2Y2ZA

Ligand-free form of tetr-like repressor simr
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
238
structure length
238
Chain Sequence
VSIWMHPEPAGRRSARSHRTLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE REPRESSOR SIMREG2
publication title Structures of the Tetr-Like Simocyclinone Efflux Pump Repressor, Simr, and the Mechanism of Ligand-Mediated Derepression.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Transcription
total genus 87
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y2zA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2y2zA02
2LK2A 5IYDJ 2R5ZB 3BT9A 2WV1A 1F43A 3JRHA 3BR6A 2DMPA 3CCYA 5E3OA 2Q24A 2DA5A 1QVTA 2HDDA 2TCTA 3S5RA 3OSGA 2FJ1A 4A3BJ 3ANPA 1WCMJ 4KWAA 4IHWA 1B8IB 2G0EA 3HTHA 4A3CJ 1JGGA 1HDDC 4JX5A 5E3NA 3JRIA 3NXCA 2M0CA 3PO2J 3GEUA 1QRYA 2IU5A 3IH2A 4FE7A 3L1PA 1MSEC 5FGLA 2CUFA 1DU6A 2ZCMA 2R5YB 1Z0XA 1GUUA 3PO3J 5M3FJ 1MBFA 2XSDC 1A6IA 3TP3A 2PMZN 3A03A 1X58A 2EQRA 5F27A 5HODA 1ETVA 2K9SA 5EG0A 2LD5A 3S1MJ 5EGOB 3QBMA 3O60A 1T56A 5AQCA 4XICA 5J1UA 2DMTA 2E2HJ 4D7NA 5J3LA 1UHSA 2DN0A 2JA5J 5F04A 3NRGA 3OOUA 4CYCB 4BXXJ 1SGMA 1RETA 3KNWA 2CQXA 3FISA 4A3FJ 1U9NA 2CQQA 5EF6A 1T33A 4GFLA 2Y31A 2NVTJ 5IP6A 3LOCA 4A3DJ 2VI6A 3S14J 2EZLA 2B63J 4V2GA 5C3EJ 3G7RA 2H1KA 3COLA 2V57A 1MBGA 5CXGA 3QKXA 2R5ZA 4ABZA 4C2MJ 4A3IJ 2REKA 2DG7A 4FCYA 2K9QA 5IOZA 2FD5A 3HTJA 3S16J 1ETYA 3Q0WA 3V78A 3VW2A 5M5WJ 1JKRC 3IH3A 3PM1A 1ZK8A 5GPAA 4AF5A 2L7FP 4FISA 3K7AJ 1ZKGA 2JK3A 3VW1A 2L9RA 5DS9A 3GTMJ 3RZOJ 3LWJA 4GCLA 1I50J 1ETKA 3MNLA 3GTGJ 1Z77A 3ZOBA 3EGQA 2HOAA 2N8GA 5IPAA 2YS9A 2WUIA 3VOXA 1FTZA 3IH4A 4HNVA 4CGRA 1H89C 1JTYA 4M3FA 3G56A 5M5YJ 2ZOYA 4L62A 3HKZN 1JKQC 3VVYA 1RKTA 1ETQA 4Y52J 5DAJA 2UXUA 3FKIJ 3HOVJ 3VVZA 1JJ6C 2RASA 1D5YA 3JSJA 2DMNA 1HF0A 5M3MJ 1UMQA 3FIWA 3T6NA 2JN6A 3VUQA 2CUEA 2JMWA 3NARA 2HXIA 5EG0B 3S1QJ 3C2BA 5EYRA 4AUXA 2WAQN 3E7QA 1R9TJ 2XPVA 4A3GJ 3BNIA 3IUVA 3TP0A 4QTRA 1HDPA 2JA8J 2DA6A 3I4MJ 3UKGA 3F1BA 2LVSA 3S1RJ 2NVQJ 3NI7A 3VIBA 2COBA 1B72A 1I3QJ 5CW8A 1IUFA 3HOWJ 1ENHA 1S7EA 2NVXJ 4JP0A 1QVUA 4JKZA 4QSHA 2IEKA 1BW5A 5D1RA 2ZB9A 3ON2A 3DCFA 3BR1A 5IP7J 2CU7A 4MLOA 3CWRA 3LSPA 2GFNA 3GTPJ 1LE8A 2QWTA 2XPWA 2QOPA 2EZIA 4UDSA 4MK6A 1AU7A 2GLOA 3BJBA 2X48A 3BTJA 3JR9A 3M3YJ 4IEJA 4IHVA 5DTDA 2XPUA 3JRCA 1RKWA 2XDNA 3F0CA 2HKUA 3CRJA 2JJ7A 5C4XJ 2DTZA 4HKUA 4RBOA 5GP9A 2OI8A 4YZEA 4AC6A 2GBYA 1IG7A 1JJ8C 2ZCNA 3ZQFA 1VNDA 4DZJA 3ANGA 3S1NJ 2RHAA 3GTJJ 3LHQA 1FIPA 3WHCA 3HEFA 3SDGA 3HOZJ 5C4JJ 3CJDA 4X1EA 1APLC 3C07A 3GTQJ 3VP5A 5C4YA 3KZ9A 2HI3A 5IYCJ 3VPRA 4X6AJ 2R7ZJ 2DA2A 1JT0A 4M3GA 2ID3A 3BTCA 3KKCA 1SFOJ 2DJNA 3JRDA 3HE0A 1GT0C 5D19A 2HOSA 1XS9A 3Q3SA 3TEDA 4NELA 5K7HA 1NTCA 3HOUJ 3GTLJ 3BCGA 3BR3A 3DEWA 5K58A 1BJZA 1FJLA 3BQYA 2VUMJ 2G7LA 4LOCA 3GBGA 2IBDA 3ZQIA 1B72B 3G1MA 1IGNA 4DYQA 3BTIA 3BQZA 2EBIA 2ECBA 1BA5A 1ZTRA 2MGQA 1X2NA 5EZGA 2FX0A 3JRFA 3RQIA 2XRLA 3GTOJ 5EFYA 1W0UA 2QKOA 5CXIA 2L0KA 2UXOA 3B6CA 5C44J 3V6GA 3O8GA 3ZQCA 4BY7J 1MBKA 3BG3A 3G1OA 1LE8B 5FKOA 1YRNA 2OPTA 4A3JJ 1PUFA 3LJLA 3HTIA 3AQTA 4M3BA 3A01A 1WH7A 2AO9A 3CDLA 4JL3A 4M3EA 2O7TA 2GM4A 5J1YA 4M3DA 1W0TA 5F0CA 3CQZJ 1TWHJ 4XRMA 3JREA 1I6HJ 1IDYA 2HXOA 1HOMA 4FE4A 1JUPA 5F08A 5IYBJ 3HOXJ 3NAUA 4MFDA 1XG1A 2Y0SN 5EDNA 4A93J 3ZQHA 4DZPA 2QIBA 3PASA 4B4CA 1K83J 3QQAA 4Y7NJ 3BR5A 1LFBA 3O8HA 4A3LJ 2NS7A 4B3AA 1RPWA 4MFEA 3JRGA 4D5CA 2DA3A 5H9TA 5FKMA 2XGDA 2GUHA 3MKLA 4FTHA 2NP5A 2EH3A 2G7SA 4B1RA 4XRSA 1ETWA 3RH2A 4D5FA 4A3MJ 2AHQA 3FK6A 1ETXA 2MW8A 4BKXA 1AHDP 9ANTA 3FRQA 1X2MA 4ICHA 3D1NI 1Y1VJ 2XB0X 3HBLA 3JRBA 1TWFJ 1H8AC 4UUSA 1GDTA 1ZR2A 1HLVA 4A69C 1DU0A 5JLXA 1ORKA 2UXHA 4C3JJ 2HOTA 1MBJA 5E3LA 3Q0VA 1WGXA 2VKEA 5FKLA 3SFIA 3SJMA 3EUPA 2ECCA 3M4OJ 3RD3A 3Q0UA 2XB5A 1IV6A 3HM5A 3CMYA 2NS8A 2W48A 5F0HA 1VI0A 4V2FA 2ME6A 4GFBA 2NOGA 4XK4A 3PPBA 5EZHA 2IAIA 3LSRA 2CJJA 4M6VA 2QTQA 1LFUP 3BR2A 1JT6A 1VF9A 3BTLA 2M2EA 4J19A 2PZ9A 3HGYA 2VKVA 2LKXA 1K61A 3AQSA 2G3BA 2FBQA 4GCKA 2NVYJ 3ZQGA 3RZDJ 1YRNB 1TWCJ 2QF7A 2NP3A 2EZHA 2LFBA 2XGCA 3H0GJ 1PUFB 4JNNA 1NK2P 1O4XA 3A01B 5FLMJ 2P81A 2LY9A 1RR7A 4L5EA 1ZQ3P 2G7GA 3NPIA 1SANA 4C3IJ 2O8KA 4BY1J 2M9HA 4JX6A 1IRZA 1EF4A 4MXMA 2HYJA 2KT0A 2L7MP 1JKPC 1JUSA 1U9OA 5FJ8J 3FK7A 5FHPA 1U78A 4GCTA 2LLKA 4MO7A 1E3OC 2I10A 1IDZA 2OF7A 3A02A 5FKKA 3RKQA 2RAEA 2WB1N 1XC5A 4NDLA 1AKHA 3HOYJ 1OFCX 1IJWC 1H88C 2LR8A 2Y2ZA 1MNMC 4AYBN 2E2JJ 2LTPA 1TWGJ 3HDDA 1UI6A 3KKDA 4PXIA 2GENA 3LSGA 2DMQA 2F07A 2X6OA 1Y1WJ 3VOKA 3H3VK 4S0HB 3HTAA 1MH4A 4I76A 2DMUA 2W53A 1GV5A 4DYCA 1MSFC 2YVEA 2ZOZA 4XRSG 2D6YA 1F36A 2XGEA 2JWTA 2E19A 5F0FA 4UUSB 1ZGWA 2DA1A 4UUTA 3B6AA 1ZR4A 2MSYA 5K7ZA 3GZIA 2EZKA 3GTKJ 1NK3P 1FTTA 2DG8A 2YUSA 2CRGA 3S2HJ 1P7IA 1Q1VA 1FEXA 2Y9ZA 1JTXA 1U8BA 1ITYA 4ME9A 4XIDA 4AC0A 3WHBA 3B81A 5FKNA 4ACIA 1UG2A 2DA4A 2ELKA 4RDUA 1TWAJ 2E1OA 3IV5A 2TRTA 5D18A 3QPSA 5F1JA 5J1RA 4QIWN 2UXPA 3BG9A 5BNGA 3VW0A 3BG5A 2JA7J 2E2IJ 2YU9J 1MBHA 3K2AA 1HCRA 2L7ZA 1MH3A 2K40A 4G12A 2M34A 3TW6A 2DA7A 5K7FA 3OSFA 1B8IA 1TC3C 3OIOA 4DW6A 1JKOC 5FMPA 1RESA 1FIAA 3S15J 2O7OA 4JX4A 1ETOA 2UXIA 1JUMA 1UI5A 2ZCXA 3HIMA 1OCTC 1VFCA 1BL0A 2R5YA 3HB9A 4W97A 5E3MA 3W6VA 4A3EJ 5HAWA 4IHYA 4DYRA 2O9LA 3MN2A 1GV2A 2OERA 5EGOA 2ID6A 3ON4A 3VVXA 4D7MA 5IOYA 3NNRA 5M5XJ 1GVDA 1POGA 2X9DA 3HGGA 1QPIA 2QCOA 3I4NJ 5HSZA 1AKHB 2VPRA 2JA6J 4NN1A 2MG4A 1BW6A 5GPCA 2HYTA 4IHXA 2YVHA 2LP0A 5HBUA 5EEAA 4W1UA 2R92J 4CYCA 3JRAA 2PBXA 4EEFG 3LNQA 3BRUA 2D5VA 5IP9J 1WH5A 1MBEA 2H8RA 2M8GX 1WI3A 4GFKA 3S17J 2ME0A 1P7JA 1A5JA 4BBRJ 2R0QC 4I6ZA 1WPKA 1OCPA 1OJLA 2HQ5A 3BHQA 5JLWA 5FLVA 2Y9YA 2R93J 4C3HJ 3G1LA 3TW7A 3ZQLA 3BR0A 3MVPA 3QPLA 2K9NA 1IC8A 1G2HA 3P9TA 2KDZA 2NX4A 3DPJA 4BBSJ 1CQTA 2Y30A 3E7LA 2WGBA 4A3KJ 3S2DJ 3LSJA 4JYKA 4MIMA 2FQ4A
chains in the Genus database with same CATH superfamily
5J40A 3K4CA 4RAGA 1ZYRF 4E4HA 1XGSA 5LGNA 2LY1A 3TDUC 4BQNA 2Q24A 2A3SA 2GIZA 5KAIC 1QVTA 5GAHJ 2HDDA 3S5RA 5DUKA 1U6GA 3OSGA 3GYHX 3V8JA 1BR2A 1IN6A 1LPQA 3L2VA 3WG9A 3VSLA 4IHWA 4XMYA 3BLYA 2G0EA 5LGUA 5E3NA 2M0CA 4GCVA 3RQ4A 3IH2A 4FE7A 2GA1A 2MC4A 2CUFA 1DU6A 2VPLA 2R5YB 1Z0XA 2DPDA 2E1MC 3S8PA 3A03A 3OYJA 2EILH 2CQ7A 1ETVA 1P4WA 4A2UA 4WX9A 2LMDA 1USTA 1AWCA 3S1MJ 5EGOB 3EDPA 1JHFA 4BH9A 4BACA 1Z3YA 3VDXA 3G2BA 5CYVA 3K6GA 2DMTA 2ZNZA 3ELKA 5J3LA 3V7SA 1FZPB 1UHSA 4AVPA 2DN0A 5F04A 2L5QA 3MD2A 4BXXJ 1DPUA 1SGMA 3TKYA 3FISA 1U9NA 2JVGA 4PCQA 4L9VA 1O7LA 3CLOA 1FOKA 2EZLA 4EATA 2B63J 1I1SA 2OU2A 4V2GA 4FHTA 3CCRI 3CDHA 5D6FA 3LSMA 3M8FA 4I01A 5CXGA 3D5LA 1J75A 4C2MJ 4A5NA 4HNTA 2REKA 4FCYA 2LDUA 3KZIC 5IOZA 3ERED 5H6RA 3S16J 2JPCA 1ETYA 3WU2C 1U5TB 3CJNA 3HRUA 3VW2A 1UCRA 3K4LA 3TO7A 1ZK8A 5GPAA 4FISA 3K7AJ 3M8JA 1SFUA 3EUKL 2QSHX 3VW1A 5DS9A 4GCLA 3KX2A 1FBUA 5TRDA 3OYAA 4L9NA 4NUBA 4HW0A 3HC7A 3F6VA 3GTGJ 2HTSA 1WHUA 2DDAA 4HA8A 3EGQA 1MIJA 2N8GA 2VODA 4HNVA 4CGRA 2QBYA 3BJ6A 2K86A 4B43A 4CXFA 1M1EB 1G8XA 1BC8C 5M5YJ 1D3YA 2RREA 1WJ5A 4E7IA 3BDDA 2ZOYA 4L62A 1QHGA 3HKZN 3NQOA 4ZDLA 5H6QA 5DAJA 1JJ6C 2QM3A 3ASNH 3GVAA 4ZYDA 2XKOA 1BN5A 2VC0A 3HL2A 4KIBA 4BHCA 4AU7A 3DTEA 3U1DA 4DQ2A 1MDMB 1X3UA 4IVNA 2JMWA 1KZHA 1IXCA 1SD7A 1BR1A 3C2BA 5EYRA 4AUXA 3P5JA 2XAJA 3H0DA 3BNIA 5DD8A 3U2RA 2JA8J 2DA6A 3I4MJ 3UKGA 3HYIA 2LBFA 5F1RA 2ZJRF 3HTSB 2LVSA 4YG2F 1I3QJ 4HF1A 5CW8A 2W82A 1IUFA 1R23A 1ENHA 3MFKA 1K6YA 4IRVA 3QPHA 4UV8A 2IEKA 1ZLKA 3CUOA 1BW5A 2ZB9A 2LNBA 3DCFA 2VIXA 2KIQA 2CU7A 3P9CA 2F2EA 4MLOA 2BBYA 4RB0A 3N05A 3HSRA 2PI0A 1UAAA 2GLOA 4OIOF 4HF2A 3BJBA 2ZJ2A 3S3MA 3CD6I 3CMEI 3JRCA 1RKWA 3H9GA 5HLHA 1OR7C 2QVOA 2JJ7A 3CC2I 4LMYA 2HKOA 3DPUA 3SYTA 2OI8A 2STWA 4AC6A 2GBYA 4Z2YA 2ZCNA 4Y13A 1H9TA 3ANGA 1BOBA 3S1NJ 1QU3A 2RHAA 1E0EA 2FBIA 3LHQA 1VTNC 2JUGA 1FIPA 3WHCA 4G9YA 4A5MA 2DJIA 1TP4A 3CJDA 3WE3A 2R7WA 3AL0C 1YLFA 4H4KC 2R7FA 1WKMA 2IVMA 5E20A 4U0YA 5IYCJ 3VPRA 5KNLA 1NH3A 3PJRA 1YO5C 2DA2A 1JT0A 4CDGA 4XLCA 3DPTA 5A2QZ 3JRDA 1GT0C 2HOSA 1J0RA 4N9IA 3OV8A 4F7ZA 3ERMA 2Y0MA 2CUJA 3VYRB 1NTCA 1S7OA 1J59A 1PDNC 3LSIA 3DEWA 5K58A 4FASD 1FJLA 2OA4A 2VUMJ 2G7LA 5HDKA 3I59A 2P5KA 5KHDA 3BOQA 1OMIA 2BVLA 3EPZA 3O3KA 4OD4A 2IBDA 2XAGA 2B3WA 5DD4A 2NVUB 4RMNA 1IGNA 1STZA 3BTIA 1GLNA 1YX5A 2FE3A 3GCMA 4L0YB 3GTOJ 1XDUA 2M45A 5CXIA 3O8GA 2FEZA 2OBPA 3BG3A 5FLXK 3KP4A 1LE8B 2Z16A 1YRNA 2M4KA 1PUFA 4GDFA 3HTIA 4U9NA 3AQTA 4M3BA 1MJAA 2E35A 4JL3A 4M3EA 6PAXA 1YX3A 3RIRA 3M8EA 4RGXA 4Y33A 3DQVC 3CQZJ 3CCLI 1DUXC 4KYWA 2EFOA 1DDNA 3L2QA 5ICFA 4DJAA 3NAUA 1S72I 5ICCA 4MFDA 1C0WA 1XG1A 5EDNA 4B4CA 3K69A 1LFBA 1EV7A 4A3LJ 2O0YA 4AVZA 2MC3A 3PL8A 4E7SA 3M1CA 4OOIA 5CKTA 3SZTA 1ZRCA 1IUYA 3R4KA 2FRHA 4HYEA 3SZGA 1SFXA 4E7ZA 1LVKA 2NP5A 1OISA 4XRSA 5LRSA 1W1WE 3ZN1A 4GYIA 1VQ5I 1LFPA 2AHQA 3H35A 1T0FA 1ZGAA 1AHDP 5EJCA 1O3QA 1IF1A 4IRGA 1XSVA 2L54A 2UV1A 1MMSA 2VLAA 3D1NI 5K5QA 4I2OA 1X1CA 4UUSA 1T95A 2OCCH 3W6KB 5BPDA 1DU0A 5AONA 4AD9A 2HOTA 4HQMA 1LJ9A 3SFIA 3SJMA 1E17A 4C9YA 3M4OJ 2FNPA 5JR3A 2EFNA 4RA2A 1YIJI 2GQQA 4CCJA 3HXLA 2M4GA 3DKYA 1R49A 4L18B 2IA0A 1VI0A 4ENNA 3K1PA 3QP6A 4X0GA 1I1GA 2QQ8A 3RTRA 2R4GA 1VZ0A 1GXQA 4IOCF 2A61A 2PBIA 1FNNA 2CJJA 2EK5A 2VQHA 3BZKA 1LFUP 2RGVA 1KYWA 3DTKA 4HX7A 3BTLA 3ISPA 4BHPA 1BC7C 1R58A 4GCKA 2NVYJ 2QF7A 2LFBA 2XGCA 4G6TB 4EM1A 3OYEA 2KL4A 1SVMA 1F4KA 5FLMJ 1QZZA 2W1OA 1RR7A 1ZQ3P 1XCBA 3BPXA 3ML6A 2O8KA 4JBAA 1T39A 4U9LA 1W5TA 1EF4A 4PZJA 1JUSA 2MA3A 1U9OA 1Z1DA 3FK7A 3RKYA 5LBQA 5FJ8J 1LUJB 1H9GA 3GO5A 3HSEA 2OF7A 4IOAF 5JFRA 1IDZA 5FKKA 4FX4A 2CW7A 2A6EF 2RAEA 3HOYJ 1OFCX 4IQ4A 2P8TA 2CQNA 1IJWC 1MNMC 4PSWA 3NS4A 2LTPA 1TWGJ 3KPHA 3KKDA 3N97A 2PMHA 1HKQA 2F07A 4PXIA 2ISYA 1JI8A 1X19A 3H3VK 1IRFA 1T38A 1BR4A 2R7TA 3HTAA 5BS6A 