4Y7N J;  3JRB A;  1JUP A;  3RZD J; 
#chains in the Genus database with same CATH topology
 2CW0 F;  4G6Q A;  2ME6 A;  3BCA A;  1ZG1 A;  3FXO A;  1MJA A;  1XX5 A;  1K79 A;  1IN4 A;  2WC2 A;  1IRX A;  1LE8 A;  1A35 A;  2DFF A;  4W1U A;  4A2U A;  2VI6 A;  1O3R A;  4CDG A;  4CGR A;  5LBQ A;  3H9J A;  3CJN A;  4U7D A;  4ABZ A;  3GW2 A;  1NG7 A;  3LOC A;  4UY8 I;  5DYM A;  1NH3 A;  3F3X A;  3LHQ A;  2LOO A;  2H09 A;  4EJU A;  4RM3 A;  3TKY A;  1AU7 A;  3D5L A;  4LJZ F;  4L18 B;  4AIJ A;  1RRJ A;  1KQ0 A;  4W97 A;  2G7S A;  4YFX F;  4NN1 A;  4XSZ F;  1MNE A;  5DV5 A;  5GPA A;  4Y33 A;  1V5F A;  4RB3 C;  5DD4 A;  1W5T A;  1Z7L A;  2TDX A;  1OJL A;  3OYC A;  3OYD A;  1MW7 A;  2K85 A;  3I59 A;  1SD4 A;  2KQR A;  3RH2 A;  1T95 A;  4DBR A;  1DP7 P;  4HDV A;  3PJR A;  1Z91 A;  3M07 A;  1JJ8 C;  1WH5 A;  2B0L A;  1REP C;  4FQG A;  5DCF A;  4L9V A;  5D4S A;  1EJ9 A;  3B81 A;  1R6R A;  4UUS A;  2L4A A;  1MNM C;  2STT A;  4JNN A;  5LGU A;  1ETX A;  1I39 A;  6PAX A;  4NHJ A;  4I02 A;  2HQR A;  2H6B A;  3OWT A;  3OYF A;  1ZH5 A;  3DBH B;  2GWR A;  1P7I A;  3AG1 H;  4PSX A;  4QIW N;  1F4K A;  1XD7 A;  4PK4 A;  3JAM K;  2ZO4 A;  1P9Q C;  2UXI A;  3V6G A;  1LVA A;  5E1X A;  3LJL A;  2X6O A;  3GFI A;  2R0Q C;  1T0F C;  4EEF G;  1GVD A;  5CVV A;  2GA2 A;  4IRH A;  3C2H A;  1U9N A;  3FIS A;  3CUQ A;  4ZDO A;  4BUP A;  2DG8 A;  1QHG A;  3WHB A;  2DMQ A;  1ZGJ A;  5IT9 Z;  2H94 A;  2BVL A;  3MFK A;  1YE9 A;  1BA5 A;  2ZCN A;  3HOS A;  2R7Z J;  4ENJ A;  2NVU B;  1NK3 P;  2E19 A;  1YW9 A;  2LLK A;  2QQA A;  3BNI A;  2BGC A;  1SD7 A;  3DKX A;  3ZQC A;  1ZN2 A;  4HYE A;  4YEJ A;  5LLQ A;  2O8K A;  3VTI A;  3M8F A;  2VKE A;  1VQK I;  3PUB A;  4EV0 A;  3MCZ A;  2NOG A;  5CVJ A;  2EA4 A;  3FX3 A;  5HLI A;  4EJW A;  2F5D A;  4CZC A;  1DU0 A;  3VDX A;  1XDU A;  3CCM I;  1AKH B;  2QKO A;  1W0T A;  3ASN H;  2NYX A;  1OYY A;  3HTH A;  5CW8 A;  3VUQ A;  1YS6 A;  2MFZ A;  3G1L A;  3K4N A;  1BW6 A;  4DW6 A;  3QYF A;  2FU4 A;  1AA7 A;  1ACI A;  4LFU A;  3WGI A;  3IWF A;  2V4J C;  4BEH B;  3ESW B;  1FOK A;  3BJA A;  4X0G A;  3GXO A;  5DUK A;  2DO7 A;  4HF0 A;  4XIC A;  3PIO F;  3LSI A;  5HLT A;  2VKD A;  3HM5 A;  3QPL A;  1O7L A;  1JTY A;  3ANG A;  3KIO A;  4JKZ A;  3FHZ A;  2QVO A;  3ZMU A;  2E2I J;  4XRS G;  2QF7 A;  3HUG A;  4YFN F;  3RTR A;  4HLY A;  3BQY A;  3LQQ A;  2HKO A;  2ZBK A;  5CVU A;  4WWC A;  3G73 A;  4RA2 A;  5HVQ C;  2GFN A;  3FKI J;  4J19 A;  4IO9 F;  3GYH X;  4UV9 A;  4NC6 A;  2QBY B;  1B6A A;  1JKQ C;  3AFH A;  4WF2 A;  4B09 A;  1SVL A;  3COA C;  2W85 A;  2GAU A;  1BL0 A;  2HYT A;  4CUG A;  2DA5 A;  5FD5 A;  3IUO A;  1V54 H;  4ZDP A;  1YFH A;  3FK6 A;  4AC0 A;  3G4S I;  4EQQ A;  3QPH A;  4F91 B;  1FTT A;  3T8R A;  3HB9 A;  3I4P A;  1B4A A;  1ETK A;  1W7P B;  2HXO A;  3GTG J;  4N9H A;  1EV7 A;  4UB8 C;  2Z1D A;  4G9Y A;  4LB5 A;  2OPT A;  5HOD A;  5IYC J;  3GF2 A;  2NRA C;  2MBF A;  2W48 A;  3BY6 A;  3HXL A;  2JT1 A;  2CUJ A;  3CJD A;  1ZAO A;  5D6F A;  3W2A A;  2KRH A;  1IN7 A;  2JA8 J;  3KYC B;  1IXS B;  3RYR A;  2R7S A;  1FT9 A;  2O03 A;  3SDG A;  4IVN A;  2YPR A;  2VT2 A;  3CES A;  1FYL A;  5HNF A;  3WTT C;  2JA6 J;  2HGC A;  4KIS A;  3RDI A;  2XVC A;  2WB1 N;  1VQP I;  1KGS A;  4F55 A;  3A03 A;  3JRD A;  3OYK A;  4MIM A;  3JRC A;  3HGY A;  2DOE A;  4YFK F;  5CXG A;  4UVB A;  1U8R A;  2KZG A;  3JRF A;  1G3W A;  5EDN A;  1PYV A;  4PJ0 C;  4D5F A;  1TWG J;  4GFB A;  5HLG A;  5H6R A;  5BNG A;  1DPR A;  5HSZ A;  4CA0 A;  1X58 A;  3HKZ N;  2XRL A;  3GO5 A;  2EIN H;  2MD0 A;  1SD6 A;  4OOI A;  2B7E A;  2L9N A;  3JRE A;  5BPI A;  1HQC A;  4CCK A;  2VC0 A;  2CH0 A;  4N9I A;  1BI0 A;  3SQN A;  2RAS A;  2EZI A;  4Y52 J;  3H36 A;  2VPR A;  2ISY A;  2K9N A;  4L0Y B;  1WJ5 A;  2LG4 A;  3K4L A;  3ABM H;  4M71 A;  4ASN A;  3WU2 C;  1U0J A;  2A61 A;  2AHQ A;  4CO8 A;  2V9P A;  2W84 A;  2WTE A;  3LSG A;  4TV7 A;  5EZG A;  3BT9 A;  3ECO A;  1IN8 A;  4YIF A;  1G2H A;  4BAY A;  3R6S A;  2K7L A;  3JRG A;  2OCE A;  2J5P A;  3ELK A;  1JJ6 C;  4H4K C;  1R00 A;  1WQ2 A;  4HST A;  2M8E A;  2VBX A;  4BDZ A;  2Y2Z A;  1PDN C;  2QBY A;  5JR3 A;  3HYI A;  4JX6 A;  4GCV A;  1UHS A;  3K4B A;  3ZGK A;  2VJ5 A;  2IS4 A;  1O7F A;  1WGX A;  4C2M J;  4HX8 A;  4JP0 A;  3BG7 A;  5JI6 A;  3PL8 A;  3CCR I;  3BJO A;  2K86 A;  1MMS A;  2XF5 A;  4ZZD A;  2K9S A;  3PPB A;  2XIG A;  4AC6 A;  2Q1Z B;  4CCM A;  5IPA A;  5BMZ A;  1H8A C;  4KIB A;  1T38 A;  3Q9V A;  1U5T C;  1XGO A;  1L3L A;  1TWF J;  3J80 K;  1VI0 A;  4EJV A;  2IGN A;  3QU6 A;  4A69 C;  1MDM A;  2KIQ A;  5IP6 A;  2Q24 A;  2NVQ J;  2Q2E A;  4LLL A;  2DMN A;  3BR2 A;  1WHU A;  3OOU A;  4O5V A;  2NX4 A;  3V42 A;  3G7R A;  3S32 A;  2O61 A;  2V1X A;  3CJT B;  