2Y34A

S-nitrosylated phd2 (no exposed) in complex with fe(ii) and un9
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
215
Chain Sequence
PLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVAYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EGL NINE HOMOLOG 1
publication title Studies on the reaction of nitric oxide with the hypoxia-inducible factor prolyl hydroxylase domain 2 (EGLN1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 64
structure length 215
sequence length 216
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2y34A00
2HBTA 5EP9A 3PL0A 4ZONA 2FCTA 3GJBA 4Y5TA 4NHYA 2RDQA 5DAWA 5IATA 4NHKA 5L9BA 5IAVA 3W21A 5DAPA 4NMIA 3EMRA 3DKQA 3KT4A 5C5UA 5A3UA 2Y34A 4XACA 5LBBA 5C5TA 4NAOA 5L9RA 4Y5SA 2RDNA 2FCVA 5LBCA 4BQWA 5L9VA 5EQUA 4MHUA 4UWDA 5IAXA 3OUHA 5HV0A 3NNMA 4IW3A 5HV4A 2RG4A 4NHMA 2G1MA 3W20A 5M0TA 4XCAA 2HBUA 3OBZA 2JIJA 4BQXA 2FCUA 3KT1A 4KBZA 4NHLA 3HQRA 5LB6A 3HQUA 3NNLA 5DAQA 3BVCA 5EPAA 4NHXA 5LA9A 5LBFA 4J25A 2RDRA 3GJAA 4ZPIA 5DAXA 4Q5OA 3NNFA 4JZRA 4XAAA 3NNJA 2V4AA 5ERLA 3ITQA 2OPWA 4XCBA 5LASA 4XABA 2Y33A 3MGUA 4MHRA 5LATA 3KT7A 4BQYA 2RDSA 4XC9A 2A1XA 3OUJA 5DAVA 5LBEA 3GZEA 3OUIA 2G19A 2JIGA
chains in the Genus database with same CATH superfamily
2VZSA 3MYXA 1W6NB 3I2JA 2YB7A 4HVQA 4WBBA 4QM9A 4RQPC 3SH4A 2XLFA 4EWAA 3DPRC 1YFWA 3PL0A 4QAWA 4LO4B 1SEFA 1V6NA 2CWSA 4CXYA 3VKOA 3WQ1A 1QDOA 4NIIA 3WNOA 2W1SA 4FCAA 5JWPA 1W9YA 4CCDA 3GZTB 4FTSA 1IPKA 2Z2SB 3MICA 1UZYA 2IXLA 5IVCA 1UL9A 5K8SA 3RZJA 2JB8A 1SFNA 1R1A3 3VKMA 1CQ9A 1WW6A 2E26A 4RQPB 3PUHA 2HWD3 3ACFA 4QPGB 1OPOA 2RM22 4QX5A 4AI2A 2YYOA 1HIXA 3FN9A 3PU3A 4HOOA 3SMHA 5EWSA 1LU2A 1MR5A 3QLQA 2PAEA 4DB5A 3FL7A 4LQRA 2PMWB 4QD2A 4YVSC 3K75B 1WWYA 2OXBA 3J8F3 3AX4A 5C3OA 1W8UA 2NLRA 3AB0A 3AYEA 2BU9A 4SBVA 1VBA3 2ILMA 1RUE1 4W50A 2PHXA 1W39A 4MYEA 4FVVA 1MVEA 4LBJA 5C7GA 3ZM8A 2ATFA 1AL21 2J1TA 4IEZA 4Y24A 4FFIA 3VZKA 1GQGA 4CU8A 1DP0A 3UJOA 2NM1A 2IFRA 1GWLA 2DBNA 4V1PA 4XFBA 4YVSB 4JHZA 4QKNA 1J3RA 2OS2A 3K48A 3KWVA 1C4RA 2E33A 3NVCA 4HBNA 4IV1B 2JDMA 5F32A 2GU9A 2QQWA 1SLIA 5I0TA 1C8M3 2RS13 5FZKA 4QXCA 3VBHA 1A34A 1KJRA 2BZDA 3X29B 1WCKA 1QJX3 3FHQA 4A7ZA 4XJ9A 1E5SA 1WBLA 4S2HA 5FP9A 4AFMA 3WY6A 1DLCA 4H7LA 4IEPA 1VJ2A 5LA2A 1W0NA 4D7TA 1RUNA 2VJXA 4LKSA 3MI8A 2BPA2 1FMD1 5E8AA 2HWC3 5CG8A 1JU3A 1GLHA 5ANQA 2D43A 1C5HA 3CZJA 2C9AA 4OHXA 3E6CC 2VMDA 1HXS2 2QQOA 3UL2A 5LBFA 1OLME 2AUYA 4NOTA 1KDMA 4YW2A 1AJKA 4R4ZA 4MVTA 1XNCA 1FAYA 1R092 1VMFA 3MIDA 5FYIA 3KHCA 1GKBA 5A32A 1POV0 2W68A 3FBYA 3DXUA 3FZ3A 1JHJA 3K2OA 4QGNA 3IIIA 1Y9GA 2F17A 2VUJA 4MGTA 5HXVA 1WMEA 2VZRA 4YZ1A 3AVRA 4BA6A 1QOOA 3AYAA 2K2SA 5F8PA 5FWJA 4UW6A 3LA3A 4O65A 2FMYA 1JYTA 3CMGA 1XYOA 2OUHA 2VBDA 4Q0SA 5J09A 1BKZA 1EUTA 4XUPA 1UU5A 4XHXA 2P1BA 1BJQA 5CKQA 5T52A 4D8MA 4CDXB 1REDA 3GGLA 2XKPA 4H7MA 3KM5A 3C3VA 2VNOA 1AR91 2CHHA 1U5IA 2O0OA 4WM7B 4PDWA 4CPBA 4M00A 1GNHA 1RHI2 2YBKA 2HEVF 1W8ZA 4QX0A 2Q0AA 3HR9A 4CE8A 5LRSA 4QKBA 5DUUA 3VD9A 3HVDA 4XUNA 2EAKA 3E6BA 5EIYB 1ZBE1 3A0KA 3GCXA 4XDOA 3T4VA 2WAOA 3J7MA 2E6VA 4Q29A 5AC93 3B94A 4YM3A 2GC2A 4V2VA 1O7FA 2B46X 5CFCC 4KU7A 3UJQA 2G9ZA 5DAPA 5L73A 4W4ZA 1FXZA 5T5LA 3WDWA 5K7PA 4P5HA 1O3SA 4XJAA 2DBIA 4YNIA 3TRSB 4M3CA 5I0SA 3AP5A 1XB9A 4L92A 4W8JA 3WEZA 1K12A 1JZ8A 5FYVA 1UX6A 3L2YA 4CEYA 1H0BA 3T30A 2H0VA 1UX7A 4DINB 3AC0A 4UFHA 3NO8A 3ZMNA 1D2QA 1LU1A 3LDBA 4BQ1A 5FDBA 2PA7A 5JOWA 5CFCB 2W47A 2ZHKA 3A21A 1POV1 3POIA 5C5TA 2EIGA 2MEV1 1SMVA 2VZ3A 5A3PA 4XUTA 3EJKA 3PNAA 3IKWA 3LDRA 2IZWA 2PQQA 4S2DA 3VBHC 3IN9A 3LPFA 5FZ8A 3SEEA 4DNYA 4JC1A 4ISQA 1ODMA 2VTXJ 2ZHMA 3C7GA 4YG6A 3WX5A 4CXWA 5F37A 1YIPA 1JHNA 4N43A 3RYRA 1O4YA 2QVSB 2W1WA 4HN0A 5IAXA 4P14A 1V6JA 4E2SA 2VO5A 3ZXGA 4R4XA 4AQTA 5LA0A 4K21A 1ONAA 5JR2A 4N9HA 2UY9A 4OI0A 1X9PA 2D6LX 5TSWA 3HD8B 1LODA 3WHTA 4MUVA 4DUWA 2NP0A 3SLIA 3VBOB 3S7IA 2HWE2 1DZTA 5JSOA 5LCWL 3VDCA 5FYZA 3BU0A 1CAWB 1SBFA 3R4SA 4MG2A 2JE9A 1GNZA 3U4XA 4CDWA 1RUF3 1BHGA 2Y26A 3GHMA 4BXFA 3UGHA 5LEJA 3Q8EA 5E88A 3BTZA 4QU2A 5FZFA 4L0PA 3BVCA 2BOJA 2QE3A 1W3VA 2NZ9A 1AYM2 2W39A 4M01A 5FMDA 4FBFA 3LOBA 1P8JA 1W06A 3GCWA 4YZ4A 4N8MA 1HX6A 2W2IA 1Z7S1 2OQ7A 3PIGA 4J25A 3V65A 4E8CA 3H1YA 2XB6C 2ZABA 1K45A 4XAEA 1CAXA 5D8AA 4GXLA 4META 5F5IA 3RYKA 3LOIA 1ZRFA 2V4AA 1DZQA 