2Y2ZA

Ligand-free form of tetr-like repressor simr
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
238
structure length
238
Chain Sequence
b'VSIWMHPEPAGRRSARSHRTLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE REPRESSOR SIMREG2
publication title Structures of the Tetr-Like Simocyclinone Efflux Pump Repressor, Simr, and the Mechanism of Ligand-Mediated Derepression.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Transcription
total genus 87
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y2zA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2y2zA02
2E19A 4D5CA 4HNVA 1WPKA 2DA1A 3M4OJ 1TWFJ 2ELKA 4A3FJ 2HOTA 3VVZA 2EBIA 1QVUA 2XGDA 2UXHA 3ZQLA 2LR8A 1ENHA 2O8KA 5FLMJ 3S14J 5HBUA 2H8RA 2OI8A 5FKKA 1ETWA 2DA6A 3BTJA 3SFIA 1CQTA 4A93J 3JRBA 1ZQ3P 1H88C 1IDYA 3COLA 2ECBA 2HOSA 3HTHA 2YVEA 2P81A 3HTIA 1MH4A 2R5YB 3H3VK 5EDNA 4JX5A 3NAUA 3O60A 3G1OA 3F1BA 5CXIA 5F04A 4D7NA 1JT0A 5DTDA 1WH7A 2FQ4A 1F36A 3RZOJ 2QTQA 3G1LA 4GFBA 3VVYA 3G1MA 4QIWN 2QCOA 2KT0A 2CU7A 1JKRC 2OF7A 2VKVA 3VW1A 2NX4A 1A6IA 5JLXA 2NS8A 5FLVA 2Y2ZA 1A5JA 4UDSA 1XG1A 2I10A 5K7HA 2XB0X 3NRGA 2MW8A 3BT9A 3PO2J 3ZOBA 1I6HJ 2JA6J 1MH3A 5J1UA 1ORKA 3B6AA 3LSPA 3LOCA 4ACIA 2G7LA 3KZ9A 2ZCMA 1IDZA 5M3MJ 2XGEA 2B63J 5FHPA 3L1PA 3RD3A 2VPRA 3JR9A 1TC3C 5E3OA 4QTRA 4JX4A 3OSGA 1OCPA 5HSZA 2L7FP 1F43A 1SGMA 1MBJA 4DYQA 3TP0A 2QKOA 2ID3A 2UXPA 2DN0A 2Y0SN 1XS9A 4DZJA 2CQQA 5D18A 2MGQA 2ZOZA 1IJWC 2CRGA 2EZHA 3BNIA 3S15J 5EZHA 4JNNA 2FJ1A 4A3JJ 5FKOA 5E3NA 2DG8A 5EF6A 3SJMA 2KDZA 1ETYA 1IUFA 5GPAA 3RQIA 1FTTA 2IAIA 2YUSA 3BTLA 1MSFC 3A03A 1NTCA 1T56A 2VUMJ 2XGCA 4AC0A 4Y52J 3HGGA 2ZB9A 1W0TA 2MG4A 1WCMJ 4NELA 2IU5A 1MSEC 3LWJA 2R5YA 3D1NI 4A3EJ 1FIPA 1ETVA 4M3FA 1FIAA 1UI5A 1B8IA 4D5FA 2E2HJ 3GEUA 5C4XJ 3LSJA 2JK3A 1R9TJ 3ANGA 1DU6A 2M2EA 3BTCA 4W97A 2LVSA 1JTXA 2HDDA 3P9TA 4KWAA 2OPTA 3FK6A 1Z77A 3SDGA 1GVDA 2HYJA 3S2HJ 4GFLA 3GBGA 3BR0A 1ZK8A 3M3YJ 2WUIA 2GBYA 2HKUA 3KKCA 4A69C 2REKA 3O8GA 5CW8A 1MBKA 3NNRA 4MXMA 3BQYA 1BJZA 2DMTA 4YZEA 1TWGJ 1O4XA 2Y31A 3I4MJ 4CYCB 3E7QA 3S16J 4RBOA 5J1RA 4A3MJ 1JUPA 3AQTA 3VW2A 2VKEA 3S1NJ 4C3JJ 4ABZA 2PMZN 3CQZJ 3IH4A 5EFYA 3BHQA 2NOGA 3TW6A 9ANTA 2DG7A 3HOUJ 4JL3A 2LY9A 3LHQA 3BRUA 1U8BA 2M34A 3H0GJ 3QBMA 1B72A 3FK7A 1MBEA 4A3LJ 3BR3A 2EZKA 5DS9A 2HOAA 3VIBA 1GV2A 3HOWJ 5JLWA 2W53A 2G0EA 5EEAA 3GTMJ 3Q0UA 2XPWA 3HE0A 1POGA 3FKIJ 1UI6A 4UUSB 4LOCA 2CUEA 3S1MJ 2QF7A 1BL0A 1ZKGA 3NXCA 2DMQA 5DAJA 2JWTA 5E3MA 2NVTJ 1RKTA 4M3GA 3QPSA 3BG5A 2HI3A 3C2BA 1YRNB 1JGGA 3GZIA 2HXOA 5H9TA 1X2NA 3CMYA 3V78A 1U9NA 1WGXA 2DMUA 2G7GA 3EUPA 2WV1A 4PXIA 3IH3A 1QRYA 3HOZJ 5D19A 2NP5A 1OFCX 2XPUA 3NPIA 2QOPA 2YU9J 1TWAJ 3VOXA 4FTHA 5C3EJ 2D5VA 5HAWA 3W6VA 4A3IJ 3S5RA 4RDUA 2JA5J 1APLC 3WHCA 1HDDC 2QIBA 3HTJA 2DA2A 3QQAA 1AKHB 1IC8A 3EGQA 1SANA 1BW6A 2H1KA 4XK4A 1MNMC 1ZR2A 1H89C 5IYBJ 5IOZA 3BR2A 5HODA 5EGOA 3JRAA 2IBDA 3HKZN 3LSGA 3S2DJ 4GCLA 4CYCA 2R92J 3DPJA 1WH5A 2ZCXA 5IYCJ 2YVHA 1UG2A 4IHXA 3NI7A 4ME9A 1JUSA 1NK3P 4MLOA 5EG0B 1JUMA 1WI3A 1VI0A 2CUFA 4FE7A 1K83J 1QPIA 4JX6A 3C07A 3JRFA 1D5YA 3HOYJ 3JSJA 1RESA 4BKXA 5C4JJ 3VVXA 2JN6A 4IHWA 4NN1A 1P7JA 2DTZA 2JA8J 4UUSA 3FIWA 4M3BA 1HOMA 5FKLA 5FKMA 4HKUA 4A3CJ 3BR1A 4J19A 1JKPC 3A01B 2M0CA 2COBA 5FJ8J 5F0FA 3G56A 3B6CA 2K9SA 5IYDJ 1RR7A 2L0KA 4AUXA 2UXUA 1HCRA 1VF9A 1PUFB 2XSDC 4XRMA 1K61A 4V2FA 4S0HB 5EYRA 3IV5A 3TEDA 3HBLA 5J3LA 4MO7A 4IHVA 3IUVA 1Q1VA 4I6ZA 4BBSJ 4G12A 5M5YJ 1MBHA 2K9NA 1NK2P 2L9RA 2ZOYA 1ETOA 2ID6A 3S1RJ 3VP5A 5F0CA 2ZCNA 4XRSG 3HDDA 3OSFA 3JRCA 1OCTC 3OIOA 2DA5A 3QPLA 3PPBA 2QWTA 3PO3J 1ITYA 4MIMA 3B81A 4GCTA 1AKHA 1OJLA 2NP3A 1X2MA 3K2AA 4BXXJ 3VOKA 4QSHA 2L7MP 3ZQGA 4BY1J 3S17J 2FD5A 3A02A 1BA5A 1DU0A 2R0QC 3BR5A 3DCFA 3HM5A 2LLKA 1VNDA 1Y1VJ 3Q3SA 5F08A 1TWCJ 2GLOA 5F27A 3LNQA 3GTQJ 2D6YA 2Q24A 1LFBA 3GTPJ 1UMQA 4XICA 1BW5A 2NVYJ 2VI6A 2XDNA 2WGBA 3MVPA 4FE4A 3WHBA 3LSRA 1U9OA 3JRHA 5D1RA 3CWRA 1RPWA 1XC5A 3HGYA 5EG0A 2XRLA 2LK2A 5F0HA 5IP6A 3MNLA 2F07A 3VUQA 4GCKA 2PZ9A 1U78A 3CJDA 1VFCA 1G2HA 4C2MJ 2G7SA 3S1QJ 2MSYA 5C44J 2FX0A 5FGLA 1IV6A 4NDLA 5IPAA 3HB9A 5GPCA 5M3FJ 2Y9ZA 4DYCA 1GT0C 1S7EA 2X48A 3JRDA 4A3DJ 1IRZA 3O8HA 3KKDA 2AO9A 4M3EA 4W1UA 4B1RA 1JTYA 3A01A 3I4NJ 2HYTA 5J1YA 1I3QJ 3PASA 2EH3A 3HOXJ 3BG9A 1HDPA 1ETQA 2NVQJ 2DA4A 4GFKA 1E3OC 2DA3A 4AC6A 4B4CA 2DMNA 4MFDA 1LE8B 5FKNA 4A3KJ 5FMPA 1JT6A 1PUFA 4A3GJ 2TCTA 3KNWA 3ZQIA 4IHYA 3FRQA 2ECCA 1ZGWA 3JRIA 2ME0A 4JKZA 1TWHJ 3CDLA 2DJNA 3TW7A 3Q0VA 2X9DA 4M3DA 5BNGA 3ON2A 1MBFA 2CJJA 1GV5A 4IEJA 2E2IJ 2GM4A 2GUHA 2OERA 2RASA 5C4YA 3E7LA 1B8IB 2JJ7A 2DA7A 3ZQHA 4Y7NJ 3JRGA 2EQRA 1H8AC 5IOYA 4C3HJ 4D7MA 4B3AA 4ICHA 4AF5A 2Y30A 4A3BJ 1ZTRA 2EZIA 5GP9A 1HLVA 3RZDJ 2NVXJ 2R5ZB 1MBGA 1JJ6C 3LJLA 2N8GA 1IG7A 3T6NA 3RKQA 2LD5A 5E3LA 3AQSA 1ZR4A 2E2JJ 1LFUP 1ETXA 2HXIA 4CGRA 5EZGA 2R7ZJ 3G7RA 2XPVA 1JJ8C 3GTOJ 2DMPA 3CCYA 4FCYA 3JREA 2IEKA 1IGNA 2UXOA 4M6VA 4JYKA 2O7TA 3PM1A 3HOVJ 3Q0WA 3BQZA 5M5WJ 1FTZA 3BTIA 2AHQA 2XB5A 1FJLA 2JA7J 3BJBA 5AQCA 2G3BA 5CXGA 1ETKA 2WAQN 5F1JA 2UXIA 5K7ZA 3ANPA 3MKLA 3IH2A 4DW6A 4FISA 3V6GA 2TRTA 2WB1N 2V57A 3ZQFA 2LFBA 4V2GA 3GTKJ 1YRNA 3HIMA 1I50J 3HEFA 1B72B 1RETA 2RAEA 1HF0A 2FBQA 1QVTA 2M9HA 2W48A 1LE8A 1AU7A 4EEFG 3GTGJ 1UHSA 4I76A 4AYBN 2GFNA 2LKXA 3HTAA 3BCGA 4JP0A 2GENA 2CQXA 2O7OA 2YS9A 1Z0XA 2LP0A 3TP3A 3UKGA 2K9QA 2R93J 1FEXA 3MN2A 3K7AJ 3NARA 3GTLJ 2L7ZA 2O9LA 1Y1WJ 2PBXA 1JKQC 1GDTA 4X6AJ 4DYRA 3DEWA 1JKOC 4MK6A 2ME6A 4DZPA 3QKXA 5IP7J 1X58A 2E1OA 4XRSA 3OOUA 1W0UA 2R5ZA 4L62A 3VW0A 3BR6A 3VPRA 2EZLA 2RHAA 5M5XJ 3F0CA 4XIDA 4BBRJ 5K7FA 4MFEA 3ON4A 1RKWA 3CRJA 4X1EA 2Y9YA 3BG3A 3RH2A 5IP9J 1EF4A 2X6OA 3GTJJ 4BY7J 1SFOJ 1P7IA 4C3IJ 5EGOB 2K40A 4UUTA 4L5EA 2NS7A 1GUUA 1T33A 2HQ5A 3ZQCA 3FISA 2M8GX 5K58A 2LTPA 1AHDP 2JMWA
chains in the Genus database with same CATH superfamily
2XV4S 3M07A 1WPKA 2DA1A 3ABMH 5D5VB 2WBMA 2ISYA 4DGWB 2EBIA 4Q47A 1BI1A 3M1EA 4MHGA 1X1BA 2UXHA 2O8KA 1XCVA 3I59B 3HYIA 5ICCA 2H6BA 4HX7A 4OD5A 1YO5C 1Z3XA 1FOWA 1ETWA 3WG9A 1FSEA 2AXLA 3SFIA 1CQTA 1PJRA 3K1MA 2JQ7A 1IDYA 3IUOA 3CCJI 4XSZF 5D8LB 1FC3A 2H94A 3T0YA 4NBQA 1MH4A 2R5YB 4BJTA 4A5NA 3G1OA 4IXAA 2FRHA 5F04A 1JT0A 1QPMA 1Z6TA 4BXUA 1F36A 4UY8I 2J5PA 3G1LA 3VVYA 1V5FA 2CYYA 3G1MA 2QCOA 1Z7UA 4XLFA 2PJPA 2P6TA 1JKRC 5FROA 3W6JB 4PK4A 3VW1A 3RDIA 5JLXA 4XN0A 2UV1A 1A5JA 3PNTA 1GXQA 4RA2A 2FXAA 2XB0X 3NRGA 2BY1A 2MW8A 4BHPA 5LLQA 4ESJA 3LSKA 2JA6J 1MH3A 5J1UA 1ORKA 2PMUA 3LSPA 3LOCA 4HLXA 3GUDA 1F5TA 1IDZA 3DEUA 5M3MJ 4AIJA 3M9AA 1OYYA 5CVIA 4WF2A 4ANJA 5FHPA 3U9GA 2K86A 4OOIA 1P4XA 5KAIC 4JX4A 2PBIA 1VQKI 2M7BA 4HRIA 2AXTC 2HPIA 5HS8A 4LK0F 4C30A 3J80Z 2QKOA 2ID3A 2UXPA 1LUJB 2Y0SN 4U88A 2BEOA 1XMXA 5HNHA 5D18A 1G8XA 2WTEA 3VOEA 3QP5A 2BYVE 2YU3A 3SQNA 3HL2A 4HQEA 3DBHB 3DF8A 1ODDA 4YEJA 2OD5A 2V9VA 4OU0A 4IOCF 5EZHA 2VC0A 1Y8RB 1TTYA 5FKOA 2KDOA 4ZYHA 2QZ8A 4CXFA 2DG8A 5E17F 1YITI 2DPDA 2HDCA 2MFZA 2ELJA 2IAIA 3A03A 1NTCA 3BC8A 3L2UA 2XGCA 5E1XA 4XN3A 2VUMJ 4G9YA 3H0DA 2IU5A 3LWJA 2XDVA 2XF5A 4A3EJ 4KDPA 1QZEA 1FIPA 3HZJA 4M3FA 4LB6B 1B8IA 2EK5A 2ZBKA 2E2HJ 3GEUA 4U0YA 2IRFG 2JK3A 2O6GE 3SDBA 2M1BA 1IRFA 4HOBA 3ULQB 2M2EA 3BTCA 3BOQA 1JTXA 2OTLI 3T8TA 4I0BA 3GLXA 5D4SA 4KWAA 3VFZA 3FK6A 4ZDPA 2NS0A 3HUGA 1P6RA 3ZCOA 2DW4A 3S2HJ 3HPHA 4IOAF 3SZPA 1Z05A 4FHTA 2ZC2A 1XGOA 2F5DA 2MH2A 4P9FA 3LSMA 2R7VA 2KHMA 3MEXA 2FU4A 2H6CA 2HKUA 3KKCA 2QQ8A 1X1AA 1TLHB 2EIJH 3NNRA 1I27A 4C2UA 2DMTA 3QU6A 1O4XA 1KA8A 3AG1H 3I4MJ 4HF0A 4CYCB 4BGDA 3CMMA 3EUHA 3OYEA 2X51A 5DCMA 3BZCA 4C3JJ 4EMSA 2XGXA 3O6BB 2K9MA 4ABZA 2FNPA 2BVLA 1S29A 1LJ9A 5BS6A 3LHQA 4E7ZA 5TGTA 4WIBA 1R1VA 3OYGA 1P2FA 3QBMA 5JR3A 1MBEA 3A0HC 3MQ0A 1R36A 2OTJI 3HOWJ 2W53A 2G0EA 3GTMJ 3GWZA 2HEOA 3FKIJ 2I5UA 1WWXA 2KLOA 3P9IA 2HR3A 1RKTA 5GTHC 4M3GA 3R0JA 3RI4A 3OOPA 1X4OA 2VODA 1JGGA 3HG9A 2HXOA 4HQMA 2LF7A 4EJTA 3GZIA 4B8XA 1DGRM 4OD4A 3L2RA 1U0JA 2IA1A 5ICFA 2ZJQF 2NYXA 1IUYA 2EINH 2DO7A 3GLLA 1T0FA 4PXIA 3IH3A 4BQAA 3PL8A 2BGCA 4JK1X 3H92A 2NP5A 1O7FA 1OFCX 3NPIA 2QOPA 3V42A 1BM9A 4FTHA 2X1CA 5DEQA 3S5RA 2K3PA 3EUKL 1Z9CA 2BE5F 2LOOA 2YVXA 1O3RA 1SEUA 3C2HA 1BW6A 1K7AA 1OKRA 4XK4A 1H89C 4YIFA 2DPUA 1HW5A 3BR2A 4XBFA 3WTVC 5FGMA 2IBDA 3HKZN 4GCLA 3GYHX 4Q4ZF 2DT6A 3DPTA 3KZZA 1FMVA 4HNUA 3M7GA 4CSWA 3K1PA 1R6RA 4FQGA 1JUSA 1JE8A 4IQJA 2FF4A 3L9FA 2VL8A 2QBYA 4M6YA 3C07A 2I8DA 3JRFA 1HQCA 3QWLA 5E1ZB 4ENMA 3VYSB 2XC7A 2A07F 3VVXA 1DPUA 2Z9OA 4IHWA 1Z1DA 2LRDA 5B5EC 4BHCA 1KQ8A 3ERED 4UUSA 2D45A 3FIWA 4NN1A 3VWBA 1Y6IA 5FKLA 4HKUA 2PJRB 2M0CA 2H27A 4G7ZF 3OYJA 2VIXA 1J5YA 3ZQQA 1R1UA 2ZFWA 5J6XA 5IYDJ 3OYDA 2XSDC 1BR1A 3IAM2 1PUFB 2HQRA 1TP4A 3HBLA 3ZGKA 4BBSJ 4N4NB 5JHUA 4RB0A 1ON1A 2K9NA 2VBWA 4WXDA 4Y4RA 4CZCA 2DXIA 2ZOYA 4HBLA 5B66C 2ID6A 3PJRA 3DEEA 3VP5A 5F0CA 4J00A 3OSFA 3WGIA 2DA5A 3QPLA 5E8IA 2WC2A 4IVNA 3OYAA 2W82A 1ITYA 3OYHA 4GCTA 4HV5A 2JT1A 1AKHA 1R4MB 3K4NA 1WFXA 1X2MA 2BXZA 3HRSA 3R4KA 2R7TA 3CLQA 3S8PA 3A02A 2R0QC 5F08A 3ZRGA 3LNQA 3K1NA 2KRCA 3ESWB 3GTQJ 4I01A 1R00A 2RGVA 2OV7A 1I5ZA 2UXNA 3QYEA 2Y0SA 3QP6A 4XICA 1Z3YA 3I55I 4YG2F 4Z2YA 2L9NA 3H1CA 4DNCA 3HTUA 1EA3A 3CWRA 4HW0A 2WV0A 1XC5A 5EG0A 2HYGD 2LK2A 4II3A 4OIPF 2F07A 3E6DA 2PZ9A 1R23A 1VFCA 5ED4A 3CJRB 5HDGA 5C44J 1T98A 5KNLA 4QWQA 5FGLA 5IPAA 1VQMI 5GPCA 3R60A 4BAYA 4DYCA 3CCSI 2X48A 4EATA 4KFCA 1SC7A 4UV9A 1QHHD 2NOJB 2QSGX 3A01A 2HYTA 1I3QJ 4N9IA 4RM2A 3F22A 1QNTA 2NVQJ 3BROA 3SFZA 2GXBA 1R5ID 1ERDA 1ZRCA 2HKXA 2P4WA 4ENNA 4A3KJ 4A0XA 1YI2I 1JT6A 4AIKA 3V7CA 2KP6A 2KQRA 4A3GJ 2EPFA 4PJJA 3PSFA 2V1DA 3FRQA 3JRIA 4ZC3A 4DOZA 1WRJA 3ZQ7A 2LKSA 5K5QA 3CDLA 1YE9A 3MZYA 2DJNA 4EJUA 2HVRA 2X9DA 1MBFA 5ILUA 4C2MA 4LD5A 2CJJA 1I39A 