3C2G A;  3GZN B;  3CF5 F;  4XON A;  1RZ4 A;  2XKP A;  2Y31 A;  2KDZ A;  3TO9 A;  3OL3 A;  2JQ7 A;  3B6C A;  5L3G A;  3FK7 A;  3PAS A;  3LSP A;  3H35 A;  1HKS A;  4L9T A;  2R4G A;  5GTH C;  1SVM A;  2VON A;  2LP0 A;  1ERD A;  4AVP A;  1WRJ A;  1P4X A;  2P8T A;  4XRM A;  5M5W J;  4EAT A;  4ETS A;  1R4N B;  3BPV A;  2V1N A;  3I53 A;  4P1W A;  3WTZ A;  4HG2 A;  4CCJ A;  3EYY A;  3ISP A;  5F1J A;  5EG0 A;  3VVY A;  3F8B A;  2EIL H;  2H1K A;  2YUS A;  2FQ4 A;  1X2N A;  2AQE A;  3O8H A;  4A3M J;  2F48 A;  2PG4 A;  4RB1 A;  2EFQ A;  5DAJ A;  1I6X A;  4EJT A;  2G0E A;  2AXL A;  1VQL I;  1WI3 A;  1TZL A;  2EV0 A;  3S93 A;  3LQR A;  4M3G A;  2GUH A;  5HDG A;  1O3T A;  3K4J A;  3VPR A;  3VSK A;  4DGW B;  2ZXJ A;  3P5J A;  4A6E A;  4BJ6 C;  2PJP A;  4RGX A;  5IT9 K;  2JPC A;  3DPU A;  4IHY A;  1F5T A;  3C1D A;  2CWE A;  2IJL A;  2M4G A;  2DU9 A;  3ZMZ A;  4QSH A;  1APL C;  3I0T A;  1TTY A;  3G1M A;  2VQH A;  3OYJ A;  3OOP A;  3LSR A;  4HW0 A;  2BY0 A;  1OYI A;  3EDP A;  3CP2 A;  3M3Y J;  2DOF A;  3KP4 A;  4II2 A;  1YIT I;  3FMS A;  3S16 J;  3MWM A;  5CPR B;  5ED4 A;  2LVS A;  2O7O A;  2E1M B;  1Z6T A;  1S8N A;  4F93 B;  3KCC A;  4UVA A;  3CC7 I;  2M45 A;  2M0M A;  2CQN A;  2M2E A;  4EGY A;  3EYI A;  3QYE A;  3PO2 J;  1K6Y A;  2LH9 A;  3A01 B;  3G56 A;  4U88 A;  4OD4 A;  5LGN A;  1WVR A;  4N4N B;  1Z0X A;  4BJT A;  2G7U A;  4YG2 F;  1HDP A;  5K5O A;  4LOC A;  1AWC A;  4XLA A;  5HOO A;  1R7J A;  1FP1 D;  3H9Q A;  1N75 A;  3ABK H;  4BAC A;  1MMA A;  4QPQ A;  3CO7 C;  1O4X A;  3DEE A;  2DJI A;  3OYH A;  2H8R A;  2XAS A;  1POG A;  1J75 A;  1ZRC A;  3KEQ A;  1QVT A;  3J80 Z;  3ZN1 A;  1IN6 A;  1FIA A;  1OCZ H;  1BR2 A;  2JK3 A;  3Q5F A;  1FNN A;  2PBI A;  4P9U A;  2KLO A;  2R7W A;  3COL A;  4HF2 A;  3NNR A;  3L2V A;  3LL7 A;  4ENN A;  1J2X A;  4HNV A;  1XCV A;  2V6C A;  1IRG A;  5EZH A;  3K1M A;  3WOD F;  5FLX K;  1SGM A;  3Q0W A;  4P96 A;  2LDU A;  3NPI A;  2DA7 A;  1R5G A;  1XN7 A;  4BXU A;  3HTS B;  2VUM J;  2P7V B;  1HCR A;  4HX4 A;  3Q0U A;  4M3F A;  4QWQ A;  1P4W A;  2DLL A;  1XSV A;  2H6C A;  1D0Z A;  1W7P A;  2KRC A;  2X6Y A;  4B4C A;  3HRT A;  5J6X A;  2OER A;  2DYR H;  1BIB A;  3QPT A;  5F04 A;  4MEY F;  2UZK A;  1JGG A;  4C3I J;  2X0L A;  5FD6 A;  2LY9 A;  4RGU A;  2O3F A;  4HV5 A;  4JBA A;  2WAD A;  1A6Q A;  2IA0 A;  3DEU A;  3EUH C;  3OMY A;  2V7F A;  3DKW A;  4HOB A;  2FUG 2;  4FT8 A;  1MGT A;  1H9T A;  1BI1 A;  1QHH D;  3D0S A;  1SVO A;  3V7R A;  1FMW A;  3PUF A;  5F0H A;  2VBZ A;  3NAU A;  4CSW A;  1W0U A;  2KJB A;  2BXZ A;  3JSJ A;  2HFH A;  3D1N I;  3JRB A;  1X4P A;  3C3W A;  1D5V A;  1ZR2 A;  3L2Q A;  3F9K A;  1F9N A;  1S5L C;  5CKT A;  3V8L A;  2ICW G;  4ACI A;  4RMN A;  3HTJ A;  5F6F A;  3OS0 A;  4HKU A;  4L5I A;  4XLF A;  3E5X A;  5TJJ A;  2CUZ A;  3HZJ A;  2QTQ A;  3GZ5 A;  1H0M A;  2HWV A;  2FOW A;  3OYM A;  1RKT A;  1QPM A;  2OZU A;  3KZY A;  2L7Z A;  2HVQ A;  5HS7 A;  3I5U A;  3ERE D;  1B9N A;  2XAQ A;  4BHC A;  4BE1 A;  5J8F A;  2WV1 A;  4JYK A;  1FWZ A;  3IRR A;  4AIK A;  1IW7 F;  3NEU A;  4KIC A;  5ILV A;  1SFO J;  2GXG A;  3LFK A;  1UHW A;  2EIM H;  5FMP A;  3TOB A;  5GAH J;  3E6B A;  2HS5 A;  1E2X A;  1I50 J;  3RSN A;  4CCN A;  2WV0 A;  2HQA A;  5B5E C;  3RD3 A;  3CMY A;  2K9L A;  2EIK H;  2OTJ I;  2ADU A;  3H5A A;  2HDW A;  1PJR A;  2FNA A;  4M6Y A;  2VOO A;  1MSE C;  2XHK A;  2DA3 A;  1Y8Q B;  4I76 A;  2DMP A;  3F1B A;  5DUI A;  4Q4Z F;  1J9I A;  5K1Y A;  3CCE I;  3HRM A;  2K4B A;  1B9M A;  2Z2S B;  4G7Z F;  2JTV A;  1WWX A;  1YRN B;  2P5L C;  1KU9 A;  2K9M A;  2XAH A;  3O2P E;  4FE4 A;  2IRF G;  3FHN A;  4L0Z B;  3E3V A;  2HYF A;  3ZQG A;  2X85 A;  3CZ6 A;  3RQ4 A;  3HDD A;  5BS6 A;  2QZ8 A;  3DTK A;  4DYC A;  5D19 A;  3ZCO A;  2NXN B;  2BEO A;  3K2A A;  3I3L A;  4UUV A;  1Z67 A;  2BYV E;  3HOU J;  1SAN A;  1VQ9 I;  2XGD A;  1MBK A;  4JOM A;  3CMM A;  2EB7 A;  4CHU A;  2FXA A;  1K7A A;  2L7K A;  5FGL A;  2HOE A;  2IBD A;  5L3C A;  4OIR F;  4ENK A;  1G4D A;  5CXI A;  4M9Z A;  2D1H A;  2VOP A;  3M9A A;  2MD5 A;  2Y69 H;  1HKQ A;  1LKX A;  3RJP A;  3I56 I;  1DGW Y;  2YSR A;  3FM5 A;  3KP2 A;  1XMA A;  3R0J A;  4BQA A;  3RI4 A;  4HSR A;  2MC4 A;  2E7X A;  3L7W A;  1GXP A;  4Q5S F;  2QUF A;  3LA2 A;  2JWT A;  1Q1H A;  5LRS A;  4NQW A;  2R7Q A;  1BOA A;  1U2W A;  2UXX A;  1QA6 A;  2CW7 A;  3RYP A;  2R92 J;  4GFL A;  2EFW A;  1QRY A;  4I99 C;  1IGN A;  3H3U A;  4Y4R A;  5JLX A;  1ON2 A;  2XAF A;  4ESF A;  1N78 A;  3HOY J;  3V8J A;  4D5C A;  4P55 A;  3GTQ J;  3S2W A;  4XRS A;  1QZZ A;  1S7A A;  2QYO A;  5C44 J;  2MGQ A;  2EH3 A;  4N4O B;  3HEF A;  1UZC A;  2VE8 A;  2XPW A;  1UEL B;  2COB A;  3BG3 A;  4YII A;  3BZ6 A;  1PVE A;  1G6N A;  2WBM A;  