1WCQA 1UMZA 4LBLA 5D1IA 1YI7A 4CP9B 1NCRA 4HLTA 2OPWA 5IFPA 3IZOA 4PDWC 5CZKA 5JOXA 1EV11 1ACCA 5HCFA 1DYPA 1RXFA 2ZBJA 1UY1A 2JDUA 5GZFA 2IXKA 2IUWA 2PHDA 2YC4A 1H4GA 2W5FA 5SV5A 2CL2A 1UYXA 2WKKA 1OQEA 3WZ1A 2NPIA 3BPZA 2JDPA 3J8F1 2WZR1 4P00B 1FX5A 4R9CA 3LA7A 4IEVA 1FOD2 1EYBA 4NIGA 2JIGA 3QBQA 5C33A 1G9CA 2ZZJA 3LPGA 4PDWB 4TSVA 5JXHA 2SLIA 3LEMA 1W2UA 2OYZA 4PBPA 4A45A 2WYSA 2PN5A 3JBG2 4GWNA 4RHV1 3QCWA 4WM8B 4MGZE 4E9KA 4A7KA 4E4HA 5FWEA 5A7NA 3FC0A 3RI9A 3S30A 2UYBA 1VRBA 1CWPA 3LCPA 3LEIA 1QXPA 2RR12 1Z78A 4HSJA 4CEYC 2XJRA 1E5IA 4NHYA 1E5HA 1OT5A 1NA1A 1UZWA 2W52A 4LUMA 1FV3A 1QH7A 1W04A 1I6XA 3VDDB 3NV2A 3WW2A 4BOWA 5DDJ2 3VD3A 2BBVA 2ZS6B 4BQ4A 1SLLA 4Q4X1 1W8OA 4OHWA 2DU0A 2DUPA 2KR2A 2RMU1 1YQ5A 3DN7A 4LHKA 2AR6A 2BW8A 3Q9OA 1OH4A 4LLOA 5FY1A 2A6WA 4MGYE 1WD4A 2WA3A 4Z2AA 3MPBA 4CUGA 1ST8A 4RFT0 3O7OA 4N43C 5CFDB 1IOAA 5L7OA 4W6WA 1ZRIA 3LZZA 4S2GA 5D21A 1LB2A 2VOWA 1QJEA 4NAOA 1X8EA 4Z82A 5L9RA 4Q4W3 3WT3A 4EYUA 3U14A 5DUWA 3AXDA 3VD5A 1YFUA 1F5JA 4LITA 2VY0A 4B1MA 4L9BA 1V00A 3KV5A 1C8NA 4BK4A 1JYXA 3BUCA 5FYHA 4Y22B 3CZUA 4JGYA 1VBD2 2IC1A 4N43B 2E63A 3ACHA 3KVBA 1X50A 4UW3A 4CDWC 3D6EA 1F8VA 4QDQA 2IVJA 5A6YA 2EIBA 5F6KA 1HB1A 2R0FA 4CDQA 4GH4C 3W20A 4PF5A 1RUJ1 2XUMA 4Z07A 4D6QA 4RR3A 1WZXA 3KV9A 4GMP0 3VL8A 1S0FA 3UKTA 4ZS3A 4TXWA 3H42B 2Y0IA 5ABJA 5D8AC 1AR83 1UYPA 2D98A 4GKYA 1OLQA 3PTRB 1ENSA 4HVRA 2CAVA 4HXCA 1VBE2 1LNSA 1NCRC 3O5SA 4I3GA 4XW3A 3HWJA 4SLIA 2Q8OA 1IQAA 1ZBA3 3WHUA 3AL6A 3O1TA 3ACLA 3L2HA 1IHMA 4GH4B 5A7WA 3B00A 4Q0PA 5K4LA 4AF9A 1FMD2 5IJRA 2QQJA 5T3NA 2WS93 4JZRA 4GIQA 2A73B 2YHJA 5DABA 3NJZA 1TEIA 4JVAA 1OBNA 3ZFEC 4BMEA 1ENXA 4XCBA 1H9PA 2P6HA 3TEWA 5DG2A 1IPSA 2BQPA 2FBEA 2PHUA 2XJUA 3ETPA 4OCTA 5LATA 1XPWA 3I3BA 1UW8A 1C28A 2J1AA 4OI2A 2GC3A 4DEQA 4FPFA 1VRH1 4KGGA 2Y8KA 3FFQA 5JIUA 2RHPA 5FBZA 1GMMA 1YQ2A 2Q1MA 1KS5A 2ZAHA 3IAPA 2C6SA 2G19A 5A6XA 3ZFEB 2KD7A 2DTYA 1V9U1 2VCCA 5FBJA 1NA1C 2R32A 1O6UA 1SLBA 4BWOA 1CZVA 1RUC2 1BQPA 2WT1A 3DCQA 1PM4A 1BK0A 2WSVA 4KU8A 4QXHA 1NCQA 1DIWA 3ILNA 3VHPA 4GWJA 3POJA 3T2QA 1AR62 4N53A 2HWE3 2VCAA 2FDJA 4LIUA 5DQ0A 5J1XA 1MEC3 5DUXA 3ZIWA 4CCCA 5IVEA 1S0IA 1LGBA 1OFSA 3IB3A 2RVAA 3ZYBA 2VCMA 4KBBA 1NA1B 2WNVB 2ZACA 4GMP1 3MDPA 5L7OC 2E51A 1GBGA 3AJYA 4KI5M 5FV3A 4CA9A 3TEZA 1BCXA 2VULA 1YLLA 5EV7A 1JZ4A 3OTFA 4HETA 4LO8A 1OOPA 3OGSA 5LA1A 4J6GA 4AK3A 1DGLA 3U10A 1GQHA 3URFA 4JGYC 1CZTA 3I2KA 3AZZA 3TAYA 3OPZA 3I3EA 2VZPA 3OEBA 4LO5B 1TME2 3CLPA 1YFYA 2WYFA 3B9IA 2P3IA 5FJHA 4B4PA 1TG7A 1VAMA 4CDQC 5KHJA 5FRAA 2OIIA 2GNMA 2VBBA 1RUI1 3AK0A 3AKPA 2FDHA 1LJ7A 2VM9A 4RR3C 1UOBA 4IGQA 1W2OA 2VW0A 1R64A 1FOD3 4JGYB 1ZZ7A 4PIZA 4AEKA 3I49A 4AL9A 5FLIA 4ASKA 5FY0A 3ZFFA 4RFRB 3RZLA 3D0SA 4QHOA 4DRVA 5C8CA 4K40A 1W6PB 2JDZA 1YO8A 2RS31 3CNAA 3I2GA 4KNCA 1D4M1 4MGQA 5AVPA 5A7PA 1UU6A 3WDVA 4IEOA 4NRMA 1JMUB 4LPLA 4BHPA 5A1LA 3ES4A 1GOHA 1AYN3 3D82A 3SHRA 3ZN5A 3HQXA 2RR13 1IPJA 1T2XA 1VE0A 2G9GA 4Y1VA 3M70A 1YCIA 1EUUA 1S0CA 3HNMA 2ZGKA 1OI6A 2FZ1A 2A3XA 2P3YA 1W6QB 3WNXA 4RGGA 4G4FA 1B35A 1QF3A 2CV6A 2RDRA 1LHNA 4Q8KA 1X36A 1XSQA 4P5YA 3GJAA 5EHDA 4XILA 1MS0A 1F31A 2G9FA 2P6CA 4Y20A 5DAXA 3WV6A 4HONA 2AH2A 4COYA 3WW4A 4NIAA 3A23A 3RVHA 2YMZA 3E5QA 2AENA 1N1TA 1W3XA 1QIQA 2E31A 2JG8B 1UY0A 2A6VA 2WLQA 2JJ6A 4YW3A 3U78A 3NV1A 4ZS2A 2A3YA 1RITA 1J58A 1HV0A 1NCQC 1ENRA 3Q8AA 5JIAA 3WQ7A 2WINB 3ZSJA 3JD71 3T3YA 3OUJA 4Y5Z0 4BM8A 1LKNA 1UNBA 3O14A 4FPOB 1AUYA 1PX4A 4N53C 2VZ1A 4LHNA 4WZFA 3JU9A 4XF0A 1TMF1 4XMAA 1RUE3 1PO11 4CP2A 2WT0A 1CR7A 5T5PA 2OVUA 1PNFA 1AL23 3OY8B 3J8F2 4LJHA 1RB8G 3AMMA 4I0BA 4IE6A 1TNRA 1H1AA 2V73A 3FLTA 4EN8B 2BJSA 2GAUA 2Y6GA 3D3AA 4I3PA 3OYWB 5FZ3A 1JXNA 4TLFA 2ADDA 2DVBA 1OOPC 1WGPA 5I93A 1ND3B 2CAUA 2E9QA 4AZZA 3WQ0A 3MEPA 4RS5B 5K0UA 3W21A 1JU4A 2VZOA 3M3OA 3MV11 4Q4V1 3KCYA 4AWDA 3CJXA 3EMRA 4CXXA 1SG3A 2X53S 3WCSA 4QX7A 4LUKA 2XHKA 4AEJA 5KWRA 4AAPA 1OURA 3D0JA 1JYIA 1O3TA 1AR81 2R1BA 1XXNA 2E32A 2RS12 2VCBA 2XVKA 4XFHA 5C9AC 3FFZA 5LW9A 1FMD3 2BNNA 2Q8DA 4JX0A 3ZSKA 1FV2A 4JGZA 4Q4X2 5FQ0A 1ZBA1 4XACA 4AAXA 5LBBA 5C4WA 1DHKB 2HLEA 1GV9A 1JOBA 4EN7B 3MZHA 1JOPA 2RMU2 1RL3A 4PI0A 5L9VA 4IL7A 5EYYA 4I02A 4AI9A 4UYBA 3B02A 4C91A 2BOIA 3ZFFC 4HK9A 4NJ4A 5C8CC 2Q4SA 1CX1A 2VMFA 1DYOA 3N7KA 2D44A 4KWLA 4K8RB 5BNNC 5JVVA 1PMJX 