2DMUA 2XAUA 3E0JB 2Q8KA 3P9IA 4HSTA 3J7AY 3GFJA 1MSFC 4XRSG 4O5VA 3H5AA 1F36A 2H6BA 2JWTA 5F0FA 2E7XA 4LK1F 3K4NA 2PFBA 3FXMA 2F4MB 2OQGA 4OAYA 4YFNF 1R1UA 2L01A 1Y0NA 1Y56A 2CWEA 3K4JA 2DG8A 3ZQ7A 3CTAA 3S2HJ 3BP8A 2XDVA 2IS2A 3HUGA 1JTXA 2COMA 3ZMTA 1U8BA 3GZNB 2ELKA 1L0OC 3IV5A 4D1QA 3OYIA 2TRTA 3GFIA 2EA2A 3A0BC 3IWZA 2ZJQF 4OU0A 5D18A 5F1JA 2DQRA 1UJ8A 4FX0A 4BJ6C 3CMAI 3D0SA 1MBHA 3F8MA 1UB9A 1HCRA 2L7ZA 2IS1A 2K40A 2M1BA 2M34A 2QUFA 3R6SA 5K7FA 3OSFA 2VXZA 5LGTA 1RESA 4M9XA 2VBYA 3S15J 1J09A 2O7OA 3EETA 4BQQA 2UXIA 2FXAA 2CO5A 2K27A 3QWLA 1BL0A 2KZGA 3QYFA 2HU9A 3HB9A 2BOLA 5E3MA 2W7NA 3FM3A 2W4SA 3OMYA 3IL2A 1U3EM 1ULYA 2HZTA 2O9LA 1R00A 3ON4A 2CV2A 3CMMA 1POGA 3I4NJ 1AKHB 2FBHA 1MJ9A 2MG4A 3A4CA 3A1YA 2UXXA 3LQQA 3ZMVA 5L3BA 3WTWC 1XMAA 2ZXIA 2RVCA 2ZNYA 4EQQA 3ASOH 2P5VA 3S93A 2D5VA 1VQ7I 1MBEA 4L9TA 2A07F 1WI3A 2ZBKA 5FRNA 5LEJA 5HOOA 2G7HA 3DBHB 2Q2EB 1FYKA 3S17J 1P7JA 2IPQX 2R0QC 2ELJA 3KIOA 4I6ZA 1WPKA 5E1WA 2DO7A 3L2WA 3MQ0A 1YJ9I 4AM3A 4G6QA 1EJ9A 2R93J 4ZTFA 4Z6YA 1SVOA 5AIPA 2E1MB 4PFOA 3G1LA 3GF2A 1MNDA 3QPLA 4HX8A 4XLAA 3RSNA 2VC1A 1SMYF 4A3KJ 3TBIA 4MIMA 1HW2A 2LK2A 3ZGKA 4DOZA 4E7JA 4LB5A 4OIQF 3BT9A 2JQ7A 4RB3C 2HPIA 2HOEA 2WV1A 3G3ZA 3DKWA 1F43A 3JRHA 2DMPA 3KYLA 3QP5A 1I39A 4BHBA 3HHHA 3MZ8A 4BDZA 2BW3A 5HLIA 3ANPA 1G3TA 1WCMJ 4LG0A 4KWAA 3FDYA 4ETSA 1JGGA 2V6CA 4JX5A 4P55A 2IXSA 1OCZH 3PNVA 4OMZA 1QRYA 2IU5A 5FGLA 2V4JC 4EMSA 2PEXA 3E6BA 1MMGA 3QOPA 2LC2A 3DLAA 2F6CA 2XSDC 4II2A 3SFZA 3IKVA 2PMZN 3BWGA 2DFIA 3BPVA 1LKXA 4B8XA 4L5JA 3GUDA 3G71I 2GXBA 3F72A 2M87A 3FF5A 1FOXA 4B3XA 2Y75A 5E1XA 4HBLA 3IUOA 2FA5A 1UELB 4CO8A 1O3TA 5E8IA 1XGOA 2HNHA 3OOUA 2A5YB 2ZFUA 3OWTA 1RETA 5ILSA 2R3SA 3RDIA 4DGWB 5L3DA 5CVIA 2Y0SA 1T33A 4GFLA 2V1DA 5IP6A 2MABA 2ZC2A 4A3DJ 2DOFA 4BJ5C 1S7AA 3G7RA 2Z5UA 1FP1D 4XLPF 2V57A 1WWXA 4QPOA 2HR3A 2R5ZA 3G73A 2FUG2 4A3IJ 3E1SA 3RYPA 3HTJA 4CCNA 2WY7Q 3L2UA 1XPXA 1YJWI 2EIJH 5M5WJ 1JKRC 3PM1A 1UFMA 2XAQA 1TT5B 1Y6IA 1BI0A 1ZKGA 1MGTA 2JK3A 2HQNA 1ON2A 2AQEA 4BE0A 3JSOA 1WVRA 1I50J 1DGRM 1ETKA 1ZREA 5B5EC 4CHUA 3H3UA 4XQFA 1Z77A 2H8WA 2RV8A 2HOAA 2W25A 1OKRA 2YS9A 1FTZA 4XSZF 1HSTA 5HLGA 3EUHC 2CMPA 2F5VA 4R8HA 1O7FA 2M3AA 3JAMK 3G56A 2BHYA 2HKXA 3V8KA 3E6DA 1RKTA 1ETQA 4Y52J 2VQLA 3PIPF 3VVZA 2RASA 1DQUA 3JSJA 5BQTA 2DMNA 2H94A 3FIWA 5TJJA 4ZYAA 3OIPA 1BJAA 3VYSB 2KQRA 4RLQA 3DU6A 4BL0B 2ZY9A 1IN5A 5JHUA 2V9PA 2OUMA 5EG0B 1VQ4I 2JA2A 3S1QJ 3T5XA 1FYMA 1TZLA 2VE8A 5DCMA 2DDBA 4U88A 4OWRB 1X1DA 4PJLA 3ABUA 2XSJC 1D5VA 2ZO4A 2NVQJ 3DP7A 2RKHA 3FZVA 3VIBA 2QSGX 2Q1ZB 3NWSA 3WU0A 1R4MB 4UUVA 3GLLA 4Y4RA 3AL0B 4QSHA 2FOKA 3KLOA 2GOXB 4CCMA 1VQNI 2RNGA 5IP7J 2WB1A 3CWRA 5GAEJ 3I9V2 3DEEA 4GXOA 1O3SA 2QWTA 4GYGA 4AYBA 1XMKA 4UDSA 3QAHA 1AU7A 2XV4S 5FFZA 4BQOA 3JR9A 3L9FA 3KYCB 5DTDA 1YW8A 3F0CA 1Q1HA 1SFKA 1WJAA 1ZHFA 4JK1X 2HKUA 3CRJA 1D1CA 2E71A 4I7HA 3WTUC 3FMSA 1X1AA 1NG7A 1YS6A 4HKUA 2BE5F 4RBOA 5GP9A 2B7EA 5L3GA 5H2FC 4A12A 1JJ8C 1UHWA 5DM7F 1VNDA 2DFFA 1FY7A 3OIQA 2ETHA 3I56I 2LRDA 3F8CA 5JI6A 1W36D 3KEOA 2JPBA 3HOSA 2W24A 1K78B 4MTEA 3SDGA 2BEOA 4PUSA 2XF5A 5K5RA 2JRTA 3C07A 3BCAA 1IV8A 4YIFA 2I8DA 3KZ9A 2MD0A 2VONA 3CZ6A 1FSEA 3C3WA 1U8RA 2Y48A 5E18F 1A35A 3KKCA 2DJNA 4UNOA 5J8CA 3HE0A 1GXPA 3LA3A 4RLFA 1HXDA 2DT5A 3CP8A 4KT6A 4FQGA 3HPGA 3QYEA 3F21A 3GTLJ 3HRMA 1DGWY 2J5OA 4WF2A 1T6SA 1XN7A 2EIMH 1FWZA 1W7PB 2YSRA 3LSKA 4UXNA 3ROUA 5HNHA 3KP3A 2FBKA 2OC6A 3K70D 1B72B 5BOXA 2ECBA 2BXYA 1ZTRA 2MGQA 1X2NA 3DPLC 1D1AA 3WGHA 1TLHB 2XRLA 1D0XA 2E34A 2WV0A 2L0KA 2X51A 3B6CA 5C44J 1Z3XA 2AXLA 3GWZA 4HDVA 3VSKA 1S6LA 5FKOA 2OPTA 4Q48A 1MD0A 4ZZDA 3RKWA 3A01A 1E2XA 1B9MA 2CFOA 3FKJA 2AO9A 3CDLA 1HKTA 2O7TA 5J1YA 3HRTA 1F5TA 1YOVB 4M3DA 2KJCA 3SZPA 3ZMUA 1W0TA 3J80K 2FMYA 2DCEA 3KYDB 2CQKA 3JREA 1I6HJ 1IDYA 3AG2H 1OCOH 2QENA 4KJZA 5F08A 5CPRB 1I6XA 2K7LA 3AG4H 3CJQB 3K10A 3Q5FA 4ON0A 3PASA 4HEA2 4P5OA 2Z1DA 4GGGA 1K83J 3O8HA 5FO5A 1MJBA 1EKEA 4B48A 4QLCU 4EGYA 3VB2A 3OYGA 5DCFA 3FXOA 2DA3A 1D8KA 5H9TA 2KDOA 5FKMA 3AKZA 1KQ8A 4HSRA 1TQPA 2GUHA 3RKXA 1SFEA 4B1RA 1LQ1A 3RH2A 4D5FA 2E1NA 2MW8A 5DUIA 3ABLH 1YTYA 3GLXA 4LITA 3FRQA 3JRBA 2XB0X 4XRFA 1H8AC 4HOBA 2QQ9A 5CQGA 2KMUA 1BI1A 1HLVA 1GDTA 2PJPA 1ORKA 2YU3A 3H36A 1N75A 1MBJA 1O57A 2O3FA 3OYNA 3Q0VA 1E3HA 3F8BA 2HVQA 4UVCA 4NC7A 1V5GA 1IV6A 3MMYB 2EJRA 1MW7A 5AIQA 2IP2A 4QWQA 2V79A 2W48A 1RUNA 5A2QK 1ZRFA 3IKTA 2UWMA 3TOAA 4HQEA 3M7GA 4M6VA 2QTQA 1TQIA 2PQ8A 1VF9A 2W84A 2IT0A 2PZ9A 2DOEA 2G3BA 1IN4A 5DV5A 3ZQGA 2FBQA 2L2OA 3K1MA 4M6YA 2NP3A 4JNNA 2IGNA 3G4SI 4L5IA 1CF7A 1O4XA 2IRFG 4KUMA 3M07A 3TO9A 1D1BA 1VQOI 4CH7A 3HSFA 1YS7A 5FD6A 3K70C 4C2MA 1IRZA 2M9HA 4BEHB 2HYJA 2KT0A 2VJJA 3I55I 4HLYA 5LHGA 1U78A 1ZAOA 2LLKA 3DLLF 1FX7A 2E36A 2QGUA 2W00A 1P2FA 1E3OC 2IGOA 1FPQA 5FD5A 4RB1A 3RKQA 1HBXG 2CYYA 1MMAA 4EJWA 3FWEA 4U7DA 5D4RA 2CV1A 2XAFA 2VN2A 4DBRA 3VTIA 2DMQA 2DQLA 1R36A 1Y1WJ 1K79A 4NQWA 3V7CA 2VBZA 1P4XA 3BG6A 3HG9A 3KP5A 2W53A 1KYZA 1V4RA 2P4WA 2VASA 5L3CA 3OOPA 2YVEA 5LFAA 2A2FX 2ZOZA 2D6YA 3PNYA 2Y69H 2CH0A 2XGEA 2J5PA 1ZGWA 3KEQA 2FOWA 3B6AA 4XM3A 3F22A 2PX9A 4OD5A 2MSYA 1RI7A 1FLIA 3I58A 2D1VA 4WIBA 2YUSA 3QYBA 3OYCA 2HPMA 2X6YA 3WE2A 1P7IA 3OYFA 2RDPA 4Q4ZF 2R7RA 2L7KA 1TT0A 4D0PA 3WHBA 5FKNA 4ACIA 2DA4A 2QQAA 3IAS2 4F93B 5LLQA 4KMFA 2WA0A 1TW3A 4F91B 5J1RA 2WAQA 3R61A 4QIWN 5BNGA 4S05A 1WJEA 3QRFF 3E6MA 3CUQA 1R22A 3OIOA 5FMPA 2G7UA 2JSPA 1GVJA 3H1CA 3K4BA 1PP8F 3C2HA 3LFKA 2R5YA 3OR2C 4MTDA 3FXQA 5B3SH 1IAWA 4N9HA 1O3RA 5HAWA 4KIGA 3DKXA 3MN2A 1GV2A 3OYMA 2OERA 2M30A 5EGOA 1RRJA 4MEXF 3P7NA 3NNRA 2FJI1 2MLGA 2HYFA 2X9DA 2L4AA 5M5XJ 1QPIA 3LMMA 1EH7A 2EIKH 1WJFA 5GPCA 2HDWA 1G6NA 3VOEA 3L7WA 4W1UA 1EH6A 3JRAA 2PBXA 3BRUA 3C2GA 4IQJA 5IP9J 4G7HF 2VT3A 1TNSA 3K9TA 2Z33A 4LLNA 3I71A 2X1EA 4GFKA 4BXFA 1PJRA 4WCGA 2GA2A 4BBRJ 5FLXZ 5J47A 2LG4A 3CJTB 1FBSA 1OCPA 3IRRA 4O3MA 2MH2A 3K4KA 5FLVA 2Y9YA 1ZG3A 4ESBA 3I5UA 1ON1A 1I3AA 3OL4A 4ENJA 1U5TA 4ITVA 3RI4A 2VQGA 2KKOA 3BR0A 4KN7X 2RQPA 1J5YA 1IC8A 2UUZA 2KDZA 1OCCH 4XBFA 3O6BB 4IPAA 3DPJA 2WGBA 2Y30A 3LSJA 2FQ4A 2BY3A 4ESJA 5IYDJ 2R5ZB 4IXAA 1K4TA 3CCYA 2CFXA 5CJ9A 2DA5A 1FBQA 2TCTA 2EA4A 1TL8A 2MFZA 3HOTA 2DLLA 5CLSA 4KDPA 1B8IB 3HTHA 2BZTA 4A3CJ 3F8NA 3I64A 3RJPA 1HDDC 1CGPA 2CV0A 1XGMA 4RGUA 4P1WA 3PO2J 2WBMA 3B73A 2L9SA 1V55H 1PP7U 2Q0OA 5GAGJ 1OYWA 3FBIB 1MSEC 3LA7A 4BE1A 4WXDA 1B59A 2ZCMA 4XKCA 5M3FJ 2K5CA 4KT5C 1MDMA 1JE8A 3MWMA 5HODA 5F27A 3CCVI 2K9SA 2LD5A 2IA1A 3KP7A 1YHQI 1B6AA 1RIOH 3QBMA 2BY0A 3I4PA 4F92B 2V1NA 1IO2A 4HPQA 1YITI 5LHIA 2PJRB 5AQCA 2E2HJ 3BROA 3IAM2 2V1UA 2GWRA 1FMWA 1SD5A 3BC8A 3JCUC 4CYCB 3CCUI 2UXNA 2ELHA 3K1NA 4LIUA 2QLZA 2NNNA 1WQ2A 2F5EA 5ED4A 2CQXA 2QWWA 4A3FJ 1WZ2A 4PFPA 2CQQA 2CW0F 2X0LA 4RM3A 1W4MA 2Y31A 2NVTJ 2XGXA 2VI6A 3HTUA 3KP6A 2A6HF 5DCMB 4B09A 4ZDOA 2DG7A 3BZ6A 1SD6A 4I98B 4KN4X 2WADA 2R7UA 2JSCA 3Q0WA 5HLTA 3CF5F 1JGSA 2M7AA 3ULQB 4AIJA 3V78A 2TDXA 4AF5A 4XOPA 1B9NA 5EEGA 2B0LA 1KU7A 4AWXB 3DWLE 3RZOJ 3GTMJ 4RAZA 3LWJA 3HIFA 2JTVA 2M7BA 4DBQA 3MNLA 3V42A 1HW1A 1S5LC 3OR1C 4OAZA 3ZOBA 4XLHA 4LG3A 2FF4A 2OZ6A 3MZYA 2M0MA 5IPAA 5D5UB 4YRVA 4IHTA 2WUIA 3VOXA 1RR8C 3IH4A 2DXIA 2IGKA 3KFWX 1A36A 3VFZA 2STTA 3V8LA 3VVYA 1JKQC 3I0TA 2F4IA 2UXUA 3FKIJ 3NEUA 1SD4A 2P6TA 1SVLA 2K9MA 4NB5A 5M3MJ 1UMQA 1J2XA 2HGCA 2V6EA 2JN6A 3VUQA 4OINF 2Z2SB 3DEUA 1I27A 4NHJA 2F5CA 5CQEA 2XPVA 2VOOA 4C2TA 2M5WA 4B47A 3J7YJ 1XTAA 2EB7A 2VJIA 1IW7F 4QTRA 1K7AA 2KZVA 5D6EA 4M6XA 3S1RJ 1YFHA 2DFHA 1ACIA 1BM9A 4QPQA 3LAJA 2KRCA 4XN3A 5FGMA 2ESHA 4JP0A 1QVUA 2K4BA 2OZUA 1UG0A 3MKZA 5D1RA 3PSFA 3BR1A 3VYUB 2NAZA 3LSPA 2GFNA 5L3EA 5GTHC 1LE8A 2XPWA 2QOPA 4MK6A 3BY6A 4BU2A 2X48A 3BTJA 4IRIA 4IEJA 4IHVA 3ZMSA 1ZG1A 1A6QA 3I53A 1VQPI 5H20A 3PUBA 3Q9SA 4WXCA 1Z6TA 3PFIA 5C4XJ 2EV0A 2ICWG 1N78A 2DTZA 2X1DA 1MMDA 5TGTA 1KGSA 3AG1H 3D5SC 5E8GA 3ZMDA 3J81K 4Y3OA 1GHCA 3ZXSA 1IG7A 4YZEA 1Z6RA 2K9LA 4UHTA 2NXNB 1P92A 3FXRA 2E5NA 5ICGA 3GTJJ 1BIAA 3PFYA 4RM2A 1BI3A 4G7OF 2JZYA 3W3CA 1YG2A 3W2VA 2IA2A 1J7KA 5B1AH 3WU1B 3HOZJ 1N25A 4HAMA 2X85A 1APLC 4XN0A 3DFGA 2QBYB 5C4YA 1T08B 3LSHA 2FNAA 3DBRB 4X6AJ 4M3GA 2ID3A 4DNCA 3OYHA 3LAPA 3M1EA 3I3LA 4P9FA 1Y8QB 3ABTA 4NNJA 1XS9A 2QQBA 3CO6C 3TEDA 4PJNA 4NELA 4UV9A 1R5ID 3IHUA 4P96A 5E79C 1HSJA 1QQIA 3SDBA 2V1XA 5HNFA 3HOUJ 1XX5A 4MNUA 3BR3A 1BJZA 3MAJA 3PIOF 3BQYA 4LLLA 2KIFA 2X4HA 1LDDA 4PGGA 3C7JA 1YYVA 2LBFB 3H3ZA 1F1ZA 3GBGA 4IF4A 3VEPA 4BYYA 2XF6A 3ZQIA 1V54H 4E6KG 1P4AA 4C2UA 5JVGF 2LSOA 5EZGA 3ZR8X 3KE2A 4BGDA 2FX0A 4WWCA 3JRFA 3RQIA 4K2EA 4O6JA 5EFYA 1W0UA 2QKOA 5IT9Z 3R0AA 2UXOA 3V6GA 2O5RA 1R71A 4BY7J 2L02A 3G1OA 1QGPA 1KU2A 1IRGA 3T8TA 1BOAA 1WH7A 3LQRA 3SWHA 1KONA 2ZMEA 3AAFA 2GM4A 2Z3YA 1HQCA 3U9GA 2NS0A 3OL3A 5F0CA 3ZRGA 2OTJI 1TWHJ 1HOMA 2HXOA 4FE4A 2JT1A 5IYBJ 2QEXI 4PDKA 2Y0SN 4A93J 4DZPA 2QIBA 1Z67A 2XKPA 3BZCA 4EV0A 2D1HA 3BR5A 1SC7A 3UR3C 2DK5A 1K4SA 3TQNA 1S29A 1RPWA 2WC2A 4MFEA 4NC8A 3JRGA 2YX7A 2KJBA 3KCCA 1VQMI 3CCEI 3E5UA 3MKLA 4FTHA 2P0WA 2EH3A 4NC6A 2V26A 3U21A 3JTGA 1ETWA 2G7SA 2LKSA 4HV5A 4BKXA 3VYTB 1X2MA 4ANJA 2AXTC 3HBLA 2XAHA 1TWFJ 1TTYA 1J9IA 5K5OA 3TO6A 1IXSB 4C3JJ 3HHGA 4N0BA 3DXJF 1WGXA 2VKEA 3F9KA 1YE9A 1LB2A 2VQCA 2ECCA 2K3PA 3QU3A 3WG7H 2VOPA 5KVRA 4I02A 1K6OA 1REPC 2XB5A 1Y8RB 3I59B 3DBLB 1NHAA 3BJOA 3CLQA 2JRMA 3HM5A 4PJJA 3OS0A 3CMYA 4BNCA 1KU3A 3U1KA 2NOJB 5F0HA 2K3FA 3RPQA 3OY9A 3FHNA 4XK4A 1W5SA 3PPBA 5EZHA 1XCVA 2BYVE 2IAIA 3DU5A 3S2WA 5GADJ 4EJUA 3LSRA 4XLNF 2CS3A 3CP2A 2YPRA 1ZARA 4RAFA 3AQSA 5J4VA 1KA8A 3E5QA 3FX3A 2LKXA 3ZP5A 1K61A 3RZDJ 1YRNB 1TWCJ 3FMQA 1SEUA 3H0GJ 1PUFB 4YIIA 2NRAC 2QZ8A 2FSWA 1T2KA 2R7VA 2F5FA 2LF8A 3E97A 1LDKB 2LY9A 3JW4A 4L5EA 3W2AA 