1G3YA 3S3OA 2PFVA 1MMNA 2XHKA 4IEJA 3IP4B 4HX8A 4RLQA 4CYDA 1IXRC 3REOA 5EEHA 3JRGA 2EQRA 3ECHA 1H8AC 2F4MB 4EJVA 1MKMA 4M74A 2Y30A 3S2WA 2LBFB 3S3NA 5EEGA 3WGGA 2DTRA 1V5GA 3TOAA 1IG7A 3T6NA 2H09A 5LEKA 5J8CA 2XRNA 3PUFA 4GYGA 2VKDA 1PP8F 2GQQA 3G7RA 3BJAA 3GTOJ 3J7AO 3CCYA 4FCYA 3JREA 2IEKA 3GZ5A 4JYKA 1E0EA 2O7TA 3CUQB 4G7HF 3BZ6A 3Q0WA 1BR4A 1J75A 5CXGA 5GAGJ 2AQEA 3TL4X 5FD5A 2VQGA 1H9TA 4TV7A 2BZTA 4RS8A 4DW6A 3KEQA 5CVVA 4F93B 1VTNC 2OZUA 1G3TA 1MNDA 3W6KB 2XAGA 1KYWA 3A4CA 1VQPI 3KLNA 4CDGA 1TBXA 2VASA 3HIMA 3HTSB 1OCZH 1ZARA 2RAEA 5D5UB 3DBLB 2M9HA 3OMYA 5CQGA 2EIKH 2D1VA 4JQFA 2QGUA 3IL2A 4AYBN 3PNYA 2MBFA 1S3JA 4XNFA 4PFPA 4KISA 2VT2A 3BCGA 2KRFA 2KKOA 2YS9A 4OMYA 4A6EA 4J01A 4HX4A 5AONA 2KIMA 4XOPA 4ZYEA 2WY8Q 1K4TA 2VBZA 3GTLJ 3ZMTA 1QHGA 1J7KA 5LHGA 2KMUA 3HKZA 2O61A 2PBXA 2QQBA 1GDTA 1SD6A 2O3FA 2ZJRF 1A36A 4GXOA 4P9UA 3AFHA 3CTAA 4F3QA 3W2AA 4AWXB 1X58A 2HS5A 4XRSA 3GFLA 2EFNA 2F4OB 1WJDA 4CCMA 1KU3A 1P92A 2VQCA 1J2XA 3BWGA 4BBRJ 1IV8A 2BY2A 4HA8A 2H1LA 4E7KA 1I1SA 4MFEA 3CRJA 2Y9YA 1FNNA 3K4MA 3FM5A 4LK1F 5IP9J 2X6OA 4IKFA 4BY7J 5EGOB 1E3PA 1IN7A 4L5IA 4ZTJA 1SD7A 1O57A 4L5EA 4OAYA 1MMSA 2VJ4A 2Z3YA 2GIVA 2CGPA 2M8GX 3L00A 3ASOH 4LLNA 4N9HA 2LC2A 4ASNA 1WSUA 1AHDP 2JMWA 3H9QA 1IZ1A 4D5CA 1NHAA 4XONA 1T39A 3M4OJ 1TWFJ 2ELKA 5J40A 1M1EB 1OPCA 1A6QA 2XGDA 3GEZA 2XUBA 1BI3A 4RGSA 3ZQLA 3S14J 5FLMJ 5HBUA 4N4OB 1XPXA 4YFNF 1SVMA 3MCZA 1KU2A 3TKYA 4BL0B 4KITB 4L0ZB 3PSIA 2V26A 3BZKA 3CESA 3QAHA 4GCVA 1FYKA 2E60A 3FMRA 1F4KA 2TDXA 4KA4A 1S9HA 2ECBA 2PG4A 3K69A 4HG2A 3CCMI 2Y69H 2V7FA 1XSDA 3HTHA 2CV1A 4IRVA 3TQNA 1LFPA 4DBRA 5EDNA 3D5SC 3F1BA 3HJEA 3JTHA 4DIQA 3FHZA 3U1KA 1XMKA 3FXUA 4HYEA 4H0EA 3GCMA 2Y75A 3OYMA 4YRVA 4QIWN 1X1CA 4UXNA 2KT0A 4NC7A 3RJPA 2VQHA 3CP8A 4BUPA 3CC2I 3R0AA 4O3MA 5FLVA 2Y2ZA 4Y15A 3DLLF 2F48A 5HLIA 4EV0A 1KZHA 3ZOBA 1YX3A 4PGGA 1UELB 4G8XA 2UUZA 3WGHA 3HSRA 1KYZA 2B63J 1ZREA 3DTEA 3B73A 3L1PA 2P6SA 3JR9A 2RQQA 1TC3C 5E3OA 4QTRA 3DTKA 4PDKA 1ZG1A 1MD0A 1YJNI 3KP2A 1RRJA 1ZN2A 3P5JA 2M5WA 1K79A 5KAFC 1LB2A 2CQQA 5BPIA 2MGQA 1A04A 3VDXA 2K4JA 2QKMB 2EZHA 1P4WA 3LAJA 3S15J 2VJ5A 4QPQA 5KK1A 4JNNA 3TOBA 5E3NA 3SJMA 4B3XA 4XR6A 3NQOA 2LMDA 3WTXC 2F6CA 5GPAA 3RQIA 2VN2A 2BY3A 1FTTA 3BTLA 3CMEI 2QUFA 4KICA 3TO6A 3WTYC 4Y52J 3HGGA 2ZB9A 1WCMJ 3I64A 4NELA 1MSEC 4XRFA 2R5YA 2A6EF 4S04A 2YSRA 3CCQI 2CO5A 2W1OA 1FIAA 4M9XA 1MDMA 3GW2A 3IWZA 3CDIA 5TRDA 5C4XJ 1R9TJ 2YR2A 1IO2A 2MA3A 3JCUC 2MABA 3E6CC 2FBHA 4Z6YA 4W97A 1STZA 2LVSA 3DKWA 2ZKZA 2R4GA 1V54H 1Z77A 3SDGA 2PLYA 1CGPA 3SEZA 4HAMA 1LEAA 3J81K 5FLXK 2D1HA 3F8MA 1VQLI 2DQLA 1ZLKA 2DJIA 3J7YJ 3WODF 3TDZC 1Z21A 2ZO4A 3JW4A 2EA2A 4EGYA 3OYIA 5CW8A 1OCRH 1XN7A 4GRIA 1UAAA 4MXMA 3BQYA 1BJZA 4L9NA 2HTJA 2OBPA 2EIMH 1FBSA 4AD9A 5KHDA 1FBUA 3E7QA 4IZZA 3E0JB 3KZIC 3RYPA 3S16J 5J1RA 1JUPA 3AQTA 3E6BA 2VKEA 3EUAA 1O3TA 2PMZN 3CQZJ 1ONVA 2QSHX 3OYNA 3BHQA 1V55H 4KT6A 1OCOH 2V1UA 4NHJA 3PQJA 3I58A 4BEHA 4IPAA 2XAJA 3KP5A 4U87A 2M34A 3I54A 5CJ9A 3PQKA 1B72A 2CUJA 3FK7A 2ZMEB 3HOTA 3K8PC 4AYBA 3A1YA 3DBRB 2Z16A 2XPWA 2ZMEC 1POGA 2Q2EB 3PIOF 1I6XA 1K6YA 1XDSA 2CUEA 3BPVA 2QF7A 5AIPA 1ZKGA 5HNFA 2DMQA 1W5SA 2ZSIB 3M8JA 2QVOA 4OMZA 2W7NA 1J09A 3PUBA 1FOXA 4RB1A 1XSXA 5H9TA 2P0WA 3CMYA 2HDWA 1U9NA 4XLPF 2ETHA 3RPUA 2WV1A 3O2PE 4AVPA 1UB9A 2ZNZA 4ZYAA 2LNBA 2DDAA 4CO8A 1MJBA 1TWAJ 3VOXA 3QPTA 3U21A 1LKXA 1FPQA 5C3EJ 3W6VA 3DTIA 4NNJA 3EYIA 3ISPA 1O7LA 2GWRA 1T2KA 2NAZA 2JA5J 3HTJA 1XMAA 5ILVA 1X3UA 2X6YA 3EGQA 4ZYGA 1SANA 2X6XA 1B9MA 4E6KG 5IY5H 2H1KA 1TZLA 4YELA 1YTYA 1N78A 2CW8A 1ZR2A 3WTWC 3FMSA 5IYBJ 5HODA 3JRAA 1W7PB 3S2DJ 2CSOA 4CYCA 2R92J 3DPJA 4GGGA 1WH5A 5D5XB 5E79C 1UG2A 4LGWA 3H35A 3IRQA 3C2GA 4ON0A 1R22A 3NI7A 2ACJA 3L2QA 4Q5SF 1LPQA 3ZN0A 4P5OA 2E71A 4MLOA 2CUFA 1VI0A 1K83J 4JX6A 1U2WA 1SD4A 4LG3A 1ON2A 3DQVC 4LIUA 5LGNA 4O6JA 1BJAA 4XM3A 5C4JJ 2JN6A 2M7AA 1GXPA 1EH8A 2L4AA 1YIOA 4F7ZA 3Q9SA 4ZJZA 5FKMA 1VQ9I 2RREA 3BR1A 4J19A 4A3CJ 4AM3A 4G7OF 2G7UA 2V6EA 1V4RA 2FUG2 5FJ8J 4GYIA 4MGRA 4RB3C 3HXLA 4Y33A 1RR7A 3BCBA 1WZ2A 3M8FA 4AUXA 2UXUA 4XLEA 4DVYP 2PX9A 5IT3A 3IV5A 1FBQA 1HSJA 2EB7A 4L9JA 1X1DA 4MO7A 5J3LA 4A0ZA 4IHVA 2XF6A 4U9LA 4I6ZA 1MGTA 4G12A 5H6QA 2MYSA 2RN7A 3KX2A 2EV6A 5FO5A 2XROA 3EETA 4ZYDA 2L9RA 4BJ5C 3GFMA 4XMYA 3RQ4A 4XRSG 3JRCA 3LA2A 1OCTC 4G6DA 4XKBA 2QWTA 2FE3A 1XSVA 5TJJA 1R49A 4GO1A 2A69F 4BXXJ 4M6XA 2L7MP 3ZQGA 1TL8A 3GVAA 2ZJPF 3BR5A 3FKJA 1T6SA 1VNDA 2LLKA 3KYCB 1TWCJ 3F21A 2GLOA 4O5VA 5L3EA 4OIRF 2Q24A 2FBIA 4IL6C 1LFBA 1GLNA 3GTPJ 1SFUA 1UMQA 2VI6A 4KN7X 2QYOA 2K85A 4RAGA 2R7FA 2KFDA 3NWSA 1U9OA 3LSRA 5FFXA 1R5GA 3I53A 2B3WA 2ZXWH 1XGNA 4WXHA 3SXYA 2IS1A 2VE9A 5DUKA 4C2MJ 2MSYA 4XOTA 1YX5A 2FX0A 4IJAA 1IV6A 3F72A 2Y9ZA 2Z2SB 1GT0C 4A3DJ 1IRZA 5D5WB 1RZ4A 1W5TA 3E97A 2PJRA 3I4NJ 1QZYA 2JPCA 4JBAA 5J1YA 2Q8KA 2EH3A 2DFIA 3HOXJ 1UJ8A 1R1TA 3RSNA 2DA4A 3K0LA 2HU9A 3PNVA 1YQAA 3N97A 4E7IA 1TW2A 2STWA 1PUFA 3M8EA 1XD7A 3MZ8A 2FSWA 3B02A 4UVAA 3FHNA 3ZQIA 1ZH5A 3N4MA 2WA0A 4IHYA 2OJED 3J81Z 3CF2A 5FLXZ 5D8KB 1L0OC 1ZGWA 1VQ4I 1TWHJ 1PDNC 1NH3A 2OCEA 1P9QC 4M3DA 3TGNA 4ENKA 1I3AA 3H5NA 1FP1D 2FOKA 2A61A 2L5QA 2V6CA 4ENJA 2BW3B 1B8IB 1YS7A 5E20A 3VODA 3FXMA 2VQLA 3ZQHA 4V19K 4NQWA 2PEXA 5H2FC 2E1NA 1UCRA 4C3HJ 4B3AA 2E35A 3OL3A 2RV8A 3KP3A 3LQRA 4RGUA 1ZTRA 3QYFA 4RGXA 2EZIA 2EFQA 2FA5A 5GADJ 3K4LA 2PMZA 2QQ9A 3RZDJ 2MD0A 2R5ZB 1MBGA 1HLVA 1JJ6C 1HW1A 1ZR4A 2OC6A 1LFUP 2E2JJ 4XQFA 1KU9A 3LFKA 2M30A 2EFOA 2YX7A 3H3UA 1LVKA 2XPVA 1D1AA 3S32A 1AA7A 1MJ9A 4M6VA 2UWMA 3IHUA 3HOVJ 3HC7A 3OYLA 5M5WJ 3WU2C 1ZG3A 2AHQA 2XB5A 5LD2C 2JA7J 2IGNA 5AQCA 2AS5F 2P7CB 4M73A 3G3ZA 5F1JA 5B1AH 5DCMB 2A68F 3QOPA 4B48A 3FBNB 3V7RA 5DUIA 3EUHC 5DM7F 5FRMA 5J4VA 2TRTA 4KMFA 5HDKA 2VJIA 1ACIA 3GTKJ 1YRNA 1LDJA 1HKSA 1I50J 4PFOA 4CZZA 2W25A 4HLYA 4OINF 3K70C 2FBQA 1AU7A 1Y56A 4EEFG 2O5RA 1A31A 4I76A 4PCQA 2GFNA 2LKXA 1OYIA 3HTAA 3OIPA 1B59A 3HPGA 4KJZA 3RKYA 2KZGA 4ZZDA 3UKGA 1Z0XA 4LG0B 2VKHA 4MNUA 3JAMK 3BG7A 1V5EA 2X1EA 5DM6F 3KP6A 1FEXA 2PFBA 3EDPA 2XAHA 3LL7A 4IO9F 3SYTA 5J4YA 2QWWA 1YJ9I 2YX4A 2K5CA 2HZDA 3S93A 2O9LA 3OYBA 1TT0A 3FM3A 3ECOA 1JKQC 1T0FC 4LJZF 4NB5A 3OWTA 2DAOA 2OUMA 1JKOC 5IP7J 1G4DA 3RTRA 2R7DA 4L62A 3LA3A 3K4JA 1OISA 3P9KA 1S8NA 2RHAA 2M45A 3EYYA 3F0CA 1J9IA 4FASD 1PP7U 2HOEA 3DFGA 4PJLA 2MC4A 1RKWA 2E34A 2BVMA 3ASNH 3RH2A 2ADUA 3C3WA 4DBQA 1EF4A 3V8KA 4RMNA 4XKWA 3GTJJ 3AL0B 4C3IJ 3CUQA 4UUTA 4L9VA 2NS7A 1D0YA 1T33A 2WAEA 3KEYA 3ZQCA 3FISA 3AL0C 3RPUD 3HIFA 4P96A 2O8XA 4BE1A 2E5NA 1VQ5I 4EM1A 2LTPA 1BOAA 2E19A 3TMOA 4HNVA 1O3QA 3ABLH 5LHHA 5F1RA 4I09A 2IA0A 3N05A 1NG6A 1U3EM 4A2UA 1T08B 1IN4A 2IGKA 2H8RA 3BP8A 2MH9A 5FKKA 4ZZLA 2EFPA 2DA6A 3BTJA 1OR7C 2R7UA 3VB2A 2LDUA 1R58A 2JTVA 3COLA 2M87A 1SMTA 2GA1A 2YVEA 1FY7A 2P81A 3HTIA 2CS3A 4JX5A 3O60A 2QQAA 5CXIA 3DPLC 4D7NA 2XF7A 2VXZA 4L9TA 1WH7A 3RZOJ 4G94A 1RIOH 2WAFA 2VLAA 2RVCA 2RC4A 3RCOA 1W36C 3FWEA 4XSXF 5HVQC 1VQ7I 4LIVA 1UHMA 4E4HA 4G6TB 2VKVA 3IKVA 2IGMA 2NX4A 2HVQA 4LLGF 4XLHA 2NS8A 2G7HA 3ZP5A 1D0ZA 1WHUA 4RAZA 3ZN1A 5K7HA 4UDSA 5DYMA 1BC7C 3H9GA 3L2VA 3LMMA 2BY0A 1LDDA 4PJNA 3L2CA 1DDNA 2VB6A 3HHGA 4BNCA 2FEZA 3CJQB 3SWHA 4ACIA 5E18F 2ZCMA 5DCFA 2DOAA 4MEXF 1VQNI 1DQUA 4EJWA 3D5LA 1T8IA 1OCPA 5HSZA 2IXSA 1F1ZA 1HKQA 4BQOA 3MMYB 4K2EA 1MBJA 1EJ9A 3TP0A 3F8CA 4PJMA 1JGSA 1FWZA 2OCCH 1TQIA 4DZJA 2P5VA 2WWYA 1ZRFA 1WJBA 3W2VA 2QKLB 4KIGA 4HDUA 2DLLA 2ZOZA 1IJWC 2KJCA 4ITVA 5LGUA 5EJCA 3U2RA 1QZZA 5GAEJ 3BNIA 4CUGA 5JVTA 3ELKA 2JZYA 2G9WA 1IN6A 2XAQA 2KDZA 2OZ6A 2YUSA 4AC0A 1VQ8I 2HWVA 2FMLA 1W0TA 2ZXIA 1RUOA 1U5TB 3VEPA 1IXSB 1MMGA 1ETVA 4I2OA 2DCEA 1Z7LA 4D5FA 4IQ4A 2VJJA 2K9LA 1U5TC 3ANGA 5FB2A 3BLYA 3ZXSA 2ZCWA 3DP7A 6PAXA 2RNJA 4L5JA 4EQQA 2OPTA 2DOFA 2X85A 3HOSA 3E5UA 4KMUX 2ZFUA 2HNHA 2YPRA 3L2WA 4II2A 1UFMA 1FYMA 2LF8A 2HYJA 2KZVA 4GFLA 1HXDA 3GBGA 4MQ9F 2EV0A 2QM3A 2X6WA 3NWTA 2WUIA 4M9SA 5AIQA 3HHHA 3L7WA 2LY1A 3CCEI 1XB4A 4U9NA 1E2XA 1MBKA 1S7OA 1S5LC 2GXGA 5H6RA 4IHTA 3HSFA 1WQ2A 4WXCA 1NG7A 1EV7A 4XL9A 4BQQA 1MNEA 4RBOA 5GTIC 1CF7B 4EJOA 1ZYRF 2V9KA 4KT5C 3IH4A 5EFYA 1ZELA 2JUCA 3TW6A 3G71I 2LY9A 5D4RA 1RNLA 2ZNYA 3F6OA 1U8BA 4C2TA 4E7JA 3IWFA 2O0YA 3IKTA 5DS9A 2HOAA 3VIBA 1GV2A 3CCLI 5JLWA 5EEAA 4RAFA 5HLTA 1UI6A 3JAMZ 4LOCA 3S1MJ 1BL0A 4E70A 3CJNA 3DWLE 5DAJA 5E3MA 2NVTJ 2M8EA 1G59A 1IRXA 3QPSA 1SFEA 4I02A 2K4BA 2HI3A 3ROUA 3GXOA 1R5HA 2LREA 3OR2C 4HDVA 3I4PA 3V78A 4Y17A 1WGXA 3E5XA 2QSFX 2DMUA 2IS2A 1D8KA 1EKEA 3F8FA 2CUZA 2ZXJA 4BACA 2NRAC 1QRYA 1LEBA 5D19A 2XPUA 4CICA 2YU9J 4CCLA 1FT9A 3K4BA 2GAUA 1K78B 3SEQA 5HAWA 2Q0OA 4A3IJ 3UR3C 4RDUA 4UHTA 2L3DA 1APLC 3WHCA 3COAC 4F92B 2DA2A 3QQAA 2HFHA 3MKYB 4IRIA 1FLIA 3WTZA 4R1HA 3U1DA 5L3BA 3I5UA 3KLOA 1YW9A 3F8NA 4GDFA 2A2FX 5IOZA 1OYWA 2LH9A 1IW7F 1UZCA 2V4JC 2FNAA 1FYLA 2RDPA 2ZCXA 5IYCJ 3CC4I 2YVHA 5JHFA 1XGSA 4XORA 5CVUA 3OIQA 1KU7A 3F6VA 1NK3P 3I3LA 2ESHA 4WK8F 2DU9A 1DP7P 3BCAA 4FE7A 1QPIA 1FMWA 3K4KA 1G3SA 4BXFA 1IN5A 3WG7H 4IRHA 2ZMEA 3IAS2 5LEJA 3HOYJ 3JSJA 3I59A 1RESA 4BKXA 1D0XA 4E7LA 2ZJ2A 3I0TA 1WJFA 5L3DA 3S3MA 2JA8J 4HV6A 1HOMA 4HNTA 2LKPA 1JI8A 1MIJA 2ELHA 2L01A 3G56A 3B6CA 4HZFA 2L0KA 1D8JA 2JA2A 1HCRA 2QEXI 4XRMA 1WI9A 1K61A 4V2FA 4BU2A 1BBYA 5EYRA 1FP2A 1ULYA 3IUVA 1Y0NA 3OS1A 2F4IA 1Y8QB 4QPOA 2JPBA 5M5YJ 1OQYA 1NK2P 2V1XA 1S6LA 3S1RJ 4OWRB 2ZCNA 3HDDA 3LAPA 4L18B 3V8JA 3OIOA 1ZAOA 3PPBA 3FZVA 1PVEA 1UHWA 3B81A 2DT7B 2HKOA 2L9SA 2NP3A 5FD6A 2LSOA 3SZTA 3K2AA 2EA4A 2DYSH 3V7SA 4BY1J 2HPMA 1DGWY 1DU0A 3BPXA 4CHUA 3DCFA 3JSOA 3Q3SA 1QBJA 1TNTA 4A6DA 1W7PA 5E1WA 1QQIA 3UNGC 1FOKA 2D6YA 2E1MB 4QLCU 3FX3A 4RLFA 5FRNA 1X1PA 3V8LA 2DDBA 1BW5A 4Y13A 2E1MC 2NVYJ 2XDNA 2OU2A 