1XSX A;  3TQN A;  1K83 J;  1LFP A;  1X19 A;  2L02 A;  5E1Z B;  4A3B J;  3N97 A;  2M4K A;  3K70 D;  2P5V A;  1XC5 A;  2F4M B;  3DEW A;  3OL4 A;  4N0B A;  3TL4 X;  3JW4 A;  3G1O A;  3PNY A;  2BHY A;  3GWZ A;  3VFZ A;  5JFR A;  4UDS A;  3K7A J;  3ABL H;  5CJ9 A;  3K70 C;  4GRI A;  3OS1 A;  3KKD A;  5FGM A;  1KYW A;  5CQG A;  4EVI A;  3TDU C;  2CQX A;  1K78 A;  1TL8 A;  1HST A;  3FBI B;  3GVA A;  1VF9 A;  2DOA A;  2DMU A;  3WE2 A;  3W6K B;  5D8K B;  3U1D A;  4ZC3 A;  5B3S H;  2ZCM A;  1DDN A;  1JKO C;  2VLA A;  2M34 A;  2RKH A;  2E35 A;  2KHM A;  5L3B A;  4F52 A;  4ZYG A;  2XRO A;  4WX9 A;  2HOS A;  3E97 A;  1J0R A;  3U1K A;  2W53 A;  3DFG A;  4IX7 A;  2BY3 A;  3MMY B;  5FKM A;  1BR1 A;  4F7Z A;  2DT7 B;  3PM1 A;  1OIS A;  4UB6 C;  2L9R A;  3KLO A;  3RIR A;  2QIB A;  5KAF C;  1FMV A;  2HPI A;  4KN7 X;  2CGP A;  3H3Z A;  2XF6 A;  4LGW A;  5M3M J;  2QSF X;  2DA1 A;  4KT5 C;  3IL2 A;  5GAG J;  1A5J A;  1D0Y A;  1W36 D;  5E79 C;  3LST A;  3P7N A;  4DYR A;  1I6H J;  2RC4 A;  2O8X A;  1ON1 A;  4A12 A;  2I5U A;  4IPA A;  2ZSI B;  2B1E A;  5E18 F;  4KA4 A;  4LD5 A;  1IV6 A;  4UHT A;  1D8J A;  2FMY A;  1FIP A;  3O3K A;  4D1Q A;  1YS7 A;  3H92 A;  3VOE A;  1ZRF A;  2QSG X;  1F36 A;  3V78 A;  3SWH A;  4OU0 A;  1R1U A;  2K3F A;  1Y6I A;  2RDP A;  2V1D A;  3SEZ A;  3RKQ A;  3PO3 J;  2ZME B;  1B59 A;  5K7H A;  2QWW A;  4E7J A;  5C4Y A;  2R7R A;  1GV2 A;  4WXD A;  5J4Y A;  5FHP A;  2R7T A;  3LAJ A;  4PZJ A;  2JA5 J;  1IRF A;  3GTO J;  4PCQ A;  4O6J A;  3DPJ A;  1MBF A;  2BW3 B;  3PSF A;  4G7H F;  4HDU A;  2Y9Z A;  1Z7U A;  1FOW A;  4IXA A;  4M3D A;  4ME9 A;  1WJF A;  2F4O B;  3L09 A;  5IT3 A;  3U2R A;  5ICE A;  3EQL F;  1R36 A;  4MLO A;  2KIS A;  3DP7 A;  1TWA J;  5LFA A;  2AQF A;  3BTJ A;  3CJR B;  2BHZ A;  2K40 A;  3UR3 C;  2L7M P;  2XAU A;  1ETQ A;  2QQ8 A;  3IHU A;  2HQ5 A;  3SJM A;  3I58 A;  4CH7 A;  1QBJ A;  4KIT B;  1MBJ A;  4YIR X;  4IHV A;  3OYB A;  1QVU A;  3R60 A;  4MEX F;  4A3F J;  2XPV A;  5EEH A;  2LKX A;  3V7S A;  2Z33 A;  2HOT A;  1GXQ A;  2FD5 A;  2XGX A;  2A69 F;  2DTR A;  2G7H A;  4DVY P;  3HTU A;  1LNW A;  2O6G E;  1LQ1 A;  1J09 A;  1ZYR F;  2R7D A;  4C3H J;  2XSD C;  5FLX Z;  3PFI A;  4D7M A;  1VQ5 I;  1WJC A;  1IXR C;  1W5C C;  5B1B H;  3REO A;  2BZT A;  4BY1 J;  3X2Q H;  5JHU A;  5KVR A;  3ANP A;  2R3S A;  3HOV J;  1FOY A;  4KMU X;  2VBY A;  1KU3 A;  1YO5 C;  1AKH A;  1ETO A;  4R1H A;  4BGD A;  2VQG A;  5KHD A;  2FBK A;  5F0F A;  3LSM A;  4NEL A;  3JTH A;  3JTG A;  2D45 A;  4P5O A;  5E17 F;  1MSF C;  1N25 A;  3FF5 A;  1S3J A;  5E8I A;  1HF0 A;  4G8X A;  3HPH A;  3Q9S A;  2MLK A;  5E20 A;  1VZ0 A;  2E34 A;  3CLO A;  4MHG A;  2O9L A;  4B3A A;  2KDO A;  2CMP A;  2XAJ A;  4PJN A;  3AQT A;  2NNN A;  3MEX A;  1YJN I;  4D7N A;  4ESB A;  2A6H F;  2Y0M A;  2A68 F;  3CJQ B;  1U5T A;  4PGH A;  4AVZ A;  3CCQ I;  4IOC F;  3HJE A;  3TP0 A;  1W5S A;  3AL0 C;  5LEK A;  2IVM A;  3BHQ A;  2N8G A;  3BTC A;  4WCG A;  1XGS A;  1ZLJ A;  3DU5 A;  5JHF A;  3OSG A;  2ECB A;  2ACJ A;  2M87 A;  4U0W A;  2HTJ A;  3CDH A;  5D5W B;  2L0K A;  3HUG B;  5IYD J;  3KNW A;  5C3E J;  3FMR A;  2JUG A;  3JRI A;  4XKC A;  1MJB A;  5TGT A;  3BR3 A;  2ZFU A;  3K2Z A;  5LGT A;  1JXS A;  2QM3 A;  1RR7 A;  2FA5 A;  4M3B A;  3J7Y J;  4I0B A;  3HTA A;  4KNY A;  5DEQ A;  2YR2 A;  3R61 A;  1QU3 A;  4ICH A;  4EM2 A;  2ZXI A;  4KFC A;  4ZH4 F;  3BPX A;  4OIO F;  4MQV A;  3MKL A;  4G6T B;  2EZK A;  1IAW A;  2RVC A;  1JT0 A;  2RAE A;  5D5X B;  2GEN A;  4AWX B;  4WXH A;  1I3A A;  2LNB A;  3QAH A;  3CQZ J;  1PP8 F;  2FX0 A;  2ELH A;  2XUB A;  1VND A;  1KU2 A;  1WJE A;  5BPD A;  3GME A;  2HVS A;  2R93 J;  2A05 A;  4I98 B;  1Z6R A;  2NNY A;  2LBF A;  2YVE A;  2B9S A;  4L9J A;  1TNT A;  3T1B A;  3CCJ I;  1UAA A;  2Y0S A;  4ENM A;  2FBH A;  3FDY A;  3OSF A;  3HG9 A;  4CCO A;  2WWY A;  2M30 A;  4U0Y A;  3SYT A;  3ZPL A;  1RC9 A;  3A0B C;  1JKP C;  3VVX A;  4M6X A;  3E6D A;  2HR3 A;  3PSI A;  2X1E A;  4PDK A;  4NUB A;  2JVG A;  3ON2 A;  3HGG A;  2MLG A;  5FKK A;  5HS8 A;  3VVZ A;  5JVG F;  2NVY J;  4GO1 A;  2CW8 A;  4Y3O A;  3F8N A;  4Y13 A;  3QP6 A;  4XLE A;  3E0J B;  4IQJ A;  3O8G A;  2AXT C;  2KFD A;  1Y0N A;  3OR2 C;  5EJC A;  3BTI A;  2P5K A;  2FQ3 A;  5FO5 A;  5E1W A;  4OIP F;  1EH8 A;  2BXY A;  5L3D A;  2EFO A;  2MYS A;  2W7N A;  1FYM A;  2E1O A;  3HIM A;  3ZQI A;  2VN2 A;  2VAS A;  3HOX J;  1IJW C;  2LRD A;  2M0C A;  3WHC A;  1MBE A;  2NVT J;  4RAZ A;  4GCL A;  3U9G A;  3DLA A;  2FJI 1;  5K5Q A;  3OIQ A;  3TBI A;  1UST A;  1S6L A;  3I9V 2;  1HKT A;  4FE7 A;  3CCV I;  1KON A;  4HA8 A;  1R49 A;  2XV4 S;  2Y9Y A;  4D0P A;  3IV5 A;  1I3Q J;  3LA7 A;  3OYA A;  4FET A;  2MA3 A;  2L54 A;  3FWE A;  3DF8 A;  2L2O