2L3DA 3NPIA 4C3IJ 2DK8A 3IWFA 4JX6A 3K4MA 3KZZA 1IN8A 4MXMA 2L7MP 2XHKA 2JUCA 5FHPA 3J7ZI 1QPMA 4R79A 5JHFA 2ZSHB 5HDGA 1ZLJA 2VE9A 4E7KA 2HDCA 3CUQB 4MO7A 2I10A 4XL9A 1IZ1A 2K02A 2KIUA 2WB1N 1AKHA 2BV6A 3RYRA 1H88C 4A6DA 2LR8A 2Y2ZA 4IZZA 4AYBN 3PSIA 2CGPA 2E2JJ 3HDDA 3E3VA 2GENA 3HRSA 3LSGA 5HS9A 2XIGA 3K2ZA 3EYYA 4LGWA 2PN6A 3ZPLA 4MQ9F 4S0HB 2VBWA 2I5UA 2LOOA 3CJRB 2LREA 4OMYA 4EJVA 3H9QA 2Q2EA 3PNTA 5LHHA 4RAYA 5J4YA 5DYMA 3ESWB 4UUSB 2FMLA 3CCQI 2E7WA 3W6JB 3FXUA 2YVXA 3GEZA 3GZIA 3RCOA 2EZKA 3GTKJ 1NK3P 2HWVA 1FTTA 2DT6A 3O2PE 3HKZA 1FOYA 2CRGA 1Q1VA 4IL6C 2XROA 2Y9ZA 2R7DA 2DBBA 3GXOA 1QO0D 3L00A 4ME9A 3B81A 4AC0A 2IS6A 4UB8C 4RDUA 3J7AO 2B9SA 2LH9A 2DW4A 3H92A 3GW2A 2EFWA 2P5LC 2V9VA 2AQFA 4KA4A 3QPSA 1A31A 2VB6A 4MGRA 3VW0A 3WGIA 2JA7J 1XD7A 2E2IJ 2YU9J 4KISA 4D9JA 2CUZA 3TOBA 5D5VB 4AIKA 2C6YA 5L3FA 1XSXA 4TV7A 3MKYB 1XB4A 1MH3A 3TW6A 3TL4X 3M9AA 4DW6A 3OYKA 1JKOC 2DOAA 3CDIA 3NRVA 2RN7A 4BDYA 2XUBA 1DP7P 2ZCXA 3HIMA 4PJ0C 5HS7A 3OS2A 1YW7A 2XC7A 1S3JA 4W97A 2DPUA 2KP6A 1R1VA 4ASNA 4A3EJ 3W6VA 2DAOA 2H27A 3LWFA 5D8KB 5IOYA 3F23A 1VQ9I 1GVDA 2DT7B 5TISC 3HGGA 4ENMA 2H1LA 1FMVA 2EV6A 1W36C 3CO7C 2VPRA 4PJMA 2JA6J 2DI3A 4R1HA 3OYLA 1BW6A 2HYTA 1FC3A 2LP0A 2OV7A 1BIBA 1KQ9A 3H9JA 2BHZA 2R92J 1ZH5A 3LNQA 2KPMA 3QPTA 1WH5A 3TGNA 3GMEA 4E7LA 1R4NB 1FOWA 4NBQA 1USSA 3ONQA 2ME0A 3IRQA 5K1YA 1A5JA 1SAXA 3VODA 5D4SA 1YQAA 2IW5A 1OJLA 4BS9A 3GZ5A 4Y17A 4EM2A 1BBYA 3KETA 3CCSI 1MKMA 1OCRH 4AIDA 2WTEA 3TW7A 4DIQA 2QA4I 3ZMZA 3J80Z 3AG3H 2VJ4A 1G2HA 2ADUA 2L9NA 4ZYEA 2MBFA 3HUGB 5LEKA 4OIPF 4Q5SF 3E7LA 5GTIC 1X1BA 5DEQA 4M74A 1W7PD 1EH8A 3PQJA 1UZCA 4BAYA 1ODDA 3WTZA 4S04A 1QZYA 4YFKF 2PLYA 3BR6A 5E3OA 1MNEA 2LY2A 1RZ4A 1X4PA 1AA7A 1OPCA 3TDZC 4HLXA 3K8PC 2R7XA 5KAFC 4LIVA 2ZXWH 2FJ1A 4A3BJ 4E7HA 4LD5A 2K4JA 2X6WA 4CICA 3SXYA 1X3WB 1V5FA 3T1BA 3WTTC 3JRIA 1VQ8I 3NXCA 2DYSH 3GEUA 1YW9A 1R5HA 3L1PA 3Q9VA 4UVBA 3QU6A 5CVUA 1GUUA 3PO3J 1OR7A 1MBFA 1A6IA 3TP3A 3H5RA 1X58A 2EQRA 2OAZA 5EG0A 3RPUD 2YX4A 2EINH 2EPFA 2AS5F 4V19K 3FHZA 3O60A 1T56A 1TNTA 4WK8F 4CCKA 2JVHA 4XICA 4A6EA 4F3QA 5J1UA 2HEOA 4D7NA 3H5NA 4XLFA 4F55A 2JA5J 3OYBA 1MMNA 3NRGA 3EUAA 3KNWA 3R60A 4IKFA 1B1BA 3GFLA 2HTJA 5EF6A 1FT9A 1H0MA 1U2WA 3LOCA 3CUQC 2F5DA 3S14J 2DU9A 4HDUA 5C3EJ 2OJED 2H1KA 4XR6A 5B1BH 3COLA 4XKVA 3ECHA 1MBGA 3QKXA 4ABZA 1WI9A 4GRIA 2K9QA 3F6OA 3CC7I 4EVIA 2FD5A 2LYCA 4P9UA 3L2RA 5LD2C 2ZFWA 4M72A 1XSDA 1Z7LA 3IH3A 3SEZA 1G3SA 2L7FP 4RGRA 5B66C 1T0FC 1ONVA 1HKSA 3G6EI 4EGZA 2L9RA 4XONA 2PFVA 5IY5H 4JQFA 2IJLA 1YJNI 2PMUA 1K78A 1RNLA 1V3FA 2EFQA 2BW3B 1EA3A 4XORA 1KU9A 2HVSA 3S32A 5KK1A 1HC8A 1H89C 1P9QC 3ECOA 1VQLI 2VKDA 1JTYA 1G3WA 4M3FA 3T8RA 4LG0B 3A2KA 1L3LA 4RS8A 2KLOA 2ZJPF 5D5XB 1VQ6I 1Z91A 4I0BA 3HOVJ 3B02A 1D5YA 2EWNA 3SHFA 5F6FA 1HF0A 3PQKA 3T6NA 2X6XA 4PSXA 3E6CC 5D5WB 2MYSA 1U5TC 2CUEA 2HQAA 4C30A 4A0ZA 3NARA 2HXIA 4XOTA 3UNGC 4PK4A 2FU4A 1NG6A 1F9NA 3MEXA 3V4GA 4ZC3A 2WAQN 2VT2A 5BPIA 1R9TJ 4A3GJ 3E7QA 3IUVA 4BJTA 3BCBA 3TMOA 3TP0A 1W7PA 4ZJZA 3WTSC 1HDPA 2D45A 4KMUX 3F1BA 2DTRA 3NI7A 2COBA 1B72A 1WJDA 3N4MA 1LVAA 5F64A 3HOWJ 1S7EA 2D2WA 2NVXJ 4JKZA 2QSFX 4CSWA 3ON2A 3LFUA 4IHSA 5DM6F 3KP2A 4XNFA 4ZZLA 3A0HC 3LL7A 4N4NB 2O8XA 3I54A 3GTPJ 2IS4A 2EZIA 2F48A 5FB2A 4UB6C 2MD5A 2ZCWA 3M3YJ 4YIRX 2XPUA 4CZCA 4BE2A 1SMTA 2XDNA 3GZ6A 1D8JA 4RB2C 4U7BA 1SAUA 5JVTA 2LF7A 2GAUA 5HVQC 1X4OA 2ZXJA 3RPUA 4DVYP 2W85A 5ERIA 3D5RC 3IC7A 3ZQFA 4DZJA 2GZWA 3WTXC 5ILUA 4F52A 2G9WA 4YELA 2KRFA 2ZMEB 2ZXHA 3HEFA 1ZELA 3IP4B 3E5XA 5C4JJ 4X1EA 3GTQJ 3VP5A 1IRXA 2VKHA 4RGSA 1OYIA 4JOMA 4BQAA 4G7ZF 2HI3A 1R6RA 1WJCA 2R7ZJ 1WJBA 3S3OA 1D0YA 3BTCA 1R7JA 3FBNB 4BUPA 3FXJA 1SFOJ 1PVEA 1N77A 1PUEE 4XSXF 1DPRA 2HYGD 3ZQQA 3FMRA 5D19A 2KIMA 1RUOA 1R5GA 3Q3SA 4KICA 1WRJA 5K7HA 2OQRA 2HVRA 2M8EA 1LDJA 3DTIA 4KFCA 3BCGA 4G6DA 3KEYA 3ABKH 2ZSIB 3GFMA 3BJAA 2F4OB 2BGCA 3DF8A 4LOCA 4G8XA 3C1DA 1P6RA 4G94A 2V7FA 4L0ZB 3EQLF 3G1MA 2HZDA 4DYQA 3FXKA 3BQZA 2EBIA 3CC4I 3P9KA 3F3XA 1BA5A 3ZN0A 2QKMB 2VBXA 1KQ0A 3ZQCA 3NWTA 1X3ZB 4KIFA 1MBKA 3K0LA 1BI2A 4CCLA 2Z99A 5LRRA 4A3JJ 2KISA 3LJLA 1OYYA 4U87A 4MHGA 2BVMA 2VXDA 2RC4A 4Q47A 5HS8A 1PYVA 1IXRC 4BEHA 1A04A 5HDNA 1VQKI 4HX4A 4XRMA 1JUPA 2V9KA 4CA0A 4EM0B 3HOXJ 4XLEA 3LSTA 4CCOA 3ZQHA 2H09A 2FQ3A 4Y7NJ 3QQAA 3HJEA 3GX4X 2HS5A 3EYIA 1XMXA 3WTVC 5E1ZB 2NS7A 3T0YA 4B3AA 4ZH4F 4E70A 2R7OA 4D5CA 1DP3A 2O6GE 3LA2A 3MZHA 2KRHA 2XGDA 1MZBA 3SEQA 1IN7A 5CVRA 4A3MJ 2A69F 3FK6A 1ETXA 9ANTA 2A5WA 2OD5A 2XVCA 3ZCOA 4ICHA 4M71A 1JHHA 1Y1VJ 1Z05A 1Y39A 4LK0F 2VJ5A 3JTHA 1W5CC 5CVVA 3V7RA 4KITB 4PGHA 4I09A 1Z9CA 1B4AA 1ZR2A 2WAEA 4A69C 4II3A 5JLXA 2UXHA 1JXSA 3ABMH 1V5EA 5E3LA 1QNTA 5FKLA 1HW5A 2ESNA 3MCZA 4MEYF 4ZDPA 4IO9F 3EUPA 4ZYGA 1E3PA 3Q0UA 3RD3A 2HQRA 4HZFA 4I99C 5ICEA 1G3YA 2NS8A 4XKWA 4L9JA 4OIRF 4V2FA 2ME6A 4GFBA 2NOGA 3HZJA 2PMZA 1FYLA 4CUGA 2KFDA 1QA6A 3BR2A 1JT6A 5D8LB 4WXHA 5IT3A 2QKLB 2M2EA 4J19A 3HGYA 2VKVA 3COAC 5FFXA 1ERDA 2QYOA 2BY1A 2OCEA 2EZHA 1XGNA 2L4MA 2NYXA 1NK2P 3KLNA 4B44A 4HV6A 3A01B 3MKWB 2DFEA 3BG7A 2P81A 1D0ZA 2G7GA 1QHHD 2Z9OA 4UY8I 1SANA 4BY1J 3WGGA 4HG2A 1JKPC 2O03A 5BMZA 1TQMA 2E1CA 1OQYA 5FROA 4CYDA 3L09A 4CGZA 5IT9K 1YIOA 4GCTA 1ZGJA 2P7VB 1HA8A 2GIVA 3A02A 4LJZF 2EV5A 4MQVA 2OTLI 1Z7UA 1ZN2A 1XC5A 4NDLA 3FM5A 4A0XA 3WTYC 1XDSA 1RC9A 5J6XA 4IJAA 4M9ZA 4EJOA 1UI6A 1U0JA 2RQQA 3OYDA 2MH9A 2L9VA 2X6OA 3VOKA 2P7CB 1WSUA 2W57A 1MH4A 4I76A 4HRIA 5KCMA 3FXLA 4GO1A 4M73A 2KHMA 1ZG5A 1GV5A 3QODA 5DDGA 1UHMA 4DYCA 1FSHA 4FETA 1TW2A 3VWBA 5E17F 2E19A 2ZMEC 4UVAA 2DA1A 4UUTA 2PG4A 3SQNA 3WODF 1ZR4A 2CW8A 2B1EA 4EJTA 2A6TA 4J01A 5K7ZA 2R7SA 2GXGA 2YR2A 2ACJA 2CSOA 1Z21A 1FEXA 4HF0A 4ZTJA 3J81Z 3OS1A 1ITYA 4N4OB 2GXAA 3F8FA 4IX7A 1QZEA 4XIDA 4HNUA 1LNWA 1UG2A 1TWAJ 1Y0UA 2E1OA 3REOA 2NNYA 1S9HA 2O61A 2E5ZA 2GOMA 3X2QH 2UXPA 3BG9A 3BG5A 5J8FA 1OLTA 2A68F 3K2AA 4IRHA 1X1PA 3VVXA 4G12A 1B8IA 2DA7A 1TC3C 2ZKZA 3PUFA 1CF7B 3QOEA 4FT8A 1FIAA 1I5ZA 4JX4A 4LB6B 1ETOA 1JUMA 1UI5A 1WFXA 4ESFA 1OCTC 1VFCA 4U0WA 3W2WA 2P6SA 1YI2I 1AOYA 4KNYA 2WWYA 4YEJA 5ILVA 3CCMI 4CZZA 4BXUA 4IHYA 4DYRA 1G59A 3KZYA 1R1TA 2BY2A 4H0EA 2ID6A 2EFPA 4D7MA 2UZKA 3R0JA 1FP2A 5CVJA 2WAFA 5HSZA 2QCOA 4I0AA 2PJRA 2DODA 3CESA 4NN1A 1ZRDA 2DYRH 4LLGF 4IHXA 2YVHA 1LEAA 3DV8A 5HBUA 5EEAA 4CYCA 2R7QA 4EEFG 4ENKA 2E60A 3L2CA 1G4DA 4NQWB 4U0VA 3S3NA 2IGMA 3EUHA 2H8RA 2RNJA 2M8GX 3CCJI 2MLKA 2VL8A 2CG4A 4J00A 2A05A 4AIHA 4LFUA 2HFHA 2H6CA 2HQ5A 3BHQA 5JLWA 3CF2A 3HPHA 4XKBA 5EEHA 1QBJA 2XASA 4C3HJ 2ISZA 5FRMA 2BXZA 3ZQLA 3AFHA 2LKPA 1TBXA 3C18A 4Y15A 2WY8Q 4YFXF 3MVPA 1T8IA 2K9NA 2X1CA 1LEBA 3P9TA 2NX4A 4A0YA 3JSPA 4BBSJ 2XF7A 2XRNA 1T98A 4M9SA 3JAMZ 1CQTA 3S2DJ 4JYKA 2K85A 1S8NA 4ZYHA
chains in the Genus database with same CATH topology
2LK2A 5IYDJ 2R5ZB 3BT9A 2WV1A 1F43A 3JRHA 3BR6A 2DMPA 3CCYA 5E3OA 2Q24A 2DA5A 1QVTA 2HDDA 2TCTA 3S5RA 3OSGA 2FJ1A 4A3BJ 3ANPA 1WCMJ 4KWAA 4IHWA 1B8IB 2G0EA 3HTHA 4A3CJ 1JGGA 1HDDC 4JX5A 5E3NA 3JRIA 3NXCA 2M0CA 3PO2J 3GEUA 1QRYA 2IU5A 3IH2A 4FE7A 3L1PA 1MSEC 5FGLA 2CUFA 1DU6A 2ZCMA 2R5YB 1Z0XA 1GUUA 3PO3J 5M3FJ 1MBFA 2XSDC 1A6IA 3TP3A 2PMZN 3A03A 1X58A 2EQRA 5F27A 5HODA 1ETVA 2K9SA 5EG0A 2LD5A 3S1MJ 5EGOB 3QBMA 3O60A 1T56A 5AQCA 4XICA 5J1UA 2DMTA 2E2HJ 4D7NA 5J3LA 1UHSA 2DN0A 2JA5J 5F04A 3NRGA 3OOUA 4CYCB 4BXXJ 1SGMA 1RETA 3KNWA 2CQXA 3FISA 4A3FJ 1U9NA 2CQQA 5EF6A 1T33A 4GFLA 2Y31A 2NVTJ 5IP6A 3LOCA 4A3DJ 2VI6A 3S14J 2EZLA 2B63J 4V2GA 5C3EJ 3G7RA 2H1KA 3COLA 2V57A 1MBGA 5CXGA 3QKXA 2R5ZA 4ABZA 4C2MJ 4A3IJ 2REKA 2DG7A 4FCYA 2K9QA 5IOZA 2FD5A 3HTJA 3S16J 1ETYA 3Q0WA 3V78A 3VW2A 5M5WJ 1JKRC 3IH3A 3PM1A 1ZK8A 5GPAA 4AF5A 2L7FP 4FISA 3K7AJ 1ZKGA 2JK3A 3VW1A 2L9RA 5DS9A 3GTMJ 3RZOJ 3LWJA 4GCLA 1I50J 1ETKA 3MNLA 3GTGJ 1Z77A 3ZOBA 3EGQA 2HOAA 2N8GA 5IPAA 2YS9A 2WUIA 3VOXA 1FTZA 3IH4A 4HNVA 4CGRA 1H89C 1JTYA 4M3FA 3G56A 5M5YJ 2ZOYA 4L62A 3HKZN 1JKQC 3VVYA 1RKTA 1ETQA 4Y52J 5DAJA 2UXUA 3FKIJ 3HOVJ 3VVZA 1JJ6C 2RASA 1D5YA 3JSJA 2DMNA 1HF0A 5M3MJ 1UMQA 3FIWA 3T6NA 2JN6A 3VUQA 2CUEA 2JMWA 3NARA 2HXIA 5EG0B 3S1QJ 3C2BA 5EYRA 4AUXA 2WAQN 3E7QA 1R9TJ 2XPVA 4A3GJ 3BNIA 3IUVA 3TP0A 4QTRA 1HDPA 2JA8J 2DA6A 3I4MJ 3UKGA 3F1BA 2LVSA 3S1RJ 2NVQJ 3NI7A 3VIBA 2COBA 1B72A 1I3QJ 5CW8A 1IUFA 3HOWJ 1ENHA 1S7EA 2NVXJ 4JP0A 1QVUA 4JKZA 4QSHA 2IEKA 1BW5A 5D1RA 2ZB9A 3ON2A 3DCFA 3BR1A 5IP7J 2CU7A 4MLOA 3CWRA 3LSPA 2GFNA 3GTPJ 1LE8A 2QWTA 2XPWA 2QOPA 2EZIA 4UDSA 4MK6A 1AU7A 2GLOA 3BJBA 2X48A 3BTJA 3JR9A 3M3YJ 4IEJA 4IHVA 5DTDA 2XPUA 3JRCA 1RKWA 2XDNA 3F0CA 2HKUA 3CRJA 2JJ7A 5C4XJ 2DTZA 4HKUA 4RBOA 5GP9A 2OI8A 4YZEA 4AC6A 2GBYA 1IG7A 1JJ8C 2ZCNA 3ZQFA 1VNDA 4DZJA 3ANGA 3S1NJ 2RHAA 3GTJJ 3LHQA 1FIPA 3WHCA 3HEFA 3SDGA 3HOZJ 5C4JJ 3CJDA 4X1EA 1APLC 3C07A 3GTQJ 3VP5A 5C4YA 3KZ9A 2HI3A 5IYCJ 3VPRA 4X6AJ 2R7ZJ 2DA2A 1JT0A 4M3GA 2ID3A 3BTCA 3KKCA 1SFOJ 2DJNA 3JRDA 3HE0A 1GT0C 5D19A 2HOSA 1XS9A 3Q3SA 3TEDA 4NELA 5K7HA 1NTCA 3HOUJ 3GTLJ 3BCGA 3BR3A 3DEWA 5K58A 1BJZA 1FJLA 3BQYA 2VUMJ 2G7LA 4LOCA 3GBGA 2IBDA 3ZQIA 1B72B 3G1MA 1IGNA 4DYQA 3BTIA 3BQZA 2EBIA 2ECBA 1BA5A 1ZTRA 2MGQA 1X2NA 5EZGA 2FX0A 3JRFA 3RQIA 2XRLA 3GTOJ 5EFYA 1W0UA 2QKOA 5CXIA 2L0KA 2UXOA 3B6CA 5C44J 3V6GA 3O8GA 3ZQCA 4BY7J 1MBKA 3BG3A 3G1OA 1LE8B 5FKOA 1YRNA 2OPTA 4A3JJ 1PUFA 3LJLA 3HTIA 3AQTA 4M3BA 3A01A 1WH7A 2AO9A 3CDLA 4JL3A 4M3EA 2O7TA 2GM4A 5J1YA 4M3DA 1W0TA 5F0CA 3CQZJ 1TWHJ 4XRMA 3JREA 1I6HJ 1IDYA 2HXOA 1HOMA 4FE4A 1JUPA 5F08A 5IYBJ 3HOXJ 3NAUA 4MFDA 1XG1A 2Y0SN 5EDNA 4A93J 3ZQHA 4DZPA 2QIBA 3PASA 4B4CA 1K83J 3QQAA 4Y7NJ 3BR5A 1LFBA 3O8HA 4A3LJ 2NS7A 4B3AA 1RPWA 4MFEA 3JRGA 4D5CA 2DA3A 5H9TA 5FKMA 2XGDA 2GUHA 3MKLA 4FTHA 2NP5A 2EH3A 2G7SA 4B1RA 4XRSA 1ETWA 3RH2A 4D5FA 