4BHBA 4FE4A 5A2QK 3WHBA 2WGBA 3OY9A 3WU1B 4DQ2A 1RPWA 3HGYA 4I99C 1TW3A 1BN5A 3A0BC 3MNLA 2A05A 1D3YA 2OQRA 4MQVA 2VOPA 1G2HA 1GVJA 3NEUA 2PQ8A 4I0AA 1S7EA 3JRDA 3NS4A 3O8HA 2AO9A 2LY2A 4CCKA 4B1RA 2E7WA 3H5AA 4Y3OA 1R7JA 3KIOA 4ZDOA 1X3WB 4OIOF 3PASA 2OA4A 4BH9A 1K4SA 3BG9A 3E1SA 3FXJA 2UXXA 4GFKA 1E3OC 2DA3A 1LNWA 5DD8A 3QODA 2DMNA 4PJ0C 1LE8B 1RI7A 2IVMA 3ABKH 1YW8A 2RQPA 2TCTA 3KNWA 1S72I 2A5YB 2ECCA 5HS7A 1WJAA 5D6EA 1JXSA 5D6FA 4JKZA 4CGZA 2R7SA 4ESBA 3KYDB 3Q0VA 1XTAA 5BNGA 1USSA 2V9PA 3TBIA 3EPZA 4Q48A 2MLKA 2E2IJ 4L0YB 2RASA 2OERA 3E7LA 2ZY9A 3MZHA 1MDMB 2CQ7A 3OL4A 3RKXA 3KP4A 1F9NA 2VXDA 4Y7NJ 2GXAA 2L4MA 5IOYA 1E3HA 4UNOA 4ICHA 3CP2A 1PYVA 3GO5A 5ERIA 4E7SA 3E3VA 5GP9A 4KNYA 2COMA 2NVXJ 3LJLA 3VYTB 3GX4X 4HSTA 2NVUB 3AQSA 1ETXA 2HXIA 3VSKA 5DV5A 4CGRA 5EZGA 2R7ZJ 4B44A 3FXKA 1UG0A 2DMPA 1TT5B 1TQMA 2L02A 1FTZA 3CMAI 1H9GA 1B1BA 1ETKA 4HEA2 2WAQN 3P9CA 2UXIA 5K7ZA 3HRTA 2DK8A 3ANPA 1QO0D 3QPHA 2MD5A 2IS4A 3AAFA 4N0BA 2DI3A 4WWCA 2FBKA 2WB1N 2EFWA 1BR2A 2V57A 4BEHB 2LFBA 2KIFA 4V2GA 2R7RA 4M72A 1T95A 4EM2A 2ZXHA 2J5OA 4I7HA 1B72B 1RETA 1K6OA 5CQEA 1HF0A 3CJTB 4BE0A 4LITA 1KONA 5HLHA 5BMZA 4H4KC 4JOMA 1VZ0A 2DFFA 3ZMSA 2F5CA 2B7EA 2JRTA 3FMQA 2CQXA 2O7OA 1MMDA 2LP0A 3CLOA 5JFRA 2IT0A 4XKCA 3ZR8X 2R93J 2BHYA 2F2EA 3MN2A 1MW7A 5CVJA 3K7AJ 1YYVA 3NARA 4BS9A 1D5VA 2DOEA 2BW3A 2L7ZA 1IXCA 3W2WA 2Y48A 5IT9K 2X1DA 2CFOA 3BDDA 1J0RA 3BG6A 4DYRA 1YOVB 5L3CA 1N25A 2P5LC 1B6AA 1VQ6I 4MK6A 2ME6A 4ETSA 2PN6A 3QRFF 2H8WA 3FXQA 2R5ZA 3VW0A 4PGHA 1MMAA 3VPRA 4ZH4F 3MFKA 5M5XJ 4XIDA 2W85A 4IRGA 2KIUA 5LFAA 3OS0A 5HS9A 5LHIA 3ON4A 2IP2A 1FX7A 2XVCA 3Q9VA 2DT5A 1P7IA 2JSCA 4BJ6C 2K40A 4HPQA 1GUUA 2HQ5A 4D1QA 1I1GA 1Y39A 4RAYA 3I71A 2QENA 3VVZA 2HOTA 4A3FJ 2VT3A 1SD5A 2HQAA 3WTTC 1FSHA 1QVUA 5HLGA 2LR8A 1ENHA 2PMHA 2EILH 1S7AA 4U0VA 4CCOA 4U7BA 2OI8A 4A93J 3EQLF 3JRBA 1ZQ3P 1H88C 4CCJA 1YFHA 2VE8A 2HOSA 4LG0A 2KIQA 3J7ZI 1JHHA 3H3VK 1SFXA 3GF2A 3NAUA 3HSEA 3AG3H 5DTDA 2FQ4A 2MLGA 2ZSHB 4UVCA 2CV0A 4ZDLA 4F52A 2QTQA 2E36A 4GFBA 2W4SA 1WJCA 1E17A 3FDYA 2CH0A 3R61A 1H0MA 3ZMVA 3HRMA 4KIFA 2CU7A 2K3FA 2FQ3A 2EV5A 5A2QZ 2OF7A 3HUGB 1A6IA 2W57A 3DXJF 3CZ6A 3E6MA 5HOOA 1XG1A 2I10A 3KCCA 3BT9A 4B47A 3PO2J 4PSXA 1I6HJ 5J47A 3B6AA 2BOLA 2L9VA 3OV8A 5BOXA 2G7LA 3KZ9A 3K6GA 4NC8A 2B9SA 3F23A 2XGEA 1TQPA 2DODA 2NXNB 4A5MA 3RD3A 3V4GA 2VPRA 5CLSA 3FBIB 3OSGA 3C18A 2L7FP 4AU7A 3OS2A 3FXLA 3SZGA 3DKXA 2M0MA 1D1CA 1F43A 3CF5F 1EH7A 1DUXC 1SGMA 3H36A 4DYQA 4WX9A 2ESNA 2R3SA 2DN0A 1XS9A 3K4CA 5F64A 1U6GA 1HKTA 1LVAA 2MC3A 3DLAA 4UB8C 3BJOA 1XGMA 3F8BA 2L54A 2FJI1 2CRGA 4OAZA 4IHSA 2VC1A 2KRHA 5TISC 4FETA 1W4MA 4IF4A 4KIBA 5E8GA 1OR7A 2FJ1A 4YFKF 1EH6A 4A3JJ 3WU0A 5EF6A 4D0PA 1USTA 4EGZA 1ETYA 3E5QA 1IUFA 2Z99A 1MSFC 1XDUA 3OYFA 1QGPA 1T56A 4KUMA 1DP3A 3T5XA 2MG4A 4F91B 4R8HA 1IN8A 1W7PD 3D1NI 3ABUA 1Y0UA 1UI5A 2PI0A 3LSHA 3LSJA 1KQ0A 2IA2A 3MWMA 1DU6A 1N77A 2DBBA 2Z33A 1FOYA 3R6SA 4CA0A 1YG2A 3F3XA 2HDDA 3P9TA 2LBFA 3DU5A 1GVDA 2K7LA 4P55A 1SAXA 2Z1DA 3BR0A 5LRRA 1ZK8A 1X3ZB 3FF5A 3BJ6A 5CYVA 4BE2A 3M3YJ 4NQWB 2GBYA 4A69C 3WTUC 1IRGA 2REKA 3O8GA 3K9TA 4YZEA 2WAQA 1TWGJ 2Y31A 1VQOI 2C6YA 1B9NA 2HGCA 3FXRA 5DDGA 4M71A 4A3MJ 3VW2A 2WB1A 3S1NJ 5BQTA 4MEYF 4XKVA 1FZPB 1KGSA 4RM3A 1B4AA 2JRMA 2NOGA 2X0LA 1ZHFA 3VYUB 5K5RA 2QBYB 3HOUJ 9ANTA 2DG7A 3BRUA 4JL3A 1WKMA 3O3KA 2V79A 2KPMA 4ESFA 3H0GJ 2IW5A 4A3LJ 3BR3A 2EZKA 2P5KA 1X19A 3CCUI 3Q0UA 1ZG5A 3HE0A 2UZKA 4UUSB 3JTGA 3RIRA 2CMPA 2RNGA 3NXCA 3KEOA 2D2WA 1YIJI 4I98B 2JWTA 4HF2A 3P7NA 2B0LA 1TNSA 3BG5A 3VTIA 2XASA 3C2BA 1YRNB 5IT9Z 1X2NA 3RPQA 1U8RA 1U5TA 1XX5A 2G7GA 4UVBA 3EUPA 5B3SH 1O3SA 5ILSA 1SFKA 1YHQI 3HOZJ 2KJBA 2ICWG 3A2KA 2IPQX 1PUEE 3C7JA 2D5VA 1REPC 3D5RC 1YJWI 2VBYA 4G6QA 3GMEA 1HDDC 2JUGA 2QIBA 3ZMUA 4B43A 2JSPA 1AKHB 1IC8A 2CG4A 5JI6A 2CFXA 2EJRA 1MNMC 1BI0A 2A6HF 1LDKB 3G6EI 3C1DA 4XLAA 5EGOA 3KZYA 3LSGA 4KN4X 5J8FA 2M4KA 3KFWX 4B09A 1CF7A 3D0SA 1Q1HA 3MAJA 5L3FA 4IHXA 1ZLJA 4ME9A 3T1BA 2GIZA 4X0GA 5EG0B 1JUMA 1MZBA 1WI3A 2DK5A 2QA4I 4U7DA 3CO6C 4M9ZA 3CDHA 4LFUA 1D5YA 3AG4H 1ZGJA 3DV8A 3GFIA 5KCMA 5HDNA 1AWCA 3CUQC 3I56I 1P7JA 2DTZA 2XSJC 5F6FA 4CCNA 5LRSA 4ZTFA 4M3BA 3WE2A 2GZWA 2GA2A 3WTSC 1JKPC 2FOWA 3A01B 2COBA 3DU6A 1P4AA 2AQFA 5F0FA 4U0WA 2DQRA 2K9SA 5K5OA 1BC8C 1RUNA 1VF9A 1QA6A 3AKZA 4AIHA 5KVRA 4S0HB 2HZTA 3TEDA 1SVLA 2NNNA 1X4PA 1JHFA 1Q1VA 3DKYA 2XAFA 3Q5FA 1QU3A 2BHZA 4EM0B 4PUSA 1MBHA 4NC6A 2JVHA 1K78A 1IAWA 1ETOA 1XCBA 2Y0MA 2IJLA 2CV2A 5JVGF 3PO3J 4MIMA 3G73A 4FX4A 1OJLA 1RR8C 4RGRA 2E7XA 5BPDA 3VOKA 4FX0A 4QSHA 4S05A 1D1BA 3ZPLA 3S17J 3K10A 2FD5A 2XKOA 3GFJA 4WCGA 1BA5A 2KL4A 3AG2H 1G6NA 3HM5A 5K1YA 1Y1VJ 2CWEA 4FT8A 5ICGA 3K70D 1HW2A 5F27A 1DPRA 4RB2C 2VPLA 3H9JA 3PFYA 2HVSA 2XIGA 1R71A 3GZ6A 1HSTA 5CKTA 2A3SA 2CQKA 3MVPA 5D1RA 2A6TA 3JRHA 1LQ1A 3TO7A 3F9KA 2XRLA 4P1WA 3ZMZA 2GOMA 3H3ZA 5F0HA 2IGOA 2OQGA 2BV6A 5IP6A 3VUQA 4GCKA 1U78A 3CJDA 2VONA 4D9JA 2X4HA 3J7AY 1OCCH 2G7SA 3S1QJ 1G3WA 3LFUA 2VBXA 3CCVI 4NDLA 5CPRB 1J59A 3ABTA 3HB9A 3MKZA 5M3FJ 4IX7A 3KKDA 4UB6C 4M3EA 5LBQA 4W1UA 1W5CC 4HF1A 3CC7I 2JVGA 1JTYA 2F5FA 4BQNA 3FXOA 2M4GA 1BIAA 1HDPA 1ETQA 3WE3A 3I9V2 1HC8A 5CVRA 1BIBA 3MKWB 4R79A 4AC6A 4B4CA 2BBYA 2L2OA 4MFDA 3J80K 3DPUA 5FKNA 3HRUA 5FMPA 3OYKA 1HBXG 2OAZA 1IF1A 4A0YA 2IS6A 1N75A 3CCRI 2ME0A 2LG4A 3JSPA 5B1BH 3TW7A 3ON2A 3VYRB 1SAUA 4KYWA 3CUOA 4LB5A 4OIQF 5L3GA 2DYRH 5LGTA 1GV5A 4YIIA 1HA8A 3OYCA 1YW7A 1A35A 1T38A 2BXYA 2GM4A 2GUHA 5C4YA 1Z6RA 4C9YA 1KQ9A 2JJ7A 2KISA 2LYCA 4MTDA 2DA7A 3KYLA 1GHCA 2R7WA 3T8RA 2Z5UA 2CW7A 3MD2A 4D7MA 3W3CA 4AF5A 4YIRX 4A3BJ 3PFIA 4UV8A 3NRVA 1YS6A 2HYFA 2P7VB 2NNYA 2N8GA 3RKQA 1C0WA 4AVZA 1V3FA 2LD5A 5E3LA 3M1CA 2W00A 3SHFA 2F5VA 5ICEA 1JJ8C 1IGNA 2STTA 2O03A 2UXOA 3PM1A 3CD6I 3BQZA 1WVRA 3BTIA 2Q1ZB 1FJLA 2ISZA 3BJBA 2A5WA 2G3BA 1ZGAA 2W24A 2W84A 4LMYA 1W1WE 2Q2EA 3QOEA 2XAUA 1W36D 3MKLA 3GZNB 3TDUC 3IH2A 4FISA 3KP7A 3V6GA 4AIDA 2HQNA 2EWNA 3TO9A 3ZQFA 3KETA 4A12A 4XLNF 2CW0F 3HEFA 2QLZA 2XKPA 3KPHA 3G4SI 1AOYA 5GAHJ 1QVTA 2W48A 1LE8A 2WADA 3L09A 3GTGJ 1MJAA 3ZMDA 1UHSA 1SMYF 3ONQA 2HTSA 2F5EA 4LLLA 4BDZA 1Z67A 4JP0A 2DFEA 4BYYA 4YFXF 3CO7C 4BDYA 1ZRDA 1OMIA 3QYBA 1OLTA 4PSWA 2GENA 1RC9A 2CQNA 4DJAA 4UUVA 3TP3A 4EVIA 3BY6A 2K9QA 3KE2A 3ERMA 2E5ZA 1WJ5A 2R7XA 4PZJA 1R4NB 1Z91A 2VOOA 2RKHA 3QU3A 2V1NA 5DD4A 1Y1WJ 1BOBA 2K02A 2WY7Q 3LA7A 4MTEA 1L3LA 3IRRA 4X6AJ 3DEWA 3LQQA 2R7QA 2DFHA 3LSTA 1BI2A 3RKWA 4DZPA 1WJEA 2B1EA 3QKXA 2E1OA 3LSIA 1W0UA 3OOUA 3IC7A 3X2QH 2L7KA 5H20A 4NUBA 3PIPF 3BR6A 4E7HA 2EZLA 5FFZA 2E1CA 1SVOA 3ML6A 2M3AA 3H5RA 5K7FA 2R7OA 3G2BA 4X1EA 3BG3A 3OR1C 3VSLA 3K2ZA 2P8TA 1SFOJ 1YLFA 3RYRA 4CH7A 4HSRA 2FMYA 3LWFA 2GOXB 2K27A 4F55A 5K58A 4XLCA
chains in the Genus database with same CATH topology
2E19A 4D5CA 4HNVA 1WPKA 2DA1A 3M4OJ 1TWFJ 2ELKA 4A3FJ 2HOTA 3VVZA 2EBIA 1QVUA 2XGDA 2UXHA 3ZQLA 2LR8A 1ENHA 2O8KA 5FLMJ 3S14J 5HBUA 2H8RA 2OI8A 5FKKA 1ETWA 2DA6A 3BTJA 3SFIA 1CQTA 4A93J 3JRBA 1ZQ3P 1H88C 1IDYA 3COLA 2ECBA 2HOSA 3HTHA 2YVEA 2P81A 3HTIA 1MH4A 2R5YB 3H3VK 5EDNA 4JX5A 3NAUA 3O60A 3G1OA 3F1BA 5CXIA 5F04A 4D7NA 1JT0A 5DTDA 1WH7A 2FQ4A 1F36A 3RZOJ 2QTQA 3G1LA 4GFBA 3VVYA 3G1MA 4QIWN 2QCOA 2KT0A 2CU7A 1JKRC 2OF7A 2VKVA 3VW1A 2NX4A 1A6IA 5JLXA 2NS8A 5FLVA 2Y2ZA 1A5JA 4UDSA 1XG1A 2I10A 5K7HA 2XB0X 3NRGA 2MW8A 3BT9A 3PO2J 3ZOBA 1I6HJ 2JA6J 1MH3A 5J1UA 1ORKA 3B6AA 3LSPA 3LOCA 4ACIA 2G7LA 3KZ9A 2ZCMA 1IDZA 5M3MJ 2XGEA 2B63J 5FHPA 3L1PA 3RD3A 2VPRA 3JR9A 1TC3C 5E3OA 4QTRA 4JX4A 3OSGA 1OCPA 5HSZA 2L7FP 1F43A 1SGMA 1MBJA 4DYQA 3TP0A 2QKOA 2ID3A 2UXPA 2DN0A 2Y0SN 1XS9A 4DZJA 2CQQA 5D18A 2MGQA 2ZOZA 1IJWC 2CRGA 2EZHA 3BNIA 3S15J 5EZHA 4JNNA 2FJ1A 4A3JJ 5FKOA 5E3NA 2DG8A 5EF6A 3SJMA 2KDZA 1ETYA 1IUFA 5GPAA 3RQIA 1FTTA 2IAIA 2YUSA 3BTLA 1MSFC 3A03A 1NTCA 1T56A 2VUMJ 2XGCA 4AC0A 4Y52J 3HGGA 2ZB9A 1W0TA 2MG4A 1WCMJ 4NELA 2IU5A 1MSEC 3LWJA 2R5YA 3D1NI 4A3EJ 1FIPA 1ETVA 4M3FA 1FIAA 1UI5A 1B8IA 4D5FA 2E2HJ 3GEUA 5C4XJ 3LSJA 2JK3A 1R9TJ 3ANGA 1DU6A 2M2EA 3BTCA 4W97A 2LVSA 1JTXA 2HDDA 3P9TA 4KWAA 2OPTA 3FK6A 1Z77A 3SDGA 1GVDA 2HYJA 3S2HJ 4GFLA 3GBGA 3BR0A 1ZK8A 3M3YJ 2WUIA 2GBYA 2HKUA 3KKCA 4A69C 2REKA 3O8GA 5CW8A 1MBKA 3NNRA 4MXMA 3BQYA 1BJZA 2DMTA 4YZEA 1TWGJ 1O4XA 2Y31A 3I4MJ 4CYCB 3E7QA 3S16J 4RBOA 5J1RA 4A3MJ 1JUPA 3AQTA 3VW2A 2VKEA 3S1NJ 4C3JJ 4ABZA 2PMZN 3CQZJ 3IH4A 5EFYA 3BHQA 2NOGA 3TW6A 9ANTA 2DG7A 3HOUJ 4JL3A 2LY9A 3LHQA 3BRUA 1U8BA 2M34A 3H0GJ 3QBMA 1B72A 3FK7A 1MBEA 4A3LJ 3BR3A 2EZKA 5DS9A 2HOAA 3VIBA 1GV2A 3HOWJ 5JLWA 2W53A 2G0EA 5EEAA 3GTMJ 3Q0UA 2XPWA 3HE0A 1POGA 3FKIJ 1UI6A 4UUSB 4LOCA 2CUEA 3S1MJ 2QF7A 1BL0A 1ZKGA 3NXCA 2DMQA 5DAJA 2JWTA 5E3MA 2NVTJ 1RKTA 4M3GA 3QPSA 3BG5A 2HI3A 3C2BA 1YRNB 1JGGA 3GZIA 2HXOA 5H9TA 1X2NA 3CMYA 3V78A 1U9NA 1WGXA 2DMUA 2G7GA 3EUPA 2WV1A 4PXIA 3IH3A 1QRYA 3HOZJ 5D19A 2NP5A 1OFCX 2XPUA 3NPIA 2QOPA 2YU9J 1TWAJ 3VOXA 4FTHA 5C3EJ 2D5VA 5HAWA 3W6VA 4A3IJ 3S5RA 4RDUA 2JA5J 1APLC 3WHCA 1HDDC 2QIBA 3HTJA 2DA2A 3QQAA 1AKHB 1IC8A 3EGQA 1SANA 1BW6A 2H1KA 4XK4A 1MNMC 1ZR2A 1H89C 5IYBJ 5IOZA 3BR2A 5HODA 5EGOA 3JRAA 2IBDA 3HKZN 3LSGA 3S2DJ 4GCLA 4CYCA 2R92J 3DPJA 1WH5A 2ZCXA 5IYCJ 2YVHA 1UG2A 4IHXA 3NI7A 4ME9A 1JUSA 1NK3P 4MLOA 5EG0B 1JUMA 1WI3A 1VI0A 2CUFA 4FE7A 1K83J 1QPIA 4JX6A 3C07A 3JRFA 1D5YA 3HOYJ 3JSJA 1RESA 4BKXA 5C4JJ 3VVXA 2JN6A 4IHWA 4NN1A 1P7JA 2DTZA 2JA8J 4UUSA 3FIWA 4M3BA 1HOMA 5FKLA 5FKMA 4HKUA 4A3CJ 3BR1A 4J19A 1JKPC 3A01B 2M0CA 2COBA 5FJ8J 5F0FA 3G56A 3B6CA 2K9SA 5IYDJ 1RR7A 2L0KA 4AUXA 2UXUA 1HCRA 1VF9A 1PUFB 2XSDC 4XRMA 1K61A 4V2FA 4S0HB 5EYRA 3IV5A 3TEDA 3HBLA 5J3LA 4MO7A 4IHVA 3IUVA 1Q1VA 4I6ZA 4BBSJ 4G12A 5M5YJ 1MBHA 2K9NA 1NK2P 2L9RA 2ZOYA 1ETOA 