A;  2WA0 A;  2NVX J;  5K5R A;  2KIU A;  1B72 A;  1BR4 A;  3KYD B;  1UJ8 A;  1VFC A;  3C18 A;  2JRM A;  5KCM A;  5CYV A;  1XMX A;  2HZD A;  1OR7 A;  3F8F A;  3WTV C;  1TBX A;  4XNF A;  1KQ8 A;  1TP4 A;  2DMT A;  4XKB A;  3OR1 C;  1I1G A;  2CSO A;  5BOX A;  1T39 A;  3S8P A;  3RPU D;  2FEZ A;  1RUO A;  4C2T A;  3ZP5 A;  4FIS A;  4IRI A;  3HSF A;  4BNC A;  2VIX A;  1BJA A;  2QEN A;  1VQ4 I;  4K2E A;  2ZCX A;  2EZH A;  3H3V K;  4I09 A;  4EMS A;  2GXB A;  2R7O A;  4XOR A;  2LRE A;  1KU7 A;  5FFX A;  3MKW B;  2DDA A;  4IQ4 A;  1YTY A;  1MIJ A;  3I4M J;  1R58 A;  1MJ9 A;  2REK A;  3TO6 A;  2KZV A;  1DGR M;  5B1A H;  1JUP A;  2H27 A;  1LPQ A;  3ONQ A;  3HBL A;  1B72 B;  2LKP A;  4AID A;  4XBF A;  4P9F A;  3F8C A;  2R5Z B;  1D1A A;  2V57 A;  1TQM A;  1DUX C;  1G3T A;  2QKL B;  1JI8 A;  3ABU A;  1UMQ A;  3K10 A;  5E8G A;  4C2U A;  3AL0 B;  1KZH A;  1VQN I;  4BJ5 C;  4DIQ A;  1QGP A;  3GEZ A;  3QU3 A;  1V5G A;  5IP7 J;  4E7K A;  1U3E M;  3ZQQ A;  5FRN A;  4RGS A;  1W7P D;  1XSD A;  3KPH A;  5FKO A;  4YEL A;  2ZC2 A;  3MVP A;  3WG9 A;  5EGO A;  2M7A A;  4NQW B;  1ZR4 A;  1WSU A;  3ULQ B;  2CG4 A;  3M1C A;  3F21 A;  2DOD A;  1XCB A;  2H8W A;  2JPB A;  4HZF A;  1T2K A;  2QGU A;  3TW7 A;  2DYS H;  1EH6 A;  5J4V A;  5CQE A;  5KAI C;  2G9W A;  4A3K J;  3OS2 A;  2DDB A;  5A2Q Z;  2DFH A;  1XTA A;  3VYR B;  3G71 I;  2FE3 A;  2X1D A;  3IAS 2;  3M8E A;  4PJM A;  1USS A;  4UVC A;  3SZG A;  2OC6 A;  1HA8 A;  2HZT A;  3JR9 A;  4E7I A;  2GIV A;  3RPU A;  3FXR A;  3AG3 H;  4G6D A;  3F6V A;  3GZ6 A;  1K6O A;  5D5V B;  1Y1V J;  4MFE A;  2XPU A;  2X6W A;  2DN0 A;  5HAW A;  4PJL A;  5DDG A;  3BJ6 A;  4V2F A;  5M5Y J;  1BC7 C;  3W6V A;  3TDZ C;  3BOQ A;  4C2M A;  2L3D A;  2HYG D;  1VQ7 I;  4GCT A;  1P4A A;  3G6E I;  5D18 A;  1OFC X;  5A2Q K;  2HDD A;  3VW1 A;  3CUQ B;  3TMO A;  1FBS A;  3DLL F;  1IDZ A;  1J5Y A;  3AG4 H;  2BVM A;  2LYC A;  3V8K A;  2I8D A;  3OIO A;  5H6Q A;  2RN7 A;  2CUE A;  3H9G A;  1T56 A;  4E7S A;  1V55 H;  1NK2 P;  5AIP A;  1EKE A;  2M7B A;  3P9I A;  2KIM A;  2LKS A;  4C9Y A;  1ETW A;  3RKX A;  1P2F A;  3BDD A;  1V3F A;  1ZK8 A;  4I0A A;  4YRV A;  1GVJ A;  4RB2 C;  2XSJ C;  3AKZ A;  4PXI A;  1QZE A;  1Z05 A;  4BKX A;  5FLV A;  1IN5 A;  3KEY A;  3LNQ A;  4KMF A;  4CZZ A;  2M8G X;  4UV8 A;  3K4C A;  3GZI A;  2KT0 A;  5DD8 A;  1D1C A;  1MMN A;  3NI7 A;  1YOV B;  2EBI A;  1X3W B;  2PMH A;  1MDM B;  4I7H A;  2L5Q A;  3GTK J;  5HBU A;  3BQZ A;  1X3U A;  4A3C J;  3IH2 A;  2BY1 A;  5L3F A;  1Q1V A;  1CGP A;  3EUK L;  3M4O J;  4NBQ A;  2K27 A;  4XOP A;  2ZFW A;  3S1R J;  1KA8 A;  1G59 A;  2Y30 A;  3I4N J;  3ML6 A;  2FBI A;  2UV1 A;  2RQP A;  1K4S A;  1WZ2 A;  3H5R A;  3J7A Y;  3S1Q J;  3D5R C;  1RES A;  2C6Y A;  3QPS A;  5AIQ A;  4XLN F;  4B43 A;  4DJA A;  2DFI A;  4XK4 A;  1BM9 A;  2Q8K A;  5LRR A;  1BN5 A;  1CF7 A;  3WTU C;  1R5I D;  2ZOY A;  5GPC A;  5ICC A;  1MH4 A;  4R79 A;  2DBB A;  3WE3 A;  3E7Q A;  3JSP A;  1ZTR A;  1TW2 A;  2E36 A;  4WXC A;  3P9T A;  1PUF B;  2L7F P;  2VPL A;  1MBG A;  3H1C A;  2A6E F;  1B8I A;  4I2O A;  5AQC A;  4U7B A;  2GOM A;  3C2B A;  3MKZ A;  3BG9 A;  3HTI A;  4AYB N;  1E0E A;  3OY9 A;  3ECH A;  4A5N A;  1BW5 A;  3HPG A;  4LIT A;  2L9V A;  1FJL A;  3VW0 A;  4NC8 A;  2CQK A;  3H0D A;  2QCO A;  3CME I;  3AAF A;  4A93 J;  1YW8 A;  2CQQ A;  3S15 J;  2IU5 A;  3CP8 A;  5DCM B;  3A02 A;  2K9Q A;  3KYL A;  2E7W A;  2OV7 A;  3OYN A;  5ICG A;  2JMW A;  2M5W A;  2A6T A;  3F8M A;  3KFW X;  4A3G J;  1OCC H;  3J81 K;  2L01 A;  1V4R A;  2CS3 A;  3EUP A;  2QEX I;  1FBQ A;  4ESJ A;  2DFE A;  4ZYE A;  1TT5 B;  3WU1 B;  2ISZ A;  1HW5 A;  3TED A;  1TQI A;  4E70 A;  1YI2 I;  1B8I B;  3TGN A;  4E7Z A;  1VTN C;  2LSO A;  2XGC A;  3AG2 H;  3EPZ A;  3DTI A;  2EIJ H;  5K7F A;  1MND A;  1ZGW A;  2ZJR F;  1TC3 C;  2A5Y B;  1BI3 A;  2COM A;  4IKF A;  4RS8 A;  2CV2 A;  4B47 A;  3J81 Z;  4OIN F;  2IS1 A;  3A01 A;  3BZK A;  1J7K A;  3QQA A;  2P4W A;  4BL0 B;  2TRT A;  4ZTF A;  2W25 A;  1U6G A;  3DBL B;  2EJR A;  1RR8 C;  1NHA A;  4XMY A;  3SZT A;  3NWT A;  2R7X A;  3CDI A;  3S14 J;  3S2H J;  4RLF A;  1TQP A;  1TNS A;  2DI3 A;  4XSX F;  4GDF A;  2QQB A;  4A3D J;  3CCY A;  4M3E A;  2PEX A;  2A3S A;  2LFB A;  5J3L A;  1G3S A;  3IH3 A;  3W2V A;  2HNH A;  3FIW A;  3MZH A;  2XDV A;  3TW6 A;  2F5C A;  1S72 I;  4FHT A;  1GV5 A;  5FLM J;  2JUC A;  2K5C A;  5KK1 A;  4CYC A;  3DCF A;  4BBR J;  5CVI A;  4XKW A;  1E3H A;  2STW A;  1A04 A;  5ILS A;  2YX7 A;  2PJR B;  1UFM A;  2WAQ N;  2DG7 A;  3BCG A;  3SFI A;  2FSW A;  1FPQ A;  3GX4 X;  3QOP A;  3K4M A;  3WTW C;  2NS8 A;  2XB5 A;  4EM0 B;  2F07 A;  3VW2 A;  4JK1 X;  2BE5 F;  2PFV A;  3IP4 B;  4HAM A;  3GTL J;  3T5X A;  2M9H A;  2D1V