4A3MJ 2AHQA 3FK6A 1ETXA 2MW8A 4BKXA 1AHDP 9ANTA 3FRQA 1X2MA 4ICHA 3D1NI 1Y1VJ 2XB0X 3HBLA 3JRBA 1TWFJ 1H8AC 4UUSA 1GDTA 1ZR2A 1HLVA 4A69C 1DU0A 5JLXA 1ORKA 2UXHA 4C3JJ 2HOTA 1MBJA 5E3LA 3Q0VA 1WGXA 2VKEA 5FKLA 3SFIA 3SJMA 3EUPA 2ECCA 3M4OJ 3RD3A 3Q0UA 2XB5A 1IV6A 3HM5A 3CMYA 2NS8A 2W48A 5F0HA 1VI0A 4V2FA 2ME6A 4GFBA 2NOGA 4XK4A 3PPBA 5EZHA 2IAIA 3LSRA 2CJJA 4M6VA 2QTQA 1LFUP 3BR2A 1JT6A 1VF9A 3BTLA 2M2EA 4J19A 2PZ9A 3HGYA 2VKVA 2LKXA 1K61A 3AQSA 2G3BA 2FBQA 4GCKA 2NVYJ 3ZQGA 3RZDJ 1YRNB 1TWCJ 2QF7A 2NP3A 2EZHA 2LFBA 2XGCA 3H0GJ 1PUFB 4JNNA 1NK2P 1O4XA 3A01B 5FLMJ 2P81A 2LY9A 1RR7A 4L5EA 1ZQ3P 2G7GA 3NPIA 1SANA 4C3IJ 2O8KA 4BY1J 2M9HA 4JX6A 1IRZA 1EF4A 4MXMA 2HYJA 2KT0A 2L7MP 1JKPC 1JUSA 1U9OA 5FJ8J 3FK7A 5FHPA 1U78A 4GCTA 2LLKA 4MO7A 1E3OC 2I10A 1IDZA 2OF7A 3A02A 5FKKA 3RKQA 2RAEA 2WB1N 1XC5A 4NDLA 1AKHA 3HOYJ 1OFCX 1IJWC 1H88C 2LR8A 2Y2ZA 1MNMC 4AYBN 2E2JJ 2LTPA 1TWGJ 3HDDA 1UI6A 3KKDA 4PXIA 2GENA 3LSGA 2DMQA 2F07A 2X6OA 1Y1WJ 3VOKA 3H3VK 4S0HB 3HTAA 1MH4A 4I76A 2DMUA 2W53A 1GV5A 4DYCA 1MSFC 2YVEA 2ZOZA 4XRSG 2D6YA 1F36A 2XGEA 2JWTA 2E19A 5F0FA 4UUSB 1ZGWA 2DA1A 4UUTA 3B6AA 1ZR4A 2MSYA 5K7ZA 3GZIA 2EZKA 3GTKJ 1NK3P 1FTTA 2DG8A 2YUSA 2CRGA 3S2HJ 1P7IA 1Q1VA 1FEXA 2Y9ZA 1JTXA 1U8BA 1ITYA 4ME9A 4XIDA 4AC0A 3WHBA 3B81A 5FKNA 4ACIA 1UG2A 2DA4A 2ELKA 4RDUA 1TWAJ 2E1OA 3IV5A 2TRTA 5D18A 3QPSA 5F1JA 5J1RA 4QIWN 2UXPA 3BG9A 5BNGA 3VW0A 3BG5A 2JA7J 2E2IJ 2YU9J 1MBHA 3K2AA 1HCRA 2L7ZA 1MH3A 2K40A 4G12A 2M34A 3TW6A 2DA7A 5K7FA 3OSFA 1B8IA 1TC3C 3OIOA 4DW6A 1JKOC 5FMPA 1RESA 1FIAA 3S15J 2O7OA 4JX4A 1ETOA 2UXIA 1JUMA 1UI5A 2ZCXA 3HIMA 1OCTC 1VFCA 1BL0A 2R5YA 3HB9A 4W97A 5E3MA 3W6VA 4A3EJ 5HAWA 4IHYA 4DYRA 2O9LA 3MN2A 1GV2A 2OERA 5EGOA 2ID6A 3ON4A 3VVXA 4D7MA 5IOYA 3NNRA 5M5XJ 1GVDA 1POGA 2X9DA 3HGGA 1QPIA 2QCOA 3I4NJ 5HSZA 1AKHB 2VPRA 2JA6J 4NN1A 2MG4A 1BW6A 5GPCA 2HYTA 4IHXA 2YVHA 2LP0A 5HBUA 5EEAA 4W1UA 2R92J 4CYCA 3JRAA 2PBXA 4EEFG 3LNQA 3BRUA 2D5VA 5IP9J 1WH5A 1MBEA 2H8RA 2M8GX 1WI3A 4GFKA 3S17J 2ME0A 1P7JA 1A5JA 4BBRJ 2R0QC 4I6ZA 1WPKA 1OCPA 1OJLA 2HQ5A 3BHQA 5JLWA 5FLVA 2Y9YA 2R93J 4C3HJ 3G1LA 3TW7A 3ZQLA 3BR0A 3MVPA 3QPLA 2K9NA 1IC8A 1G2HA 3P9TA 2KDZA 2NX4A 3DPJA 4BBSJ 1CQTA 2Y30A 3E7LA 2WGBA 4A3KJ 3S2DJ 3LSJA 4JYKA 4MIMA 2FQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LK2 A;  5IYD J;  2R5Z B;  3BT9 A;  2WV1 A;  1F43 A;  3JRH A;  3BR6 A;  2DMP A;  3CCY A;  5E3O A;  2Q24 A;  2DA5 A;  1QVT A;  2HDD A;  2TCT A;  3S5R A;  3OSG A;  2FJ1 A;  4A3B J;  3ANP A;  1WCM J;  4KWA A;  4IHW A;  1B8I B;  2G0E A;  3HTH A;  4A3C J;  1JGG A;  1HDD C;  4JX5 A;  5E3N A;  3JRI A;  3NXC A;  2M0C A;  3PO2 J;  3GEU A;  1QRY A;  2IU5 A;  3IH2 A;  4FE7 A;  3L1P A;  1MSE C;  5FGL A;  2CUF A;  1DU6 A;  2ZCM A;  2R5Y B;  1Z0X A;  1GUU A;  3PO3 J;  5M3F J;  1MBF A;  2XSD C;  1A6I A;  3TP3 A;  2PMZ N;  3A03 A;  1X58 A;  2EQR A;  5F27 A;  5HOD A;  1ETV A;  2K9S A;  5EG0 A;  2LD5 A;  3S1M J;  5EGO B;  3QBM A;  3O60 A;  1T56 A;  5AQC A;  4XIC A;  5J1U A;  2DMT A;  2E2H J;  4D7N A;  5J3L A;  1UHS A;  2DN0 A;  2JA5 J;  5F04 A;  3NRG A;  3OOU A;  4CYC B;  4BXX J;  1SGM A;  1RET A;  3KNW A;  2CQX A;  3FIS A;  4A3F J;  1U9N A;  2CQQ A;  5EF6 A;  1T33 A;  4GFL A;  2Y31 A;  2NVT J;  5IP6 A;  3LOC A;  4A3D J;  2VI6 A;  3S14 J;  2EZL A;  2B63 J;  4V2G A;  5C3E J;  3G7R A;  2H1K A;  3COL A;  2V57 A;  1MBG A;  5CXG A;  3QKX A;  2R5Z A;  4ABZ A;  4C2M J;  4A3I J;  2REK A;  2DG7 A;  4FCY A;  2K9Q A;  5IOZ A;  2FD5 A;  3HTJ A;  3S16 J;  1ETY A;  3Q0W A;  3V78 A;  3VW2 A;  5M5W J;  1JKR C;  3IH3 A;  3PM1 A;  1ZK8 A;  5GPA A;  4AF5 A;  2L7F P;  4FIS A;  3K7A J;  1ZKG A;  2JK3 A;  3VW1 A;  2L9R A;  5DS9 A;  3GTM J;  3RZO J;  3LWJ A;  4GCL A;  1I50 J;  1ETK A;  3MNL A;  3GTG J;  1Z77 A;  3ZOB A;  3EGQ A;  2HOA A;  2N8G A;  5IPA A;  2YS9 A;  2WUI A;  3VOX A;  1FTZ A;  3IH4 A;  4HNV A;  4CGR A;  1H89 C;  1JTY A;  4M3F A;  3G56 A;  5M5Y J;  2ZOY A;  4L62 A;  3HKZ N;  1JKQ C;  3VVY A;  1RKT A;  1ETQ A;  4Y52 J;  5DAJ A;  2UXU A;  3FKI J;  3HOV J;  3VVZ A;  1JJ6 C;  2RAS A;  1D5Y A;  3JSJ A;  2DMN A;  1HF0 A;  5M3M J;  1UMQ A;  3FIW A;  3T6N A;  2JN6 A;  3VUQ A;  2CUE A;  2JMW A;  3NAR A;  2HXI A;  5EG0 B;  3S1Q J;  3C2B A;  5EYR A;  4AUX A;  2WAQ N;  3E7Q A;  1R9T J;  2XPV A;  4A3G J;  3BNI A;  3IUV A;  3TP0 A;  4QTR A;  1HDP A;  2JA8 J;  2DA6 A;  3I4M J;  3UKG A;  3F1B A;  2LVS A;  3S1R J;  2NVQ J;  3NI7 A;  3VIB A;  2COB A;  1B72 A;  1I3Q J;  5CW8 A;  1IUF A;  3HOW J;  1ENH A;  1S7E A;  2NVX J;  4JP0 A;  1QVU A;  4JKZ A;  4QSH A;  2IEK A;  1BW5 A;  5D1R A;  2ZB9 A;  3ON2 A;  3DCF A;  3BR1 A;  5IP7 J;  2CU7 A;  4MLO A;  3CWR A;  3LSP A;  2GFN A;  3GTP J;  1LE8 A;  2QWT A;  2XPW A;  2QOP A;  2EZI A;  4UDS A;  4MK6 A;  1AU7 A;  2GLO A;  3BJB A;  2X48 A;  3BTJ A;  3JR9 A;  3M3Y J;  4IEJ A;  4IHV A;  5DTD A;  2XPU A;  3JRC A;  1RKW A;  2XDN A;  3F0C A;  2HKU A;  3CRJ A;  2JJ7 A;  5C4X J;  2DTZ A;  4HKU A;  4RBO A;  5GP9 A;  2OI8 A;  4YZE A;  4AC6 A;  2GBY A;  1IG7 A;  1JJ8 C;  2ZCN A;  3ZQF A;  1VND A;  4DZJ A;  3ANG A;  3S1N J;  2RHA A;  3GTJ J;  3LHQ A;  1FIP A;  3WHC A;  3HEF A;  3SDG A;  3HOZ J;  5C4J J;  3CJD A;  4X1E A;  1APL C;  3C07 A;  3GTQ J;  3VP5 A;  5C4Y A;  3KZ9 A;  2HI3 A;  5IYC J;  3VPR A;  4X6A J;  2R7Z J;  2DA2 A;  1JT0 A;  4M3G A;  2ID3 A;  3BTC A;  3KKC A;  1SFO J;  2DJN A;  3JRD A;  3HE0 A;  1GT0 C;  5D19 A;  2HOS A;  1XS9 A;  3Q3S A;  3TED A;  4NEL A;  5K7H A;  1NTC A;  3HOU J;  3GTL J;  3BCG A;  3BR3 A;  3DEW A;  5K58 A;  1BJZ A;  1FJL A;  3BQY A;  2VUM J;  2G7L A;  4LOC A;  3GBG A;  2IBD A;  3ZQI A;  1B72 B;  3G1M A;  1IGN A;  4DYQ A;  3BTI A;  3BQZ A;  2EBI A;  2ECB A;  1BA5 A;  1ZTR A;  2MGQ A;  1X2N A;  5EZG A;  2FX0 A;  3JRF A;  3RQI A;  2XRL A;  3GTO J;  5EFY A;  1W0U A;  2QKO A;  5CXI A;  2L0K A;  2UXO A;  3B6C A;  5C44 J;  3V6G A;  3O8G A;  3ZQC A;  4BY7 J;  1MBK A;  3BG3 A;  3G1O A;  1LE8 B;  5FKO A;  1YRN A;  2OPT A;  4A3J J;  1PUF A;  3LJL A;  3HTI A;  3AQT A;  4M3B A;  3A01 A;  1WH7 A;  2AO9 A;  3CDL A;  4JL3 A;  4M3E A;  2O7T A;  2GM4 A;  5J1Y A;  4M3D A;  1W0T A;  5F0C A;  3CQZ J;  1TWH J;  4XRM A;  3JRE A;  1I6H J;  1IDY A;  2HXO A;  1HOM A;  4FE4 A;  1JUP A;  5F08 A;  5IYB J;  3HOX J;  3NAU A;  4MFD A;  1XG1 A;  2Y0S N;  5EDN A;  4A93 J;  3ZQH A;  4DZP A;  2QIB A;  3PAS A;  4B4C A;  1K83 J;  3QQA A;  4Y7N J;  3BR5 A;  1LFB A;  3O8H A;  4A3L J;  2NS7 A;  4B3A A;  1RPW A;  4MFE A;  3JRG A;  4D5C A;  2DA3 A;  5H9T A;  5FKM A;  2XGD A;  2GUH A;  3MKL A;  4FTH A;  2NP5 A;  2EH3 A;  2G7S A;  4B1R A;  4XRS A;  1ETW A;  3RH2 A;  4D5F A;  4A3M J;  2AHQ A;  3FK6 A;  1ETX A;  2MW8 A;  4BKX A;  1AHD P;  9ANT A;  3FRQ A;  1X2M A;  4ICH A;  3D1N I;  1Y1V J;  2XB0 X;  3HBL A;  3JRB A;  1TWF J;  1H8A C;  4UUS A;  1GDT A;  1ZR2 A;  1HLV A;  4A69 C;  1DU0 A;  5JLX A;  1ORK A;  2UXH A;  4C3J J;  2HOT A;  1MBJ A;  5E3L A;  3Q0V A;  1WGX A;  2VKE A;  5FKL A;  3SFI A;  3SJM A;  3EUP A;  2ECC A;  3M4O J;  3RD3 A;  3Q0U A;  2XB5 A;  1IV6 A;  3HM5 A;  3CMY A;  2NS8 A;  2W48 A;  5F0H A;  1VI0 A;  4V2F A;  2ME6 A;  4GFB A;  2NOG A;  4XK4 A;  3PPB A;  5EZH A;  2IAI A;  3LSR A;  2CJJ A;  4M6V A;  2QTQ A;  1LFU P;  3BR2 A;  1JT6 A;  1VF9 A;  3BTL A;  2M2E A;  4J19 A;  2PZ9 A;  3HGY A;  2VKV A;  2LKX A;  1K61 A;  3AQS A;  2G3B A;  2FBQ A;  4GCK A;  2NVY J;  3ZQG A;  3RZD J;  1YRN B;  1TWC J;  2QF7 A;  2NP3 A;  2EZH A;  2LFB A;  2XGC A;  3H0G J;  1PUF B;  4JNN A;  1NK2 P;  1O4X A;  3A01 B;  5FLM J;  2P81 A;  2LY9 A;  1RR7 A;  4L5E A;  1ZQ3 P;  2G7G A;  3NPI A;  1SAN A;  4C3I J;  2O8K A;  4BY1 J;  2M9H A;  4JX6 A;  1IRZ A;  1EF4 A;  4MXM A;  2HYJ A;  2KT0 A;  2L7M P;  1JKP C;  1JUS A;  1U9O A;  5FJ8 J;  3FK7 A;  5FHP A;  1U78 A;  4GCT A;  2LLK A;  4MO7 A;  1E3O C;  2I10 A;  1IDZ A;  2OF7 A;  3A02 A;  5FKK A;  3RKQ A;  2RAE A;  2WB1 N;  1XC5 A;  4NDL A;  1AKH A;  3HOY J;  1OFC X;  1IJW C;  1H88 C;  2LR8 A;  2Y2Z A;  1MNM C;  4AYB N;  2E2J J;  2LTP A;  1TWG J;  3HDD A;  1UI6 A;  3KKD A;  4PXI A;  2GEN A;  3LSG A;  2DMQ A;  2F07 A;  2X6O A;  1Y1W J;  3VOK A;  3H3V K;  4S0H B;  3HTA A;  1MH4 A;  4I76 A;  2DMU A;  2W53 A;  1GV5 A;  4DYC A;  1MSF C;  2YVE A;  2ZOZ A;  4XRS G;  2D6Y A;  1F36 A;  2XGE A;  2JWT A;  2E19 A;  5F0F A;  4UUS B;  1ZGW A;  2DA1 A;  4UUT A;  3B6A A;  1ZR4 A;  2MSY A;  5K7Z A;  3GZI A;  2EZK A;  3GTK J;  1NK3 P;  1FTT A;  2DG8 A;  2YUS A;  2CRG A;  3S2H J;  1P7I A;  1Q1V A;  1FEX A;  2Y9Z A;  1JTX A;  1U8B A;  1ITY A;  4ME9 A;  4XID A;  4AC0 A;  3WHB A;  3B81 A;  5FKN A;  4ACI A;  1UG2 A;  2DA4 A;  2ELK A;  4RDU A;  1TWA J;  2E1O A;  3IV5 A;  2TRT A;  5D18 A;  3QPS A;  5F1J A;  5J1R A;  4QIW N;  2UXP A;  3BG9 A;  5BNG A;  3VW0 A;  3BG5 A;  2JA7 J;  2E2I J;  2YU9 J;  1MBH A;  3K2A A;  1HCR A;  2L7Z A;  1MH3 A;  2K40 A;  4G12 A;  2M34 A;  3TW6 A;  2DA7 A;  5K7F A;  3OSF A;  1B8I A;  1TC3 C;  3OIO A;  4DW6 A;  1JKO C;  5FMP A;  1RES A;  1FIA A;  3S15 J;  2O7O A;  4JX4 A;  1ETO A;  2UXI A;  1JUM A;  1UI5 A;  2ZCX A;  3HIM A;  1OCT C;  1VFC A;  1BL0 A;  2R5Y A;  3HB9 A;  4W97 A;  5E3M A;  3W6V A;  4A3E J;  5HAW A;  4IHY A;  4DYR A;  2O9L A;  3MN2 A;  1GV2 A;  2OER A;  5EGO A;  2ID6 A;  3ON4 A;  3VVX A;  4D7M A;  5IOY A;  3NNR A;  5M5X J;  1GVD A;  1POG A;  2X9D A;  3HGG A;  1QPI A;  2QCO A;  3I4N J;  5HSZ A;  1AKH B;  2VPR A;  2JA6 J;  4NN1 A;  2MG4 A;  1BW6 A;  5GPC A;  2HYT A;  4IHX A;  2YVH A;  2LP0 A;  5HBU A;  5EEA A;  4W1U A;  2R92 J;  4CYC A;  3JRA A;  2PBX A;  4EEF G;  3LNQ A;  3BRU A;  2D5V A;  5IP9 J;  1WH5 A;  1MBE A;  2H8R A;  2M8G X;  1WI3 A;  4GFK A;  3S17 J;  2ME0 A;  1P7J A;  1A5J A;  4BBR J;  2R0Q C;  4I6Z A;  1WPK A;  1OCP A;  1OJL A;  2HQ5 A;  3BHQ A;  5JLW A;  5FLV A;  2Y9Y A;  2R93 J;  4C3H J;  3G1L A;  3TW7 A;  3ZQL A;  3BR0 A;  3MVP A;  3QPL A;  2K9N A;  1IC8 A;  1G2H A;  3P9T A;  2KDZ A;  2NX4 A;  3DPJ A;  4BBS J;  1CQT A;  2Y30 A;  3E7L A;  2WGB A;  4A3K J;  3S2D J;  3LSJ A;  4JYK A;  4MIM A;  2FQ4 A; 