2ID6A 3S1RJ 3VP5A 5F0CA 2ZCNA 4XRSG 3HDDA 3OSFA 3JRCA 1OCTC 3OIOA 2DA5A 3QPLA 3PPBA 2QWTA 3PO3J 1ITYA 4MIMA 3B81A 4GCTA 1AKHA 1OJLA 2NP3A 1X2MA 3K2AA 4BXXJ 3VOKA 4QSHA 2L7MP 3ZQGA 4BY1J 3S17J 2FD5A 3A02A 1BA5A 1DU0A 2R0QC 3BR5A 3DCFA 3HM5A 2LLKA 1VNDA 1Y1VJ 3Q3SA 5F08A 1TWCJ 2GLOA 5F27A 3LNQA 3GTQJ 2D6YA 2Q24A 1LFBA 3GTPJ 1UMQA 4XICA 1BW5A 2NVYJ 2VI6A 2XDNA 2WGBA 3MVPA 4FE4A 3WHBA 3LSRA 1U9OA 3JRHA 5D1RA 3CWRA 1RPWA 1XC5A 3HGYA 5EG0A 2XRLA 2LK2A 5F0HA 5IP6A 3MNLA 2F07A 3VUQA 4GCKA 2PZ9A 1U78A 3CJDA 1VFCA 1G2HA 4C2MJ 2G7SA 3S1QJ 2MSYA 5C44J 2FX0A 5FGLA 1IV6A 4NDLA 5IPAA 3HB9A 5GPCA 5M3FJ 2Y9ZA 4DYCA 1GT0C 1S7EA 2X48A 3JRDA 4A3DJ 1IRZA 3O8HA 3KKDA 2AO9A 4M3EA 4W1UA 4B1RA 1JTYA 3A01A 3I4NJ 2HYTA 5J1YA 1I3QJ 3PASA 2EH3A 3HOXJ 3BG9A 1HDPA 1ETQA 2NVQJ 2DA4A 4GFKA 1E3OC 2DA3A 4AC6A 4B4CA 2DMNA 4MFDA 1LE8B 5FKNA 4A3KJ 5FMPA 1JT6A 1PUFA 4A3GJ 2TCTA 3KNWA 3ZQIA 4IHYA 3FRQA 2ECCA 1ZGWA 3JRIA 2ME0A 4JKZA 1TWHJ 3CDLA 2DJNA 3TW7A 3Q0VA 2X9DA 4M3DA 5BNGA 3ON2A 1MBFA 2CJJA 1GV5A 4IEJA 2E2IJ 2GM4A 2GUHA 2OERA 2RASA 5C4YA 3E7LA 1B8IB 2JJ7A 2DA7A 3ZQHA 4Y7NJ 3JRGA 2EQRA 1H8AC 5IOYA 4C3HJ 4D7MA 4B3AA 4ICHA 4AF5A 2Y30A 4A3BJ 1ZTRA 2EZIA 5GP9A 1HLVA 3RZDJ 2NVXJ 2R5ZB 1MBGA 1JJ6C 3LJLA 2N8GA 1IG7A 3T6NA 3RKQA 2LD5A 5E3LA 3AQSA 1ZR4A 2E2JJ 1LFUP 1ETXA 2HXIA 4CGRA 5EZGA 2R7ZJ 3G7RA 2XPVA 1JJ8C 3GTOJ 2DMPA 3CCYA 4FCYA 3JREA 2IEKA 1IGNA 2UXOA 4M6VA 4JYKA 2O7TA 3PM1A 3HOVJ 3Q0WA 3BQZA 5M5WJ 1FTZA 3BTIA 2AHQA 2XB5A 1FJLA 2JA7J 3BJBA 5AQCA 2G3BA 5CXGA 1ETKA 2WAQN 5F1JA 2UXIA 5K7ZA 3ANPA 3MKLA 3IH2A 4DW6A 4FISA 3V6GA 2TRTA 2WB1N 2V57A 3ZQFA 2LFBA 4V2GA 3GTKJ 1YRNA 3HIMA 1I50J 3HEFA 1B72B 1RETA 2RAEA 1HF0A 2FBQA 1QVTA 2M9HA 2W48A 1LE8A 1AU7A 4EEFG 3GTGJ 1UHSA 4I76A 4AYBN 2GFNA 2LKXA 3HTAA 3BCGA 4JP0A 2GENA 2CQXA 2O7OA 2YS9A 1Z0XA 2LP0A 3TP3A 3UKGA 2K9QA 2R93J 1FEXA 3MN2A 3K7AJ 3NARA 3GTLJ 2L7ZA 2O9LA 1Y1WJ 2PBXA 1JKQC 1GDTA 4X6AJ 4DYRA 3DEWA 1JKOC 4MK6A 2ME6A 4DZPA 3QKXA 5IP7J 1X58A 2E1OA 4XRSA 3OOUA 1W0UA 2R5ZA 4L62A 3VW0A 3BR6A 3VPRA 2EZLA 2RHAA 5M5XJ 3F0CA 4XIDA 4BBRJ 5K7FA 4MFEA 3ON4A 1RKWA 3CRJA 4X1EA 2Y9YA 3BG3A 3RH2A 5IP9J 1EF4A 2X6OA 3GTJJ 4BY7J 1SFOJ 1P7IA 4C3IJ 5EGOB 2K40A 4UUTA 4L5EA 2NS7A 1GUUA 1T33A 2HQ5A 3ZQCA 3FISA 2M8GX 5K58A 2LTPA 1AHDP 2JMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E19 A;  4D5C A;  4HNV A;  1WPK A;  2DA1 A;  3M4O J;  1TWF J;  2ELK A;  4A3F J;  2HOT A;  3VVZ A;  2EBI A;  1QVU A;  2XGD A;  2UXH A;  3ZQL A;  2LR8 A;  1ENH A;  2O8K A;  5FLM J;  3S14 J;  5HBU A;  2H8R A;  2OI8 A;  5FKK A;  1ETW A;  2DA6 A;  3BTJ A;  3SFI A;  1CQT A;  4A93 J;  3JRB A;  1ZQ3 P;  1H88 C;  1IDY A;  3COL A;  2ECB A;  2HOS A;  3HTH A;  2YVE A;  2P81 A;  3HTI A;  1MH4 A;  2R5Y B;  3H3V K;  5EDN A;  4JX5 A;  3NAU A;  3O60 A;  3G1O A;  3F1B A;  5CXI A;  5F04 A;  4D7N A;  1JT0 A;  5DTD A;  1WH7 A;  2FQ4 A;  1F36 A;  3RZO J;  2QTQ A;  3G1L A;  4GFB A;  3VVY A;  3G1M A;  4QIW N;  2QCO A;  2KT0 A;  2CU7 A;  1JKR C;  2OF7 A;  2VKV A;  3VW1 A;  2NX4 A;  1A6I A;  5JLX A;  2NS8 A;  5FLV A;  2Y2Z A;  1A5J A;  4UDS A;  1XG1 A;  2I10 A;  5K7H A;  2XB0 X;  3NRG A;  2MW8 A;  3BT9 A;  3PO2 J;  3ZOB A;  1I6H J;  2JA6 J;  1MH3 A;  5J1U A;  1ORK A;  3B6A A;  3LSP A;  3LOC A;  4ACI A;  2G7L A;  3KZ9 A;  2ZCM A;  1IDZ A;  5M3M J;  2XGE A;  2B63 J;  5FHP A;  3L1P A;  3RD3 A;  2VPR A;  3JR9 A;  1TC3 C;  5E3O A;  4QTR A;  4JX4 A;  3OSG A;  1OCP A;  5HSZ A;  2L7F P;  1F43 A;  1SGM A;  1MBJ A;  4DYQ A;  3TP0 A;  2QKO A;  2ID3 A;  2UXP A;  2DN0 A;  2Y0S N;  1XS9 A;  4DZJ A;  2CQQ A;  5D18 A;  2MGQ A;  2ZOZ A;  1IJW C;  2CRG A;  2EZH A;  3BNI A;  3S15 J;  5EZH A;  4JNN A;  2FJ1 A;  4A3J J;  5FKO A;  5E3N A;  2DG8 A;  5EF6 A;  3SJM A;  2KDZ A;  1ETY A;  1IUF A;  5GPA A;  3RQI A;  1FTT A;  2IAI A;  2YUS A;  3BTL A;  1MSF C;  3A03 A;  1NTC A;  1T56 A;  2VUM J;  2XGC A;  4AC0 A;  4Y52 J;  3HGG A;  2ZB9 A;  1W0T A;  2MG4 A;  1WCM J;  4NEL A;  2IU5 A;  1MSE C;  3LWJ A;  2R5Y A;  3D1N I;  4A3E J;  1FIP A;  1ETV A;  4M3F A;  1FIA A;  1UI5 A;  1B8I A;  4D5F A;  2E2H J;  3GEU A;  5C4X J;  3LSJ A;  2JK3 A;  1R9T J;  3ANG A;  1DU6 A;  2M2E A;  3BTC A;  4W97 A;  2LVS A;  1JTX A;  2HDD A;  3P9T A;  4KWA A;  2OPT A;  3FK6 A;  1Z77 A;  3SDG A;  1GVD A;  2HYJ A;  3S2H J;  4GFL A;  3GBG A;  3BR0 A;  1ZK8 A;  3M3Y J;  2WUI A;  2GBY A;  2HKU A;  3KKC A;  4A69 C;  2REK A;  3O8G A;  5CW8 A;  1MBK A;  3NNR A;  4MXM A;  3BQY A;  1BJZ A;  2DMT A;  4YZE A;  1TWG J;  1O4X A;  2Y31 A;  3I4M J;  4CYC B;  3E7Q A;  3S16 J;  4RBO A;  5J1R A;  4A3M J;  1JUP A;  3AQT A;  3VW2 A;  2VKE A;  3S1N J;  4C3J J;  4ABZ A;  2PMZ N;  3CQZ J;  3IH4 A;  5EFY A;  3BHQ A;  2NOG A;  3TW6 A;  9ANT A;  2DG7 A;  3HOU J;  4JL3 A;  2LY9 A;  3LHQ A;  3BRU A;  1U8B A;  2M34 A;  3H0G J;  3QBM A;  1B72 A;  3FK7 A;  1MBE A;  4A3L J;  3BR3 A;  2EZK A;  5DS9 A;  2HOA A;  3VIB A;  1GV2 A;  3HOW J;  5JLW A;  2W53 A;  2G0E A;  5EEA A;  3GTM J;  3Q0U A;  2XPW A;  3HE0 A;  1POG A;  3FKI J;  1UI6 A;  4UUS B;  4LOC A;  2CUE A;  3S1M J;  2QF7 A;  1BL0 A;  1ZKG A;  3NXC A;  2DMQ A;  5DAJ A;  2JWT A;  5E3M A;  2NVT J;  1RKT A;  4M3G A;  3QPS A;  3BG5 A;  2HI3 A;  3C2B A;  1YRN B;  1JGG A;  3GZI A;  2HXO A;  5H9T A;  1X2N A;  3CMY A;  3V78 A;  1U9N A;  1WGX A;  2DMU A;  2G7G A;  3EUP A;  2WV1 A;  4PXI A;  3IH3 A;  1QRY A;  3HOZ J;  5D19 A;  2NP5 A;  1OFC X;  2XPU A;  3NPI A;  2QOP A;  2YU9 J;  1TWA J;  3VOX A;  4FTH A;  5C3E J;  2D5V A;  5HAW A;  3W6V A;  4A3I J;  3S5R A;  4RDU A;  2JA5 J;  1APL C;  3WHC A;  1HDD C;  2QIB A;  3HTJ A;  2DA2 A;  3QQA A;  1AKH B;  1IC8 A;  3EGQ A;  1SAN A;  1BW6 A;  2H1K A;  4XK4 A;  1MNM C;  1ZR2 A;  1H89 C;  5IYB J;  5IOZ A;  3BR2 A;  5HOD A;  5EGO A;  3JRA A;  2IBD A;  3HKZ N;  3LSG A;  3S2D J;  4GCL A;  4CYC A;  2R92 J;  3DPJ A;  1WH5 A;  2ZCX A;  5IYC J;  2YVH A;  1UG2 A;  4IHX A;  3NI7 A;  4ME9 A;  1JUS A;  1NK3 P;  4MLO A;  5EG0 B;  1JUM A;  1WI3 A;  1VI0 A;  2CUF A;  4FE7 A;  1K83 J;  1QPI A;  4JX6 A;  3C07 A;  3JRF A;  1D5Y A;  3HOY J;  3JSJ A;  1RES A;  4BKX A;  5C4J J;  3VVX A;  2JN6 A;  4IHW A;  4NN1 A;  1P7J A;  2DTZ A;  2JA8 J;  4UUS A;  3FIW A;  4M3B A;  1HOM A;  5FKL A;  5FKM A;  4HKU A;  4A3C J;  3BR1 A;  4J19 A;  1JKP C;  3A01 B;  2M0C A;  2COB A;  5FJ8 J;  5F0F A;  3G56 A;  3B6C A;  2K9S A;  5IYD J;  1RR7 A;  2L0K A;  4AUX A;  2UXU A;  1HCR A;  1VF9 A;  1PUF B;  2XSD C;  4XRM A;  1K61 A;  4V2F A;  4S0H B;  5EYR A;  3IV5 A;  3TED A;  3HBL A;  5J3L A;  4MO7 A;  4IHV A;  3IUV A;  1Q1V A;  4I6Z A;  4BBS J;  4G12 A;  5M5Y J;  1MBH A;  2K9N A;  1NK2 P;  2L9R A;  2ZOY A;  1ETO A;  2ID6 A;  3S1R J;  3VP5 A;  5F0C A;  2ZCN A;  4XRS G;  3HDD A;  3OSF A;  3JRC A;  1OCT C;  3OIO A;  2DA5 A;  3QPL A;  3PPB A;  2QWT A;  3PO3 J;  1ITY A;  4MIM A;  3B81 A;  4GCT A;  1AKH A;  1OJL A;  2NP3 A;  1X2M A;  3K2A A;  4BXX J;  3VOK A;  4QSH A;  2L7M P;  3ZQG A;  4BY1 J;  3S17 J;  2FD5 A;  3A02 A;  1BA5 A;  1DU0 A;  2R0Q C;  3BR5 A;  3DCF A;  3HM5 A;  2LLK A;  1VND A;  1Y1V J;  3Q3S A;  5F08 A;  1TWC J;  2GLO A;  5F27 A;  3LNQ A;  3GTQ J;  2D6Y A;  2Q24 A;  1LFB A;  3GTP J;  1UMQ A;  4XIC A;  1BW5 A;  2NVY J;  2VI6 A;  2XDN A;  2WGB A;  3MVP A;  4FE4 A;  3WHB A;  3LSR A;  1U9O A;  3JRH A;  5D1R A;  3CWR A;  1RPW A;  1XC5 A;  3HGY A;  5EG0 A;  2XRL A;  2LK2 A;  5F0H A;  5IP6 A;  3MNL A;  2F07 A;  3VUQ A;  4GCK A;  2PZ9 A;  1U78 A;  3CJD A;  1VFC A;  1G2H A;  4C2M J;  2G7S A;  3S1Q J;  2MSY A;  5C44 J;  2FX0 A;  5FGL A;  1IV6 A;  4NDL A;  5IPA A;  3HB9 A;  5GPC A;  5M3F J;  2Y9Z A;  4DYC A;  1GT0 C;  1S7E A;  2X48 A;  3JRD A;  4A3D J;  1IRZ A;  3O8H A;  3KKD A;  2AO9 A;  4M3E A;  4W1U A;  4B1R A;  1JTY A;  3A01 A;  3I4N J;  2HYT A;  5J1Y A;  1I3Q J;  3PAS A;  2EH3 A;  3HOX J;  3BG9 A;  1HDP A;  1ETQ A;  2NVQ J;  2DA4 A;  4GFK A;  1E3O C;  2DA3 A;  4AC6 A;  4B4C A;  2DMN A;  4MFD A;  1LE8 B;  5FKN A;  4A3K J;  5FMP A;  1JT6 A;  1PUF A;  4A3G J;  2TCT A;  3KNW A;  3ZQI A;  4IHY A;  3FRQ A;  2ECC A;  1ZGW A;  3JRI A;  2ME0 A;  4JKZ A;  1TWH J;  3CDL A;  2DJN A;  3TW7 A;  3Q0V A;  2X9D A;  4M3D A;  5BNG A;  3ON2 A;  1MBF A;  2CJJ A;  1GV5 A;  4IEJ A;  2E2I J;  2GM4 A;  2GUH A;  2OER A;  2RAS A;  5C4Y A;  3E7L A;  1B8I B;  2JJ7 A;  2DA7 A;  3ZQH A;  4Y7N J;  3JRG A;  2EQR A;  1H8A C;  5IOY A;  4C3H J;  4D7M A;  4B3A A;  4ICH A;  4AF5 A;  2Y30 A;  4A3B J;  1ZTR A;  2EZI A;  5GP9 A;  1HLV A;  3RZD J;  2NVX J;  2R5Z B;  1MBG A;  1JJ6 C;  3LJL A;  2N8G A;  1IG7 A;  3T6N A;  3RKQ A;  2LD5 A;  5E3L A;  3AQS A;  1ZR4 A;  2E2J J;  1LFU P;  1ETX A;  2HXI A;  4CGR A;  5EZG A;  2R7Z J;  3G7R A;  2XPV A;  1JJ8 C;  3GTO J;  2DMP A;  3CCY A;  4FCY A;  3JRE A;  2IEK A;  1IGN A;  2UXO A;  4M6V A;  4JYK A;  2O7T A;  3PM1 A;  3HOV J;  3Q0W A;  3BQZ A;  5M5W J;  1FTZ A;  3BTI A;  2AHQ A;  2XB5 A;  1FJL A;  2JA7 J;  3BJB A;  5AQC A;  2G3B A;  5CXG A;  1ETK A;  2WAQ N;  5F1J A;  2UXI A;  5K7Z A;  3ANP A;  3MKL A;  3IH2 A;  4DW6 A;  4FIS A;  3V6G A;  2TRT A;  2WB1 N;  2V57 A;  3ZQF A;  2LFB A;  4V2G A;  3GTK J;  1YRN A;  3HIM A;  1I50 J;  3HEF A;  1B72 B;  1RET A;  2RAE A;  1HF0 A;  2FBQ A;  1QVT A;  2M9H A;  2W48 A;  1LE8 A;  1AU7 A;  4EEF G;  3GTG J;  1UHS A;  4I76 A;  4AYB N;  2GFN A;  2LKX A;  3HTA A;  3BCG A;  4JP0 A;  2GEN A;  2CQX A;  2O7O A;  2YS9 A;  1Z0X A;  2LP0 A;  3TP3 A;  3UKG A;  2K9Q A;  2R93 J;  1FEX A;  3MN2 A;  3K7A J;  3NAR A;  3GTL J;  2L7Z A;  2O9L A;  1Y1W J;  2PBX A;  1JKQ C;  1GDT A;  4X6A J;  4DYR A;  3DEW A;  1JKO C;  4MK6 A;  2ME6 A;  4DZP A;  3QKX A;  5IP7 J;  1X58 A;  2E1O A;  4XRS A;  3OOU A;  1W0U A;  2R5Z A;  4L62 A;  3VW0 A;  3BR6 A;  3VPR A;  2EZL A;  2RHA A;  5M5X J;  3F0C A;  4XID A;  4BBR J;  5K7F A;  4MFE A;  3ON4 A;  1RKW A;  3CRJ A;  4X1E A;  2Y9Y A;  3BG3 A;  3RH2 A;  5IP9 J;  1EF4 A;  2X6O A;  3GTJ J;  4BY7 J;  1SFO J;  1P7I A;  4C3I J;  5EGO B;  2K40 A;  4UUT A;  4L5E A;  2NS7 A;  1GUU A;  1T33 A;  2HQ5 A;  3ZQC A;  3FIS A;  2M8G X;  5K58 A;  2LTP A;  1AHD P;  2JMW A; 