4IW3A 3KCXA 5FR3A 4LK6A 4Q4Y1 3UNPA 4LBMA 2QFEA 4ORFA 2PHTA 5M0TA 4A42A 1B35C 3ZFFB 4Z92B 1CAVB 1HKDA 3IAQA 4PF1A 2VNVA 4QQPA 1QHDA 1AR93 1H1MA 3LFIA 1HRI1 1MS1A 5BNNB 1U0AA 3VD7A 4S2FA 3T1MA 1RUG1 4Q2FA 5LA9A 1RUJ2 1ZBE3 2HWF3 2YGMA 3H1MA 1WMFA 4AHWA 4L99A 5EJ3A 5FXZA 4D94A 5I0UA 5IVBA 3O1MA 2QUOA 2F6BA 1B35B 4DXRA 3FX3A 1HB4A 2JD4A 2Q5TA 5FMCA 3VBFA 1AR71 3POSA 4LE3A 3MW4A 4YW4A 2FMDA 3OBAA 4LT5A 2BERA 2DVDA 2XKOA 2XQXA 3T2TA 4ZKTB 2ZHNA 2D93A 1V6LA 1K3IA 2XMLA 4P9GA 2WNEA 5DAVA 2CYFA 3LAGA 5H9SA 2NN8A 4L97A 3WLUA 1DYKA 5LY2A 4DEVA 3GBGA 3OPTA 3EQEA 2BDRA 2DFBA 3IT8A 1POV3 4GWMA 2QQKA 4CEWB 2MEV3 4IESA 5A33B 4I2OA 4JDMA 5K0UC 2D5HA 1ZX5A 3MUZ1 3R4DB 3AVSA 4KWJA 4A44A 5IW0A 3V64A 4LE4A 2ZGNA 4ZONA 4IEYA 1S0BA 1AXZA 3U1XA 1S0EA 3SCHA 3H8OA 3K4DA 1V9U2 2ZZQA 5FYYA 1AL0G 2EXJA 4YZ3A 2ENRA 4IXLA 2LTNA 2HYKA 3KB5A 4JGZC 5FZEA 3UT0A 1PGSA 2JICA 3DKQA 3OPWA 3UGFA 5C4WC 2XHNA 3QH7A 5J7MA 3KT4A 2YG0A 3BI3A 2K46A 4AI1A 2XG3A 3BGAA 4XBLA 4YVWA 4ATFA 4FTBA 1K42A 3JCIA 2XVGA 4FPYA 3WNMA 3ACGA 2D3PA 4DXTA 1GZCA 2ET7A 3CJIB 4LO6B 2GSYA 4QDSA 1F35A 1W6MA 3H9AA 1FI2A 3Q8CA 3U07A 3VKNA 2GMPA 3I2OA 4NO4A 1QDCA 2I74A 4EE2A 2RDNA 4R9AA 3ACIA 3OF1A 5EXOA 2O8OA 1PK6A 1NY71 1Z7S3 1RUF2 1UAIA 1HN1A 3FBMA 1QKQA 1WCSA 1Y7BA 2BNOA 3ZMOA 4FOVA 4R9BA 1KXGA 1JN2P 4IE4A 4OYUA 4LK7A 1OF3A 4RSUA 3RS6A 4CRQA 4KL1A 2VL4A 3PVBB 3AMNA 1YJKA 2WLPA 1GP6A 1V6KA 3DYOA 4MXWA 1PVC1 1I9RA 5CAZA 3DPRB 1EV13 3R4UA 1UQXA 1WMXA 3M3IA 4JCKA 1YIFA 5D2AA 4FAGA 3APBA 1XC6A 4UFKA 5JOYA 5LZ6A 3KS7A 4ZZ8A 2YY1A 4OHVA 4A7YA 2WZR3 3GDBA 5A1AA 1W9FA 5FXWA 4EJRA 5HCAA 4XMIA 1UWWA 1HJFA 1UOGA 1B09A 4LA3A 5FY7A 4HPKA 3RNSA 5T55A 4QPIA 2R061 2X5IA 3EYPA 5FLJA 1HW5A 1PIV1 1ZZ6A 3VBFC 5JOZA 4RHV3 1C3HA 1VR3A 4NAMA 1BBT1 3WD5A 1D4M2 2D6KA 3I7DA 3IDAA 4IEQA 3WNLA 4F7ZA 1TNFA 4H55A 1MQTA 4ZU7A 1CPNA 2WDBA 2DDUA 2ZEZA 3BB6A 1OVPA 1BMV2 2UWAA 3AMQA 3TN91 4FAHA 1NLRA 4JQRA 4OQ9A 5ISLA 3ABZA 2WAAA 1BVP1 2VQUA 3LIHA 4INDA 3ZN6B 1ZYBA 3M8LA 2VUAA 3N36A 4XABA 1RIRA 4Q4X3 3AKQA 4LBQA 1Q8QA 3MLJA 2RMU3 3KT7A 3ECQA 3MW3A 4H2AA 3C2UA 4ZU4A 1KD7A 4XC9A 1PGW2 2PHWA 1QMJA 5CFCA 1L7RA 3V0AA 4BYYA 1ZREA 2WO2A 3MLKA 1PO21 4LLFA 2C24A 5FREA 3AP4A 1HJGA 1J1TA 2BTVC 3JQWA 4HANA 1W8FA 4XFAA 2EICA 5DPNA 1MS4A 2CGOA 4BPZA 1CESA 2JDHA 5F2SA 4O9GA 4PQQA 3FUOA 3AM2A 1MS3A 4OVEA 1O3QA 3GJBA 4YGCA 1G9DA 4KG8A 4Q4W2 4YVWC 4X8PA 2BFUL 5BPXA 4GZ9A 4W65A 2D97A 2DV9A 5FIXA 2XBO1 2LALA 2Y64A 2WR9A 3J7NA 4H3WA 3ZFGA 4D3WA 2WUHA 2JWPA 5CEHA 5J48A 1G8WA 3WQBA 3ZN4A 4CTEA 1QGLA 2D3SA 2EAAA 5KHIA 3JQXA 2C4XA 1RUJ3 2ES3A 1PK6C 5F39A 4C1XA 3U75A 4YWAA 5JZGA 3NSTA 1KGYA 1OH3A 1ULEA 2B42B 3CEWA 4HN1A 1MZ5A 4LOTA 4QM8A 5FMBA 1H4HA 2YGLA 2ZX1A 4OFGA 5IVFA 1XJAA 1Y3TA 1AX0A 2HWF1 2H0BA 3NQHA 2ET1A 2FD8A 2FCVA 4QDRA 3AP6A 1OQ1A 2A7AA 5FO7B 1AR82 1RUOA 3JB4C 3MFAA 5JAXA 1H9WA 4QB1A 4BH9A 3AL5A 4WVVA 3S5AA 1NLQA 1URXA 1W9SA 5FZ9A 4F83A 1ULOA 1ZBA2 4QQOA 3IPVA 1D7PM 2CTVA 2QQMA 1W2NA 3B3QE 1LHVA 2B5HA 4XDQA 4Q1PA 3VZJA 2I07B 3N3HA 4QKFA 5KBFA 4MO3M 2WIIB 3ZR6A 2WS92 3WDTA 4OZOA 4QPIC 1COV1 4YFWA 2X5IC 3KMHA 3I59A 4NIHA 3LEGA 4XJZA 3MPPG 1O8SA 2A6YA 1DQ1A 2JD9A 3POYA 1CGPA 3UKNA 4P9JA 1VRH3 1AF9A 2EF6A 4NRQA 2ETEA 1MQTC 4QU1A 4UFIA 4CUBA 4URTA 4BCUA 4AHYA 4M3CE 4CSWA 3HAGA 1N47A 4N90A 2MNGA 4CUAA 2DURA 3NNLA 4D7YA 1V9U3 4BQ5A 5DAQA 3CDZB 3LIGA 4BISA 5C9AA 1XU1A 4Q4Y2 2WFPA 2GH8A 5A3MA 3LKJA 5FY8A 4KMQA 3T2OA 5FXXA 2AACA 5IT6A 2VMCA 3LFMA 1PMHX 4C0BA 5J36A 2GMMA 2FDFA 1HRI2 2DUOA 4LA2A 3ZYHA 1LR5A 1O3RA 2UURA 1CIWA 1PM7A 4YZ5A 2Y6LA 3CBNA 3MF9A 5CYYA 1UY3A 5ERLA 1NT0A 1VPHA 5J96B 4GMP3 5JI9A 1L7LA 3VBHB 2Y33A 1POQA 3O12A 1MEC2 2P2KA 4MADA 4COZA 4FPHA 4DY5A 5F7UA 3POGA 4AGVA 2AREA 5FPVA 2JG9A 4M0NA 3NV4A 2XWJB 4JKKA 1L3JA 1A3KA 4QWNA 1UY2A 5BNPA 2BEOA 1WLCA 2Y6KA 5K9YA 3NRUA 4A6SA 1TQ5A 4HVOA 3AZVA 3ZFGC 1BK1A 1STMA 5JI7A 4IDZA 1R081 3CQOA 4LBOA 5LEKA 1MACA 4AEDA 2BRTA 3MO4A 1LAJA 4DMIA 1ZNPA 5A32B 3CO2A 3M1HA 1ASJ1 2NYYA 3KGZA 4BQ2A 5A3TA 1UMHA 4OHYA 1WCDJ 1RUI3 2VUCA 2ZGPA 3MFCA 4RN5A 4XIKA 5DZGA 5AVAA 2EXHA 4CUCA 2QKDA 2Z5WA 4GWIA 3VKFC 5JZGC 2GNTA 2B8MA 3BN6A 3OG2A 1Q5OA 2D7FA 1OSGA 2D40A 3AZXA 3DYPA 1UZVA 5FFOC 5IATA 4P9WA 5FPAA 1CZSA 4K8FA 2R49A 3RDIA 4XFIA 5FO8B 5A3LA 4P9LA 4XYXA 2R041 3M4FA 4Q1RA 3SH3A 4CDUA 5CKNA 1A78A 4A6OA 3BOPA 