A;  3BZC A;  5EEA A;  1G8X A;  4MQ9 F;  2DCE A;  3B6A A;  2M3A A;  4M73 A;  2LY2 A;  4U0V A;  2E2J J;  4A0X A;  4JX4 A;  5M5X J;  3HHG A;  4I01 A;  1W4M A;  2K3P A;  5TRD A;  2QQ9 A;  4R8H A;  4XM3 A;  1OR7 C;  2O5R A;  1U78 A;  1ZRD A;  3FXL A;  2IAI A;  3V4G A;  1HW2 A;  4HRI A;  3HSE A;  1SD5 A;  1GDT A;  2DA4 A;  2F2E A;  2L9S A;  4OAZ A;  1WJD A;  3WG7 H;  1T6S A;  2Z16 A;  3OIP A;  1K78 B;  3A4C A;  2K4J A;  4HV6 A;  4XN3 A;  5D6E A;  5F08 A;  5M3F J;  3GUD A;  4M74 A;  2VQC A;  3GEU A;  1UCR A;  3RZO J;  1H88 C;  2IGO A;  1X1P A;  4G12 A;  1ETY A;  2VE9 A;  2G7L A;  4XLC A;  2VB6 A;  1ODD A;  3DPT A;  1PP7 U;  4GYG A;  3SXY A;  2V26 A;  4LB6 B;  5KNL A;  4M9X A;  2E60 A;  5DM7 F;  3J7Z I;  3HRS A;  3S17 J;  3IKT A;  1E17 A;  2P6S A;  4XRF A;  3VYS B;  2ZNZ A;  2BOL A;  4GXO A;  2R5Z A;  2ID6 A;  2NP5 A;  5AON A;  2Z9O A;  2WY7 Q;  4XLP F;  4V19 K;  2NAZ A;  3CC4 I;  5FRM A;  1X4O A;  1TT0 A;  2IEK A;  3CLQ A;  5L3E A;  2GM4 A;  2CFX A;  2EV5 A;  3TOA A;  2DAO A;  5FKN A;  3VSL A;  1O57 A;  1SMT A;  1HDD C;  2YU3 A;  4MGR A;  5EG0 B;  2CV0 A;  3OV8 A;  4E4H A;  4F92 B;  4MXM A;  4IEJ A;  3LMM A;  1BBY A;  2OQG A;  2V9V A;  3P9K A;  3L2U A;  4OWR B;  3BR5 A;  1K4T A;  3ABT A;  3QP5 A;  1CQT A;  1U9O A;  3S1M J;  4L62 A;  1SAX A;  4C3J J;  4XQF A;  3ZN0 A;  4KDP A;  1ZQ3 P;  4IRG A;  2GXA A;  1R22 A;  2GLO A;  1WFX A;  1VQO I;  2OBP A;  2M1B A;  2HU9 A;  1I5Z A;  3FKJ A;  3GLL A;  2WGB A;  1YJW I;  3S5R A;  3CCU I;  1FEX A;  3QKX A;  3MZY A;  5J1R A;  3VIB A;  4I6Z A;  3CUO A;  3HOZ J;  1P7J A;  1VQ6 I;  1ENH A;  1A31 A;  2KKO A;  1Y8R B;  3KP6 A;  2FNP A;  3DTE A;  3SEQ A;  3LSJ A;  2LMD A;  2P0W A;  4NDL A;  1UB9 A;  4WK8 F;  2DQL A;  2XGE A;  4CCL A;  3I55 I;  2ZSH B;  3KLN A;  1LEB A;  1PUE E;  1S29 A;  1BI2 A;  4OD5 A;  3LSK A;  3FM3 A;  4HQM A;  2HI3 A;  5J8C A;  3M8J A;  4BE2 A;  1ONV A;  1Y39 A;  1ZKG A;  4PUS A;  3GCM A;  4PFP A;  1E3O C;  3K8P C;  5F64 A;  2OI8 A;  1ZHF A;  2OU2 A;  4CIC A;  1SFU A;  1Y0U A;  1R71 A;  1IDY A;  2JSP A;  2PFB A;  3DWL E;  5F27 A;  1BJZ A;  2EFN A;  4HNT A;  2ZME C;  3MQ0 A;  2DK8 A;  2HKU A;  1D3Y A;  2VL8 A;  2ZJQ F;  3NXC A;  4FAS D;  1RKW A;  2PX9 A;  3AQS A;  3BCB A;  3EGQ A;  3W2W A;  4X6A J;  1T08 B;  3KZ9 A;  4MFD A;  1ITY A;  3DQV C;  4KJZ A;  2W57 A;  3HOW J;  3JAM Z;  2AO9 A;  2NS7 A;  1R1V A;  1UG2 A;  1YLF A;  1D1B A;  3TP3 A;  1MH3 A;  3GLX A;  2QKM B;  3FXK A;  3LA3 A;  3L00 A;  1XGN A;  3K1P A;  3BRO A;  1M1E B;  2LK2 A;  5IP9 J;  1A6I A;  2XKO A;  2OQR A;  1LDJ A;  3OYL A;  4IL6 C;  2QSH X;  4OAY A;  3OYG A;  2OAZ A;  1LDD A;  4KUM A;  1AOY A;  3W3C A;  4WIB A;  4HPQ A;  2IA2 A;  2X6X A;  3A1Y A;  3WGG A;  2R5Y B;  1ULY A;  4IHS A;  1I1S A;  3KKC A;  1R23 A;  3HE0 A;  2EWN A;  3L9F A;  2LY1 A;  4KYW A;  3DV8 A;  2OUM A;  2ZXH A;  4A3J J;  4UUS B;  2ELJ A;  1CF7 B;  1X2M A;  3UKG A;  2DPD A;  1HOM A;  4BEH A;  2FF4 A;  4OIQ F;  4IHT A;  3HRU A;  2UWM A;  2WUI A;  1JUS A;  1XMK A;  5DTD A;  2YS9 A;  1PUF A;  2VJI A;  5B66 C;  4DBQ A;  9ANT A;  1Y56 A;  1HBX G;  2OF7 A;  5E3N A;  4LIU A;  2VT3 A;  1G3Y A;  2IP2 A;  5E3O A;  3VOX A;  1YG2 A;  2RNJ A;  2FRH A;  3BG6 A;  1A36 A;  1RPW A;  2ID3 A;  3FRQ A;  4ZJZ A;  1WJA A;  3VYU B;  3F6O A;  2XDN A;  2VXZ A;  1STZ A;  1YHQ I;  3DXJ F;  2ZB9 A;  3ROU A;  1IUF A;  5CLS A;  4ZYD A;  3B02 A;  4XOT A;  5HDN A;  2DPU A;  2P6T A;  3ERM A;  4BBS J;  1MMD A;  1YX5 A;  1SFK A;  5D8L B;  4II3 A;  1Z77 A;  3JSO A;  3BWG A;  3J7A O;  5LHH A;  3S2D J;  5J40 A;  4B48 A;  3W6J B;  5HLH A;  3HOT A;  4QLC U;  2LC2 A;  1Z3Y A;  4NC7 A;  2RQQ A;  3TO7 A;  3BR1 A;  3JCU C;  2MC3 A;  3I64 A;  3WTY C;  1Z9C A;  3E6M A;  2UXH A;  3NQO A;  3BRU A;  1FOX A;  3ON4 A;  4XN0 A;  1ZEL A;  2G3B A;  3F22 A;  3IUV A;  4ZTJ A;  3D5S C;  4B44 A;  3FXJ A;  1IC8 A;  2P7C B;  2PJR A;  4YZE A;  3K6G A;  2LBF B;  1Z1D A;  3ZMT A;  3ZQL A;  3MD2 A;  4KIG A;  2D6Y A;  1MZB A;  4U9N A;  3CTA A;  3KET A;  2D5V A;  1U5T B;  4PJJ A;  1YYV A;  5HS9 A;  2R7F A;  4BS9 A;  3GFL A;  2VKH A;  4IHW A;  3QBM A;  4FX0 A;  3F0C A;  1WH7 A;  1QPI A;  3MZ8 A;  2OJE D;  3CO6 C;  3K0L A;  3I59 B;  2GA1 A;  1FBU A;  3S3O A;  2QOP A;  1JHF A;  3H0G J;  2PN6 A;  4BQO A;  4IHX A;  1UHM A;  4GYI A;  4V2G A;  2E1M C;  2V6E A;  2TCT A;  3FXM A;  1LFU P;  1FLI A;  2EQR A;  1OLT A;  1QZY A;  4AU7 A;  5D5U B;  2R5Y A;  3VP5 A;  1IXC A;  4AYB A;  2UXN A;  1WKM A;  1XDS A;  2EK5 A;  1JTX A;  2XRN A;  3FXQ A;  5FFZ A;  2X48 A;  4HF1 A;  2ME0 A;  5IYB J;  4CXF A;  2DA6 A;  3SZP A;  4AF5 A;  2Q0O A;  4MTD A;  1XS9 A;  3K69 A;  2MAB A;  3E1S A;  3I71 A;  2OZ6 A;  3DBR B;  2LF8 A;  1SMY F;  4BXX J;  2YVX A;  1HSJ A;  2CYY