#chains in the Genus database with same CATH topology
 2XV4 S;  3M07 A;  1WPK A;  2DA1 A;  3ABM H;  5D5V B;  2WBM A;  2ISY A;  4DGW B;  2EBI A;  4Q47 A;  1BI1 A;  3M1E A;  4MHG A;  1X1B A;  2UXH A;  2O8K A;  1XCV A;  3I59 B;  3HYI A;  5ICC A;  2H6B A;  4HX7 A;  4OD5 A;  1YO5 C;  1Z3X A;  1FOW A;  1ETW A;  3WG9 A;  1FSE A;  2AXL A;  3SFI A;  1CQT A;  1PJR A;  3K1M A;  2JQ7 A;  1IDY A;  3IUO A;  3CCJ I;  4XSZ F;  5D8L B;  1FC3 A;  2H94 A;  3T0Y A;  4NBQ A;  1MH4 A;  2R5Y B;  4BJT A;  4A5N A;  3G1O A;  4IXA A;  2FRH A;  5F04 A;  1JT0 A;  1QPM A;  1Z6T A;  4BXU A;  1F36 A;  4UY8 I;  2J5P A;  3G1L A;  3VVY A;  1V5F A;  2CYY A;  3G1M A;  2QCO A;  1Z7U A;  4XLF A;  2PJP A;  2P6T A;  1JKR C;  5FRO A;  3W6J B;  4PK4 A;  3VW1 A;  3RDI A;  5JLX A;  4XN0 A;  2UV1 A;  1A5J A;  3PNT A;  1GXQ A;  4RA2 A;  2FXA A;  2XB0 X;  3NRG A;  2BY1 A;  2MW8 A;  4BHP A;  5LLQ A;  4ESJ A;  3LSK A;  2JA6 J;  1MH3 A;  5J1U A;  1ORK A;  2PMU A;  3LSP A;  3LOC A;  4HLX A;  3GUD A;  1F5T A;  1IDZ A;  3DEU A;  5M3M J;  4AIJ A;  3M9A A;  1OYY A;  5CVI A;  4WF2 A;  4ANJ A;  5FHP A;  3U9G A;  2K86 A;  4OOI A;  1P4X A;  5KAI C;  4JX4 A;  2PBI A;  1VQK I;  2M7B A;  4HRI A;  2AXT C;  2HPI A;  5HS8 A;  4LK0 F;  4C30 A;  3J80 Z;  2QKO A;  2ID3 A;  2UXP A;  1LUJ B;  2Y0S N;  4U88 A;  2BEO A;  1XMX A;  5HNH A;  5D18 A;  1G8X A;  2WTE A;  3VOE A;  3QP5 A;  2BYV E;  2YU3 A;  3SQN A;  3HL2 A;  4HQE A;  3DBH B;  3DF8 A;  1ODD A;  4YEJ A;  2OD5 A;  2V9V A;  4OU0 A;  4IOC F;  5EZH A;  2VC0 A;  1Y8R B;  1TTY A;  5FKO A;  2KDO A;  4ZYH A;  2QZ8 A;  4CXF A;  2DG8 A;  5E17 F;  1YIT I;  2DPD A;  2HDC A;  2MFZ A;  2ELJ A;  2IAI A;  3A03 A;  1NTC A;  3BC8 A;  3L2U A;  2XGC A;  5E1X A;  4XN3 A;  2VUM J;  4G9Y A;  3H0D A;  2IU5 A;  3LWJ A;  2XDV A;  2XF5 A;  4A3E J;  4KDP A;  1QZE A;  1FIP A;  3HZJ A;  4M3F A;  4LB6 B;  1B8I A;  2EK5 A;  2ZBK A;  2E2H J;  3GEU A;  4U0Y A;  2IRF G;  2JK3 A;  2O6G E;  3SDB A;  2M1B A;  1IRF A;  4HOB A;  3ULQ B;  2M2E A;  3BTC A;  3BOQ A;  1JTX A;  2OTL I;  3T8T A;  4I0B A;  3GLX A;  5D4S A;  4KWA A;  3VFZ A;  3FK6 A;  4ZDP A;  2NS0 A;  3HUG A;  1P6R A;  3ZCO A;  2DW4 A;  3S2H J;  3HPH A;  4IOA F;  3SZP A;  1Z05 A;  4FHT A;  2ZC2 A;  1XGO A;  2F5D A;  2MH2 A;  4P9F A;  3LSM A;  2R7V A;  2KHM A;  3MEX A;  2FU4 A;  2H6C A;  2HKU A;  3KKC A;  2QQ8 A;  1X1A A;  1TLH B;  2EIJ H;  3NNR A;  1I27 A;  4C2U A;  2DMT A;  3QU6 A;  1O4X A;  1KA8 A;  3AG1 H;  3I4M J;  4HF0 A;  4CYC B;  4BGD A;  3CMM A;  3EUH A;  3OYE A;  2X51 A;  5DCM A;  3BZC A;  4C3J J;  4EMS A;  2XGX A;  3O6B B;  2K9M A;  4ABZ A;  2FNP A;  2BVL A;  1S29 A;  1LJ9 A;  5BS6 A;  3LHQ A;  4E7Z A;  5TGT A;  4WIB A;  1R1V A;  3OYG A;  1P2F A;  3QBM A;  5JR3 A;  1MBE A;  3A0H C;  3MQ0 A;  1R36 A;  2OTJ I;  3HOW J;  2W53 A;  2G0E A;  3GTM J;  3GWZ A;  2HEO A;  3FKI J;  2I5U A;  1WWX A;  2KLO A;  3P9I A;  2HR3 A;  1RKT A;  5GTH C;  4M3G A;  3R0J A;  3RI4 A;  3OOP A;  1X4O A;  2VOD A;  1JGG A;  3HG9 A;  2HXO A;  4HQM A;  2LF7 A;  4EJT A;  3GZI A;  4B8X A;  1DGR M;  4OD4 A;  3L2R A;  1U0J A;  2IA1 A;  5ICF A;  2ZJQ F;  2NYX A;  1IUY A;  2EIN H;  2DO7 A;  3GLL A;  1T0F A;  4PXI A;  3IH3 A;  4BQA A;  3PL8 A;  2BGC A;  4JK1 X;  3H92 A;  2NP5 A;  1O7F A;  1OFC X;  3NPI A;  2QOP A;  3V42 A;  1BM9 A;  4FTH A;  2X1C A;  5DEQ A;  3S5R A;  2K3P A;  3EUK L;  1Z9C A;  2BE5 F;  2LOO A;  2YVX A;  1O3R A;  1SEU A;  3C2H A;  1BW6 A;  1K7A A;  1OKR A;  4XK4 A;  1H89 C;  4YIF A;  2DPU A;  1HW5 A;  3BR2 A;  4XBF A;  3WTV C;  5FGM A;  2IBD A;  3HKZ N;  4GCL A;  3GYH X;  4Q4Z F;  2DT6 A;  3DPT A;  3KZZ A;  1FMV A;  4HNU A;  3M7G A;  4CSW A;  3K1P A;  1R6R A;  4FQG A;  1JUS A;  1JE8 A;  4IQJ A;  2FF4 A;  3L9F A;  2VL8 A;  2QBY A;  4M6Y A;  3C07 A;  2I8D A;  3JRF A;  1HQC A;  3QWL A;  5E1Z B;  4ENM A;  3VYS B;  2XC7 A;  2A07 F;  3VVX A;  1DPU A;  2Z9O A;  4IHW A;  1Z1D A;  2LRD A;  5B5E C;  4BHC A;  1KQ8 A;  3ERE D;  4UUS A;  2D45 A;  3FIW A;  4NN1 A;  3VWB A;  1Y6I A;  5FKL A;  4HKU A;  2PJR B;  2M0C A;  2H27 A;  4G7Z F;  3OYJ A;  2VIX A;  1J5Y A;  3ZQQ A;  1R1U A;  2ZFW A;  5J6X A;  5IYD J;  3OYD A;  2XSD C;  1BR1 A;  3IAM 2;  1PUF B;  2HQR A;  1TP4 A;  3HBL A;  3ZGK A;  4BBS J;  4N4N B;  5JHU A;  4RB0 A;  1ON1 A;  2K9N A;  2VBW A;  4WXD A;  4Y4R A;  4CZC A;  2DXI A;  2ZOY A;  4HBL A;  5B66 C;  2ID6 A;  3PJR A;  3DEE A;  3VP5 A;  5F0C A;  4J00 A;  3OSF A;  3WGI A;  2DA5 A;  3QPL A;  5E8I A;  2WC2 A;  4IVN A;  3OYA A;  2W82 A;  1ITY A;  3OYH A;  4GCT A;  4HV5 A;  2JT1 A;  1AKH A;  1R4M B;  3K4N A;  1WFX A;  1X2M A;  2BXZ A;  3HRS A;  3R4K A;  2R7T A;  3CLQ A;  3S8P A;  3A02 A;  2R0Q C;  5F08 A;  3ZRG A;  3LNQ A;  3K1N A;  2KRC A;  3ESW B;  3GTQ J;  4I01 A;  1R00 A;  2RGV A;  2OV7 A;  1I5Z A;  2UXN A;  3QYE A;  2Y0S A;  3QP6 A;  4XIC A;  1Z3Y A;  3I55 I;  4YG2 F;  4Z2Y A;  2L9N A;  3H1C A;  4DNC A;  3HTU A;  1EA3 A;  3CWR A;  4HW0 A;  2WV0 A;  1XC5 A;  5EG0 A;  2HYG D;  2LK2 A;  4II3 A;  4OIP F;  2F07 A;  3E6D A;  2PZ9 A;  1R23 A;  1VFC A;  5ED4 A;  3CJR B;  5HDG A;  5C44 J;  1T98 A;  5KNL A;  4QWQ A;  5FGL A;  5IPA A;  1VQM I;  5GPC A;  3R60 A;  4BAY A;  4DYC A;  3CCS I;  2X48 A;  4EAT A;  4KFC A;  1SC7 A;  4UV9 A;  1QHH D;  2NOJ B;  2QSG X;  3A01 A;  2HYT A;  1I3Q J;  4N9I A;  4RM2 A;  3F22 A;  1QNT A;  2NVQ J;  3BRO A;  3SFZ A;  2GXB A;  1R5I D;  1ERD A;  1ZRC A;  2HKX A;  2P4W A;  4ENN A;  4A3K J;  4A0X A;  1YI2 I;  1JT6 A;  4AIK A;  3V7C A;  2KP6 A;  2KQR A;  4A3G J;  2EPF A;  4PJJ A;  3PSF A;  2V1D A;  3FRQ A;  3JRI A;  4ZC3 A;  4DOZ A;  1WRJ A;  3ZQ7 A;  2LKS A;  5K5Q A;  3CDL A;  1YE9 A;  3MZY A;  2DJN A;  4EJU A;  2HVR A;  2X9D A;  1MBF A;  5ILU A;  4C2M A;  4LD5 A;  2CJJ A;  1I39 A;  1G3Y A;  3S3O A;  2PFV A;  1MMN A;  2XHK A;  4IEJ A;  3IP4 B;  4HX8 A;  4RLQ A;  4CYD A;  1IXR C;  3REO A;  5EEH A;  3JRG A;  2EQR A;  3ECH A;  1H8A C;  2F4M B;  4EJV A;  1MKM A;  4M74 A;  2Y30 A;  3S2W A;  2LBF B;  3S3N A;  5EEG A;  3WGG A;  2DTR A;  1V5G A;  3TOA A;  1IG7 A;  3T6N A;  2H09 A;  5LEK A;  5J8C A;  2XRN A;  3PUF A;  4GYG A;  2VKD A;  1PP8 F;  2GQQ A;  3G7R A;  3BJA A;  3GTO J;  3J7A O;  3CCY A;  4FCY A;  3JRE A;  2IEK A;  3GZ5 A;  4JYK A;  1E0E A;  2O7T A;  3CUQ B;  4G7H F;  3BZ6 A;  3Q0W A;  1BR4 A;  1J75 A;  5CXG A;  5GAG J;  2AQE A;  3TL4 X;  5FD5 A;  2VQG A;  1H9T A;  4TV7 A;  2BZT A;  4RS8 A;  4DW6 A;  3KEQ A;  5CVV A;  4F93 B;  1VTN C;  2OZU A;  1G3T A;  1MND A;  3W6K B;  2XAG A;  1KYW A;  3A4C A;  1VQP I;  3KLN A;  4CDG A;  1TBX A;  2VAS A;  3HIM A;  3HTS B;  1OCZ H;  1ZAR A;  2RAE A;  5D5U B;  3DBL B;  2M9H A;  3OMY A;  5CQG A;  2EIK H;  2D1V A;  4JQF A;  2QGU A;  3IL2 A;  4AYB N;  3PNY A;  2MBF A;  1S3J A;  4XNF A;  4PFP A;  4KIS A;  2VT2 A;  3BCG A;  2KRF A;  2KKO A;  2YS9 A;  4OMY A;  4A6E A;  4J01 A;  4HX4 A;  5AON A;  2KIM A;  4XOP A;  4ZYE A;  2WY8 Q;  1K4T A;  2VBZ A;  3GTL J;  3ZMT A;  1QHG A;  1J7K A;  5LHG A;  2KMU A;  3HKZ A;  2O61 A;  2PBX A;  2QQB A;  1GDT A;  1SD6 A;  2O3F A;  2ZJR F;  1A36 A;  4GXO A;  4P9U A;  3AFH A;  3CTA A;  4F3Q A;  3W2A A;  4AWX B;  1X58 A;  2HS5 A;  4XRS A;  3GFL A;  2EFN A;  2F4O B;  1WJD A;  4CCM A;  1KU3 A;  1P92 A;  2VQC A;  1J2X A;  3BWG A;  4BBR J;  1IV8 A;  2BY2 A;  4HA8 A;  2H1L A;  4E7K A;  1I1S A;  4MFE A;  3CRJ A;  2Y9Y A;  1FNN A;  3K4M A;  3FM5 A;  4LK1 F;  5IP9 J;  2X6O A;  4IKF A;  4BY7 J;  5EGO B;  1E3P A;  1IN7 A;  4L5I A;  4ZTJ A;  1SD7 A;  1O57 A;  4L5E A;  4OAY A;  1MMS A;  2VJ4 A;  2Z3Y A;  2GIV A;  2CGP A;  2M8G X;  3L00 A;  3ASO H;  4LLN A;  4N9H A;  2LC2 A;  4ASN A;  1WSU A;  1AHD P;  2JMW A;  3H9Q A;  1IZ1 A;  4D5C A;  1NHA A;  4XON A;  1T39 A;  3M4O J;  1TWF J;  2ELK A;  5J40 A;  1M1E B;  1OPC A;  1A6Q A;  2XGD A;  3GEZ A;  2XUB A;  1BI3 A;  4RGS A;  3ZQL A;  3S14 J;  5FLM J;  5HBU A;  4N4O B;  1XPX A;  4YFN F;  1SVM A;  3MCZ A;  1KU2 A;  3TKY A;  4BL0 B;  4KIT B;  4L0Z B;  3PSI A;  2V26 A;  3BZK A;  3CES A;  3QAH A;  4GCV A;  1FYK A;  2E60 A;  3FMR A;  1F4K A;  2TDX A;  4KA4 A;  1S9H A;  2ECB A;  2PG4 A;  3K69 A;  4HG2 A;  3CCM I;  2Y69 H;  2V7F A;  1XSD A;  3HTH A;  2CV1 A;  4IRV A;  3TQN A;  1LFP A;  4DBR A;  5EDN A;  3D5S C;  3F1B A;  3HJE A;  3JTH A;  4DIQ A;  3FHZ A;  3U1K A;  1XMK A;  3FXU A;  4HYE A;  4H0E A;  3GCM A;  2Y75 A;  3OYM A;  4YRV A;  4QIW N;  1X1C A;  4UXN A;  2KT0 A;  4NC7 A;  3RJP A;  2VQH A;  3CP8 A;  4BUP A;  3CC2 I;  3R0A A;  4O3M A;  5FLV A;  2Y2Z A;  4Y15 A;  3DLL F;  2F48 A;  5HLI A;  4EV0 A;  1KZH A;  3ZOB A;  1YX3 A;  4PGG A;  1UEL B;  4G8X A;  2UUZ A;  3WGH A;  3HSR A;  1KYZ A;  2B63 J;  1ZRE A;  3DTE A;  3B73 A;  3L1P A;  2P6S A;  3JR9 A;  2RQQ A;  1TC3 C;  5E3O A;  4QTR A;  3DTK A;  4PDK A;  1ZG1 A;  1MD0 A;  1YJN I;  3KP2 A;  1RRJ A;  1ZN2 A;  3P5J A;  2M5W A;  1K79 A;  5KAF C;  1LB2 A;  2CQQ A;  5BPI A;  2MGQ A;  1A04 A;  3VDX A;  2K4J A;  2QKM B;  2EZH A;  1P4W A;  3LAJ A;  3S15 J;  2VJ5 A;  4QPQ A;  5KK1 A;  4JNN A;  3TOB A;  5E3N A;  3SJM A;  4B3X A;  4XR6 A;  3NQO A;  2LMD A;  3WTX C;  2F6C A;  5GPA A;  3RQI A;  2VN2 A;  2BY3 A;  1FTT A;  3BTL A;  3CME I;  2QUF A;  4KIC A;  3TO6 A;  