#chains in the Genus database with same CATH topology
 5J40 A;  3K4C A;  4RAG A;  1ZYR F;  4E4H A;  1XGS A;  5LGN A;  2LY1 A;  3TDU C;  4BQN A;  2Q24 A;  2A3S A;  2GIZ A;  5KAI C;  1QVT A;  5GAH J;  2HDD A;  3S5R A;  5DUK A;  1U6G A;  3OSG A;  3GYH X;  3V8J A;  1BR2 A;  1IN6 A;  1LPQ A;  3L2V A;  3WG9 A;  3VSL A;  4IHW A;  4XMY A;  3BLY A;  2G0E A;  5LGU A;  5E3N A;  2M0C A;  4GCV A;  3RQ4 A;  3IH2 A;  4FE7 A;  2GA1 A;  2MC4 A;  2CUF A;  1DU6 A;  2VPL A;  2R5Y B;  1Z0X A;  2DPD A;  2E1M C;  3S8P A;  3A03 A;  3OYJ A;  2EIL H;  2CQ7 A;  1ETV A;  1P4W A;  4A2U A;  4WX9 A;  2LMD A;  1UST A;  1AWC A;  3S1M J;  5EGO B;  3EDP A;  1JHF A;  4BH9 A;  4BAC A;  1Z3Y A;  3VDX A;  3G2B A;  5CYV A;  3K6G A;  2DMT A;  2ZNZ A;  3ELK A;  5J3L A;  3V7S A;  1FZP B;  1UHS A;  4AVP A;  2DN0 A;  5F04 A;  2L5Q A;  3MD2 A;  4BXX J;  1DPU A;  1SGM A;  3TKY A;  3FIS A;  1U9N A;  2JVG A;  4PCQ A;  4L9V A;  1O7L A;  3CLO A;  1FOK A;  2EZL A;  4EAT A;  2B63 J;  1I1S A;  2OU2 A;  4V2G A;  4FHT A;  3CCR I;  3CDH A;  5D6F A;  3LSM A;  3M8F A;  4I01 A;  5CXG A;  3D5L A;  1J75 A;  4C2M J;  4A5N A;  4HNT A;  2REK A;  4FCY A;  2LDU A;  3KZI C;  5IOZ A;  3ERE D;  5H6R A;  3S16 J;  2JPC A;  1ETY A;  3WU2 C;  1U5T B;  3CJN A;  3HRU A;  3VW2 A;  1UCR A;  3K4L A;  3TO7 A;  1ZK8 A;  5GPA A;  4FIS A;  3K7A J;  3M8J A;  1SFU A;  3EUK L;  2QSH X;  3VW1 A;  5DS9 A;  4GCL A;  3KX2 A;  1FBU A;  5TRD A;  3OYA A;  4L9N A;  4NUB A;  4HW0 A;  3HC7 A;  3F6V A;  3GTG J;  2HTS A;  1WHU A;  2DDA A;  4HA8 A;  3EGQ A;  1MIJ A;  2N8G A;  2VOD A;  4HNV A;  4CGR A;  2QBY A;  3BJ6 A;  2K86 A;  4B43 A;  4CXF A;  1M1E B;  1G8X A;  1BC8 C;  5M5Y J;  1D3Y A;  2RRE A;  1WJ5 A;  4E7I A;  3BDD A;  2ZOY A;  4L62 A;  1QHG A;  3HKZ N;  3NQO A;  4ZDL A;  5H6Q A;  5DAJ A;  1JJ6 C;  2QM3 A;  3ASN H;  3GVA A;  4ZYD A;  2XKO A;  1BN5 A;  2VC0 A;  3HL2 A;  4KIB A;  4BHC A;  4AU7 A;  3DTE A;  3U1D A;  4DQ2 A;  1MDM B;  1X3U A;  4IVN A;  2JMW A;  1KZH A;  1IXC A;  1SD7 A;  1BR1 A;  3C2B A;  5EYR A;  4AUX A;  3P5J A;  2XAJ A;  3H0D A;  3BNI A;  5DD8 A;  3U2R A;  2JA8 J;  2DA6 A;  3I4M J;  3UKG A;  3HYI A;  2LBF A;  5F1R A;  2ZJR F;  3HTS B;  2LVS A;  4YG2 F;  1I3Q J;  4HF1 A;  5CW8 A;  2W82 A;  1IUF A;  1R23 A;  1ENH A;  3MFK A;  1K6Y A;  4IRV A;  3QPH A;  4UV8 A;  2IEK A;  1ZLK A;  3CUO A;  1BW5 A;  2ZB9 A;  2LNB A;  3DCF A;  2VIX A;  2KIQ A;  2CU7 A;  3P9C A;  2F2E A;  4MLO A;  2BBY A;  4RB0 A;  3N05 A;  3HSR A;  2PI0 A;  1UAA A;  2GLO A;  4OIO F;  4HF2 A;  3BJB A;  2ZJ2 A;  3S3M A;  3CD6 I;  3CME I;  3JRC A;  1RKW A;  3H9G A;  5HLH A;  1OR7 C;  2QVO A;  2JJ7 A;  3CC2 I;  4LMY A;  2HKO A;  3DPU A;  3SYT A;  2OI8 A;  2STW A;  4AC6 A;  2GBY A;  4Z2Y A;  2ZCN A;  4Y13 A;  1H9T A;  3ANG A;  1BOB A;  3S1N J;  1QU3 A;  2RHA A;  1E0E A;  2FBI A;  3LHQ A;  1VTN C;  2JUG A;  1FIP A;  3WHC A;  4G9Y A;  4A5M A;  2DJI A;  1TP4 A;  3CJD A;  3WE3 A;  2R7W A;  3AL0 C;  1YLF A;  4H4K C;  2R7F A;  1WKM A;  2IVM A;  5E20 A;  4U0Y A;  5IYC J;  3VPR A;  5KNL A;  1NH3 A;  3PJR A;  1YO5 C;  2DA2 A;  1JT0 A;  4CDG A;  4XLC A;  3DPT A;  5A2Q Z;  3JRD A;  1GT0 C;  2HOS A;  1J0R A;  4N9I A;  3OV8 A;  4F7Z A;  3ERM A;  2Y0M A;  2CUJ A;  3VYR B;  1NTC A;  1S7O A;  1J59 A;  1PDN C;  3LSI A;  3DEW A;  5K58 A;  4FAS D;  1FJL A;  2OA4 A;  2VUM J;  2G7L A;  5HDK A;  3I59 A;  2P5K A;  5KHD A;  3BOQ A;  1OMI A;  2BVL A;  3EPZ A;  3O3K A;  4OD4 A;  2IBD A;  2XAG A;  2B3W A;  5DD4 A;  2NVU B;  4RMN A;  1IGN A;  1STZ A;  3BTI A;  1GLN A;  1YX5 A;  2FE3 A;  3GCM A;  4L0Y B;  3GTO J;  1XDU A;  2M45 A;  5CXI A;  3O8G A;  2FEZ A;  2OBP A;  3BG3 A;  5FLX K;  3KP4 A;  1LE8 B;  2Z16 A;  1YRN A;  2M4K A;  1PUF A;  4GDF A;  3HTI A;  4U9N A;  3AQT A;  4M3B A;  1MJA A;  2E35 A;  4JL3 A;  4M3E A;  6PAX A;  1YX3 A;  3RIR A;  3M8E A;  4RGX A;  4Y33 A;  3DQV C;  3CQZ J;  3CCL I;  1DUX C;  4KYW A;  2EFO A;  1DDN A;  3L2Q A;  5ICF A;  4DJA A;  3NAU A;  1S72 I;  5ICC A;  4MFD A;  1C0W A;  1XG1 A;  5EDN A;  4B4C A;  3K69 A;  1LFB A;  1EV7 A;  4A3L J;  2O0Y A;  4AVZ A;  2MC3 A;  3PL8 A;  4E7S A;  3M1C A;  4OOI A;  5CKT A;  3SZT A;  1ZRC A;  1IUY A;  3R4K A;  2FRH A;  4HYE A;  3SZG A;  1SFX A;  4E7Z A;  1LVK A;  2NP5 A;  1OIS A;  4XRS A;  5LRS A;  1W1W E;  3ZN1 A;  4GYI A;  1VQ5 I;  1LFP A;  2AHQ A;  3H35 A;  1T0F A;  1ZGA A;  1AHD P;  5EJC A;  1O3Q A;  1IF1 A;  4IRG A;  1XSV A;  2L54 A;  2UV1 A;  1MMS A;  2VLA A;  3D1N I;  5K5Q A;  4I2O A;  1X1C A;  4UUS A;  1T95 A;  2OCC H;  3W6K B;  5BPD A;  1DU0 A;  5AON A;  4AD9 A;  2HOT A;  4HQM A;  1LJ9 A;  3SFI A;  3SJM A;  1E17 A;  4C9Y A;  3M4O J;  2FNP A;  5JR3 A;  2EFN A;  4RA2 A;  1YIJ I;  2GQQ A;  4CCJ A;  3HXL A;  2M4G A;  3DKY A;  1R49 A;  4L18 B;  2IA0 A;  1VI0 A;  4ENN A;  3K1P A;  3QP6 A;  4X0G A;  1I1G A;  2QQ8 A;  3RTR A;  2R4G A;  1VZ0 A;  1GXQ A;  4IOC F;  2A61 A;  2PBI A;  1FNN A;  2CJJ A;  2EK5 A;  2VQH A;  3BZK A;  1LFU P;  2RGV A;  1KYW A;  3DTK A;  4HX7 A;  3BTL A;  3ISP A;  4BHP A;  1BC7 C;  1R58 A;  4GCK A;  2NVY J;  2QF7 A;  2LFB A;  2XGC A;  4G6T B;  4EM1 A;  3OYE A;  2KL4 A;  1SVM A;  1F4K A;  5FLM J;  1QZZ A;  2W1O A;  1RR7 A;  1ZQ3 P;  1XCB A;  3BPX A;  3ML6 A;  2O8K A;  4JBA A;  1T39 A;  4U9L A;  1W5T A;  1EF4 A;  4PZJ A;  1JUS A;  2MA3 A;  1U9O A;  1Z1D A;  3FK7 A;  3RKY A;  5LBQ A;  5FJ8 J;  1LUJ B;  1H9G A;  3GO5 A;  3HSE A;  2OF7 A;  4IOA F;  5JFR A;  1IDZ A;  5FKK A;  4FX4 A;  2CW7 A;  2A6E F;  2RAE A;  3HOY J;  1OFC X;  4IQ4 A;  2P8T A;  2CQN A;  1IJW C;  1MNM C;  4PSW A;  3NS4 A;  2LTP A;  1TWG J;  3KPH A;  3KKD A;  3N97 A;  2PMH A;  1HKQ A;  2F07 A;  4PXI A;  2ISY A;  1JI8 A;  1X19 A;  3H3V K;  1IRF A;  1T38 A;  1BR4 A;  2R7T A;  3HTA A;  5BS6 A;  2DMU A;  2XAU A;  3E0J B;  2Q8K A;  3P9I A;  4HST A;  3J7A Y;  3GFJ A;  1MSF C;  4XRS G;  4O5V A;  3H5A A;  1F36 A;  2H6B A;  2JWT A;  5F0F A;  2E7X A;  4LK1 F;  3K4N A;  2PFB A;  3FXM A;  2F4M B;  2OQG A;  4OAY A;  4YFN F;  1R1U A;  2L01 A;  1Y0N A;  1Y56 A;  2CWE A;  3K4J A;  2DG8 A;  3ZQ7 A;  3CTA A;  3S2H J;  3BP8 A;  2XDV A;  2IS2 A;  3HUG A;  1JTX A;  2COM A;  3ZMT A;  1U8B A;  3GZN B;  2ELK A;  1L0O C;  3IV5 A;  4D1Q A;  3OYI A;  2TRT A;  3GFI A;  2EA2 A;  3A0B C;  3IWZ A;  2ZJQ F;  4OU0 A;  5D18 A;  5F1J A;  2DQR A;  1UJ8 A;  4FX0 A;  4BJ6 C;  3CMA I;  3D0S A;  1MBH A;  3F8M A;  1UB9 A;  1HCR A;  2L7Z A;  2IS1 A;  2K40 A;  2M1B A;  2M34 A;  2QUF A;  3R6S A;  5K7F A;  3OSF A;  2VXZ A;  5LGT A;  1RES A;  4M9X A;  2VBY A;  3S15 J;  1J09 A;  2O7O A;  3EET A;  4BQQ A;  2UXI A;  2FXA A;  2CO5 A;  2K27 A;  3QWL A;  1BL0 A;  2KZG A;  3QYF A;  2HU9 A;  3HB9 A;  2BOL A;  5E3M A;  2W7N A;  3FM3 A;  2W4S A;  3OMY A;  3IL2 A;  1U3E M;  1ULY A;  2HZT A;  2O9L A;  1R00 A;  3ON4 A;  2CV2 A;  3CMM A;  1POG A;  3I4N J;  1AKH B;  2FBH A;  1MJ9 A;  2MG4 A;  3A4C A;  3A1Y A;  2UXX A;  3LQQ A;  3ZMV A;  5L3B A;  3WTW C;  1XMA A;  2ZXI A;  2RVC A;  2ZNY A;  4EQQ A;  3ASO H;  2P5V A;  3S93 A;  2D5V A;  1VQ7 I;  1MBE A;  4L9T A;  2A07 F;  1WI3 A;  2ZBK A;  5FRN A;  5LEJ A;  5HOO A;  2G7H A;  3DBH B;  2Q2E B;  1FYK A;  3S17 J;  1P7J A;  2IPQ X;  2R0Q C;  2ELJ A;  3KIO A;  4I6Z A;  1WPK A;  5E1W A;  2DO7 A;  3L2W A;  3MQ0 A;  1YJ9 I;  4AM3 A;  4G6Q A;  1EJ9 A;  2R93 J;  4ZTF A;  4Z6Y A;  1SVO A;  5AIP A;  2E1M B;  4PFO A;  3G1L A;  3GF2 A;  1MND A;  3QPL A;  4HX8 A;  4XLA A;  3RSN A;  2VC1 A;  1SMY F;  4A3K J;  3TBI A;  4MIM A;  1HW2 A;  2LK2 A;  3ZGK A;  4DOZ A;  4E7J A;  4LB5 A;  4OIQ F;  3BT9 A;  2JQ7 A;  4RB3 C;  2HPI A;  2HOE A;  2WV1 A;  3G3Z A;  3DKW A;  1F43 A;  3JRH A;  2DMP A;  3KYL A;  3QP5 A;  1I39 A;  4BHB A;  3HHH A;  3MZ8 A;  4BDZ A;  2BW3 A;  5HLI A;  3ANP A;  1G3T A;  1WCM J;  4LG0 A;  4KWA A;  3FDY A;  4ETS A;  1JGG A;  2V6C A;  4JX5 A;  4P55 A;  2IXS A;  1OCZ H;  3PNV A;  4OMZ A;  1QRY A;  2IU5 A;  5FGL A;  2V4J C;  4EMS A;  2PEX A;  3E6B A;  1MMG A;  3QOP A;  2LC2 A;  3DLA A;  2F6C A;  2XSD C;  4II2 A;  3SFZ A;  3IKV A;  2PMZ N;  3BWG A;  2DFI A;  3BPV A;  1LKX A;  4B8X A;  4L5J A;  3GUD A;  3G71 I;  2GXB A;  3F72 A;  2M87 A;  3FF5 A;  1FOX A;  4B3X A;  2Y75 A;  5E1X A;  4HBL A;  3IUO A;  2FA5 A;  1UEL B;  4CO8 A;  1O3T A;  5E8I A;  1XGO A;  2HNH A;  3OOU A;  2A5Y B;  2ZFU A;  3OWT A;  1RET A;  5ILS A;  2R3S A;  3RDI A;  4DGW B;  5L3D A;  5CVI A;  2Y0S A;  1T33 A;  4GFL A;  2V1D A;  5IP6 A;  2MAB A;  2ZC2 A;  4A3D J;  2DOF A;  4BJ5 C;  1S7A A;  3G7R A;  2Z5U A;  1FP1 D;  4XLP F;  2V57 A;  1WWX A;  4QPO A;  2HR3 A;  2R5Z A;  3G73 A;  2FUG 2;  4A3I J;  3E1S A;  3RYP A;  3HTJ A;  4CCN A;  2WY7 Q;  3L2U A;  1XPX A;  1YJW I;  2EIJ H;  5M5W J;  1JKR C;  3PM1 A;  1UFM A;  2XAQ A;  1TT5 B;  1Y6I A;  1BI0 A;  1ZKG A;  1MGT A;  2JK3 A;  2HQN A;  1ON2 A;  2AQE A;  4BE0 A;  3JSO A;  1WVR A;  1I50 J;  1DGR M;  1ETK A;  1ZRE A;  5B5E C;  4CHU A;  3H3U A;  4XQF A;  1Z77 A;  2H8W A;  2RV8 A;  2HOA A;  2W25 A;  1OKR A;  2YS9 A;  1FTZ A;  4XSZ F;  1HST A;  5HLG A;  3EUH C;  2CMP A;  2F5V A;  4R8H A;  1O7F A;  2M3A A;  3JAM K;  3G56 A;  2BHY A;  2HKX A;  3V8K A;  3E6D A;  1RKT A;  1ETQ A;  4Y52 J;  2VQL A;  3PIP F;  3VVZ A;  