3PLQA 1FPN3 1UF2C 2RS33 2WO1A 1D4M3 1U5XA 5DMYA 2AGSA 4AE2A 3HBZA 4MLOA 5A3UA 1H2NA 1YQ8A 1GFF2 3V0BA 1W8WA 2OT7A 4K1ZA 5CG9A 1WCUA 1ULCA 1ALYA 4FFHA 4Y4RA 1BVVA 1D0HA 5HCHA 1YNAA 1LULA 1S2EA 3BU7A 3KZ4C 1OF4A 3PURA 4FP2A 3VN4A 1AYN2 3BIWE 5FP8A 5FPBA 4MXVA 2YXSA 4P9XA 1WLDA 3OSDA 4WZCA 2R071 1L7QA 1RVF1 5IVJA 5FZ6A 1ZRDA 1X8MA 3PUIA 4B1LA 4BZ4A 5FUIA 3NKGA 5BY5A 2XJPA 4IEWA 2QQIA 2QTWB 4MGSA 2CNAA 2W87A 3MBWA 2HH9A 2UWBA 2HKXA 2VGDA 4AI3A 1H2KA 3S0MA 1MPXA 3WSOA 4WVMA 3P6BA 2OPKA 4HKOA 4DS0A 3R0RA 5FPLA 4GB31 3TNQA 5CA6A 3KQ4B 1RUD1 3E97A 2DVGA 3IMMA 3NNMA 3MV01 4M3CB 1NQJA 4Q27A 4AHXA 4WVZA 2WN2A 5IK7A 3KCCA 2PAMA 4CEYB 2WRAA 4RGKA 4AGGA 5IK8A 5J37A 3GBFA 3I59B 4FFGA 2K0GA 3JD73 1RYYA 2WZ8A 5LK7B 4DY3A 3S6PA 2VZVA 4PIXA 1ND2A 4UW4A 2JIJA 1TMF3 5A6ZA 3C8XA 5FOBB 4ISRA 1PO13 4XEZA 1DGWA 5FZBA 3VHRA 2UWCA 4FXGB 2RJLA 4Z2WA 2VPVA 5C9AB 2V4VA 4I0WB 3U11A 3L9JT 1CN1A 4ZZ5A 1RUE2 2XJQA 2GDFA 3INAA 3I4IA 2Y60A 2YU2A 3NJVA 2VBPA 3POBA 4Q0QA 5FUNA 3GBWA 3GF6A 5SV8A 4N7UA 3RWNA 1AL22 1LOBA 2J1VA 1REFA 2R062 2W94A 4M0HA 1PGL1 1PHMA 4W6XA 4OLLA 5FZ0A 3F95A 5BNPC 5EFUA 1ENQA 1YJLA 4Q4V3 1G6NA 4RD7A 5FMOL 3POFA 3DECA 4G3YC 4BXSV 4PBOA 3AP9A 5CKMA 1NX9A 3ZXLA 5KXDA 3I3MA 3KF5A 2JE8A 4AEDC 5FTTC 3TN92 2LRPA 2VMIA 4URAA 5H9RA 1H8TA 4CDWB 4UBHA 1UXXX 3OB8A 4YW6A 4EN0A 2R7EB 2ZX3A 1Y9MA 3GZUC 5FAXA 5BXXA 2B9VA 1XE0A 3ZXAC 2AYHA 1US2A 1LRHA 3IMNA 2A71A 4DOUA 2HEWF 4PHZA 1CAXB 5D8AB 4HL0A 1GSLA 2GP3A 2EXIA 5GZGA 5FZDA 4DFSA 5CBLA 1JH5A 2XLAA 3RRDA 2VU9A 1LECA 1CJDA 3POEA 5KHKA 4DUVA 1NCRB 1VALA 3M2MA 2Q30A 4LORA 3EBRA 1QNYA 4OULA 5EJ1B 1YQ6A 3ZPOA 1QOTA 3USUA 4ZXEA 3RSJA 2IVIB 4RA0A 4Q4Y3 1SHWB 1YRZA 3RYPA 3PTYA 5C5UA 4AQ6A 1GR3A 2CWMA 3OD4A 1WA4A 3G7DA 4JTNA 4XTPA 2BWAA 4XFFA 4ITCA 2YROA 4OUSA 5CNAA 1HRI3 4EQVA 1EAH1 2DYCA 2CSGA 2WWSA 1JYCA 3VHOA 5KXCA 2EIDA 2EA7A 2X10A 3D5OA 1ZZ9A 5IVYA 2VH9A 4NVPA 1FNYA 1RUG3 3BCWA 3H8UA 1NZCA 3ZDVA 5GLUA 1AR92 4JDOA 4Y5SA 5FK7A 2WZPP 3GNEA 4A3XA 5FCCA 1H2MA 1XNDA 1LHUA 3CU7A 2ARCA 1O4TA 3VBSA 2C9KA 3OCPA 1S4CA 1V0AA 1UYZA 3WCRA 4DXSA 2A5ZA 1RUH1 1YQCA 2LUWA 1JZ7A 1TVGA 2C1FA 4NPMA 5FUPA 1ZBE2 2HWF2 3SNMA 4C8DA 4AHZA 4QHBA 1MS8A 4DRRA 1ND2C 1AR73 3OJBA 1W99A 4DXZA 2PFWA 1OHFA 2HJIA 2W3JA 4G9SB 1H8VA 1Q8SA 1O4ZA 4D69A 2WNUA 5F2WA 4BK5A 2ZEYA 1W05A 2R1DA 3M3EA 4IV3A 4JAAA 4A41A 4B4RA 1E57A 4B4QA 2G1MA 1I1EA 2Y6HA 4OI4A 1YHFA 2A6ZA 3I2HA 1S0DA 2DCTA 3KD4A 1SLCA 2D3RA 2JENA 2HBUA 1YC61 3PUQA 2WO7A 3TEXA 4NHLA 3E1F1 5L7OB 2I2SA 3HQUA 4AVTA 1ND2B 2AEZA 3LQCA 4Y1XA 4CPBD 3AFGA 2ZMLA 1MVQA 3AJZA 1Q8OA 5FZ7A 4QX1A 2VMEA 1XYPA 2BUKA 2BVVA 4Q8LA 2MEV2 2BWCA 3FMGA 2JKXA 1GUIA 2B4KA 5ABJC 4UT5A 5L36A 1SDWA 1VBC1 2H6CA 4UOJA 1ZM1A 4M3CF 4AVCA 5IHRA 1GICA 4E8DA 1KEXA 3BALA 1FPN1 1JZ5A 2MPFA 4CDQB 1MZEA 4X6QB 2RM21 4QPWA 2YC0A 1ZZ8A 2F4LA 4K6BA 1U5ZA 4N7IA 1G86A 1AHSA 3N9OA 5KC5A 5A7QA 4RR3B 2PTMA 4L2NA 2OX0A 2PELA 5LK5A 1YEWA 5ABJB 5JDBA 3ZKYA 3C7OA 2QZ3A 3FHIB 2UYAA 3N9NA 3A4UA 5T50A 2BV4A 1NE4A 4QGMA 5FXVA 1SCSA 2XJTA 4YFZA 3N7JA 5DG1A 2J1RA 1CD3G 1CONA 3MUY1 2R0HA 5A7WB 1G9AA 4MSVA 4CU9A 4LEJA 4GULA 1MZFA 4XETA 3VZNA 4PT6A 3DEMA 2ARAA 5FP7A 5FY4A 1NE6A 1UKRA 1QJY1 4EROA 2BNMA 1PVC3 1Z7S2 3JUUA 4LR4A 4CZSA 4PI2A 2OQ6A 1OPMA 4IEXA 4FOQA 3BTYA 3NAPA 3WG3A 1UCXA 1KQRA 5FZ1A 2VVFA 3O1RA 1EY2A 4XZPA 1EV12 1TZOA 3VBSC 2GNDA 3H3ZA 1IKPA 3TOJA 1GWKA 1U5YA 1SQ4A 3IBMA 2P17A 3VV1A 4IGPA 1KJLA 4FXKB 4ZU5A 1Q3EA 3NWKA 4XE9A 1WA6X 2R063 1X33A 2WZR2 1PIV3 3ILRA 2KA3A 4Y33A 3SKJE 1NXMA 2VXRA 4ES9A 1U12A 3HNYM 1BBT3 1NCQB 3EXUA 1VMHA 1J3QA 1R091 2F4PA 3W9AA 4BQWA 3E5XA 5EQUA 3C7HA 3NMBA 3AFKA 1W8HA 2BFUS 1C57A 2EXKA 4IV3C 4UI9L 3P3NA 3IDEA 3JB8A 4N53B 3F2ZA 2VNGA 2LW8A 4RYDA 4RHV2 1LGNA 1PZ7A 2ZXQA 3TN93 3IWZA 1LENA 1O8PA 3OUHA 4YYOA 2Y6FA 4ASLA 4DPNA 3P5BA 2Y0OA 3FE5A 1SFPA 3K46A 4BIFA 4CCKA 4E4ZA 1IGOA 1NAEA 4QX3A 3J4UH 1CAUA 1DCSA 1UIJA 3FHAA 2BYVE 4XJ8A 2YU1A 2K9ZA 3USSA 1H30A 4R8HA 3ZSEA 1XNAA 1VIWB 4ONUA 4NHMA 1DQ6A 3UK9A 1OOPB 4GQ7A 1X7NA 4IV3B 3VLBB 1RJ7A 1PO23 3OBZA 1DDLA 1RHI1 1PZ8A 1SLAA 4GB32 4B3NA 2VE1A 1RUD2 2WN3A 2BGCA 2IWGB 2WQ4A 3WDUA 2DVAA 3KQRA 1OXCA 3VKLA 1VMJA 2LROA 2KM2A 5KC6A 2DFCA 1W03A 1W6OA 3SISA 2R6QA 5EPAA 4K9SA 4BE3A 2IXJA 2GMEA 1W6NA 3ZLIA 1PZ9A 4JDNA 3AMPA 3H3LA 2E7AA 1JYNA 5GLTA 1ULPA 4IE0A 4U36A 