A;  2ELK A;  4PGG A;  4LLG F;  1FYK A;  2EV6 A;  5LD2 C;  2D2W A;  4RAG A;  4AUX A;  1HC8 A;  1ZG3 A;  3B73 A;  2RRE A;  1KYZ A;  1O3Q A;  3R4K A;  2W00 A;  4PSW A;  1FSE A;  3T8T A;  3CDL A;  4A5M A;  1DP3 A;  2QA4 I;  2DTZ A;  2X4H A;  4F3Q A;  5FRO A;  4RBO A;  1T98 A;  2B63 J;  4M72 A;  4RGR A;  4BQN A;  1P92 A;  4EJO A;  3KP5 A;  3KP3 A;  2E1N A;  4IZZ A;  4UXN A;  1X1D A;  2XB0 X;  1J59 A;  1W1W E;  3E6C C;  4NNJ A;  1IO2 A;  1R9T J;  1R5H A;  3UNG C;  2NOJ B;  4AIH A;  1BIA A;  1LEA A;  2G7G A;  4HEA 2;  1JUM A;  3HL2 A;  4IOA F;  2KJC A;  3KE2 A;  3HKZ A;  3Q3S A;  4A3L J;  4QTR A;  2ZME A;  2VBW A;  1R1T A;  2KP6 A;  1NG6 A;  1HLV A;  2HDC A;  4ZZL A;  3HC7 A;  3IKV A;  3CMA I;  1T8I A;  1B1B A;  5K7Z A;  4EGZ A;  2OD5 A;  3ZOB A;  4Q48 A;  4XLH A;  5IOY A;  3NS4 A;  4HNU A;  3PFY A;  5DS9 A;  2OA4 A;  3IAM 2;  5HNH A;  3M1E A;  4RAF A;  1SFX A;  1P6R A;  2AS5 F;  3E5U A;  4IRV A;  3T0Y A;  2DT5 A;  5F1R A;  2CRG A;  2K02 A;  3NAR A;  4GFK A;  1QQI A;  1YX3 A;  2VQL A;  1OQY A;  2CFO A;  5ICF A;  1GHC A;  4HLX A;  2MG4 A;  2PMU A;  5LEJ A;  3HHH A;  4BDY A;  2CUF A;  2JA7 J;  2GBY A;  3VEP A;  4FX4 A;  3PQJ A;  3BG5 A;  2IXS A;  3KX2 A;  3CCL I;  2CO5 A;  2HVR A;  2UUZ A;  1F1Z A;  2O7T A;  4ZDL A;  4MO7 A;  3E7L A;  3E5Q A;  1FZP B;  1W36 C;  2ZCW A;  3CRJ A;  1FP2 A;  2LR8 A;  5LHI A;  1NTC A;  3L1P A;  3QYB A;  2GZW A;  3VOK A;  1JE8 A;  2FBQ A;  2RNG A;  1ZGA A;  1R4M B;  2OTL I;  4DNC A;  2PZ9 A;  4KIF A;  3KZI C;  1ZAR A;  1D0X A;  1IZ1 A;  2Y48 A;  3A0H C;  3FBN B;  3IH4 A;  3IWZ A;  2NP3 A;  2VC1 A;  2HPM A;  4DOZ A;  1Z3X A;  4IF4 A;  2DJN A;  3G2B A;  4OMZ A;  1LE8 B;  3EET A;  2E5N A;  1IG7 A;  1TLH B;  2J5O A;  2KIF A;  3MN2 A;  2NS0 A;  4MK6 A;  2IW5 A;  4AD9 A;  3QRF F;  4KWA A;  4BXF A;  5GAE J;  1UG0 A;  1VQ8 I;  4B1R A;  4IJA A;  3PQK A;  4S0H B;  5F0C A;  2IT0 A;  4G94 A;  1YIJ I;  2BY2 A;  4BQQ A;  5FJ8 J;  3BP8 A;  2DA2 A;  1WJB A;  3M7G A;  4M6V A;  4BHB A;  1AHD P;  2ZY9 A;  5EEG A;  4E6K G;  4Q47 A;  3K1N A;  2A07 F;  3DKY A;  2L4M A;  3NRG A;  3RQI A;  1ZLK A;  1H9G A;  3ZQ7 A;  3G3Z A;  4M9S A;  5D4R A;  4RAY A;  4EM1 A;  5CVR A;  2FJ1 A;  4J01 A;  1QO0 D;  5H20 A;  2LTP A;  3Q0V A;  3QOD A;  1MBH A;  1XGM A;  4BY7 J;  1JHH A;  2X1C A;  3HSR A;  4L5J A;  4UUT A;  4B8X A;  1OCT C;  1LB2 A;  3V7C A;  4UNO A;  3ZR8 X;  4HX7 A;  3GFJ A;  4ZYA A;  1E3P A;  2KPM A;  3QOE A;  2IPQ X;  2ZXW H;  3EUA A;  2R7V A;  4RLQ A;  1JGS A;  1ORK A;  4KN4 X;  3MNL A;  4AM3 A;  2I10 A;  2EA2 A;  2VKV A;  1HXD A;  3NRV A;  1YRN A;  1QNT A;  4ITV A;  2EZL A;  2R7U A;  1I27 A;  1MMG A;  2KMU A;  2XAG A;  3BR0 A;  3ZMD A;  2ZJ2 A;  3FXU A;  2PLY A;  2ESN A;  1ZRE A;  2HEO A;  4A0Z A;  2CU7 A;  2XC7 A;  1GT0 C;  1HW1 A;  4L9N A;  5BQT A;  2QLZ A;  4B3X A;  4RB0 A;  2W1O A;  1SEU A;  1T0F A;  2WAE A;  1RET A;  4HBL A;  2Y0S N;  2GQQ A;  2HKX A;  2RV8 A;  1OYW A;  3WU0 A;  4CYD A;  1MD0 A;  2Z3Y A;  4CYC B;  2DK5 A;  4LK0 F;  3VOD A;  2F5V A;  2ECC A;  2XF7 A;  2GOX B;  3C7J A;  5J47 A;  1K61 A;  1UI6 A;  5DCM A;  2JA2 A;  2ZNY A;  5EF6 A;  3A2K A;  5K58 A;  2X51 A;  5D1R A;  4LK1 F;  2PI0 A;  1TW3 A;  3SDB A;  1OCO H;  3CF2 A;  4J00 A;  4A3I J;  4O3M A;  4X1E A;  5HDK A;  5IOZ A;  2Q2E B;  4RM2 A;  4FCY A;  2Z5U A;  3VYT B;  2YVH A;  3GTP J;  1O3S A;  1RNL A;  4DQ2 A;  3GTJ J;  1UI5 A;  4Y15 A;  4E7L A;  3BLY A;  2E71 A;  3K4K A;  3MKY B;  3U21 A;  1X1C A;  1FX7 A;  3RKY A;  3OYE A;  5LHG A;  4C30 A;  4A6D A;  5JLW A;  2HOA A;  3S3M A;  2X9D A;  1H89 C;  1EA3 A;  1FSH A;  2A2F X;  2F5E A;  2UXO A;  1BOB A;  2IGK A;  4Y17 A;  3CCS I;  1JKR C;  1U8B A;  4U9L A;  2V9K A;  4LMY A;  1GLN A;  4JX5 A;  1MKM A;  3ZMV A;  2IS2 A;  1FY7 A;  4GCK A;  2YU9 J;  4BHP A;  3WGH A;  4S05 A;  2W82 A;  3JRH A;  2PBX A;  2KRF A;  4KT6 A;  2F5F A;  4DYQ A;  2UXU A;  1SC7 A;  4ANJ A;  1LVK A;  4RDU A;  5EGO B;  3S1N J;  2LF7 A;  1GUU A;  3KZZ A;  2RGV A;  1RI7 A;  3F72 A;  3BJB A;  1S9H A;  4HQE A;  3K9T A;  1LDK B;  2FOK A;  3GFM A;  3I54 A;  1D8K A;  4MNU A;  2VJ4 A;  2V1U A;  1OCP A;  4E7H A;  4ZYH A;  1KQ9 A;  1SAU A;  4S04 A;  4JL3 A;  3CUQ C;  2QWT A;  3R0A A;  5GAD J;  2BW3 A;  3L2C A;  3CWR A;  1IUY A;  5J1Y A;  4LIV A;  5C4X J;  4BH9 A;  1YW7 A;  4A3E J;  3LFU A;  3WTS C;  2OCC H;  1VQM I;  2WAQ A;  3ZQF A;  4JQF A;  4ON0 A;  5GP9 A;  1SFE A;  1OPC A;  3LWF A;  2E2H J;  2A5W A;  3LAP A;  2VXD A;  2CJJ A;  4A0Y A;  2EPF A;  4FTH A;  1JT6 A;  2H1L A;  4XKV A;  4G7O F;  2E5Z A;  2F4I A;  1D5Y A;  5DM6 F;  4BYY A;  4LG0 B;  3PIP F;  1XB4 A;  2JVH A;  3MAJ A;  2JSC A;  2CQ7 A;  5EYR A;  4Z2Y A;  2IS6 A;  1F43 A;  3FMQ A;  3KP7 A;  3S3N A;  3HIF A;  1IRZ A;  3DPL