2RAS A;  1DQU A;  3JSJ A;  5BQT A;  2DMN A;  2H94 A;  3FIW A;  5TJJ A;  4ZYA A;  3OIP A;  1BJA A;  3VYS B;  2KQR A;  4RLQ A;  3DU6 A;  4BL0 B;  2ZY9 A;  1IN5 A;  5JHU A;  2V9P A;  2OUM A;  5EG0 B;  1VQ4 I;  2JA2 A;  3S1Q J;  3T5X A;  1FYM A;  1TZL A;  2VE8 A;  5DCM A;  2DDB A;  4U88 A;  4OWR B;  1X1D A;  4PJL A;  3ABU A;  2XSJ C;  1D5V A;  2ZO4 A;  2NVQ J;  3DP7 A;  2RKH A;  3FZV A;  3VIB A;  2QSG X;  2Q1Z B;  3NWS A;  3WU0 A;  1R4M B;  4UUV A;  3GLL A;  4Y4R A;  3AL0 B;  4QSH A;  2FOK A;  3KLO A;  2GOX B;  4CCM A;  1VQN I;  2RNG A;  5IP7 J;  2WB1 A;  3CWR A;  5GAE J;  3I9V 2;  3DEE A;  4GXO A;  1O3S A;  2QWT A;  4GYG A;  4AYB A;  1XMK A;  4UDS A;  3QAH A;  1AU7 A;  2XV4 S;  5FFZ A;  4BQO A;  3JR9 A;  3L9F A;  3KYC B;  5DTD A;  1YW8 A;  3F0C A;  1Q1H A;  1SFK A;  1WJA A;  1ZHF A;  4JK1 X;  2HKU A;  3CRJ A;  1D1C A;  2E71 A;  4I7H A;  3WTU C;  3FMS A;  1X1A A;  1NG7 A;  1YS6 A;  4HKU A;  2BE5 F;  4RBO A;  5GP9 A;  2B7E A;  5L3G A;  5H2F C;  4A12 A;  1JJ8 C;  1UHW A;  5DM7 F;  1VND A;  2DFF A;  1FY7 A;  3OIQ A;  2ETH A;  3I56 I;  2LRD A;  3F8C A;  5JI6 A;  1W36 D;  3KEO A;  2JPB A;  3HOS A;  2W24 A;  1K78 B;  4MTE A;  3SDG A;  2BEO A;  4PUS A;  2XF5 A;  5K5R A;  2JRT A;  3C07 A;  3BCA A;  1IV8 A;  4YIF A;  2I8D A;  3KZ9 A;  2MD0 A;  2VON A;  3CZ6 A;  1FSE A;  3C3W A;  1U8R A;  2Y48 A;  5E18 F;  1A35 A;  3KKC A;  2DJN A;  4UNO A;  5J8C A;  3HE0 A;  1GXP A;  3LA3 A;  4RLF A;  1HXD A;  2DT5 A;  3CP8 A;  4KT6 A;  4FQG A;  3HPG A;  3QYE A;  3F21 A;  3GTL J;  3HRM A;  1DGW Y;  2J5O A;  4WF2 A;  1T6S A;  1XN7 A;  2EIM H;  1FWZ A;  1W7P B;  2YSR A;  3LSK A;  4UXN A;  3ROU A;  5HNH A;  3KP3 A;  2FBK A;  2OC6 A;  3K70 D;  1B72 B;  5BOX A;  2ECB A;  2BXY A;  1ZTR A;  2MGQ A;  1X2N A;  3DPL C;  1D1A A;  3WGH A;  1TLH B;  2XRL A;  1D0X A;  2E34 A;  2WV0 A;  2L0K A;  2X51 A;  3B6C A;  5C44 J;  1Z3X A;  2AXL A;  3GWZ A;  4HDV A;  3VSK A;  1S6L A;  5FKO A;  2OPT A;  4Q48 A;  1MD0 A;  4ZZD A;  3RKW A;  3A01 A;  1E2X A;  1B9M A;  2CFO A;  3FKJ A;  2AO9 A;  3CDL A;  1HKT A;  2O7T A;  5J1Y A;  3HRT A;  1F5T A;  1YOV B;  4M3D A;  2KJC A;  3SZP A;  3ZMU A;  1W0T A;  3J80 K;  2FMY A;  2DCE A;  3KYD B;  2CQK A;  3JRE A;  1I6H J;  1IDY A;  3AG2 H;  1OCO H;  2QEN A;  4KJZ A;  5F08 A;  5CPR B;  1I6X A;  2K7L A;  3AG4 H;  3CJQ B;  3K10 A;  3Q5F A;  4ON0 A;  3PAS A;  4HEA 2;  4P5O A;  2Z1D A;  4GGG A;  1K83 J;  3O8H A;  5FO5 A;  1MJB A;  1EKE A;  4B48 A;  4QLC U;  4EGY A;  3VB2 A;  3OYG A;  5DCF A;  3FXO A;  2DA3 A;  1D8K A;  5H9T A;  2KDO A;  5FKM A;  3AKZ A;  1KQ8 A;  4HSR A;  1TQP A;  2GUH A;  3RKX A;  1SFE A;  4B1R A;  1LQ1 A;  3RH2 A;  4D5F A;  2E1N A;  2MW8 A;  5DUI A;  3ABL H;  1YTY A;  3GLX A;  4LIT A;  3FRQ A;  3JRB A;  2XB0 X;  4XRF A;  1H8A C;  4HOB A;  2QQ9 A;  5CQG A;  2KMU A;  1BI1 A;  1HLV A;  1GDT A;  2PJP A;  1ORK A;  2YU3 A;  3H36 A;  1N75 A;  1MBJ A;  1O57 A;  2O3F A;  3OYN A;  3Q0V A;  1E3H A;  3F8B A;  2HVQ A;  4UVC A;  4NC7 A;  1V5G A;  1IV6 A;  3MMY B;  2EJR A;  1MW7 A;  5AIQ A;  2IP2 A;  4QWQ A;  2V79 A;  2W48 A;  1RUN A;  5A2Q K;  1ZRF A;  3IKT A;  2UWM A;  3TOA A;  4HQE A;  3M7G A;  4M6V A;  2QTQ A;  1TQI A;  2PQ8 A;  1VF9 A;  2W84 A;  2IT0 A;  2PZ9 A;  2DOE A;  2G3B A;  1IN4 A;  5DV5 A;  3ZQG A;  2FBQ A;  2L2O A;  3K1M A;  4M6Y A;  2NP3 A;  4JNN A;  2IGN A;  3G4S I;  4L5I A;  1CF7 A;  1O4X A;  2IRF G;  4KUM A;  3M07 A;  3TO9 A;  1D1B A;  1VQO I;  4CH7 A;  3HSF A;  1YS7 A;  5FD6 A;  3K70 C;  4C2M A;  1IRZ A;  2M9H A;  4BEH B;  2HYJ A;  2KT0 A;  2VJJ A;  3I55 I;  4HLY A;  5LHG A;  1U78 A;  1ZAO A;  2LLK A;  3DLL F;  1FX7 A;  2E36 A;  2QGU A;  2W00 A;  1P2F A;  1E3O C;  2IGO A;  1FPQ A;  5FD5 A;  4RB1 A;  3RKQ A;  1HBX G;  2CYY A;  1MMA A;  4EJW A;  3FWE A;  4U7D A;  5D4R A;  2CV1 A;  2XAF A;  2VN2 A;  4DBR A;  3VTI A;  2DMQ A;  2DQL A;  1R36 A;  1Y1W J;  1K79 A;  4NQW A;  3V7C A;  2VBZ A;  1P4X A;  3BG6 A;  3HG9 A;  3KP5 A;  2W53 A;  1KYZ A;  1V4R A;  2P4W A;  2VAS A;  5L3C A;  3OOP A;  2YVE A;  5LFA A;  2A2F X;  2ZOZ A;  2D6Y A;  3PNY A;  2Y69 H;  2CH0 A;  2XGE A;  2J5P A;  1ZGW A;  3KEQ A;  2FOW A;  3B6A A;  4XM3 A;  3F22 A;  2PX9 A;  4OD5 A;  2MSY A;  1RI7 A;  1FLI A;  3I58 A;  2D1V A;  4WIB A;  2YUS A;  3QYB A;  3OYC A;  2HPM A;  2X6Y A;  3WE2 A;  1P7I A;  3OYF A;  2RDP A;  4Q4Z F;  2R7R A;  2L7K A;  1TT0 A;  4D0P A;  3WHB A;  5FKN A;  4ACI A;  2DA4 A;  2QQA A;  3IAS 2;  4F93 B;  5LLQ A;  4KMF A;  2WA0 A;  1TW3 A;  4F91 B;  5J1R A;  2WAQ A;  3R61 A;  4QIW N;  5BNG A;  4S05 A;  1WJE A;  3QRF F;  3E6M A;  3CUQ A;  1R22 A;  3OIO A;  5FMP A;  2G7U A;  2JSP A;  1GVJ A;  3H1C A;  3K4B A;  1PP8 F;  3C2H A;  3LFK A;  2R5Y A;  3OR2 C;  4MTD A;  3FXQ A;  5B3S H;  1IAW A;  4N9H A;  1O3R A;  5HAW A;  4KIG A;  3DKX A;  3MN2 A;  1GV2 A;  3OYM A;  2OER A;  2M30 A;  5EGO A;  1RRJ A;  4MEX F;  3P7N A;  3NNR A;  2FJI 1;  2MLG A;  2HYF A;  2X9D A;  2L4A A;  5M5X J;  1QPI A;  3LMM A;  1EH7 A;  2EIK H;  1WJF A;  5GPC A;  2HDW A;  1G6N A;  3VOE A;  3L7W A;  4W1U A;  1EH6 A;  3JRA A;  2PBX A;  3BRU A;  3C2G A;  4IQJ A;  5IP9 J;  4G7H F;  2VT3 A;  1TNS A;  3K9T A;  2Z33 A;  4LLN A;  3I71 A;  2X1E A;  4GFK A;  4BXF A;  1PJR A;  4WCG A;  2GA2 A;  4BBR J;  5FLX Z;  5J47 A;  2LG4 A;  3CJT B;  1FBS A;  1OCP A;  3IRR A;  4O3M A;  2MH2 A;  3K4K A;  5FLV A;  2Y9Y A;  1ZG3 A;  4ESB A;  3I5U A;  1ON1 A;  1I3A A;  3OL4 A;  4ENJ A;  1U5T A;  4ITV A;  3RI4 A;  2VQG A;  2KKO A;  3BR0 A;  4KN7 X;  2RQP A;  1J5Y A;  1IC8 A;  2UUZ A;  2KDZ A;  1OCC H;  4XBF A;  3O6B B;  4IPA A;  3DPJ A;  2WGB A;  2Y30 A;  3LSJ A;  2FQ4 A;  2BY3 A;  4ESJ A;  5IYD J;  2R5Z B;  4IXA A;  1K4T A;  3CCY A;  2CFX A;  5CJ9 A;  2DA5 A;  1FBQ A;  2TCT A;  2EA4 A;  1TL8 A;  2MFZ A;  3HOT A;  2DLL A;  5CLS A;  4KDP A;  1B8I B;  3HTH A;  2BZT A;  4A3C J;  3F8N A;  3I64 A;  3RJP A;  1HDD C;  1CGP A;  2CV0 A;  1XGM A;  4RGU A;  4P1W A;  3PO2 J;  2WBM A;  3B73 A;  2L9S A;  1V55 H;  1PP7 U;  2Q0O A;  5GAG J;  1OYW A;  3FBI B;  1MSE C;  3LA7 A;  4BE1 A;  4WXD A;  1B59 A;  2ZCM A;  4XKC A;  5M3F J;  2K5C A;  4KT5 C;  1MDM A;  1JE8 A;  3MWM A;  5HOD A;  5F27 A;  3CCV I;  2K9S A;  2LD5 A;  2IA1 A;  3KP7 A;  1YHQ I;  1B6A A;  1RIO H;  3QBM A;  2BY0 A;  3I4P A;  4F92 B;  2V1N A;  1IO2 A;  4HPQ A;  1YIT I;  5LHI A;  2PJR B;  5AQC A;  2E2H J;  3BRO A;  3IAM 2;  2V1U A;  2GWR A;  1FMW A;  1SD5 A;  3BC8 A;  3JCU C;  4CYC B;  3CCU I;  2UXN A;  2ELH A;  3K1N A;  4LIU A;  2QLZ A;  2NNN A;  1WQ2 A;  2F5E A;  5ED4 A;  2CQX A;  2QWW A;  4A3F J;  1WZ2 A;  4PFP A;  2CQQ A;  2CW0 F;  2X0L A;  4RM3 A;  1W4M A;  2Y31 A;  2NVT J;  2XGX A;  2VI6 A;  3HTU A;  3KP6 A;  2A6H F;  5DCM B;  4B09 A;  4ZDO A;  2DG7 A;  3BZ6 A;  1SD6 A;  4I98 B;  4KN4 X;  2WAD A;  2R7U A;  2JSC A;  3Q0W A;  5HLT A;  3CF5 F;  1JGS A;  2M7A A;  3ULQ B;  4AIJ A;  3V78 A;  2TDX A;  4AF5 A;  4XOP A;  1B9N A;  5EEG A;  2B0L A;  1KU7 A;  4AWX B;  3DWL E;  3RZO J;  3GTM J;  4RAZ A;  3LWJ A;  3HIF A;  2JTV A;  2M7B A;  4DBQ A;  3MNL A;  3V42 A;  1HW1 A;  1S5L C;  3OR1 C;  4OAZ A;  3ZOB A;  4XLH A;  4LG3 A;  2FF4 A;  2OZ6 A;  3MZY A;  2M0M A;  5IPA A;  5D5U B;  4YRV A;  4IHT A;  2WUI A;  3VOX A;  1RR8 C;  3IH4 A;  2DXI A;  2IGK A;  3KFW X;  1A36 A;  3VFZ A;  2STT A;  3V8L A;  3VVY A;  1JKQ C;  3I0T A;  2F4I A;  2UXU A;  3FKI J;  3NEU A;  1SD4 A;  2P6T A;  1SVL A;  2K9M A;  4NB5 A;  5M3M J;  1UMQ A;  1J2X A;  2HGC A;  2V6E A;  2JN6 A;  3VUQ A;  4OIN F;  2Z2S B;  3DEU A;  1I27 A;  4NHJ A;  2F5C A;  5CQE A;  2XPV A;  2VOO A;  4C2T A;  2M5W A;  4B47 A;  3J7Y J;  1XTA A;  2EB7 A;  2VJI A;  1IW7 F;  4QTR A;  1K7A A;  2KZV A;  5D6E A;  4M6X A;  3S1R J;  1YFH A;  2DFH A;  1ACI A;  1BM9 A;  4QPQ A;  3LAJ A;  2KRC A;  4XN3 A;  5FGM A;  2ESH A;  4JP0 A;  1QVU A;  2K4B A;  2OZU A;  1UG0 A;  3MKZ A;  5D1R A;  3PSF A;  3BR1 A;  3VYU B;  2NAZ A;  3LSP A;  2GFN A;  5L3E A;  5GTH C;  1LE8 A;  2XPW A;  2QOP A;  4MK6 A;  3BY6 A;  4BU2 A;  2X48 A;  3BTJ A;  4IRI A;  4IEJ A;  4IHV A;  3ZMS A;  1ZG1 A;  1A6Q A;  3I53 A;  1VQP I;  5H20 A;  3PUB A;  3Q9S A;  4WXC A;  1Z6T A;  3PFI A;  5C4X J;  2EV0 A;  2ICW G;  1N78 A;  2DTZ A;  2X1D A;  1MMD A;  5TGT A;  1KGS A;  3AG1 H;  3D5S C;  5E8G A;  3ZMD A;  3J81 K;  4Y3O A;  1GHC A;  3ZXS A;  1IG7 A;  4YZE A;  1Z6R A;  2K9L A;  4UHT A;  2NXN B;  1P92 A;  3FXR A;  2E5N A;  5ICG A;  3GTJ J;  1BIA A;  3PFY A;  4RM2 A;  1BI3 A;  4G7O F;  2JZY A;  3W3C A;  1YG2 A;  3W2V A;  2IA2 A;  1J7K A;  5B1A H;  3WU1 B;  3HOZ J;  1N25 A;  4HAM A;  2X85 A;  1APL C;  4XN0 A;  3DFG A;  2QBY B;  5C4Y A;  1T08 B;  3LSH A;  2FNA A;  3DBR B;  4X6A J;  4M3G A;  2ID3 A;  4DNC A;  3OYH A;  3LAP A;  3M1E A;  3I3L A;  4P9F A;  1Y8Q B;  3ABT A;  4NNJ A;  1XS9 A;  2QQB A;  3CO6 C;  3TED A;  4PJN A;  4NEL A;  4UV9 A;  1R5I D;  3IHU A;  4P96 A;  5E79 C;  1HSJ A;  1QQI A;  3SDB A;  2V1X A;  5HNF A;  3HOU J;  1XX5 A;  4MNU A;  3BR3 A;  1BJZ A;  3MAJ A;  3PIO F;  3BQY A;  4LLL A;  2KIF A;  2X4H A;  1LDD A;  4PGG A;  3C7J A;  1YYV A;  2LBF B;  3H3Z A;  1F1Z A;  3GBG A;  4IF4 A;  3VEP A;  4BYY A;  2XF6 A;  3ZQI A;  1V54 H;  4E6K G;  1P4A A;  4C2U A;  5JVG F;  2LSO A;  5EZG A;  3ZR8 X;  3KE2 A;  4BGD A;  2FX0 A;  4WWC A;  3JRF A;  3RQI A;  4K2E A;  4O6J A;  5EFY A;  1W0U A;  2QKO A;  5IT9 Z;  3R0A A;  2UXO A;  3V6G A;  2O5R A;  1R71 A;  4BY7 J;  2L02 A;  3G1O A;  1QGP A;  1KU2 A;  1IRG A;  3T8T A;  1BOA A;  1WH7 A;  3LQR A;  3SWH A;  1KON A;  2ZME A;  3AAF A;  2GM4 A;  2Z3Y A;  1HQC A;  3U9G A;  2NS0 A;  3OL3 A;  5F0C A;  3ZRG A;  2OTJ I;  1TWH J;  1HOM A;  2HXO A;  4FE4 A;  2JT1 A;  5IYB J;  2QEX I;  4PDK A;  2Y0S N;  4A93 J;  4DZP A;  2QIB A;  1Z67 A;  2XKP A;  3BZC A;  4EV0 A;  2D1H A;  3BR5 A;  1SC7 A;  3UR3 C;  2DK5 A;  1K4S A;  3TQN A;  1S29 A;  1RPW A;  2WC2 A;  4MFE A;  4NC8 A;  3JRG A;  2YX7 A;  2KJB A;  3KCC A;  1VQM I;  3CCE I;  3E5U A;  3MKL A;  4FTH A;  2P0W A;  2EH3 A;  4NC6 A;  2V26 A;  3U21 A;  3JTG A;  1ETW A;  2G7S A;  2LKS A;  4HV5 A;  4BKX A;  3VYT B;  1X2M A;  4ANJ A;  2AXT C;  3HBL A;  2XAH A;  1TWF J;  1TTY A;  1J9I A;  5K5O A;  3TO6 A;  1IXS B;  4C3J J;  3HHG A;  4N0B A;  3DXJ F;  1WGX A;  2VKE A;  3F9K A;  1YE9 A;  1LB2 A;  2VQC A;  2ECC A;  2K3P A;  3QU3 A;  3WG7 H;  2VOP A;  5KVR A;  4I02 A;  1K6O A;  1REP C;  2XB5 A;  1Y8R B;  3I59 B;  3DBL B;  1NHA A;  3BJO A;  3CLQ A;  2JRM A;  3HM5 A;  4PJJ A;  3OS0 A;  3CMY A;  4BNC A;  1KU3 A;  3U1K A;  2NOJ B;  5F0H A;  2K3F A;  3RPQ A;  3OY9 A;  3FHN A;  4XK4 A;  1W5S A;  3PPB A;  5EZH A;  1XCV A;  2BYV E;  2IAI A;  3DU5 A;  3S2W A;  5GAD J;  4EJU A;  3LSR A;  4XLN F;  2CS3 A;  3CP2 A;  2YPR A;  1ZAR A;  4RAF A;  3AQS A;  5J4V A;  1KA8 A;  3E5Q A;  3FX3 A;  2LKX A;  3ZP5 A;  1K61 A;  3RZD J;  1YRN B;  1TWC J;  3FMQ A;  1SEU A;  3H0G J;  1PUF B;  4YII A;  2NRA C;  2QZ8 A;  2FSW A;  1T2K A;  2R7V A;  2F5F A;  2LF8 A;  3E97 A;  1LDK B;  2LY9 A;  3JW4 A;  4L5E A;  3W2A A;  2L3D A;  3NPI A;  4C3I J;  2DK8 A;  3IWF A;  4JX6 A;  3K4M A;  3KZZ A;  1IN8 A;  4MXM A;  2L7M P;  2XHK A;  2JUC A;  5FHP A;  3J7Z I;  1QPM A;  4R79 A;  5JHF A;  2ZSH B;  5HDG A;  1ZLJ A;  2VE9 A;  4E7K A;  2HDC A;  3CUQ B;  4MO7 A;  2I10 A;  4XL9 A;  1IZ1 A;  2K02 A;  2KIU A;  2WB1 N;  1AKH A;  2BV6 A;  3RYR A;  1H88 C;  4A6D A;  2LR8 A;  2Y2Z A;  4IZZ A;  4AYB N;  3PSI A;  2CGP A;  2E2J J;  3HDD A;  3E3V A;  2GEN A;  3HRS A;  3LSG A;  5HS9 A;  2XIG A;  3K2Z A;  3EYY A;  4LGW A;  2PN6 A;  3ZPL A;  4MQ9 F;  4S0H B;  2VBW A;  2I5U A;  2LOO A;  3CJR B;  2LRE A;  4OMY A;  4EJV A;  3H9Q A;  2Q2E A;  3PNT A;  5LHH A;  4RAY A;  5J4Y A;  5DYM A;  3ESW B;  4UUS B;  2FML A;  3CCQ I;  2E7W A;  3W6J B;  3FXU A;  2YVX A;  3GEZ A;  3GZI A;  3RCO A;  2EZK A;  3GTK J;  1NK3 P;  2HWV A;  1FTT A;  2DT6 A;  3O2P E;  3HKZ A;  1FOY A;  2CRG A;  1Q1V A;  4IL6 C;  2XRO A;  2Y9Z A;  2R7D A;  2DBB A;  3GXO A;  1QO0 D;  3L00 A;  4ME9 A;  3B81 A;  4AC0 A;  2IS6 A;  4UB8 C;  4RDU A;  3J7A O;  2B9S A;  2LH9 A;  2DW4 A;  3H92 A;  3GW2 A;  2EFW A;  2P5L C;  2V9V A;  2AQF A;  4KA4 A;  3QPS A;  1A31 A;  2VB6 A;  4MGR A;  3VW0 A;  3WGI A;  2JA7 J;  1XD7 A;  2E2I J;  2YU9 J;  4KIS A;  4D9J A;  2CUZ A;  3TOB A;  5D5V B;  4AIK A;  2C6Y A;  5L3F A;  1XSX A;  4TV7 A;  3MKY B;  1XB4 A;  1MH3 A;  3TW6 A;  3TL4 X;  3M9A A;  4DW6 A;  3OYK A;  1JKO C;  2DOA A;  3CDI A;  3NRV A;  2RN7 A;  4BDY A;  2XUB A;  1DP7 P;  2ZCX A;  3HIM A;  4PJ0 C;  5HS7 A;  3OS2 A;  1YW7 A;  2XC7 A;  1S3J A;  4W97 A;  2DPU A;  2KP6 A;  1R1V A;  4ASN A;  4A3E J;  3W6V A;  2DAO A;  2H27 A;  3LWF A;  5D8K B;  5IOY A;  3F23 A;  1VQ9 I;  1GVD A;  2DT7 B;  5TIS C;  3HGG A;  4ENM A;  2H1L A;  1FMV A;  2EV6 A;  1W36 C;  3CO7 C;  2VPR A;  4PJM A;  2JA6 J;  2DI3 A;  4R1H A;  3OYL A;  1BW6 A;  2HYT A;  1FC3 A;  2LP0 A;  2OV7 A;  1BIB A;  1KQ9 A;  3H9J A;  2BHZ A;  2R92 J;  1ZH5 A;  3LNQ A;  2KPM A;  3QPT A;  1WH5 A;  3TGN A;  3GME A;  4E7L A;  1R4N B;  1FOW A;  4NBQ A;  1USS A;  3ONQ A;  2ME0 A;  3IRQ A;  5K1Y A;  1A5J A;  1SAX A;  3VOD A;  5D4S A;  1YQA A;  2IW5 A;  1OJL A;  4BS9 A;  3GZ5 A;  4Y17 A;  4EM2 A;  1BBY A;  3KET A;  3CCS I;  1MKM A;  1OCR H;  4AID A;  2WTE A;  3TW7 A;  4DIQ A;  2QA4 I;  3ZMZ A;  3J80 Z;  3AG3 H;  2VJ4 A;  1G2H A;  2ADU A;  2L9N A;  4ZYE A;  2MBF A;  3HUG B;  5LEK A;  4OIP F;  4Q5S F;  3E7L A;  5GTI C;  1X1B A;  5DEQ A;  4M74 A;  1W7P D;  1EH8 A;  3PQJ A;  1UZC A;  4BAY A;  1ODD A;  3WTZ A;  4S04 A;  1QZY A;  4YFK F;  2PLY A;  3BR6 A;  5E3O A;  1MNE A;  2LY2 A;  1RZ4 A;  1X4P A;  1AA7 A;  1OPC A;  3TDZ C;  4HLX A;  3K8P C;  2R7X A;  5KAF C;  4LIV A;  2ZXW H;  2FJ1 A;  4A3B J;  4E7H A;  4LD5 A;  2K4J A;  2X6W A;  4CIC A;  3SXY A;  1X3W B;  1V5F A;  3T1B A;  3WTT C;  3JRI A;  1VQ8 I;  3NXC A;  2DYS H;  3GEU A;  1YW9 A;  1R5H A;  3L1P A;  3Q9V A;  4UVB A;  3QU6 A;  5CVU A;  1GUU A;  3PO3 J;  1OR7 A;  1MBF A;  1A6I A;  3TP3 A;  3H5R A;  1X58 A;  2EQR A;  2OAZ A;  5EG0 A;  3RPU D;  2YX4 A;  2EIN H;  2EPF A;  2AS5 F;  4V19 K;  3FHZ A;  3O60 A;  1T56 A;  1TNT A;  4WK8 F;  4CCK A;  2JVH A;  4XIC A;  4A6E A;  4F3Q A;  5J1U A;  2HEO A;  4D7N A;  3H5N A;  4XLF A;  4F55 A;  2JA5 J;  3OYB A;  1MMN A;  3NRG A;  3EUA A;  3KNW A;  3R60 A;  4IKF A;  1B1B A;  3GFL A;  2HTJ A;  5EF6 A;  1FT9 A;  1H0M A;  1U2W A;  3LOC A;  3CUQ C;  2F5D A;  3S14 J;  2DU9 A;  4HDU A;  5C3E J;  2OJE D;  2H1K A;  4XR6 A;  5B1B H;  3COL A;  4XKV A;  3ECH A;  1MBG A;  3QKX A;  4ABZ A;  1WI9 A;  4GRI A;  2K9Q A;  3F6O A;  3CC7 I;  4EVI A;  2FD5 A;  2LYC A;  4P9U A;  3L2R A;  5LD2 C;  2ZFW A;  4M72 A;  1XSD A;  1Z7L A;  3IH3 A;  3SEZ A;  1G3S A;  2L7F P;  4RGR A;  5B66 C;  1T0F C;  1ONV A;  1HKS A;  3G6E I;  4EGZ A;  2L9R A;  4XON A;  2PFV A;  5IY5 H;  4JQF A;  2IJL A;  1YJN I;  2PMU A;  1K78 A;  1RNL A;  1V3F A;  2EFQ A;  2BW3 B;  1EA3 A;  4XOR A;  1KU9 A;  2HVS A;  3S32 A;  5KK1 A;  1HC8 A;  1H89 C;  1P9Q C;  3ECO A;  1VQL I;  2VKD A;  1JTY A;  1G3W A;  4M3F A;  3T8R A;  4LG0 B;  3A2K A;  1L3L A;  4RS8 A;  2KLO A;  2ZJP F;  5D5X B;  1VQ6 I;  1Z91 A;  4I0B A;  3HOV J;  3B02 A;  1D5Y A;  2EWN A;  3SHF A;  5F6F A;  1HF0 A;  3PQK A;  3T6N A;  2X6X A;  4PSX A;  3E6C C;  5D5W B;  2MYS A;  1U5T C;  2CUE A;  2HQA A;  4C30 A;  4A0Z A;  3NAR A;  2HXI A;  4XOT A;  3UNG C;  4PK4 A;  2FU4 A;  1NG6 A;  1F9N A;  3MEX A;  3V4G A;  4ZC3 A;  2WAQ N;  2VT2 A;  5BPI A;  1R9T J;  4A3G J;  3E7Q A;  3IUV A;  4BJT A;  3BCB A;  3TMO A;  3TP0 A;  1W7P A;  4ZJZ A;  3WTS C;  1HDP A;  2D45 A;  4KMU X;  3F1B A;  2DTR A;  3NI7 A;  2COB A;  1B72 A;  1WJD A;  3N4M A;  1LVA A;  5F64 A;  3HOW J;  1S7E A;  2D2W A;  2NVX J;  4JKZ A;  2QSF X;  4CSW A;  3ON2 A;  3LFU A;  4IHS A;  5DM6 F;  3KP2 A;  4XNF A;  4ZZL A;  3A0H C;  3LL7 A;  4N4N B;  2O8X A;  3I54 A;  3GTP J;  2IS4 A;  2EZI A;  2F48 A;  5FB2 A;  4UB6 C;  2MD5 A;  2ZCW A;  3M3Y J;  4YIR X;  2XPU A;  4CZC A;  4BE2 A;  1SMT A;  2XDN A;  3GZ6 A;  1D8J A;  4RB2 C;  4U7B A;  1SAU A;  5JVT A;  2LF7 A;  2GAU A;  5HVQ C;  1X4O A;  2ZXJ A;  3RPU A;  4DVY P;  2W85 A;  5ERI A;  3D5R C;  3IC7 A;  3ZQF A;  4DZJ A;  2GZW A;  3WTX C;  5ILU A;  4F52 A;  2G9W A;  4YEL A;  2KRF A;  2ZME B;  2ZXH A;  3HEF A;  1ZEL A;  3IP4 B;  3E5X A;  5C4J J;  4X1E A;  3GTQ J;  3VP5 A;  1IRX A;  2VKH A;  4RGS A;  1OYI A;  4JOM A;  4BQA A;  4G7Z F;  2HI3 A;  1R6R A;  1WJC A;  2R7Z J;  1WJB A;  3S3O A;  1D0Y A;  3BTC A;  1R7J A;  3FBN B;  4BUP A;  3FXJ A;  1SFO J;  1PVE A;  1N77 A;  1PUE E;  4XSX F;  1DPR A;  2HYG D;  3ZQQ A;  3FMR A;  5D19 A;  2KIM A;  1RUO A;  1R5G A;  3Q3S A;  4KIC A;  1WRJ A;  5K7H A;  2OQR A;  2HVR A;  2M8E A;  1LDJ A;  3DTI A;  4KFC A;  3BCG A;  4G6D A;  3KEY A;  3ABK H;  2ZSI B;  3GFM A;  3BJA A;  2F4O B;  2BGC A;  3DF8 A;  4LOC A;  4G8X A;  3C1D A;  1P6R A;  4G94 A;  2V7F A;  4L0Z B;  3EQL F;  3G1M A;  2HZD A;  4DYQ A;  3FXK A;  3BQZ A;  2EBI A;  3CC4 I;  3P9K A;  3F3X A;  1BA5 A;  3ZN0 A;  2QKM B;  2VBX A;  1KQ0 A;  3ZQC A;  3NWT A;  1X3Z B;  4KIF A;  1MBK A;  3K0L A;  1BI2 A;  4CCL A;  2Z99 A;  5LRR A;  4A3J J;  2KIS A;  3LJL A;  1OYY A;  4U87 A;  4MHG A;  2BVM A;  2VXD A;  2RC4 A;  4Q47 A;  5HS8 A;  1PYV A;  1IXR C;  4BEH A;  1A04 A;  5HDN A;  1VQK I;  4HX4 A;  4XRM A;  1JUP A;  2V9K A;  4CA0 A;  4EM0 B;  3HOX J;  4XLE A;  3LST A;  4CCO A;  3ZQH A;  2H09 A;  2FQ3 A;  4Y7N J;  3QQA A;  3HJE A;  3GX4 X;  2HS5 A;  3EYI A;  1XMX A;  3WTV C;  5E1Z B;  2NS7 A;  3T0Y A;  4B3A A;  4ZH4 F;  4E70 A;  2R7O A;  4D5C A;  1DP3 A;  2O6G E;  3LA2 A;  3MZH A;  2KRH A;  2XGD A;  1MZB A;  3SEQ A;  1IN7 A;  5CVR A;  4A3M J;  2A69 F;  3FK6 A;  1ETX A;  9ANT A;  2A5W A;  2OD5 A;  2XVC A;  3ZCO A;  4ICH A;  4M71 A;  1JHH A;  1Y1V J;  1Z05 A;  1Y39 A;  4LK0 F;  2VJ5 A;  3JTH A;  1W5C C;  5CVV A;  3V7R A;  4KIT B;  4PGH A;  4I09 A;  1Z9C A;  1B4A A;  1ZR2 A;  2WAE A;  4A69 C;  4II3 A;  5JLX A;  2UXH A;  1JXS A;  3ABM H;  1V5E A;  5E3L A;  1QNT A;  5FKL A;  1HW5 A;  2ESN A;  3MCZ A;  4MEY F;  4ZDP A;  4IO9 F;  3EUP A;  4ZYG A;  1E3P A;  3Q0U A;  3RD3 A;  2HQR A;  4HZF A;  4I99 C;  5ICE A;  1G3Y A;  2NS8 A;  4XKW A;  4L9J A;  4OIR F;  4V2F A;  2ME6 A;  4GFB A;  2NOG A;  3HZJ A;  2PMZ A;  1FYL A;  4CUG A;  2KFD A;  1QA6 A;  3BR2 A;  1JT6 A;  5D8L B;  4WXH A;  5IT3 A;  2QKL B;  2M2E A;  4J19 A;  3HGY A;  2VKV A;  3COA C;  5FFX A;  1ERD A;  2QYO A;  2BY1 A;  2OCE A;  2EZH A;  1XGN A;  2L4M A;  2NYX A;  1NK2 P;  3KLN A;  4B44 A;  4HV6 A;  3A01 B;  3MKW B;  2DFE A;  3BG7 A;  2P81 A;  1D0Z A;  2G7G A;  1QHH D;  2Z9O A;  4UY8 I;  1SAN A;  4BY1 J;  3WGG A;  4HG2 A;  1JKP C;  2O03 A;  5BMZ A;  1TQM A;  2E1C A;  1OQY A;  5FRO A;  4CYD A;  3L09 A;  4CGZ A;  5IT9 K;  1YIO A;  4GCT A;  1ZGJ A;  2P7V B;  1HA8 A;  2GIV A;  3A02 A;  4LJZ F;  2EV5 A;  4MQV A;  2OTL I;  1Z7U A;  1ZN2 A;  1XC5 A;  4NDL A;  3FM5 A;  4A0X A;  3WTY C;  1XDS A;  1RC9 A;  5J6X A;  4IJA A;  4M9Z A;  4EJO A;  1UI6 A;  1U0J A;  2RQQ A;  3OYD A;  2MH9 A;  2L9V A;  2X6O A;  3VOK A;  2P7C B;  1WSU A;  2W57 A;  1MH4 A;  4I76 A;  4HRI A;  5KCM A;  3FXL A;  4GO1 A;  4M73 A;  2KHM A;  1ZG5 A;  1GV5 A;  3QOD A;  5DDG A;  1UHM A;  4DYC A;  1FSH A;  4FET A;  