2NMNA 4CCNA 2DCJA 4K7JA 5IWFA 3RI8A 2XBO3 3ZPYA 5CISA 3I3DA 3O1VA 3NNJA 2GN7A 4YGDA 5EJZB 1QWRA 1F4HA 3GYDA 2XDVA 4YGBA 4D0QA 3AYDA 5F5QA 1OA2A 1OA4A 5C8CB 1NLSA 1OA3A 2N7GA 2PHRA 1S0JA 4YG0A 2XPJA 3A0NA 2ZGQA 4BQYA 1J83A 1V6MA 1ZRCA 2IXHA 1OD3A 2VW2A 5FPZA 2VQAA 2RDSA 3BODA 4CYDA 1PGL2 1NYWA 4QPGA 4B8EA 4HMZA 1PX3A 3VZMA 5C3QA 5GJ6A 3QD6A 4AFDA 1D4VB 2CY6A 1HRV3 1EPZA 2JDAA 4BMBA 1JODA 4FFFA 4ARXA 5APAA 4FOYA 4AQ2A 5FYCA 1UOFA 1LESA 4TTGA 3UKVA 5JMCA 1WKYA 3I2DA 3NAPC 1GWMA 1BYHA 2WFF1 5H9PA 5CADA 3W5MA 4Y20B 5FKBA 4CU6A 1I5ZA 3KV6A 4BLJA 2RDQA 5CVRA 3OGVA 5E6HA 4OI1A 3RJ2X 3P3PA 4NHKA 3S7EA 1QJU1 1COV3 2ZKNA 5GKAC 1CVNA 3TEYA 5JCTA 4IV1A 2CU5A 4V2WA 5I8SA 4XZUG 1AVBA 3THDA 4KWUA 4AI8A 3HNBM 3T2PA 3V56A 4UXAA 1YXWA 1HQNA 5FPUA 2NQYA 3NJYA 3K77A 3ME2A 1WW4A 2GC0A 3WF4A 1AYM1 2VTFA 4Y1YA 3C7FA 2VD7A 1VRH2 5CB7A 2Y38A 4AG4A 3K4ZA 3LWCA 1JYVA 3T08A 4HFSA 1OMIA 2VXJA 1W9TA 1A6CA 1W9WA 2PHLA 1XYNA 1IS4A 1AX2A 4MV2A 3AMHA 3PIJA 5C3SA 3WUCA 3SQOA 2VTXA 4TZDA 3PUSA 3RZKA 3UETA 5K0UB 4AW7A 2P4EA 4NE9A 2O14A 4CCLA 3LF7A 3MIHA 2D6NA 3BTXA 4I30A 5GM0A 2W95A 2VVDA 1C1FA 2ZCWA 4GALA 2RG4A 1VBB3 5ACA1 1RUH2 3JXSA 3BOWA 5GALA 1BZWA 1HDKA 5HI0A 3ZIXA 1HLCA 1IQDC 1DGRA 1R1ZA 1SFYA 1MZ6A 2PLV1 2RS51 1LCLA 4KBZA 4JGZB 2Y6JA 4NPLA 5FQ0B 4FTEA 4GD4A 4CDXA 5C4WB 1DZRA 4QX8A 3JBG1 2IXCA 3DF0A 4OUMA 5CU1A 5KXEA 1R083 4WM7A 3ENRA 2X29A 2JEMA 4BLIA 2VQ0A 5H9QA 1W6OB 5E1RA 1ASJ3 2FDIA 4YZ2A 1GOFA 4H14A 2YZ4A 5CIRA 2A70A 4IE5A 1CIYA 5FZHA 2HWB1 5DDJ1 1JYWA 1M4WA 1VAVA 4QPGC 2QJVA 4BJ0A 5GZCA 3FLRA 1KS4A 2P37A 2V5DA 3GALA 4HG6B 2R043 4I09A 5DXDA 1RUI2 3OOXA 1N1YA 3MGUA 2VAUA 3WW3A 5C6CA 4HKLA 2DUQA 1RGSA 1F5FA 2BBAA 3MLLA 2BP6A 1SLTA 3OGRA 4Y4YA 4CU7A 4MHRA 2DCZA 1VBC2 3PVEA 3U4SA 2ZPXA 4QPYA 1ZA4A 4MGKE 5JXGA 1KFUL 5G04L 4PQ9A 1GANA 4X8NA 4JKLA 4Z1VA 1LTEA 3GZEA 4I01A 5FJKA 1CJPA 4EWDA 2D6OX 1GYKA 1FPN2 2RS32 1XOYA 4XUOA 1NUKA 3SXWA 1RINA 1C1LA 3K3NA 2P5BA 3RZZA 3H8RA 1O59A 1NZIA 2O1QA 1RVF3 2R073 5EP9A 2XJSA 5FY9A 4HSLA 4IV1C 3NL1A 4HT1T 4A3ZA 4K20A 4B29A 3H0OA 2ZGRA 5HBAA 4KQ7A 1VBD1 5JPNB 4FO9A 3OEAA 5FMOS 3VBFB 4YLZA 2E7QA 2ZMKA 2FHRA 2XQRA 5KHGA 1REEA 3WDYA 3HOBA 5DAWA 4GB33 2WT2A 1RUD3 2VZUA 2VOXA 1JZ3A 1JUHA 1GP4A 4BB3A 4C1WA 3OD0A 2FQPA 2YC2A 1LOAA 2J1UA 3BTAA 4NUBA 3H3UA 1QJY2 1A8MA 5KXBA 3H8XA 3UYJA 4GAZA 3OBRA 3WG2A 5C3PA 4N9IA 3VBOA 4AVVA 1VBE1 4XXAA 2V72A 1CAWA 4IUGA 1OLMA 4P9YA 3JD72 3LA2A 2Y34A 3KV4A 4EZHA 4XIOA 2W92A 4BIOA 2OZ6A 3VUOA 3MW2A 1JUIA 5LBCA 1TMF2 3CHXA 3HMYA 2Q8EA 4CCEA 1CX4A 1RC6A 3ZVXA 1PO12 4AR2A 4LKDA 4QT6A 4QX2A 1UZZA 2H6BA 3O0VA 1S0GA 4O7XA 5FZIA 1LEDA 2QQVA 1Z0HA 4XF3A 3ZYJB 4J1XA 4YARA 4W6YA 2W9XA 5JXIA 3ZXKA 4XF1A 2VNRA 3PHMA 4CDXC 3VDBA 2ERFA 1W2TA 4OQ8A 4IQPA 2EVXA 4CP9A 1ZA7A 4R52A 4AYUA 4WM7C 4YVWB 1LHWA 4LXLA 2V5YA 3ELNA 4HK8A 4Q4V2 3ZXFA 1RJ8A 3ZR5A 3BPSA 4EV0A 1IS6A 1HRV1 2IXIA 2WO3A 5A6QA 2QZ2A 5FZGA 3PMEA 3WF3A 1W6MB 5FZOA 4DZGA 3EB7A 3J26N 3PDQA 3DYMA 5DUVA 2ZAAA 4QXBA 3SCFA 1RUC1 3HEIA 1QH6A 4P9IA 5F6LB 4TN7A 4GJZA 4AEMA 1XNBA 2FDGA 2Q1ZB 1PK6B 3RMXA 3WF0A 3BYWA 5LWBA 2ZHLA 4PLNA 1RXGA 1YYNA 2PAKA 3C7EA 4QB6A 1AR61 5FK8A 2GH2A 2HYXA 4AVBA 3P1IA 1DGRN 4XFGA 3T1LA 3DUIA 3I2FA 3PMSA 4XVHA 2C26A 1RMU1 1X9TA 3CKHA 4J1WA 4WM8A 4MXWB 3K3OA 4ZPIA 3O1PA 1LOGA 4Q5OA 4WVWA 1N1VA 1UOJA 4XAAA 1QXRA 5FZLA 1AXYA 2ARXA 3WXPA 4EZ4A 2JDYA 3M7AA 4CCJA 5LY1A 4UFJA 3S57A 5FYSA 1XRUA 2J1EA 3AKRA 4FPJA 1WW7A 3SKVA 3VDDA 4D6SA 5I0DA 2YBSA 3B7MA 3RG0A 1SDDB 3K4AA 1GNYA 2UY8A 3HT2A 4XUQA 5B4NA 4Y1UA 2XL7A 1WLTA 1EAH3 1J3PA 5LBEA 1AXKA 4HPKB 2ZEXA 3B01A 3HN3A 1UIKA 4FPLA 4QPIB 4YW7A 3UGGA 4D6RA 2X5IB 4GKXA 1N3OA 4LBKA 5IYYA 5IK5A 5F3GA 1QQP1 1TME1 5CFDA 3W5NA 5A1FA 4BDVB 1MQTB 1S55A 2TEPA 4FPKA 3LSDA 1F9KA 2W91A 2WWJA 4TLGA 3H50A 1RUH3 1G9FA 1BEV3 1RUG2 1PVXA 3KSCA 2FCTA 4Y5TA 4AFCA 1F4AA 2XWBB 4PJYA 1MS5A 1CPMA 4OHZA 1H6XA 3I97A 3O0XA 4JRAA 3U37A 3VBOC 4X6RB 4IGOA 3POWA 1VBB1 4JTOA 3PVOA 4Y22A 4LBQB 3WVJA 1I5PA 1UMIA 4XQDA 2WFF2 1O5UA 3QH6A 2TUNA 1N1SA 2ZGUA 4LO7A 2UU8A 4FQ4A 3G6JB 1AR72 2I45A 3HIFA 4AXOA 5BV6A 2YUEA 3V0AB 3CIHA 4JRLA 2Z79A 5C3RA 1V6OA 3VBRA 3NNGA 4DO0A 2PXJA 1QJU2 1OUXA 4AGRA 1H1IA 2ZGMA 1GP5A 4Y1ZA 5F1RA 1DGWX 4E2GA 3AKTA 3M3QA 2OW4A 3J7LA 2D5FA 4XJWA 5FY5A 2BGOA 3N7MA 1F2NA 4ZXKA 5IUQA 3LD8A 3VL9A 4UWDA 2QBXA 