3WTY C;  4Y52 J;  3HGG A;  2ZB9 A;  1WCM J;  3I64 A;  4NEL A;  1MSE C;  4XRF A;  2R5Y A;  2A6E F;  4S04 A;  2YSR A;  3CCQ I;  2CO5 A;  2W1O A;  1FIA A;  4M9X A;  1MDM A;  3GW2 A;  3IWZ A;  3CDI A;  5TRD A;  5C4X J;  1R9T J;  2YR2 A;  1IO2 A;  2MA3 A;  3JCU C;  2MAB A;  3E6C C;  2FBH A;  4Z6Y A;  4W97 A;  1STZ A;  2LVS A;  3DKW A;  2ZKZ A;  2R4G A;  1V54 H;  1Z77 A;  3SDG A;  2PLY A;  1CGP A;  3SEZ A;  4HAM A;  1LEA A;  3J81 K;  5FLX K;  2D1H A;  3F8M A;  1VQL I;  2DQL A;  1ZLK A;  2DJI A;  3J7Y J;  3WOD F;  3TDZ C;  1Z21 A;  2ZO4 A;  3JW4 A;  2EA2 A;  4EGY A;  3OYI A;  5CW8 A;  1OCR H;  1XN7 A;  4GRI A;  1UAA A;  4MXM A;  3BQY A;  1BJZ A;  4L9N A;  2HTJ A;  2OBP A;  2EIM H;  1FBS A;  4AD9 A;  5KHD A;  1FBU A;  3E7Q A;  4IZZ A;  3E0J B;  3KZI C;  3RYP A;  3S16 J;  5J1R A;  1JUP A;  3AQT A;  3E6B A;  2VKE A;  3EUA A;  1O3T A;  2PMZ N;  3CQZ J;  1ONV A;  2QSH X;  3OYN A;  3BHQ A;  1V55 H;  4KT6 A;  1OCO H;  2V1U A;  4NHJ A;  3PQJ A;  3I58 A;  4BEH A;  4IPA A;  2XAJ A;  3KP5 A;  4U87 A;  2M34 A;  3I54 A;  5CJ9 A;  3PQK A;  1B72 A;  2CUJ A;  3FK7 A;  2ZME B;  3HOT A;  3K8P C;  4AYB A;  3A1Y A;  3DBR B;  2Z16 A;  2XPW A;  2ZME C;  1POG A;  2Q2E B;  3PIO F;  1I6X A;  1K6Y A;  1XDS A;  2CUE A;  3BPV A;  2QF7 A;  5AIP A;  1ZKG A;  5HNF A;  2DMQ A;  1W5S A;  2ZSI B;  3M8J A;  2QVO A;  4OMZ A;  2W7N A;  1J09 A;  3PUB A;  1FOX A;  4RB1 A;  1XSX A;  5H9T A;  2P0W A;  3CMY A;  2HDW A;  1U9N A;  4XLP F;  2ETH A;  3RPU A;  2WV1 A;  3O2P E;  4AVP A;  1UB9 A;  2ZNZ A;  4ZYA A;  2LNB A;  2DDA A;  4CO8 A;  1MJB A;  1TWA J;  3VOX A;  3QPT A;  3U21 A;  1LKX A;  1FPQ A;  5C3E J;  3W6V A;  3DTI A;  4NNJ A;  3EYI A;  3ISP A;  1O7L A;  2GWR A;  1T2K A;  2NAZ A;  2JA5 J;  3HTJ A;  1XMA A;  5ILV A;  1X3U A;  2X6Y A;  3EGQ A;  4ZYG A;  1SAN A;  2X6X A;  1B9M A;  4E6K G;  5IY5 H;  2H1K A;  1TZL A;  4YEL A;  1YTY A;  1N78 A;  2CW8 A;  1ZR2 A;  3WTW C;  3FMS A;  5IYB J;  5HOD A;  3JRA A;  1W7P B;  3S2D J;  2CSO A;  4CYC A;  2R92 J;  3DPJ A;  4GGG A;  1WH5 A;  5D5X B;  5E79 C;  1UG2 A;  4LGW A;  3H35 A;  3IRQ A;  3C2G A;  4ON0 A;  1R22 A;  3NI7 A;  2ACJ A;  3L2Q A;  4Q5S F;  1LPQ A;  3ZN0 A;  4P5O A;  2E71 A;  4MLO A;  2CUF A;  1VI0 A;  1K83 J;  4JX6 A;  1U2W A;  1SD4 A;  4LG3 A;  1ON2 A;  3DQV C;  4LIU A;  5LGN A;  4O6J A;  1BJA A;  4XM3 A;  5C4J J;  2JN6 A;  2M7A A;  1GXP A;  1EH8 A;  2L4A A;  1YIO A;  4F7Z A;  3Q9S A;  4ZJZ A;  5FKM A;  1VQ9 I;  2RRE A;  3BR1 A;  4J19 A;  4A3C J;  4AM3 A;  4G7O F;  2G7U A;  2V6E A;  1V4R A;  2FUG 2;  5FJ8 J;  4GYI A;  4MGR A;  4RB3 C;  3HXL A;  4Y33 A;  1RR7 A;  3BCB A;  1WZ2 A;  3M8F A;  4AUX A;  2UXU A;  4XLE A;  4DVY P;  2PX9 A;  5IT3 A;  3IV5 A;  1FBQ A;  1HSJ A;  2EB7 A;  4L9J A;  1X1D A;  4MO7 A;  5J3L A;  4A0Z A;  4IHV A;  2XF6 A;  4U9L A;  4I6Z A;  1MGT A;  4G12 A;  5H6Q A;  2MYS A;  2RN7 A;  3KX2 A;  2EV6 A;  5FO5 A;  2XRO A;  3EET A;  4ZYD A;  2L9R A;  4BJ5 C;  3GFM A;  4XMY A;  3RQ4 A;  4XRS G;  3JRC A;  3LA2 A;  1OCT C;  4G6D A;  4XKB A;  2QWT A;  2FE3 A;  1XSV A;  5TJJ A;  1R49 A;  4GO1 A;  2A69 F;  4BXX J;  4M6X A;  2L7M P;  3ZQG A;  1TL8 A;  3GVA A;  2ZJP F;  3BR5 A;  3FKJ A;  1T6S A;  1VND A;  2LLK A;  3KYC B;  1TWC J;  3F21 A;  2GLO A;  4O5V A;  5L3E A;  4OIR F;  2Q24 A;  2FBI A;  4IL6 C;  1LFB A;  1GLN A;  3GTP J;  1SFU A;  1UMQ A;  2VI6 A;  4KN7 X;  2QYO A;  2K85 A;  4RAG A;  2R7F A;  2KFD A;  3NWS A;  1U9O A;  3LSR A;  5FFX A;  1R5G A;  3I53 A;  2B3W A;  2ZXW H;  1XGN A;  4WXH A;  3SXY A;  2IS1 A;  2VE9 A;  5DUK A;  4C2M J;  2MSY A;  4XOT A;  1YX5 A;  2FX0 A;  4IJA A;  1IV6 A;  3F72 A;  2Y9Z A;  2Z2S B;  1GT0 C;  4A3D J;  1IRZ A;  5D5W B;  1RZ4 A;  1W5T A;  3E97 A;  2PJR A;  3I4N J;  1QZY A;  2JPC A;  4JBA A;  5J1Y A;  2Q8K A;  2EH3 A;  2DFI A;  3HOX J;  1UJ8 A;  1R1T A;  3RSN A;  2DA4 A;  3K0L A;  2HU9 A;  3PNV A;  1YQA A;  3N97 A;  4E7I A;  1TW2 A;  2STW A;  1PUF A;  3M8E A;  1XD7 A;  3MZ8 A;  2FSW A;  3B02 A;  4UVA A;  3FHN A;  3ZQI A;  1ZH5 A;  3N4M A;  2WA0 A;  4IHY A;  2OJE D;  3J81 Z;  3CF2 A;  5FLX Z;  5D8K B;  1L0O C;  1ZGW A;  1VQ4 I;  1TWH J;  1PDN C;  1NH3 A;  2OCE A;  1P9Q C;  4M3D A;  3TGN A;  4ENK A;  1I3A A;  3H5N A;  1FP1 D;  2FOK A;  2A61 A;  2L5Q A;  2V6C A;  4ENJ A;  2BW3 B;  1B8I B;  1YS7 A;  5E20 A;  3VOD A;  3FXM A;  2VQL A;  3ZQH A;  4V19 K;  4NQW A;  2PEX A;  5H2F C;  2E1N A;  1UCR A;  4C3H J;  4B3A A;  2E35 A;  3OL3 A;  2RV8 A;  3KP3 A;  3LQR A;  4RGU A;  1ZTR A;  3QYF A;  4RGX A;  2EZI A;  2EFQ A;  2FA5 A;  5GAD J;  3K4L A;  2PMZ A;  2QQ9 A;  3RZD J;  2MD0 A;  2R5Z B;  1MBG A;  1HLV A;  1JJ6 C;  1HW1 A;  1ZR4 A;  2OC6 A;  1LFU P;  2E2J J;  4XQF A;  1KU9 A;  3LFK A;  2M30 A;  2EFO A;  2YX7 A;  3H3U A;  1LVK A;  2XPV A;  1D1A A;  3S32 A;  1AA7 A;  1MJ9 A;  4M6V A;  2UWM A;  3IHU A;  3HOV J;  3HC7 A;  3OYL A;  5M5W J;  3WU2 C;  1ZG3 A;  2AHQ A;  2XB5 A;  5LD2 C;  2JA7 J;  2IGN A;  5AQC A;  2AS5 F;  2P7C B;  4M73 A;  3G3Z A;  5F1J A;  5B1A H;  5DCM B;  2A68 F;  3QOP A;  4B48 A;  3FBN B;  3V7R A;  5DUI A;  3EUH C;  5DM7 F;  5FRM A;  5J4V A;  2TRT A;  4KMF A;  5HDK A;  2VJI A;  1ACI A;  3GTK J;  1YRN A;  1LDJ A;  1HKS A;  1I50 J;  4PFO A;  4CZZ A;  2W25 A;  4HLY A;  4OIN F;  3K70 C;  2FBQ A;  1AU7 A;  1Y56 A;  4EEF G;  2O5R A;  1A31 A;  4I76 A;  4PCQ A;  2GFN A;  2LKX A;  1OYI A;  3HTA A;  3OIP A;  1B59 A;  3HPG A;  4KJZ A;  3RKY A;  2KZG A;  4ZZD A;  3UKG A;  1Z0X A;  4LG0 B;  2VKH A;  4MNU A;  3JAM K;  3BG7 A;  1V5E A;  2X1E A;  5DM6 F;  3KP6 A;  1FEX A;  2PFB A;  3EDP A;  2XAH A;  3LL7 A;  4IO9 F;  3SYT A;  5J4Y A;  2QWW A;  1YJ9 I;  2YX4 A;  2K5C A;  2HZD A;  3S93 A;  2O9L A;  3OYB A;  1TT0 A;  3FM3 A;  3ECO A;  1JKQ C;  1T0F C;  4LJZ F;  4NB5 A;  3OWT A;  2DAO A;  2OUM A;  1JKO C;  5IP7 J;  1G4D A;  3RTR A;  2R7D A;  4L62 A;  3LA3 A;  3K4J A;  1OIS A;  3P9K A;  1S8N A;  2RHA A;  2M45 A;  3EYY A;  3F0C A;  1J9I A;  4FAS D;  1PP7 U;  2HOE A;  3DFG A;  4PJL A;  2MC4 A;  1RKW A;  2E34 A;  2BVM A;  3ASN H;  3RH2 A;  2ADU A;  3C3W A;  4DBQ A;  1EF4 A;  3V8K A;  4RMN A;  4XKW A;  3GTJ J;  3AL0 B;  4C3I J;  3CUQ A;  4UUT A;  4L9V A;  2NS7 A;  1D0Y A;  1T33 A;  2WAE A;  3KEY A;  3ZQC A;  3FIS A;  3AL0 C;  3RPU D;  3HIF A;  4P96 A;  2O8X A;  4BE1 A;  2E5N A;  1VQ5 I;  4EM1 A;  2LTP A;  1BOA A;  2E19 A;  3TMO A;  4HNV A;  1O3Q A;  3ABL H;  5LHH A;  5F1R A;  4I09 A;  2IA0 A;  3N05 A;  1NG6 A;  1U3E M;  4A2U A;  1T08 B;  1IN4 A;  2IGK A;  2H8R A;  3BP8 A;  2MH9 A;  5FKK A;  4ZZL A;  2EFP A;  2DA6 A;  3BTJ A;  1OR7 C;  2R7U A;  3VB2 A;  2LDU A;  1R58 A;  2JTV A;  3COL A;  2M87 A;  1SMT A;  2GA1 A;  2YVE A;  1FY7 A;  2P81 A;  3HTI A;  2CS3 A;  4JX5 A;  3O60 A;  2QQA A;  5CXI A;  3DPL C;  4D7N A;  2XF7 A;  2VXZ A;  4L9T A;  1WH7 A;  3RZO J;  4G94 A;  1RIO H;  2WAF A;  2VLA A;  2RVC A;  2RC4 A;  3RCO A;  1W36 C;  3FWE A;  4XSX F;  5HVQ C;  1VQ7 I;  4LIV A;  1UHM A;  4E4H A;  4G6T B;  2VKV A;  3IKV A;  2IGM A;  2NX4 A;  2HVQ A;  4LLG F;  4XLH A;  2NS8 A;  2G7H A;  3ZP5 A;  1D0Z A;  1WHU A;  4RAZ A;  3ZN1 A;  5K7H A;  4UDS A;  5DYM A;  1BC7 C;  3H9G A;  3L2V A;  3LMM A;  2BY0 A;  1LDD A;  4PJN A;  3L2C A;  1DDN A;  2VB6 A;  3HHG A;  4BNC A;  2FEZ A;  3CJQ B;  3SWH A;  4ACI A;  5E18 F;  2ZCM A;  5DCF A;  2DOA A;  4MEX F;  1VQN I;  1DQU A;  4EJW A;  3D5L A;  1T8I A;  1OCP A;  5HSZ A;  2IXS A;  1F1Z A;  1HKQ A;  4BQO A;  3MMY B;  4K2E A;  1MBJ A;  1EJ9 A;  3TP0 A;  3F8C A;  4PJM A;  1JGS A;  1FWZ A;  2OCC H;  1TQI A;  4DZJ A;  2P5V A;  2WWY A;  1ZRF A;  1WJB A;  3W2V A;  2QKL B;  4KIG A;  4HDU A;  2DLL A;  2ZOZ A;  1IJW C;  2KJC A;  4ITV A;  5LGU A;  5EJC A;  3U2R A;  1QZZ A;  5GAE J;  3BNI A;  4CUG A;  5JVT A;  3ELK A;  2JZY A;  2G9W A;  1IN6 A;  2XAQ A;  2KDZ A;  2OZ6 A;  2YUS A;  4AC0 A;  1VQ8 I;  2HWV A;  2FML A;  1W0T A;  2ZXI A;  1RUO A;  1U5T B;  3VEP A;  1IXS B;  1MMG A;  1ETV A;  4I2O A;  2DCE A;  1Z7L A;  4D5F A;  4IQ4 A;  2VJJ A;  2K9L A;  1U5T C;  3ANG A;  5FB2 A;  3BLY A;  3ZXS A;  2ZCW A;  3DP7 A;  6PAX A;  2RNJ A;  4L5J A;  4EQQ A;  2OPT A;  2DOF A;  2X85 A;  3HOS A;  3E5U A;  4KMU X;  2ZFU A;  2HNH A;  2YPR A;  3L2W A;  4II2 A;  1UFM A;  1FYM A;  2LF8 A;  2HYJ A;  2KZV A;  4GFL A;  1HXD A;  3GBG A;  4MQ9 F;  2EV0 A;  2QM3 A;  2X6W A;  3NWT A;  2WUI A;  4M9S A;  5AIQ A;  3HHH A;  3L7W A;  2LY1 A;  3CCE I;  1XB4 A;  4U9N A;  1E2X A;  1MBK A;  1S7O A;  1S5L C;  2GXG A;  5H6R A;  4IHT A;  3HSF A;  1WQ2 A;  4WXC A;  1NG7 A;  1EV7 A;  4XL9 A;  4BQQ A;  1MNE A;  4RBO A;  5GTI C;  1CF7 B;  4EJO A;  1ZYR F;  2V9K A;  4KT5 C;  3IH4 A;  5EFY A;  1ZEL A;  2JUC A;  3TW6 A;  3G71 I;  2LY9 A;  5D4R A;  1RNL A;  2ZNY A;  3F6O A;  1U8B A;  4C2T A;  4E7J A;  3IWF A;  2O0Y A;  3IKT A;  5DS9 A;  2HOA A;  3VIB A;  1GV2 A;  3CCL I;  5JLW A;  5EEA A;  4RAF A;  5HLT A;  1UI6 A;  3JAM Z;  4LOC A;  3S1M J;  1BL0 A;  4E70 A;  3CJN A;  3DWL E;  5DAJ A;  5E3M A;  2NVT J;  2M8E A;  1G59 A;  1IRX A;  3QPS A;  1SFE A;  4I02 A;  2K4B A;  2HI3 A;  3ROU A;  3GXO A;  1R5H A;  2LRE A;  3OR2 C;  4HDV A;  3I4P A;  3V78 A;  4Y17 A;  1WGX A;  3E5X A;  2QSF X;  2DMU A;  2IS2 A;  1D8K A;  1EKE A;  3F8F A;  2CUZ A;  2ZXJ A;  4BAC A;  2NRA C;  1QRY A;  1LEB A;  5D19 A;  2XPU A;  4CIC A;  2YU9 J;  4CCL A;  1FT9 A;  3K4B A;  2GAU A;  1K78 B;  3SEQ A;  5HAW A;  2Q0O A;  4A3I J;  3UR3 C;  4RDU A;  4UHT A;  2L3D A;  1APL C;  3WHC A;  3COA C;  4F92 B;  2DA2 A;  3QQA A;  2HFH A;  3MKY B;  4IRI A;  1FLI A;  3WTZ A;  4R1H A;  3U1D A;  5L3B A;  3I5U A;  3KLO A;  1YW9 A;  3F8N A;  4GDF A;  2A2F X;  5IOZ A;  1OYW A;  2LH9 A;  1IW7 F;  1UZC A;  2V4J C;  2FNA A;  1FYL A;  2RDP A;  2ZCX A;  5IYC J;  3CC4 I;  2YVH A;  5JHF A;  1XGS A;  4XOR A;  5CVU A;  3OIQ A;  1KU7 A;  3F6V A;  1NK3 P;  3I3L A;  2ESH A;  4WK8 F;  2DU9 A;  1DP7 P;  3BCA A;  4FE7 A;  1QPI A;  1FMW A;  3K4K A;  1G3S A;  4BXF A;  1IN5 A;  3WG7 H;  4IRH A;  2ZME A;  3IAS 2;  5LEJ A;  3HOY J;  3JSJ A;  3I59 A;  1RES A;  4BKX A;  1D0X A;  4E7L A;  2ZJ2 A;  3I0T A;  1WJF A;  5L3D A;  3S3M A;  2JA8 J;  4HV6 A;  1HOM A;  4HNT A;  2LKP A;  1JI8 A;  1MIJ A;  2ELH A;  2L01 A;  3G56 A;  3B6C A;  4HZF A;  2L0K A;  1D8J A;  2JA2 A;  1HCR A;  2QEX I;  4XRM A;  1WI9 A;  1K61 A;  4V2F A;  4BU2 A;  1BBY A;  5EYR A;  1FP2 A;  1ULY A;  3IUV A;  1Y0N A;  3OS1 A;  2F4I A;  1Y8Q B;  4QPO A;  2JPB A;  5M5Y J;  1OQY A;  1NK2 P;  2V1X A;  1S6L A;  3S1R J;  4OWR B;  2ZCN A;  3HDD A;  3LAP A;  4L18 B;  3V8J A;  3OIO A;  1ZAO A;  3PPB A;  3FZV A;  1PVE A;  1UHW A;  3B81 A;  2DT7 B;  2HKO A;  2L9S A;  2NP3 A;  5FD6 A;  2LSO A;  3SZT A;  3K2A A;  2EA4 A;  2DYS H;  3V7S A;  4BY1 J;  2HPM A;  1DGW Y;  1DU0 A;  3BPX A;  4CHU A;  3DCF A;  3JSO A;  3Q3S A;  1QBJ A;  1TNT A;  4A6D A;  1W7P A;  5E1W A;  1QQI A;  3UNG C;  1FOK A;  2D6Y A;  2E1M B;  4QLC U;  3FX3 A;  4RLF A;  5FRN A;  1X1P A;  3V8L A;  2DDB A;  1BW5 A;  4Y13 A;  2E1M C;  2NVY J;  2XDN A;  2OU2 A;  4BHB A;  4FE4 A;  5A2Q K;  3WHB A;  2WGB A;  3OY9 A;  3WU1 B;  4DQ2 A;  1RPW A;  3HGY A;  4I99 C;  1TW3 A;  1BN5 A;  3A0B C;  3MNL A;  2A05 A;  1D3Y A;  2OQR A;  4MQV A;  2VOP A;  1G2H A;  1GVJ A;  3NEU A;  2PQ8 A;  4I0A A;  1S7E A;  3JRD A;  3NS4 A;  3O8H A;  2AO9 A;  2LY2 A;  4CCK A;  4B1R A;  2E7W A;  3H5A A;  4Y3O A;  1R7J A;  3KIO A;  4ZDO A;  1X3W B;  4OIO F;  3PAS A;  2OA4 A;  4BH9 A;  1K4S A;  3BG9 A;  3E1S A;  3FXJ A;  2UXX A;  4GFK A;  1E3O C;  2DA3 A;  1LNW A;  5DD8 A;  3QOD A;  2DMN A;  4PJ0 C;  1LE8 B;  1RI7 A;  2IVM A;  3ABK H;  1YW8 A;  2RQP A;  2TCT A;  3KNW A;  1S72 I;  2A5Y B;  2ECC A;  5HS7 A;  1WJA A;  5D6E A;  1JXS A;  5D6F A;  4JKZ A;  4CGZ A;  2R7S A;  4ESB A;  3KYD B;  3Q0V A;  1XTA A;  5BNG A;  1USS A;  2V9P A;  3TBI A;  3EPZ A;  4Q48 A;  2MLK A;  2E2I J;  4L0Y B;  2RAS A;  2OER A;  3E7L A;  2ZY9 A;  3MZH A;  1MDM B;  2CQ7 A;  3OL4 A;  3RKX A;  3KP4 A;  1F9N A;  2VXD A;  4Y7N J;  2GXA A;  2L4M A;  5IOY A;  1E3H A;  4UNO A;  4ICH A;  3CP2 A;  1PYV A;  3GO5 A;  5ERI A;  4E7S A;  3E3V A;  5GP9 A;  4KNY A;  2COM A;  2NVX J;  3LJL A;  3VYT B;  3GX4 X;  4HST A;  2NVU B;  3AQS A;  1ETX A;  2HXI A;  3VSK A;  5DV5 A;  4CGR A;  5EZG A;  2R7Z J;  4B44 A;  3FXK A;  1UG0 A;  2DMP A;  1TT5 B;  1TQM A;  2L02 A;  1FTZ A;  3CMA I;  1H9G A;  1B1B A;  1ETK A;  4HEA 2;  2WAQ N;  3P9C A;  2UXI A;  5K7Z A;  3HRT A;  2DK8 A;  3ANP A;  1QO0 D;  3QPH A;  2MD5 A;  2IS4 A;  3AAF A;  4N0B A;  2DI3 A;  4WWC A;  2FBK A;  2WB1 N;  2EFW A;  1BR2 A;  2V57 A;  4BEH B;  2LFB A;  2KIF A;  4V2G A;  2R7R A;  4M72 A;  1T95 A;  4EM2 A;  2ZXH A;  2J5O A;  4I7H A;  1B72 B;  1RET A;  1K6O A;  5CQE A;  1HF0 A;  3CJT B;  4BE0 A;  4LIT A;  1KON A;  5HLH A;  5BMZ A;  4H4K C;  4JOM A;  1VZ0 A;  2DFF A;  3ZMS A;  2F5C A;  2B7E A;  2JRT A;  3FMQ A;  2CQX A;  2O7O A;  1MMD A;  2LP0 A;  3CLO A;  5JFR A;  2IT0 A;  4XKC A;  3ZR8 X;  2R93 J;  2BHY A;  2F2E A;  3MN2 A;  1MW7 A;  5CVJ A;  3K7A J;  1YYV A;  3NAR A;  4BS9 A;  1D5V A;  2DOE A;  2BW3 A;  2L7Z A;  1IXC A;  3W2W A;  2Y48 A;  5IT9 K;  2X1D A;  2CFO A;  3BDD A;  1J0R A;  3BG6 A;  4DYR A;  1YOV B;  5L3C A;  1N25 A;  2P5L C;  1B6A A;  1VQ6 I;  4MK6 A;  2ME6 A;  4ETS A;  2PN6 A;  3QRF F;  2H8W A;  3FXQ A;  2R5Z A;  3VW0 A;  4PGH A;  1MMA A;  3VPR A;  4ZH4 F;  3MFK A;  5M5X J;  4XID A;  2W85 A;  4IRG A;  2KIU A;  5LFA A;  3OS0 A;  5HS9 A;  5LHI A;  3ON4 A;  2IP2 A;  1FX7 A;  2XVC A;  3Q9V A;  2DT5 A;  1P7I A;  2JSC A;  4BJ6 C;  2K40 A;  4HPQ A;  1GUU A;  2HQ5 A;  4D1Q A;  1I1G A;  1Y39 A;  4RAY A;  3I71 A;  2QEN A;  3VVZ A;  2HOT A;  4A3F J;  2VT3 A;  1SD5 A;  2HQA A;  3WTT C;  1FSH A;  1QVU A;  5HLG A;  2LR8 A;  1ENH A;  2PMH A;  2EIL H;  1S7A A;  4U0V A;  4CCO A;  4U7B A;  2OI8 A;  4A93 J;  3EQL F;  3JRB A;  1ZQ3 P;  1H88 C;  4CCJ A;  1YFH A;  2VE8 A;  2HOS A;  4LG0 A;  2KIQ A;  3J7Z I;  1JHH A;  3H3V K;  1SFX A;  3GF2 A;  3NAU A;  3HSE A;  3AG3 H;  5DTD A;  2FQ4 A;  2MLG A;  2ZSH B;  4UVC A;  2CV0 A;  4ZDL A;  4F52 A;  2QTQ A;  2E36 A;  4GFB A;  2W4S A;  1WJC A;  1E17 A;  3FDY A;  2CH0 A;  3R61 A;  1H0M A;  3ZMV A;  3HRM A;  4KIF A;  2CU7 A;  2K3F A;  2FQ3 A;  2EV5 A;  5A2Q Z;  2OF7 A;  3HUG B;  1A6I A;  2W57 A;  3DXJ F;  3CZ6 A;  3E6M A;  5HOO A;  1XG1 A;  2I10 A;  3KCC A;  3BT9 A;  4B47 A;  3PO2 J;  4PSX A;  1I6H J;  5J47 A;  3B6A A;  2BOL A;  2L9V A;  3OV8 A;  5BOX A;  2G7L A;  3KZ9 A;  3K6G A;  4NC8 A;  2B9S A;  3F23 A;  2XGE A;  1TQP A;  2DOD A;  2NXN B;  4A5M A;  3RD3 A;  3V4G A;  2VPR A;  5CLS A;  3FBI B;  3OSG A;  3C18 A;  2L7F P;  4AU7 A;  3OS2 A;  3FXL A;  3SZG A;  3DKX A;  2M0M A;  1D1C A;  1F43 A;  3CF5 F;  1EH7 A;  1DUX C;  1SGM A;  3H36 A;  4DYQ A;  4WX9 A;  2ESN A;  2R3S A;  2DN0 A;  1XS9 A;  3K4C A;  5F64 A;  1U6G A;  1HKT A;  1LVA A;  2MC3 A;  3DLA A;  4UB8 C;  3BJO A;  1XGM A;  3F8B A;  2L54 A;  2FJI 1;  2CRG A;  4OAZ A;  4IHS A;  2VC1 A;  2KRH A;  5TIS C;  4FET A;  1W4M A;  4IF4 A;  4KIB A;  5E8G A;  1OR7 A;  2FJ1 A;  4YFK F;  1EH6 A;  4A3J J;  3WU0 A;  5EF6 A;  4D0P A;  1UST A;  4EGZ A;  1ETY A;  3E5Q A;  1IUF A;  2Z99 A;  1MSF C;  1XDU A;  3OYF A;  1QGP A;  1T56 A;  4KUM A;  1DP3 A;  3T5X A;  2MG4 A;  4F91 B;  4R8H A;  1IN8 A;  1W7P D;  3D1N I;  3ABU A;  1Y0U A;  1UI5 A;  2PI0 A;  3LSH A;  3LSJ A;  1KQ0 A;  2IA2 A;  3MWM A;  1DU6 A;  1N77 A;  2DBB A;  2Z33 A;  1FOY A;  3R6S A;  4CA0 A;  1YG2 A;  3F3X A;  2HDD A;  3P9T A;  2LBF A;  3DU5 A;  1GVD A;  2K7L A;  4P55 A;  1SAX A;  2Z1D A;  3BR0 A;  5LRR A;  1ZK8 A;  1X3Z B;  3FF5 A;  3BJ6 A;  5CYV A;  4BE2 A;  3M3Y J;  4NQW B;  2GBY A;  4A69 C;  3WTU C;  1IRG A;  2REK A;  3O8G A;  3K9T A;  4YZE A;  2WAQ A;  1TWG J;  2Y31 A;  1VQO I;  2C6Y A;  1B9N A;  2HGC A;  3FXR A;  5DDG A;  4M71 A;  4A3M J;  3VW2 A;  2WB1 A;  3S1N J;  5BQT A;  4MEY F;  4XKV A;  1FZP B;  1KGS A;  4RM3 A;  1B4A A;  2JRM A;  2NOG A;  2X0L A;  1ZHF A;  3VYU B;  5K5R A;  2QBY B;  3HOU J;  9ANT A;  2DG7 A;  3BRU A;  4JL3 A;  1WKM A;  3O3K A;  2V79 A;  2KPM A;  4ESF A;  3H0G J;  2IW5 A;  4A3L J;  3BR3 A;  2EZK A;  2P5K A;  1X19 A;  3CCU I;  3Q0U A;  1ZG5 A;  3HE0 A;  2UZK A;  4UUS B;  3JTG A;  3RIR A;  2CMP A;  2RNG A;  3NXC A;  3KEO A;  2D2W A;  1YIJ I;  4I98 B;  2JWT A;  4HF2 A;  3P7N A;  2B0L A;  1TNS A;  3BG5 A;  3VTI A;  2XAS A;  3C2B A;  1YRN B;  5IT9 Z;  1X2N A;  3RPQ A;  1U8R A;  1U5T A;  1XX5 A;  2G7G A;  4UVB A;  3EUP A;  5B3S H;  1O3S A;  5ILS A;  1SFK A;  1YHQ I;  3HOZ J;  2KJB A;  2ICW G;  3A2K A;  2IPQ X;  1PUE E;  3C7J A;  2D5V A;  1REP C;  3D5R C;  1YJW I;  2VBY A;  4G6Q A;  3GME A;  1HDD C;  2JUG A;  2QIB A;  3ZMU A;  4B43 A;  2JSP A;  1AKH B;  1IC8 A;  2CG4 A;  5JI6 A;  2CFX A;  2EJR A;  1MNM C;  1BI0 A;  2A6H F;  1LDK B;  3G6E I;  3C1D A;  4XLA A;  5EGO A;  3KZY A;  3LSG A;  4KN4 X;  5J8F A;  2M4K A;  3KFW X;  4B09 A;  1CF7 A;  3D0S A;  1Q1H A;  3MAJ A;  5L3F A;  4IHX A;  1ZLJ A;  4ME9 A;  3T1B A;  2GIZ A;  4X0G A;  5EG0 B;  1JUM A;  1MZB A;  1WI3 A;  2DK5 A;  2QA4 I;  4U7D A;  3CO6 C;  4M9Z A;  3CDH A;  4LFU A;  1D5Y A;  3AG4 H;  1ZGJ A;  3DV8 A;  3GFI A;  5KCM A;  5HDN A;  1AWC A;  3CUQ C;  3I56 I;  1P7J A;  2DTZ A;  2XSJ C;  5F6F A;  4CCN A;  5LRS A;  4ZTF A;  4M3B A;  3WE2 A;  2GZW A;  2GA2 A;  3WTS C;  1JKP C;  2FOW A;  3A01 B;  2COB A;  3DU6 A;  1P4A A;  2AQF A;  5F0F A;  4U0W A;  2DQR A;  2K9S A;  5K5O A;  1BC8 C;  1RUN A;  1VF9 A;  1QA6 A;  3AKZ A;  4AIH A;  5KVR A;  4S0H B;  2HZT A;  3TED A;  1SVL A;  2NNN A;  1X4P A;  1JHF A;  1Q1V A;  3DKY A;  2XAF A;  3Q5F A;  1QU3 A;  2BHZ A;  4EM0 B;  4PUS A;  1MBH A;  4NC6 A;  2JVH A;  1K78 A;  1IAW A;  1ETO A;  1XCB A;  2Y0M A;  2IJL A;  2CV2 A;  5JVG F;  3PO3 J;  4MIM A;  3G73 A;  4FX4 A;  1OJL A;  1RR8 C;  4RGR A;  2E7X A;  5BPD A;  3VOK A;  4FX0 A;  4QSH A;  4S05 A;  1D1B A;  3ZPL A;  3S17 J;  3K10 A;  2FD5 A;  2XKO A;  3GFJ A;  4WCG A;  1BA5 A;  2KL4 A;  3AG2 H;  1G6N A;  3HM5 A;  5K1Y A;  1Y1V J;  2CWE A;  4FT8 A;  5ICG A;  3K70 D;  1HW2 A;  5F27 A;  1DPR A;  4RB2 C;  2VPL A;  3H9J A;  3PFY A;  2HVS A;  2XIG A;  1R71 A;  3GZ6 A;  1HST A;  5CKT A;  2A3S A;  2CQK A;  3MVP A;  5D1R A;  2A6T A;  3JRH A;  1LQ1 A;  3TO7 A;  3F9K A;  2XRL A;  4P1W A;  3ZMZ A;  2GOM A;  3H3Z A;  5F0H A;  2IGO A;  2OQG A;  2BV6 A;  5IP6 A;  3VUQ A;  4GCK A;  1U78 A;  3CJD A;  2VON A;  4D9J A;  2X4H A;  3J7A Y;  1OCC H;  2G7S A;  3S1Q J;  1G3W A;  3LFU A;  2VBX A;  3CCV I;  4NDL A;  5CPR B;  1J59 A;  3ABT A;  3HB9 A;  3MKZ A;  5M3F J;  4IX7 A;  3KKD A;  4UB6 C;  4M3E A;  5LBQ A;  4W1U A;  1W5C C;  4HF1 A;  3CC7 I;  2JVG A;  1JTY A;  2F5F A;  4BQN A;  3FXO A;  2M4G A;  1BIA A;  1HDP A;  1ETQ A;  3WE3 A;  3I9V 2;  1HC8 A;  5CVR A;  1BIB A;  3MKW B;  4R79 A;  4AC6 A;  4B4C A;  2BBY A;  2L2O A;  4MFD A;  3J80 K;  3DPU A;  5FKN A;  3HRU A;  5FMP A;  3OYK A;  1HBX G;  2OAZ A;  1IF1 A;  4A0Y A;  2IS6 A;  1N75 A;  3CCR I;  2ME0 A;  2LG4 A;  3JSP A;  5B1B H;  3TW7 A;  3ON2 A;  3VYR B;  1SAU A;  4KYW A;  3CUO A;  4LB5 A;  4OIQ F;  5L3G A;  2DYR H;  5LGT A;  1GV5 A;  4YII A;  1HA8 A;  3OYC A;  1YW7 A;  1A35 A;  1T38 A;  2BXY A;  2GM4 A;  2GUH A;  5C4Y A;  1Z6R A;  4C9Y A;  1KQ9 A;  2JJ7 A;  2KIS A;  2LYC A;  4MTD A;  