1TW2 A;  3VWB A;  5E17 F;  2E19 A;  2ZME C;  4UVA A;  2DA1 A;  4UUT A;  2PG4 A;  3SQN A;  3WOD F;  1ZR4 A;  2CW8 A;  2B1E A;  4EJT A;  2A6T A;  4J01 A;  5K7Z A;  2R7S A;  2GXG A;  2YR2 A;  2ACJ A;  2CSO A;  1Z21 A;  1FEX A;  4HF0 A;  4ZTJ A;  3J81 Z;  3OS1 A;  1ITY A;  4N4O B;  2GXA A;  3F8F A;  4IX7 A;  1QZE A;  4XID A;  4HNU A;  1LNW A;  1UG2 A;  1TWA J;  1Y0U A;  2E1O A;  3REO A;  2NNY A;  1S9H A;  2O61 A;  2E5Z A;  2GOM A;  3X2Q H;  2UXP A;  3BG9 A;  3BG5 A;  5J8F A;  1OLT A;  2A68 F;  3K2A A;  4IRH A;  1X1P A;  3VVX A;  4G12 A;  1B8I A;  2DA7 A;  1TC3 C;  2ZKZ A;  3PUF A;  1CF7 B;  3QOE A;  4FT8 A;  1FIA A;  1I5Z A;  4JX4 A;  4LB6 B;  1ETO A;  1JUM A;  1UI5 A;  1WFX A;  4ESF A;  1OCT C;  1VFC A;  4U0W A;  3W2W A;  2P6S A;  1YI2 I;  1AOY A;  4KNY A;  2WWY A;  4YEJ A;  5ILV A;  3CCM I;  4CZZ A;  4BXU A;  4IHY A;  4DYR A;  1G59 A;  3KZY A;  1R1T A;  2BY2 A;  4H0E A;  2ID6 A;  2EFP A;  4D7M A;  2UZK A;  3R0J A;  1FP2 A;  5CVJ A;  2WAF A;  5HSZ A;  2QCO A;  4I0A A;  2PJR A;  2DOD A;  3CES A;  4NN1 A;  1ZRD A;  2DYR H;  4LLG F;  4IHX A;  2YVH A;  1LEA A;  3DV8 A;  5HBU A;  5EEA A;  4CYC A;  2R7Q A;  4EEF G;  4ENK A;  2E60 A;  3L2C A;  1G4D A;  4NQW B;  4U0V A;  3S3N A;  2IGM A;  3EUH A;  2H8R A;  2RNJ A;  2M8G X;  3CCJ I;  2MLK A;  2VL8 A;  2CG4 A;  4J00 A;  2A05 A;  4AIH A;  4LFU A;  2HFH A;  2H6C A;  2HQ5 A;  3BHQ A;  5JLW A;  3CF2 A;  3HPH A;  4XKB A;  5EEH A;  1QBJ A;  2XAS A;  4C3H J;  2ISZ A;  5FRM A;  2BXZ A;  3ZQL A;  3AFH A;  2LKP A;  1TBX A;  3C18 A;  4Y15 A;  2WY8 Q;  4YFX F;  3MVP A;  1T8I A;  2K9N A;  2X1C A;  1LEB A;  3P9T A;  2NX4 A;  4A0Y A;  3JSP A;  4BBS J;  2XF7 A;  2XRN A;  1T98 A;  4M9S A;  3JAM Z;  1CQT A;  3S2D J;  4JYK A;  2K85 A;  1S8N A;  4ZYH A; 
#chains in the Genus database with same CATH homology
 2LK2 A;  5IYD J;  2R5Z B;  3BT9 A;  2WV1 A;  1F43 A;  3JRH A;  3BR6 A;  2DMP A;  3CCY A;  5E3O A;  2Q24 A;  2DA5 A;  1QVT A;  2HDD A;  2TCT A;  3S5R A;  3OSG A;  2FJ1 A;  4A3B J;  3ANP A;  1WCM J;  4KWA A;  4IHW A;  1B8I B;  2G0E A;  3HTH A;  4A3C J;  1JGG A;  1HDD C;  4JX5 A;  5E3N A;  3JRI A;  3NXC A;  2M0C A;  3PO2 J;  3GEU A;  1QRY A;  2IU5 A;  3IH2 A;  4FE7 A;  3L1P A;  1MSE C;  5FGL A;  2CUF A;  1DU6 A;  2ZCM A;  2R5Y B;  1Z0X A;  1GUU A;  3PO3 J;  5M3F J;  1MBF A;  2XSD C;  1A6I A;  3TP3 A;  2PMZ N;  3A03 A;  1X58 A;  2EQR A;  5F27 A;  5HOD A;  1ETV A;  2K9S A;  5EG0 A;  2LD5 A;  3S1M J;  5EGO B;  3QBM A;  3O60 A;  1T56 A;  5AQC A;  4XIC A;  5J1U A;  2DMT A;  2E2H J;  4D7N A;  5J3L A;  1UHS A;  2DN0 A;  2JA5 J;  5F04 A;  3NRG A;  3OOU A;  4CYC B;  4BXX J;  1SGM A;  1RET A;  3KNW A;  2CQX A;  3FIS A;  4A3F J;  1U9N A;  2CQQ A;  5EF6 A;  1T33 A;  4GFL A;  2Y31 A;  2NVT J;  5IP6 A;  3LOC A;  4A3D J;  2VI6 A;  3S14 J;  2EZL A;  2B63 J;  4V2G A;  5C3E J;  3G7R A;  2H1K A;  3COL A;  2V57 A;  1MBG A;  5CXG A;  3QKX A;  2R5Z A;  4ABZ A;  4C2M J;  4A3I J;  2REK A;  2DG7 A;  4FCY A;  2K9Q A;  5IOZ A;  2FD5 A;  3HTJ A;  3S16 J;  1ETY A;  3Q0W A;  3V78 A;  3VW2 A;  5M5W J;  1JKR C;  3IH3 A;  3PM1 A;  1ZK8 A;  5GPA A;  4AF5 A;  2L7F P;  4FIS A;  3K7A J;  1ZKG A;  2JK3 A;  3VW1 A;  2L9R A;  5DS9 A;  3GTM J;  3RZO J;  3LWJ A;  4GCL A;  1I50 J;  1ETK A;  3MNL A;  3GTG J;  1Z77 A;  3ZOB A;  3EGQ A;  2HOA A;  2N8G A;  5IPA A;  2YS9 A;  2WUI A;  3VOX A;  1FTZ A;  3IH4 A;  4HNV A;  4CGR A;  1H89 C;  1JTY A;  4M3F A;  3G56 A;  5M5Y J;  2ZOY A;  4L62 A;  3HKZ N;  1JKQ C;  3VVY A;  1RKT A;  1ETQ A;  4Y52 J;  5DAJ A;  2UXU A;  3FKI J;  3HOV J;  3VVZ A;  1JJ6 C;  2RAS A;  1D5Y A;  3JSJ A;  2DMN A;  1HF0 A;  5M3M J;  1UMQ A;  3FIW A;  3T6N A;  2JN6 A;  3VUQ A;  2CUE A;  2JMW A;  3NAR A;  2HXI A;  5EG0 B;  3S1Q J;  3C2B A;  5EYR A;  4AUX A;  2WAQ N;  3E7Q A;  1R9T J;  2XPV A;  4A3G J;  3BNI A;  3IUV A;  3TP0 A;  4QTR A;  1HDP A;  2JA8 J;  2DA6 A;  3I4M J;  3UKG A;  3F1B A;  2LVS A;  3S1R J;  2NVQ J;  3NI7 A;  3VIB A;  2COB A;  1B72 A;  1I3Q J;  5CW8 A;  1IUF A;  3HOW J;  1ENH A;  1S7E A;  2NVX J;  4JP0 A;  1QVU A;  4JKZ A;  4QSH A;  2IEK A;  1BW5 A;  5D1R A;  2ZB9 A;  3ON2 A;  3DCF A;  3BR1 A;  5IP7 J;  2CU7 A;  4MLO A;  3CWR A;  3LSP A;  2GFN A;  3GTP J;  1LE8 A;  2QWT A;  2XPW A;  2QOP A;  2EZI A;  4UDS A;  4MK6 A;  1AU7 A;  2GLO A;  3BJB A;  2X48 A;  3BTJ A;  3JR9 A;  3M3Y J;  4IEJ A;  4IHV A;  5DTD A;  2XPU A;  3JRC A;  1RKW A;  2XDN A;  3F0C A;  2HKU A;  3CRJ A;  2JJ7 A;  5C4X J;  2DTZ A;  4HKU A;  4RBO A;  5GP9 A;  2OI8 A;  4YZE A;  4AC6 A;  2GBY A;  1IG7 A;  1JJ8 C;  2ZCN A;  3ZQF A;  1VND A;  4DZJ A;  3ANG A;  3S1N J;  2RHA A;  3GTJ J;  3LHQ A;  1FIP A;  3WHC A;  3HEF A;  3SDG A;  3HOZ J;  5C4J J;  3CJD A;  4X1E A;  1APL C;  3C07 A;  3GTQ J;  3VP5 A;  5C4Y A;  3KZ9 A;  2HI3 A;  5IYC J;  3VPR A;  4X6A J;  2R7Z J;  2DA2 A;  1JT0 A;  4M3G A;  2ID3 A;  3BTC A;  3KKC A;  1SFO J;  2DJN A;  3JRD A;  3HE0 A;  1GT0 C;  5D19 A;  2HOS A;  1XS9 A;  3Q3S A;  3TED A;  4NEL A;  5K7H A;  1NTC A;  3HOU J;  3GTL J;  3BCG A;  3BR3 A;  3DEW A;  5K58 A;  1BJZ A;  1FJL A;  3BQY A;  2VUM J;  2G7L A;  4LOC A;  3GBG A;  2IBD A;  3ZQI A;  1B72 B;  3G1M A;  1IGN A;  4DYQ A;  3BTI A;  3BQZ A;  2EBI A;  2ECB A;  1BA5 A;  1ZTR A;  2MGQ A;  1X2N A;  5EZG A;  2FX0 A;  3JRF A;  3RQI A;  2XRL A;  3GTO J;  5EFY A;  1W0U A;  2QKO A;  5CXI A;  2L0K A;  2UXO A;  3B6C A;  5C44 J;  3V6G A;  3O8G A;  3ZQC A;  4BY7 J;  1MBK A;  3BG3 A;  3G1O A;  1LE8 B;  5FKO A;  1YRN A;  2OPT A;  4A3J J;  1PUF A;  3LJL A;  3HTI A;  3AQT A;  4M3B A;  3A01 A;  1WH7 A;  2AO9 A;  3CDL A;  4JL3 A;  4M3E A;  2O7T A;  2GM4 A;  5J1Y A;  4M3D A;  1W0T A;  5F0C A;  3CQZ J;  1TWH J;  4XRM A;  3JRE A;  1I6H J;  1IDY A;  2HXO A;  1HOM A;  4FE4 A;  1JUP A;  5F08 A;  5IYB J;  3HOX J;  3NAU A;  4MFD A;  1XG1 A;  2Y0S N;  5EDN A;  4A93 J;  3ZQH A;  4DZP A;  2QIB A;  3PAS A;  4B4C A;  1K83 J;  3QQA A;  4Y7N J;  3BR5 A;  1LFB A;  3O8H A;  4A3L J;  2NS7 A;  4B3A A;  1RPW A;  4MFE A;  3JRG A;  4D5C A;  2DA3 A;  5H9T A;  5FKM A;  2XGD A;  2GUH A;  3MKL A;  4FTH A;  2NP5 A;  2EH3 A;  2G7S A;  4B1R A;  4XRS A;  1ETW A;  3RH2 A;  4D5F A;  4A3M J;  2AHQ A;  3FK6 A;  1ETX A;  2MW8 A;  4BKX A;  1AHD P;  9ANT A;  3FRQ A;  1X2M A;  4ICH A;  3D1N I;  1Y1V J;  2XB0 X;  3HBL A;  3JRB A;  1TWF J;  1H8A C;  4UUS A;  1GDT A;  1ZR2 A;  1HLV A;  4A69 C;  1DU0 A;  5JLX A;  1ORK A;  2UXH A;  4C3J J;  2HOT A;  1MBJ A;  5E3L A;  3Q0V A;  1WGX A;  2VKE A;  5FKL A;  3SFI A;  3SJM A;  3EUP A;  2ECC A;  3M4O J;  3RD3 A;  3Q0U A;  2XB5 A;  1IV6 A;  3HM5 A;  3CMY A;  2NS8 A;  2W48 A;  5F0H A;  1VI0 A;  4V2F A;  2ME6 A;  4GFB A;  2NOG A;  4XK4 A;  3PPB A;  5EZH A;  2IAI A;  3LSR A;  2CJJ A;  4M6V A;  2QTQ A;  1LFU P;  3BR2 A;  1JT6 A;  1VF9 A;  3BTL A;  2M2E A;  4J19 A;  2PZ9 A;  3HGY A;  2VKV A;  2LKX A;  1K61 A;  3AQS A;  2G3B A;  2FBQ A;  4GCK A;  2NVY J;  3ZQG A;  3RZD J;  1YRN B;  1TWC J;  2QF7 A;  2NP3 A;  2EZH A;  2LFB A;  2XGC A;  3H0G J;  1PUF B;  4JNN A;  1NK2 P;  1O4X A;  3A01 B;  5FLM J;  2P81 A;  2LY9 A;  1RR7 A;  4L5E A;  1ZQ3 P;  2G7G A;  3NPI A;  1SAN A;  4C3I J;  2O8K A;  4BY1 J;  2M9H A;  4JX6 A;  1IRZ A;  1EF4 A;  4MXM A;  2HYJ A;  2KT0 A;  2L7M P;  1JKP C;  1JUS A;  1U9O A;  5FJ8 J;  3FK7 A;  5FHP A;  1U78 A;  4GCT A;  2LLK A;  4MO7 A;  1E3O C;  2I10 A;  1IDZ A;  2OF7 A;  3A02 A;  5FKK A;  3RKQ A;  2RAE A;  2WB1 N;  1XC5 A;  4NDL A;  1AKH A;  3HOY J;  1OFC X;  1IJW C;  1H88 C;  2LR8 A;  2Y2Z A;  1MNM C;  4AYB N;  2E2J J;  2LTP A;  1TWG J;  3HDD A;  1UI6 A;  3KKD A;  4PXI A;  2GEN A;  3LSG A;  2DMQ A;  2F07 A;  2X6O A;  1Y1W J;  3VOK A;  3H3V K;  4S0H B;  3HTA A;  1MH4 A;  4I76 A;  2DMU A;  2W53 A;  1GV5 A;  4DYC A;  1MSF C;  2YVE A;  2ZOZ A;  4XRS G;  2D6Y A;  1F36 A;  2XGE A;  2JWT A;  2E19 A;  5F0F A;  4UUS B;  1ZGW A;  2DA1 A;  4UUT A;  3B6A A;  1ZR4 A;  2MSY A;  5K7Z A;  3GZI A;  2EZK A;  3GTK J;  1NK3 P;  1FTT A;  2DG8 A;  2YUS A;  2CRG A;  3S2H J;  1P7I A;  1Q1V A;  1FEX A;  2Y9Z A;  1JTX A;  1U8B A;  1ITY A;  4ME9 A;  4XID A;  4AC0 A;  3WHB A;  3B81 A;  5FKN A;  4ACI A;  1UG2 A;  2DA4 A;  2ELK A;  4RDU A;  1TWA J;  2E1O A;  3IV5 A;  2TRT A;  5D18 A;  3QPS A;  5F1J A;  5J1R A;  4QIW N;  2UXP A;  3BG9 A;  5BNG A;  3VW0 A;  3BG5 A;  2JA7 J;  2E2I J;  2YU9 J;  1MBH A;  3K2A A;  1HCR A;  2L7Z A;  1MH3 A;  2K40 A;  4G12 A;  2M34 A;  3TW6 A;  2DA7 A;  5K7F A;  3OSF A;  1B8I A;  1TC3 C;  3OIO A;  4DW6 A;  1JKO C;  5FMP A;  1RES A;  1FIA A;  3S15 J;  2O7O A;  4JX4 A;  1ETO A;  2UXI A;  1JUM A;  1UI5 A;  2ZCX A;  3HIM A;  1OCT C;  1VFC A;  1BL0 A;  2R5Y A;  3HB9 A;  4W97 A;  5E3M A;  3W6V A;  4A3E J;  5HAW A;  4IHY A;  4DYR A;  2O9L A;  3MN2 A;  1GV2 A;  2OER A;  5EGO A;  2ID6 A;  3ON4 A;  3VVX A;  4D7M A;  5IOY A;  3NNR A;  5M5X J;  1GVD A;  1POG A;  2X9D A;  3HGG A;  1QPI A;  2QCO A;  3I4N J;  5HSZ A;  1AKH B;  2VPR A;  2JA6 J;  4NN1 A;  2MG4 A;  1BW6 A;  5GPC A;  2HYT A;  4IHX A;  2YVH A;  2LP0 A;  5HBU A;  5EEA A;  4W1U A;  2R92 J;  4CYC A;  3JRA A;  2PBX A;  4EEF G;  3LNQ A;  3BRU A;  2D5V A;  5IP9 J;  1WH5 A;  1MBE A;  2H8R A;  2M8G X;  1WI3 A;  4GFK A;  3S17 J;  2ME0 A;  1P7J A;  1A5J A;  4BBR J;  2R0Q C;  4I6Z A;  1WPK A;  1OCP A;  1OJL A;  2HQ5 A;  3BHQ A;  5JLW A;  5FLV A;  2Y9Y A;  2R93 J;  4C3H J;  3G1L A;  3TW7 A;  3ZQL A;  3BR0 A;  3MVP A;  3QPL A;  2K9N A;  1IC8 A;  1G2H A;  3P9T A;  2KDZ A;  2NX4 A;  3DPJ A;  4BBS J;  1CQT A;  2Y30 A;  3E7L A;  2WGB A;  4A3K J;  3S2D J;  3LSJ A;  4JYK A;  4MIM A;  2FQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...