2B45X 1XNTA 3WG4A 1JI6A 1VBC3 3WP5A 4O9EA 5GLZA 5JLVA 3ZDSA 4GH4A 2ORZA 3ZFGB 2VZQA 2P3JA 1O91A 4QB2A 3WF2A 4P02B 2JXAA 4CP0A 5A3NA 3PJYA 3GZAA 3H7JA 2WQ8A 2YV8A 2ZGOA 2RM23 4GA9A 2X8KA 4XPVA 3IDCB 5HCBA 5A80A 4UBGA 1IKQA 4B7KA 5JMOA 1OFNA 1TE1B 1R1A1 2YPJA 1KFXL 3D4KA 4YPJA 1W90A 5JZGB 2HWD1 5EYXA 3ZXDA 4ATEA 2C0ZA 1W0OA 2CDPA 3GXUA 4FQZA 5FP4A 3ST7A 4NR1A 4WM8C 2BVBA 3WUDA 2OA2A 3UV9A 4MOAA 5FZOB 5B4XA 1XNKA 2VECA 5ACA2 4F3JA 2VOVA 1YUDA 1VB2A 4LHLA 1VBA1 3ZFEA 3A7QA 4XBNA 1JS9A 4XF4A 3HPNA 2AC1A 2DU1A 3H7YA 4JQTA 3VDDC 2PLV2 3DGTA 2RS52 5B2GB 3WNPA 1QJY3 3D8CA 4ARYA 2XR4A 3J7HA 4QQHA 1NY72 5FZCA 3IPVB 2XJVA 4DUXA 2B9UA 1OLRA 3MIFA 5E89A 1YWKA 3E5UA 2DF7A 2JECA 3SC7X 3VZLA 2XONA 2W46A 3DKWA 2X09A 3RZHA 1PVC2 5CFDC 5I0RA 5BNOA 1SCRA 1C8M1 2RS11 2WNVA 2ORXA 3AKSA 2JE7A 3DL3A 3LSEA 3WP3A 1JZ6A 3THTA 3SCGA 2HWB2 4A4AA 1ZVFA 3CL1A 1QJX1 3HJRA 2ZGLA 3AP7A 4BQ3A 2VMGA 1GZWA 3WR0A 1IS3A 1XU2A 5IK4A 3OUIA 5FP3A 1HN0A 1QNWA 2E53A 1US3A 2TBVA 2VZTA 1HXS3 4MZUA 4O61A 2R30A 3Q8FA 2RV9A 3CF6E 3LGRA 4LBNA 3ZYGA 2RJKA 1UZ0A 1G7YA 1KDKA 1R093 2XVLA 1QY4A 2HWC1 2ZX0A 3B93A 1J84A 4K3UA 3AXEA 2HBTA 5F5AA 2X05A 4AFAA 4CCMA 3ZYRA 4CP1A 2JG9C 5JSPA 1JZ2A 2PQSA 3PVNA 1PIV2 1QOSA 1T6BX 4MH0E 1ODNA 5GLWA 1BBT2 2P34A 2XXZA 4AFBA 1AJOA 1JOJA 1OQDA 1Q56A 4LKEA 4DQAA 2JB4A 1WD3A 3VBRC 1QU0A 2RJ2A 5JPMB 3ZYIB 1HQWA 3ZXJA 5J3UA 5L9BA 5FZMA 1BXHA 2MHFA 3H1WA 4UAPA 5IAVA 4MGIE 1W8TA 2QQLA 4LKFA 4NMIA 2YDEA 5F5CA 4EN9B 2JG9B 5FOJB 2XL9A 4AQSA 1DQ2A 5I8TA 1FYUA 3ILFA 2GNBA 5BNPB 2J22A 2W0XA 1RHI3 1ULGA 3AYCA 3THPA 1W6PA 4NWWA 2ZX2A 4FT8A 4EWEA 1SPPA 3WNKA 2R16A 2WSUA 3VBRB 1UN1A 4D7SA 2ARBA 4CDUC 1A8DA 2ADEA 2P3KA 3QACA 1XBFA 4KGQA 4OZXA 1PO22 4PIYA 3AZYA 3T4HB 4AEDB 5FYBA 3TWIA 3LEKA 4WV8A 4C90A 3JZVA 4YSFA 5BUVA 2EALA 1APNA 1S1AA 3T0BA 1W6QA 2QQNA 5DZFA 5F3IA 3R6SA 4ASMB 1XE8A 3ALQA 3VDAA 1M06G 1NG0A 4Z8BA 1D0GA 1QEXA 2VVEA 3MIGA 5AC91 3U0ZA 1UPSA 5A3OA 4CDUB 1N3PA 3IDBB 1Q8PA 4QHZA 4ET7A 5HV4A 2XBO2 4LBQD 2QQPA 5L19A 1Y43B 3VGIA 2OUJA 3NV3A 2XLGA 1Q43A 2JG8A 2OZJA 1JTZX 2AZ5A 3I3QA 1T6GC 1LOCA 4XBQA 1UPIA 2WABA 3V0BB 1JBCA 2QCSB 2VR4A 1JW6A 1WMDA 2RE9A 4XDPA 2FCUA 3WDXA 4YRDA 5LB6A 1I3HA 2JX9A 5FO9B 2DCYA 2DCKA 2ID4A 4M4PA 3S5QA 2ZMNA 1Q8VA 2NMOA 3GHNA 3VBUA 3ZYFA 1EP0A 3TNPB 1BEV1 1KITA 2IFWA 2WFF3 3N9QA 3ROUA 1HRV2 1UY4A 1SZBA 2VQTA 2ZEWA 4TWTA 2D6MA 3N4MA 3RZGA 5BNOC 5GZDA 3OY8A 1VAKA 2WNVC 5T5OA 2DVFA 2YFZA 4IETA 4WVMB 2WQZC 3MHZA 4YM1A 4XXPA 3VZOA 3OYWA 1NQDA 1G9BA 1QJU3 3ITQA 2Z69A 1ND3A 3FJSA 3DXTA 2A6XA 1DF0A 1HQLA 3PJQA 3HN1A 4KH9A 5AFEA 1SBDA 4RS5A 1RMU2 3QOPA 3RMYA 4Q26A 1EPWA 5F3EA 5C71A 2XGXA 1ZZCA 1UO9A 1COV2 4TYSA 1XSRA 5BNOB 1WW5A 3W59A 5IVVA 4AVAA 1K5JA 1AYM3 4E2QA 3SEPA 5GLVA 1GZWB 2W1QA 1H6YA 4RL7A 1RUF1 2CGPA 4ES8A 1VLNA 5G05L 1DG6A 1AZDA 3O1UA 3HBKA 4LMFA 1H8TC 1HV1A 2YFUA 3KVAA 1XE7A 1VB4A 3R05A 4XF9A 3FWEA 3EHKA 3LB9A 1ULFA 4NROA 5FZAA 5JXJA 3K51A 3ZXEA 5I91A 5I8YA 2CGNA 2ZGTA 4KWKA 2QQUA 2ZTNA 3MIEA 4YW5A 1DBNA 1QQP2 1BLZA 3I8TA 3MIBA 5F9TA 4C0HA 1UXZA 2ZGSA 3VHNA 1J59A 5LRRA 4CVUA 1ZRRA 4GJYA 4JKMA 5ACA3 1OKQA 2SBAA 1DQ5A 3ZO0B 3N9PA 1H8TB 1K5MA 1OC1A 2JDNA 3TYJA 1QXJA 4YM2A 2PLV3 2RS53 3ZKUA 4DIQA 1VBB2 3N9LA 1LOEA 1LOFA 1W8NA 4U2AA 1CAVA 1LGCA 4COUA 1NKGA 2WA4A 3JBG3 3O1OA 3T09A 1D2SA 4E4DX 1SPPB 5A7OA 2Z4FA 1F15A 1ULDA 5BNNA 3ZX7A 2V09A 2ZOEB 1LHOA 2GALA 4OUEA 2FZ2A 2QNKA 5JR7B 2XOMA 2YPDA 1BMV1 2W08A 1DQ0A 3A22A 1Y4WA 4UW5A 1XQNA 2J42A 1R082 2WZEA 3ZYPA 2WWUA 2JG8C 4QXKA 2HWB3 5DDJ3 5DN2A 3ZSLA 2Q1FA 5F3CA 2D6PA 4Y3OA 1ASJ2 2YBPA 1GQPA 3NJXA 4UF0A 2GC1A 4XFCA 5E16A 3RFRA 3USUB 3VB9A 5HV0A 4RGAA 3WG1A 3O0WA 5A3WA 2ZX4A 3UESA 2CDOA 4NIDA 5FYTA 4COVA 5T5JA 2LM3A 4YG3A 3RPQA 1S2BA 3VBUC 1GOGA 1V6IA 1PGW1 3ORJA 2QDRA 3E6DA 2R042 4PLMA 3T0AA 1HXS1 2VOKA 1J1LA 2FDKA 1MS9A 4M4RA 4XCAA 2XUEA 2KXLA 1OVSA 4FOWA 5EZWA 5BYNA 2WNUC 2JKBA 1NXD1 3RZMA 1WLWA 1R1A2 2WBKA 4QKDA 3VBSB 4CEWA 1ND3C 2HWD2 3OGJA 1UU4A 4NHXA 2A3WA 2J1SA 4XOGA 4YGEA 4XJUA 1YFXA 5A33A 4LOSA 4Q4W1 4RS5C 3VBUB 4BU2A 3KGLA 1VP6A 2WJSA 3DV8A 1VBD3 4LIVA 5FLHA 5FKCA 3I2IA 1SACA 4COWA 3TBDA 3AZWA 3BKZA 2R072 1RVF2 3WW1A 1FATA 4QQLA 5BNQA 3B69A 2WNUB 1VBA2 2B7YA 1QJZA 3SITA 1FT9A 3ASIA 5JSRA 5J98B 1RTVA 1DQ4A 3I54A 5DZEA 1UKGA 1GU3A 2E7TA 3T0DA 5KR7A 4AVSA 1IG0A 5FZ4A 4NN0A 