2DA7 A;  3KYL A;  1GHC A;  2R7W A;  3T8R A;  2Z5U A;  2CW7 A;  3MD2 A;  4D7M A;  3W3C A;  4AF5 A;  4YIR X;  4A3B J;  3PFI A;  4UV8 A;  3NRV A;  1YS6 A;  2HYF A;  2P7V B;  2NNY A;  2N8G A;  3RKQ A;  1C0W A;  4AVZ A;  1V3F A;  2LD5 A;  5E3L A;  3M1C A;  2W00 A;  3SHF A;  2F5V A;  5ICE A;  1JJ8 C;  1IGN A;  2STT A;  2O03 A;  2UXO A;  3PM1 A;  3CD6 I;  3BQZ A;  1WVR A;  3BTI A;  2Q1Z B;  1FJL A;  2ISZ A;  3BJB A;  2A5W A;  2G3B A;  1ZGA A;  2W24 A;  2W84 A;  4LMY A;  1W1W E;  2Q2E A;  3QOE A;  2XAU A;  1W36 D;  3MKL A;  3GZN B;  3TDU C;  3IH2 A;  4FIS A;  3KP7 A;  3V6G A;  4AID A;  2HQN A;  2EWN A;  3TO9 A;  3ZQF A;  3KET A;  4A12 A;  4XLN F;  2CW0 F;  3HEF A;  2QLZ A;  2XKP A;  3KPH A;  3G4S I;  1AOY A;  5GAH J;  1QVT A;  2W48 A;  1LE8 A;  2WAD A;  3L09 A;  3GTG J;  1MJA A;  3ZMD A;  1UHS A;  1SMY F;  3ONQ A;  2HTS A;  2F5E A;  4LLL A;  4BDZ A;  1Z67 A;  4JP0 A;  2DFE A;  4BYY A;  4YFX F;  3CO7 C;  4BDY A;  1ZRD A;  1OMI A;  3QYB A;  1OLT A;  4PSW A;  2GEN A;  1RC9 A;  2CQN A;  4DJA A;  4UUV A;  3TP3 A;  4EVI A;  3BY6 A;  2K9Q A;  3KE2 A;  3ERM A;  2E5Z A;  1WJ5 A;  2R7X A;  4PZJ A;  1R4N B;  1Z91 A;  2VOO A;  2RKH A;  3QU3 A;  2V1N A;  5DD4 A;  1Y1W J;  1BOB A;  2K02 A;  2WY7 Q;  3LA7 A;  4MTE A;  1L3L A;  3IRR A;  4X6A J;  3DEW A;  3LQQ A;  2R7Q A;  2DFH A;  3LST A;  1BI2 A;  3RKW A;  4DZP A;  1WJE A;  2B1E A;  3QKX A;  2E1O A;  3LSI A;  1W0U A;  3OOU A;  3IC7 A;  3X2Q H;  2L7K A;  5H20 A;  4NUB A;  3PIP F;  3BR6 A;  4E7H A;  2EZL A;  5FFZ A;  2E1C A;  1SVO A;  3ML6 A;  2M3A A;  3H5R A;  5K7F A;  2R7O A;  3G2B A;  4X1E A;  3BG3 A;  3OR1 C;  3VSL A;  3K2Z A;  2P8T A;  1SFO J;  1YLF A;  3RYR A;  4CH7 A;  4HSR A;  2FMY A;  3LWF A;  2GOX B;  2K27 A;  4F55 A;  5K58 A;  4XLC A; 
#chains in the Genus database with same CATH homology
 2E19 A;  4D5C A;  4HNV A;  1WPK A;  2DA1 A;  3M4O J;  1TWF J;  2ELK A;  4A3F J;  2HOT A;  3VVZ A;  2EBI A;  1QVU A;  2XGD A;  2UXH A;  3ZQL A;  2LR8 A;  1ENH A;  2O8K A;  5FLM J;  3S14 J;  5HBU A;  2H8R A;  2OI8 A;  5FKK A;  1ETW A;  2DA6 A;  3BTJ A;  3SFI A;  1CQT A;  4A93 J;  3JRB A;  1ZQ3 P;  1H88 C;  1IDY A;  3COL A;  2ECB A;  2HOS A;  3HTH A;  2YVE A;  2P81 A;  3HTI A;  1MH4 A;  2R5Y B;  3H3V K;  5EDN A;  4JX5 A;  3NAU A;  3O60 A;  3G1O A;  3F1B A;  5CXI A;  5F04 A;  4D7N A;  1JT0 A;  5DTD A;  1WH7 A;  2FQ4 A;  1F36 A;  3RZO J;  2QTQ A;  3G1L A;  4GFB A;  3VVY A;  3G1M A;  4QIW N;  2QCO A;  2KT0 A;  2CU7 A;  1JKR C;  2OF7 A;  2VKV A;  3VW1 A;  2NX4 A;  1A6I A;  5JLX A;  2NS8 A;  5FLV A;  2Y2Z A;  1A5J A;  4UDS A;  1XG1 A;  2I10 A;  5K7H A;  2XB0 X;  3NRG A;  2MW8 A;  3BT9 A;  3PO2 J;  3ZOB A;  1I6H J;  2JA6 J;  1MH3 A;  5J1U A;  1ORK A;  3B6A A;  3LSP A;  3LOC A;  4ACI A;  2G7L A;  3KZ9 A;  2ZCM A;  1IDZ A;  5M3M J;  2XGE A;  2B63 J;  5FHP A;  3L1P A;  3RD3 A;  2VPR A;  3JR9 A;  1TC3 C;  5E3O A;  4QTR A;  4JX4 A;  3OSG A;  1OCP A;  5HSZ A;  2L7F P;  1F43 A;  1SGM A;  1MBJ A;  4DYQ A;  3TP0 A;  2QKO A;  2ID3 A;  2UXP A;  2DN0 A;  2Y0S N;  1XS9 A;  4DZJ A;  2CQQ A;  5D18 A;  2MGQ A;  2ZOZ A;  1IJW C;  2CRG A;  2EZH A;  3BNI A;  3S15 J;  5EZH A;  4JNN A;  2FJ1 A;  4A3J J;  5FKO A;  5E3N A;  2DG8 A;  5EF6 A;  3SJM A;  2KDZ A;  1ETY A;  1IUF A;  5GPA A;  3RQI A;  1FTT A;  2IAI A;  2YUS A;  3BTL A;  1MSF C;  3A03 A;  1NTC A;  1T56 A;  2VUM J;  2XGC A;  4AC0 A;  4Y52 J;  3HGG A;  2ZB9 A;  1W0T A;  2MG4 A;  1WCM J;  4NEL A;  2IU5 A;  1MSE C;  3LWJ A;  2R5Y A;  3D1N I;  4A3E J;  1FIP A;  1ETV A;  4M3F A;  1FIA A;  1UI5 A;  1B8I A;  4D5F A;  2E2H J;  3GEU A;  5C4X J;  3LSJ A;  2JK3 A;  1R9T J;  3ANG A;  1DU6 A;  2M2E A;  3BTC A;  4W97 A;  2LVS A;  1JTX A;  2HDD A;  3P9T A;  4KWA A;  2OPT A;  3FK6 A;  1Z77 A;  3SDG A;  1GVD A;  2HYJ A;  3S2H J;  4GFL A;  3GBG A;  3BR0 A;  1ZK8 A;  3M3Y J;  2WUI A;  2GBY A;  2HKU A;  3KKC A;  4A69 C;  2REK A;  3O8G A;  5CW8 A;  1MBK A;  3NNR A;  4MXM A;  3BQY A;  1BJZ A;  2DMT A;  4YZE A;  1TWG J;  1O4X A;  2Y31 A;  3I4M J;  4CYC B;  3E7Q A;  3S16 J;  4RBO A;  5J1R A;  4A3M J;  1JUP A;  3AQT A;  3VW2 A;  2VKE A;  3S1N J;  4C3J J;  4ABZ A;  2PMZ N;  3CQZ J;  3IH4 A;  5EFY A;  3BHQ A;  2NOG A;  3TW6 A;  9ANT A;  2DG7 A;  3HOU J;  4JL3 A;  2LY9 A;  3LHQ A;  3BRU A;  1U8B A;  2M34 A;  3H0G J;  3QBM A;  1B72 A;  3FK7 A;  1MBE A;  4A3L J;  3BR3 A;  2EZK A;  5DS9 A;  2HOA A;  3VIB A;  1GV2 A;  3HOW J;  5JLW A;  2W53 A;  2G0E A;  5EEA A;  3GTM J;  3Q0U A;  2XPW A;  3HE0 A;  1POG A;  3FKI J;  1UI6 A;  4UUS B;  4LOC A;  2CUE A;  3S1M J;  2QF7 A;  1BL0 A;  1ZKG A;  3NXC A;  2DMQ A;  5DAJ A;  2JWT A;  5E3M A;  2NVT J;  1RKT A;  4M3G A;  3QPS A;  3BG5 A;  2HI3 A;  3C2B A;  1YRN B;  1JGG A;  3GZI A;  2HXO A;  5H9T A;  1X2N A;  3CMY A;  3V78 A;  1U9N A;  1WGX A;  2DMU A;  2G7G A;  3EUP A;  2WV1 A;  4PXI A;  3IH3 A;  1QRY A;  3HOZ J;  5D19 A;  2NP5 A;  1OFC X;  2XPU A;  3NPI A;  2QOP A;  2YU9 J;  1TWA J;  3VOX A;  4FTH A;  5C3E J;  2D5V A;  5HAW A;  3W6V A;  4A3I J;  3S5R A;  4RDU A;  2JA5 J;  1APL C;  3WHC A;  1HDD C;  2QIB A;  3HTJ A;  2DA2 A;  3QQA A;  1AKH B;  1IC8 A;  3EGQ A;  1SAN A;  1BW6 A;  2H1K A;  4XK4 A;  1MNM C;  1ZR2 A;  1H89 C;  5IYB J;  5IOZ A;  3BR2 A;  5HOD A;  5EGO A;  3JRA A;  2IBD A;  3HKZ N;  3LSG A;  3S2D J;  4GCL A;  4CYC A;  2R92 J;  3DPJ A;  1WH5 A;  2ZCX A;  5IYC J;  2YVH A;  1UG2 A;  4IHX A;  3NI7 A;  4ME9 A;  1JUS A;  1NK3 P;  4MLO A;  5EG0 B;  1JUM A;  1WI3 A;  1VI0 A;  2CUF A;  4FE7 A;  1K83 J;  1QPI A;  4JX6 A;  3C07 A;  3JRF A;  1D5Y A;  3HOY J;  3JSJ A;  1RES A;  4BKX A;  5C4J J;  3VVX A;  2JN6 A;  4IHW A;  4NN1 A;  1P7J A;  2DTZ A;  2JA8 J;  4UUS A;  3FIW A;  4M3B A;  1HOM A;  5FKL A;  5FKM A;  4HKU A;  4A3C J;  3BR1 A;  4J19 A;  1JKP C;  3A01 B;  2M0C A;  2COB A;  5FJ8 J;  5F0F A;  3G56 A;  3B6C A;  2K9S A;  5IYD J;  1RR7 A;  2L0K A;  4AUX A;  2UXU A;  1HCR A;  1VF9 A;  1PUF B;  2XSD C;  4XRM A;  1K61 A;  4V2F A;  4S0H B;  5EYR A;  3IV5 A;  3TED A;  3HBL A;  5J3L A;  4MO7 A;  4IHV A;  3IUV A;  1Q1V A;  4I6Z A;  4BBS J;  4G12 A;  5M5Y J;  1MBH A;  2K9N A;  1NK2 P;  2L9R A;  2ZOY A;  1ETO A;  2ID6 A;  3S1R J;  3VP5 A;  5F0C A;  2ZCN A;  4XRS G;  3HDD A;  3OSF A;  3JRC A;  1OCT C;  3OIO A;  2DA5 A;  3QPL A;  3PPB A;  2QWT A;  3PO3 J;  1ITY A;  4MIM A;  3B81 A;  4GCT A;  1AKH A;  1OJL A;  2NP3 A;  1X2M A;  3K2A A;  4BXX J;  3VOK A;  4QSH A;  2L7M P;  3ZQG A;  4BY1 J;  3S17 J;  2FD5 A;  3A02 A;  1BA5 A;  1DU0 A;  2R0Q C;  3BR5 A;  3DCF A;  3HM5 A;  2LLK A;  1VND A;  1Y1V J;  3Q3S A;  5F08 A;  1TWC J;  2GLO A;  5F27 A;  3LNQ A;  3GTQ J;  2D6Y A;  2Q24 A;  1LFB A;  3GTP J;  1UMQ A;  4XIC A;  1BW5 A;  2NVY J;  2VI6 A;  2XDN A;  2WGB A;  3MVP A;  4FE4 A;  3WHB A;  3LSR A;  1U9O A;  3JRH A;  5D1R A;  3CWR A;  1RPW A;  1XC5 A;  3HGY A;  5EG0 A;  2XRL A;  2LK2 A;  5F0H A;  5IP6 A;  3MNL A;  2F07 A;  3VUQ A;  4GCK A;  2PZ9 A;  1U78 A;  3CJD A;  1VFC A;  1G2H A;  4C2M J;  2G7S A;  3S1Q J;  2MSY A;  5C44 J;  2FX0 A;  5FGL A;  1IV6 A;  4NDL A;  5IPA A;  3HB9 A;  5GPC A;  5M3F J;  2Y9Z A;  4DYC A;  1GT0 C;  1S7E A;  2X48 A;  3JRD A;  4A3D J;  1IRZ A;  3O8H A;  3KKD A;  2AO9 A;  4M3E A;  4W1U A;  4B1R A;  1JTY A;  3A01 A;  3I4N J;  2HYT A;  5J1Y A;  1I3Q J;  3PAS A;  2EH3 A;  3HOX J;  3BG9 A;  1HDP A;  1ETQ A;  2NVQ J;  2DA4 A;  4GFK A;  1E3O C;  2DA3 A;  4AC6 A;  4B4C A;  2DMN A;  4MFD A;  1LE8 B;  5FKN A;  4A3K J;  5FMP A;  1JT6 A;  1PUF A;  4A3G J;  2TCT A;  3KNW A;  3ZQI A;  4IHY A;  3FRQ A;  2ECC A;  1ZGW A;  3JRI A;  2ME0 A;  4JKZ A;  1TWH J;  3CDL A;  2DJN A;  3TW7 A;  3Q0V A;  2X9D A;  4M3D A;  5BNG A;  3ON2 A;  1MBF A;  2CJJ A;  1GV5 A;  4IEJ A;  2E2I J;  2GM4 A;  2GUH A;  2OER A;  2RAS A;  5C4Y A;  3E7L A;  1B8I B;  2JJ7 A;  2DA7 A;  3ZQH A;  4Y7N J;  3JRG A;  2EQR A;  1H8A C;  5IOY A;  4C3H J;  4D7M A;  4B3A A;  4ICH A;  4AF5 A;  2Y30 A;  4A3B J;  1ZTR A;  2EZI A;  5GP9 A;  1HLV A;  3RZD J;  2NVX J;  2R5Z B;  1MBG A;  1JJ6 C;  3LJL A;  2N8G A;  1IG7 A;  3T6N A;  3RKQ A;  2LD5 A;  5E3L A;  3AQS A;  1ZR4 A;  2E2J J;  1LFU P;  1ETX A;  2HXI A;  4CGR A;  5EZG A;  2R7Z J;  3G7R A;  2XPV A;  1JJ8 C;  3GTO J;  2DMP A;  3CCY A;  4FCY A;  3JRE A;  2IEK A;  1IGN A;  2UXO A;  4M6V A;  4JYK A;  2O7T A;  3PM1 A;  3HOV J;  3Q0W A;  3BQZ A;  5M5W J;  1FTZ A;  3BTI A;  2AHQ A;  2XB5 A;  1FJL A;  2JA7 J;  3BJB A;  5AQC A;  2G3B A;  5CXG A;  1ETK A;  2WAQ N;  5F1J A;  2UXI A;  5K7Z A;  3ANP A;  3MKL A;  3IH2 A;  4DW6 A;  4FIS A;  3V6G A;  2TRT A;  2WB1 N;  2V57 A;  3ZQF A;  2LFB A;  4V2G A;  3GTK J;  1YRN A;  3HIM A;  1I50 J;  3HEF A;  1B72 B;  1RET A;  2RAE A;  1HF0 A;  2FBQ A;  1QVT A;  2M9H A;  2W48 A;  1LE8 A;  1AU7 A;  4EEF G;  3GTG J;  1UHS A;  4I76 A;  4AYB N;  2GFN A;  2LKX A;  3HTA A;  3BCG A;  4JP0 A;  2GEN A;  2CQX A;  2O7O A;  2YS9 A;  1Z0X A;  2LP0 A;  3TP3 A;  3UKG A;  2K9Q A;  2R93 J;  1FEX A;  3MN2 A;  3K7A J;  3NAR A;  3GTL J;  2L7Z A;  2O9L A;  1Y1W J;  2PBX A;  1JKQ C;  1GDT A;  4X6A J;  4DYR A;  3DEW A;  1JKO C;  4MK6 A;  2ME6 A;  4DZP A;  3QKX A;  5IP7 J;  1X58 A;  2E1O A;  4XRS A;  3OOU A;  1W0U A;  2R5Z A;  4L62 A;  3VW0 A;  3BR6 A;  3VPR A;  2EZL A;  2RHA A;  5M5X J;  3F0C A;  4XID A;  4BBR J;  5K7F A;  4MFE A;  3ON4 A;  1RKW A;  3CRJ A;  4X1E A;  2Y9Y A;  3BG3 A;  3RH2 A;  5IP9 J;  1EF4 A;  2X6O A;  3GTJ J;  4BY7 J;  1SFO J;  1P7I A;  4C3I J;  5EGO B;  2K40 A;  4UUT A;  4L5E A;  2NS7 A;  1GUU A;  1T33 A;  2HQ5 A;  3ZQC A;  3FIS A;  2M8G X;  5K58 A;  2LTP A;  1AHD P;  2JMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...