C;  2MW8 A;  3P9C A;  1S7E A;  4D9J A;  1S7O A;  3BC8 A;  4BE0 A;  3H5N A;  3CC2 I;  1N77 A;  1T33 A;  3FZV A;  1RIO H;  1X3Z B;  4OMY A;  1LFB A;  1DU6 A;  2KL4 A;  2O0Y A;  2MH2 A;  3ZRG A;  5FKL A;  1IV8 A;  2HTS A;  5E3L A;  4CGZ A;  2DW4 A;  4BU2 A;  1YIO A;  3GTM J;  3KEO A;  5E3M A;  2IA1 A;  2ZOZ A;  3LWJ A;  1WPK A;  3C07 A;  2FML A;  3O6B B;  3BR6 A;  2ZJP F;  3F23 A;  3WTX C;  2JN6 A;  2LD5 A;  1IF1 A;  3L2W A;  1LJ9 A;  4MTE A;  3JRA A;  1OCR H;  3PNT A;  1EF4 A;  2WB1 A;  1TWH J;  3GBG A;  3ZQH A;  4Z6Y A;  1DPU A;  4LG3 A;  1WCM J;  4GGG A;  5J1U A;  3ZMS A;  2YX4 A;  1ETV A;  2W24 A;  2WAF A;  3O60 A;  4PFO A;  4DZJ A;  3BTL A;  2DQR A;  1XG1 A;  2RHA A;  4H0E A;  3EUH A;  4QPO A;  2VOD A;  1Y1W J;  3CD6 I;  2JRT A;  1FC3 A;  2UXP A;  1YQA A;  5FB2 A;  4NB5 A;  1BC8 C;  3ZXS A;  4L5E A;  2F6C A;  5IY5 H;  5EFY A;  5ERI A;  2Z99 A;  3ASO H;  3RKW A;  2PMZ N;  2MSY A;  3LSH A;  2MH9 A;  2P81 A;  2E1C A;  2Y75 A;  2B3W A;  2HYJ A;  3RPQ A;  5TIS C;  2ESH A;  5H2F C;  2W4S A;  2ETH A;  1EH7 A;  1DQU A;  3NWS A;  1X1A A;  3L2R A;  5ILU A;  3N05 A;  3N4M A;  1WI9 A;  2JZY A;  2DXI A;  2V79 A;  4XR6 A;  3RCO A;  4XID A;  2JJ7 A;  2HQN A;  1ZG5 A;  5GTI C;  1C0W A;  2PQ8 A;  2CV1 A;  2BBY A;  4LLN A;  5C4J J;  3T6N A;  1XPX A;  2GIZ A;  4U87 A;  3OYI A;  1Z21 A;  1L0O C;  2WY8 Q;  2HXI A;  1OMI A;  3DU6 A;  3IRQ A;  1RUN A;  3SFZ A;  1FTZ A;  2EFP A;  5JVT A;  3PNV A;  3VWB A;  1OKR A;  4LG0 A;  1YJ9 I;  2ZKZ A;  5H9T A;  1X1B A;  1LUJ B;  3QWL A;  2VJJ A;  2BV6 A;  4DZP A;  1V5E A;  1TWC J;  3VB2 A;  4XL9 A;  2IGM A;  4Y7N J;  2PMZ A;  3IC7 A;  2DT6 A;  3SHF A;  3RZD J; 
#chains in the Genus database with same CATH homology
 3BR1 A;  3HBL A;  1B72 B;  2UXH A;  3ON4 A;  2ME6 A;  3BRU A;  1ZR2 A;  2G3B A;  2R5Z B;  3IUV A;  2V57 A;  4ACI A;  3HTJ A;  1LE8 A;  4HKU A;  4W1U A;  1IC8 A;  2VI6 A;  1UMQ A;  4YZE A;  4CGR A;  2QTQ A;  3ZQL A;  4ABZ A;  3LOC A;  2D6Y A;  1RKT A;  2D5V A;  2L7Z A;  3LHQ A;  1AU7 A;  5IP7 J;  4IHW A;  3QBM A;  2WV1 A;  4W97 A;  2G7S A;  3F0C A;  1WH7 A;  4JYK A;  5FKO A;  1QPI A;  4NN1 A;  5EGO A;  3MVP A;  5GPA A;  1ZR4 A;  1SFO J;  5FMP A;  2QOP A;  3H0G J;  4IHX A;  1I50 J;  1OJL A;  3RH2 A;  3TW7 A;  3RD3 A;  4V2G A;  3CMY A;  2TCT A;  1LFU P;  4A3K J;  2EQR A;  2R5Y A;  1JJ8 C;  1WH5 A;  1MSE C;  3VP5 A;  2DA3 A;  3JR9 A;  4I76 A;  2DMP A;  3F1B A;  3B81 A;  1JTX A;  4UUS A;  1MNM C;  2X48 A;  2ME0 A;  4JNN A;  1Y1V J;  4MFE A;  2XPU A;  1ETX A;  2DA6 A;  5IYB J;  2DN0 A;  1YRN B;  4AF5 A;  5HAW A;  4V2F A;  1XS9 A;  5M5Y J;  1P7I A;  3W6V A;  4QIW N;  4FE4 A;  4BXX J;  2UXI A;  4GCT A;  2ELK A;  3V6G A;  3ZQG A;  3LJL A;  2X6O A;  3HDD A;  5D18 A;  4AUX A;  1OFC X;  2HDD A;  4DYC A;  2R0Q C;  4EEF G;  5D19 A;  3VW1 A;  1GVD A;  3K2A A;  1IDZ A;  3CDL A;  3HOU J;  1U9N A;  3FIS A;  1SAN A;  2DTZ A;  2XGD A;  3OIO A;  2B63 J;  4RBO A;  2DG8 A;  1MBK A;  2CUE A;  2DMQ A;  1T56 A;  3WHB A;  1NK2 P;  5FGL A;  2IBD A;  1ETW A;  2XB0 X;  1BA5 A;  5CXI A;  2ZCN A;  2R7Z J;  1ZK8 A;  1NK3 P;  2E19 A;  1R9T J;  4PXI A;  2LLK A;  3BNI A;  4BKX A;  3ZQC A;  2O8K A;  5FLV A;  3LNQ A;  2G7G A;  2M8G X;  1JUM A;  3GZI A;  2KT0 A;  2VKE A;  3NI7 A;  3Q3S A;  4A3L J;  2JWT A;  4QTR A;  2EBI A;  3GTK J;  2NOG A;  5HBU A;  3BQZ A;  4A3C J;  3IH2 A;  1HLV A;  1DU0 A;  2R92 J;  1Q1V A;  4GFL A;  1AKH B;  1QRY A;  3M4O J;  1IGN A;  2QKO A;  1W0T A;  5JLX A;  3S1R J;  3HTH A;  5CW8 A;  5K7Z A;  2Y30 A;  3I4N J;  3VUQ A;  3HOY J;  3ZOB A;  4D5C A;  5IOY A;  3G1L A;  3S1Q J;  1BW6 A;  5DS9 A;  1RES A;  4DW6 A;  3GTQ J;  3QPS A;  4XRS A;  5C44 J;  2MGQ A;  2EH3 A;  4XK4 A;  3HEF A;  2XPW A;  2CRG A;  3NAR A;  4GFK A;  2COB A;  3BG3 A;  2ZOY A;  5GPC A;  1MH4 A;  4XIC A;  1K83 J;  3E7Q A;  4A3B J;  1ZTR A;  3HM5 A;  3QPL A;  3P9T A;  1PUF B;  1JTY A;  2L7F P;  2MG4 A;  3ANG A;  1MBG A;  1B8I A;  3DEW A;  1XC5 A;  4JKZ A;  5AQC A;  3C2B A;  2CUF A;  3BG9 A;  3G1O A;  4XRS G;  2QF7 A;  2GBY A;  4AYB N;  2E2I J;  2JA7 J;  3HTI A;  3BG5 A;  3BQY A;  2GFN A;  1BW5 A;  1FJL A;  3K7A J;  4UDS A;  3VW0 A;  3FKI J;  4J19 A;  2QCO A;  4A93 J;  2IU5 A;  3KKD A;  2CQQ A;  3S15 J;  2O7T A;  1JKQ C;  4MO7 A;  3A02 A;  2K9Q A;  3E7L A;  2CQX A;  1VF9 A;  3CRJ A;  2LR8 A;  2DMU A;  2JMW A;  1BL0 A;  2HYT A;  1NTC A;  2DA5 A;  3L1P A;  4A3G J;  3VOK A;  2FBQ A;  3FK6 A;  4AC0 A;  2ZCM A;  3EUP A;  1JKO C;  2M34 A;  1FTT A;  2PZ9 A;  3HB9 A;  2HOS A;  1ETK A;  2HXO A;  2W53 A;  3IH4 A;  3GTG J;  3TED A;  5FKM A;  2NP3 A;  1B8I B;  2XGC A;  2OPT A;  3PM1 A;  5HOD A;  5IYC J;  2L9R A;  2W48 A;  1LE8 B;  2DJN A;  1IG7 A;  2QIB A;  5K7F A;  1ZGW A;  1TC3 C;  3CJD