1DFQA 1VBE3 2VW1A 3FUQA 1Y9QA 3Q8BA 1WBFA 3WP6A 4QMAA 3HT1A 3CJIA 4FPCA 1C8M2 2PYTA 2QDNA 1OD5A 5GZEA 4FP3A 3WOGA 3OGGA 1QJX2 4XQWA 4LULA 2ZKLA 2WL1A 1YI9A 3PUAA 4IE7A 4UFMA 3VD4A 1UYYA 4XTMA 2L9LA 5FYMA 1K5MC 3RJRA 1DU3D 4YM0A 2WS91 2HWC2 2LS6A 2DTWA 3ZOIA 1LOFC 4B7EA 1N3QA 4RQPA 3RGBA 4XURA 3DPRA 3O1SA 2XH6A 4ZY9A 1E5RA 4KG0A 4HKWA 4R9DA 2VC9A 2ZJCA 1K5MB 3MF6A 4JV4A 3THCA 2EIEA 3KHBA 1RUC3 3RQ0A 4ZHNA 2W1UA 3IIAA 4L8QA 4NPRA 5KHHA 4Q0VA 3OBTA 5FYUA 5JUVA 3EO6A 3LE0A 3FLPA 1W28A 2VG9A 2GZWA 3PU8A 2G4IA 5T54A 1AR63 3WNNA 1GZTA 1HB3A 1AX1A 3J9SA 2HEYF 4MHUA 2GN3A 1IS5A 1X82A 4JHTA 1RMU3 3ATGA 2AEYA 4HZFA 2WC2A 4LHSA 1KRIA 2PHFA 2VMHA 4YVSA 5C8WA 5HXMA 4MX3A 1PNGA 1W2AX 2JDKA 4LNVA 5ANNA 1SBEA 4K1YA 2HWE1 1FNZA 4E27A 1MEC1 3NAPB 3WINE 3N9MA 2VOTA 2J7MA 4UF0B 2ZA9A 2O8QA 4NRPA 4AI0A 3ZN6A 4PLOA 3WF1A 1PMIA 3N35A 3W58A 4E4SA 3GM8A 2DWRA 4XQ4A 4CEWC 4Q0UA 1C5IA 4QGLA 2OKXA 5A70A 4OMDA 5AC92 1W0PA 2BGPA 4UFLA 1V70A 4BQXA 3KT1A 3HQRA 3ES1A 4FPEA 4Y26A 1DLLA 1H2LA 1HB2A 4NWVA 4LTAA 4PCRA 1QQP3 1TME3 4IERA 3RWKX 3WP4A 1EAH2 4FI9A 4XHBA 1OKOA 1OUSA 4L11A 3ON7A 4IEUA 4F8AA 3N7LA 5HPOA 3M3CA 4FSJA 3NKTA 1IZ3A 4I0AA 3B9CA 4QQ2A 2GP5A 1ZZBA 2Z42A 2B39A 3NNFA 1NOVA 1QJFA 3KLSA 1CAUB 3B5LB 2WNOA 5FPXA 3NW4A 1BEV2 3IM0A 3SH5A 5LASA 5IFTA 4P08A 5A7SA 3TB0A 4AOCA 1IG3A 1FOD1 4A2UA 2C5DA 3CJIC 2TNFA 2Q8CA 4FPGA 5C70A 1S2KA 3ETQA 1LEMA 2VUDA 1GZ9A 1WUVA 2A75A 2A1XA 3KF3A 3ZSMA 1UD1A 4CCOA 3LDKA 1AYN1 4YW1A 4EN6B 4OMCA 5AFBA 2RR11 1O5LA 3BIEA
chains in the Genus database with same CATH topology
2HBTA 5EP9A 3PL0A 4ZONA 2FCTA 3GJBA 4Y5TA 4NHYA 2RDQA 5DAWA 5IATA 4NHKA 5L9BA 5IAVA 3W21A 5DAPA 4NMIA 3EMRA 3DKQA 3KT4A 5C5UA 5A3UA 2Y34A 4XACA 5LBBA 5C5TA 4NAOA 5L9RA 4Y5SA 2RDNA 2FCVA 5LBCA 4BQWA 5L9VA 5EQUA 4MHUA 4UWDA 5IAXA 3OUHA 5HV0A 3NNMA 4IW3A 5HV4A 2RG4A 4NHMA 2G1MA 3W20A 5M0TA 4XCAA 2HBUA 3OBZA 2JIJA 4BQXA 2FCUA 3KT1A 4KBZA 4NHLA 3HQRA 5LB6A 3HQUA 3NNLA 5DAQA 3BVCA 5EPAA 4NHXA 5LA9A 5LBFA 4J25A 2RDRA 3GJAA 4ZPIA 5DAXA 4Q5OA 3NNFA 4JZRA 4XAAA 3NNJA 2V4AA 5ERLA 3ITQA 2OPWA 4XCBA 5LASA 4XABA 2Y33A 3MGUA 4MHRA 5LATA 3KT7A 4BQYA 2RDSA 4XC9A 2A1XA 3OUJA 5DAVA 5LBEA 3GZEA 3OUIA 2G19A 2JIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBT A;  5EP9 A;  3PL0 A;  4ZON A;  2FCT A;  3GJB A;  4Y5T A;  4NHY A;  2RDQ A;  5DAW A;  5IAT A;  4NHK A;  5L9B A;  5IAV A;  3W21 A;  5DAP A;  4NMI A;  3EMR A;  3DKQ A;  3KT4 A;  5C5U A;  5A3U A;  2Y34 A;  4XAC A;  5LBB A;  5C5T A;  4NAO A;  5L9R A;  4Y5S A;  2RDN A;  2FCV A;  5LBC A;  4BQW A;  5L9V A;  5EQU A;  4MHU A;  4UWD A;  5IAX A;  3OUH A;  5HV0 A;  3NNM A;  4IW3 A;  5HV4 A;  2RG4 A;  4NHM A;  2G1M A;  3W20 A;  5M0T A;  4XCA A;  2HBU A;  3OBZ A;  2JIJ A;  4BQX A;  2FCU A;  3KT1 A;  4KBZ A;  4NHL A;  3HQR A;  5LB6 A;  3HQU A;  3NNL A;  5DAQ A;  3BVC A;  5EPA A;  4NHX A;  5LA9 A;  5LBF A;  4J25 A;  2RDR A;  3GJA A;  4ZPI A;  5DAX A;  4Q5O A;  3NNF A;  4JZR A;  4XAA A;  3NNJ A;  2V4A A;  5ERL A;  3ITQ A;  2OPW A;  4XCB A;  5LAS A;  4XAB A;  2Y33 A;  3MGU A;  4MHR A;  5LAT A;  3KT7 A;  4BQY A;  2RDS A;  4XC9 A;  2A1X A;  3OUJ A;  5DAV A;  5LBE A;  3GZE A;  3OUI A;  2G19 A;  2JIG A; 
#chains in the Genus database with same CATH topology
 2VZS A;  3MYX A;  1W6N B;  3I2J A;  2YB7 A;  4HVQ A;  4WBB A;  4QM9 A;  4RQP C;  3SH4 A;  2XLF A;  4EWA A;  3DPR C;  1YFW A;  3PL0 A;  4QAW A;  4LO4 B;  1SEF A;  1V6N A;  2CWS A;  4CXY A;  3VKO A;  3WQ1 A;  1QDO A;  4NII A;  3WNO A;  2W1S A;  4FCA A;  5JWP A;  1W9Y A;  4CCD A;  3GZT B;  4FTS A;  1IPK A;  2Z2S B;  3MIC A;  1UZY A;  2IXL A;  5IVC A;  1UL9 A;  5K8S A;  3RZJ A;  2JB8 A;  1SFN A;  1R1A 3;  3VKM A;  1CQ9 A;  1WW6 A;  2E26 A;  4RQP B;  3PUH A;  2HWD 3;  3ACF A;  4QPG B;  1OPO A;  2RM2 2;  4QX5 A;  4AI2 A;  2YYO A;  1HIX A;  3FN9 A;  3PU3 A;  4HOO A;  3SMH A;  5EWS A;  1LU2 A;  1MR5 A;  3QLQ A;  2PAE A;  4DB5 A;  3FL7 A;  4LQR A;  2PMW B;  4QD2 A;  4YVS C;  3K75 B;  1WWY A;  2OXB A;  3J8F 3;  3AX4 A;  5C3O A;  1W8U A;  2NLR A;  3AB0 A;  3AYE A;  2BU9 A;  4SBV A;  1VBA 3;  2ILM A;  1RUE 1;  4W50 A;  2PHX A;  1W39 A;  4MYE A;  4FVV A;  1MVE A;  4LBJ A;  5C7G A;  3ZM8 A;  2ATF A;  1AL2 1;  2J1T A;  4IEZ A;  4Y24 A;  4FFI A;  3VZK A;  1GQG A;  4CU8 A;  1DP0 A;  3UJO A;  