A;  5M3M J;  2DA1 A;  3MN2 A;  2JA8 J;  4MK6 A;  1A5J A;  3SDG A;  4KWA A;  4DYR A;  1I6H J;  4B1R A;  3A01 A;  2JA6 J;  3QQA A;  4S0H B;  2WB1 N;  2TRT A;  5F0C A;  3A03 A;  3JRD A;  4MIM A;  3JRC A;  1IV6 A;  5FJ8 J;  2DA2 A;  3HGY A;  3S14 J;  3S2H J;  1FIP A;  5CXG A;  4M6V A;  1AHD P;  3JRF A;  3HIM A;  4A3D J;  5EDN A;  1F36 A;  3CCY A;  4M3E A;  3NRG A;  3V78 A;  2LFB A;  5J3L A;  3RQI A;  1TWG J;  4D5F A;  3RKQ A;  3IH3 A;  4GFB A;  3PO3 J;  5BNG A;  5K7H A;  3FIW A;  2FJ1 A;  5HSZ A;  1X58 A;  2LTP A;  3HKZ N;  3Q0V A;  3TW6 A;  5C4Y A;  1MBH A;  1GV2 A;  4BY7 J;  2XRL A;  1GV5 A;  5FLM J;  4UUT A;  1OCT C;  5FHP A;  3JRE A;  2JA5 J;  3GTO J;  4CYC A;  3DCF A;  4BBR J;  3DPJ A;  1MBF A;  2Y9Z A;  2WAQ N;  2DG7 A;  2RAS A;  3SFI A;  3BCG A;  2EZI A;  4M3D A;  4ME9 A;  1ORK A;  2NS8 A;  2XB5 A;  4Y52 J;  2F07 A;  3MNL A;  2I10 A;  3VW2 A;  2VPR A;  2K9N A;  4MLO A;  2VKV A;  1YRN A;  3GTL J;  1TWA J;  2M9H A;  2AHQ A;  2EZL A;  3BR0 A;  3BTJ A;  3LSG A;  5EZG A;  2K40 A;  3BT9 A;  5EEA A;  2L7M P;  1G2H A;  1ETQ A;  3B6A A;  2CU7 A;  1GT0 C;  2HQ5 A;  3SJM A;  2E2J J;  3JRG A;  1MBJ A;  4JX4 A;  5M5X J;  1JJ6 C;  4IHV A;  1QVU A;  1RET A;  4A3F J;  2XPV A;  2LKX A;  2Y0S N;  2HOT A;  2Y2Z A;  1U78 A;  4JX6 A;  2FD5 A;  2IAI A;  1UHS A;  1WGX A;  4CYC B;  4C2M J;  4JP0 A;  2XSD C;  4C3H J;  2ECC A;  1K61 A;  1GDT A;  1UI6 A;  2DA4 A;  3PPB A;  2K9S A;  5EF6 A;  5K58 A;  4AC6 A;  5IPA A;  5M3F J;  5F08 A;  4D7M A;  3GEU A;  5D1R A;  1H8A C;  3RZO J;  4A3I J;  4X1E A;  1H88 C;  4G12 A;  5IOZ A;  4BY1 J;  1ETY A;  1TWF J;  1VI0 A;  3ANP A;  2G7L A;  4A69 C;  4FCY A;  2YVH A;  5IP6 A;  3GTP J;  2Q24 A;  3GTJ J;  2NVQ J;  3HOV J;  1UI5 A;  2DMN A;  3BR2 A;  1AKH A;  1ETO A;  3OOU A;  2NX4 A;  5F0F A;  3G7R A;  3S17 J;  4NEL A;  5JLW A;  1MSF C;  2HOA A;  2X9D A;  1H89 C;  2R5Z A;  1HF0 A;  2UXO A;  1JKR C;  2ID6 A;  2NP5 A;  1U8B A;  2Y31 A;  2KDZ A;  2O9L A;  4JX5 A;  4B3A A;  3B6C A;  3PAS A;  3FK7 A;  2IEK A;  3LSP A;  4GCK A;  3AQT A;  2GM4 A;  2YU9 J;  3JRH A;  5FKN A;  4D7N A;  2PBX A;  2LP0 A;  1HDD C;  4XRM A;  5M5W J;  4DYQ A;  5EG0 B;  2UXU A;  3TP0 A;  4MXM A;  3BHQ A;  4RDU A;  2N8G A;  4IEJ A;  5EGO B;  3BTC A;  3S1N J;  1GUU A;  3OSG A;  5F1J A;  2ECB A;  5EG0 A;  3BJB A;  3VVY A;  2H1K A;  2L0K A;  2YUS A;  5IYD J;  2FQ4 A;  1X2N A;  3KNW A;  3O8H A;  4A3M J;  5C3E J;  3JRI A;  3BR5 A;  1CQT A;  5DAJ A;  1U9O A;  1OCP A;  3BR3 A;  3S1M J;  2G0E A;  4L62 A;  4C3J J;  1WI3 A;  4JL3 A;  2QWT A;  1RR7 A;  1ZQ3 P;  4M3B A;  3HTA A;  4M3G A;  2GUH A;  3CWR A;  2GLO A;  3VPR A;  5J1Y A;  4ICH A;  5C4X J;  4A3E J;  2WGB A;  3S5R A;  4IHY A;  1FEX A;  3QKX A;  5J1R A;  3VIB A;  4I6Z A;  3ZQF A;  5GP9 A;  3HOZ J;  3MKL A;  2E2H J;  1P7J A;  2EZK A;  1ENH A;  1JT0 A;  2CJJ A;  2RAE A;  2GEN A;  4FTH A;  1JT6 A;  4QSH A;  1APL C;  3G1M A;  1D5Y A;  3LSJ A;  3LSR A;  4NDL A;  5EYR A;  2XGE A;  3CQZ J;  1F43 A;  2FX0 A;  3M3Y J;  1IRZ A;  1VND A;  2MW8 A;  1S7E A;  3S16 J;  2R93 J;  2HI3 A;  2LVS A;  1T33 A;  1ZKG A;  2O7O A;  1E3O C;  1LFB A;  2OI8 A;  1DU6 A;  2M2E A;  2YVE A;  3PO2 J;  1IDY A;  3A01 B;  3G56 A;  5F27 A;  5FKL A;  1BJZ A;  3OSF A;  5E3L A;  2HKU A;  3NXC A;  1Z0X A;  1RKW A;  3GTM J;  3AQS A;  3EGQ A;  1HDP A;  1JKP C;  5E3M A;  4X6A J;  3KZ9 A;  4LOC A;  4MFD A;  1ITY A;  2ZOZ A;  3LWJ A;  3VVX A;  1WPK A;  3C07 A;  3HOW J;  3BR6 A;  2AO9 A;  2NS7 A;  1UG2 A;  2JN6 A;  2LD5 A;  1O4X A;  3ON2 A;  2H8R A;  3TP3 A;  1MH3 A;  1POG A;  3HGG A;  3JRA A;  5FKK A;  3ZQH A;  1TWH J;  3GBG A;  1QVT A;  1EF4 A;  3VVZ A;  2NVY J;  1WCM J;  1FIA A;  2LK2 A;  5IP9 J;  1A6I A;  5J1U A;  1ETV A;  2JK3 A;  3O60 A;  3O8G A;  4DZJ A;  3BTL A;  1XG1 A;  3BTI A;  2RHA A;  3COL A;  3NNR A;  1Y1W J;  4HNV A;  2E1O A;  5EZH A;  3ZQI A;  2NVT J;  1IJW C;  3HOX J;  2R5Y B;  2M0C A;  2UXP A;  3WHC A;  1MBE A;  1SGM A;  3Q0W A;  4GCL A;  4L5E A;  3KKC A;  3HE0 A;  3NPI A;  2DA7 A;  2VUM J;  5EFY A;  4FE7 A;  4A3J J;  2PMZ N;  2MSY A;  4UUS B;  1HCR A;  3Q0U A;  2P81 A;  4M3F A;  2Y9Y A;  1X2M A;  3UKG A;  1HOM A;  3IV5 A;  1I3Q J;  2HYJ A;  4B4C A;  2NVX J;  2WUI A;  1JUS A;  2OER A;  5DTD A;  1B72 A;  2YS9 A;  1PUF A;  1VFC A;  5F04 A;  1JGG A;  9ANT A;  4C3I J;  2OF7 A;  5E3N A;  2LY9 A;  5E3O A;  3VOX A;  2DMT A;  4XID A;  2JJ7 A;  1RPW A;  2ID3 A;  3FRQ A;  2XDN A;  5C4J J;  3T6N A;  2ZB9 A;  4FIS A;  1IUF A;  2HXI A;  1FTZ A;  5F0H A;  3NAU A;  4BBS J;  2ZCX A;  2EZH A;  3H3V K;  1W0U A;  1Z77 A;  5H9T A;  4DZP A;  3I4M J;  3JSJ A;  3S2D J;  1TWC J;  3D1N I;  2REK A;  4Y7N J;  3JRB A;  1JUP A;  3RZD J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...