2NM1 A;  2IFR A;  1GWL A;  2DBN A;  4V1P A;  4XFB A;  4YVS B;  4JHZ A;  4QKN A;  1J3R A;  2OS2 A;  3K48 A;  3KWV A;  1C4R A;  2E33 A;  3NVC A;  4HBN A;  4IV1 B;  2JDM A;  5F32 A;  2GU9 A;  2QQW A;  1SLI A;  5I0T A;  1C8M 3;  2RS1 3;  5FZK A;  4QXC A;  3VBH A;  1A34 A;  1KJR A;  2BZD A;  3X29 B;  1WCK A;  1QJX 3;  3FHQ A;  4A7Z A;  4XJ9 A;  1E5S A;  1WBL A;  4S2H A;  5FP9 A;  4AFM A;  3WY6 A;  1DLC A;  4H7L A;  4IEP A;  1VJ2 A;  5LA2 A;  1W0N A;  4D7T A;  1RUN A;  2VJX A;  4LKS A;  3MI8 A;  2BPA 2;  1FMD 1;  5E8A A;  2HWC 3;  5CG8 A;  1JU3 A;  1GLH A;  5ANQ A;  2D43 A;  1C5H A;  3CZJ A;  2C9A A;  4OHX A;  3E6C C;  2VMD A;  1HXS 2;  2QQO A;  3UL2 A;  5LBF A;  1OLM E;  2AUY A;  4NOT A;  1KDM A;  4YW2 A;  1AJK A;  4R4Z A;  4MVT A;  1XNC A;  1FAY A;  1R09 2;  1VMF A;  3MID A;  5FYI A;  3KHC A;  1GKB A;  5A32 A;  1POV 0;  2W68 A;  3FBY A;  3DXU A;  3FZ3 A;  1JHJ A;  3K2O A;  4QGN A;  3III A;  1Y9G A;  2F17 A;  2VUJ A;  4MGT A;  5HXV A;  1WME A;  2VZR A;  4YZ1 A;  3AVR A;  4BA6 A;  1QOO A;  3AYA A;  2K2S A;  5F8P A;  5FWJ A;  4UW6 A;  3LA3 A;  4O65 A;  2FMY A;  1JYT A;  3CMG A;  1XYO A;  2OUH A;  2VBD A;  4Q0S A;  5J09 A;  1BKZ A;  1EUT A;  4XUP A;  1UU5 A;  4XHX A;  2P1B A;  1BJQ A;  5CKQ A;  5T52 A;  4D8M A;  4CDX B;  1RED A;  3GGL A;  2XKP A;  4H7M A;  3KM5 A;  3C3V A;  2VNO A;  1AR9 1;  2CHH A;  1U5I A;  2O0O A;  4WM7 B;  4PDW A;  4CPB A;  4M00 A;  1GNH A;  1RHI 2;  2YBK A;  2HEV F;  1W8Z A;  4QX0 A;  2Q0A A;  3HR9 A;  4CE8 A;  5LRS A;  4QKB A;  5DUU A;  3VD9 A;  3HVD A;  4XUN A;  2EAK A;  3E6B A;  5EIY B;  1ZBE 1;  3A0K A;  3GCX A;  4XDO A;  3T4V A;  2WAO A;  3J7M A;  2E6V A;  4Q29 A;  5AC9 3;  3B94 A;  4YM3 A;  2GC2 A;  4V2V A;  1O7F A;  2B46 X;  5CFC C;  4KU7 A;  3UJQ A;  2G9Z A;  5DAP A;  5L73 A;  4W4Z A;  1FXZ A;  5T5L A;  3WDW A;  5K7P A;  4P5H A;  1O3S A;  4XJA A;  2DBI A;  4YNI A;  3TRS B;  4M3C A;  5I0S A;  3AP5 A;  1XB9 A;  4L92 A;  4W8J A;  3WEZ A;  1K12 A;  1JZ8 A;  5FYV A;  1UX6 A;  3L2Y A;  4CEY A;  1H0B A;  3T30 A;  2H0V A;  1UX7 A;  4DIN B;  3AC0 A;  4UFH A;  3NO8 A;  3ZMN A;  1D2Q A;  1LU1 A;  3LDB A;  4BQ1 A;  5FDB A;  2PA7 A;  5JOW A;  5CFC B;  2W47 A;  2ZHK A;  3A21 A;  1POV 1;  3POI A;  5C5T A;  2EIG A;  2MEV 1;  1SMV A;  2VZ3 A;  5A3P A;  4XUT A;  3EJK A;  3PNA A;  3IKW A;  3LDR A;  2IZW A;  2PQQ A;  4S2D A;  3VBH C;  3IN9 A;  3LPF A;  5FZ8 A;  3SEE A;  4DNY A;  4JC1 A;  4ISQ A;  1ODM A;  2VTX J;  2ZHM A;  3C7G A;  4YG6 A;  3WX5 A;  4CXW A;  5F37 A;  1YIP A;  1JHN A;  4N43 A;  3RYR A;  1O4Y A;  2QVS B;  2W1W A;  4HN0 A;  5IAX A;  4P14 A;  1V6J A;  4E2S A;  2VO5 A;  3ZXG A;  4R4X A;  4AQT A;  5LA0 A;  4K21 A;  1ONA A;  5JR2 A;  4N9H A;  2UY9 A;  4OI0 A;  1X9P A;  2D6L X;  5TSW A;  3HD8 B;  1LOD A;  3WHT A;  4MUV A;  4DUW A;  2NP0 A;  3SLI A;  3VBO B;  3S7I A;  2HWE 2;  1DZT A;  5JSO A;  5LCW L;  3VDC A;  5FYZ A;  3BU0 A;  1CAW B;  1SBF A;  3R4S A;  4MG2 A;  2JE9 A;  1GNZ A;  3U4X A;  4CDW A;  1RUF 3;  1BHG A;  2Y26 A;  3GHM A;  4BXF A;  3UGH A;  5LEJ A;  3Q8E A;  5E88 A;  3BTZ A;  4QU2 A;  5FZF A;  4L0P A;  3BVC A;  2BOJ A;  2QE3 A;  1W3V A;  2NZ9 A;  1AYM 2;  2W39 A;  4M01 A;  5FMD A;  4FBF A;  3LOB A;  1P8J A;  1W06 A;  3GCW A;  4YZ4 A;  4N8M A;  1HX6 A;  2W2I A;  1Z7S 1;  2OQ7 A;  3PIG A;  4J25 A;  3V65 A;  4E8C A;  3H1Y A;  2XB6 C;  2ZAB A;  1K45 A;  4XAE A;  1CAX A;  5D8A A;  4GXL A;  4MET A;  5F5I A;  3RYK A;  3LOI A;  1ZRF A;  2V4A A;  1DZQ A;  1WCQ A;  1UMZ A;  4LBL A;  5D1I A;  1YI7 A;  4CP9 B;  1NCR A;  4HLT A;  2OPW A;  5IFP A;  3IZO A;  4PDW C;  5CZK A;  5JOX A;  1EV1 1;  1ACC A;  5HCF A;  1DYP A;  1RXF A;  2ZBJ A;  1UY1 A;  2JDU A;  5GZF A;  2IXK A;  2IUW A;  2PHD A;  2YC4 A;  1H4G A;  2W5F A;  5SV5 A;  2CL2 A;  1UYX A;  2WKK A;  1OQE A;  3WZ1 A;  2NPI A;  3BPZ A;  2JDP A;  3J8F 1;  2WZR 1;  4P00 B;  1FX5 A;  4R9C A;  3LA7 A;  4IEV A;  1FOD 2;  1EYB A;  4NIG A;  2JIG A;  3QBQ A;  5C33 A;  1G9C A;  2ZZJ A;  3LPG A;  4PDW B;  4TSV A;  5JXH A;  2SLI A;  3LEM A;  1W2U A;  2OYZ A;  4PBP A;  4A45 A;  2WYS A;  2PN5 A;  3JBG 2;  4GWN A;  4RHV 1;  3QCW A;  4WM8 B;  4MGZ E;  4E9K A;  4A7K A;  4E4H A;  5FWE A;  5A7N A;  3FC0 A;  3RI9 A;  3S30 A;  2UYB A;  1VRB A;  1CWP A;  3LCP A;  3LEI A;  1QXP A;  2RR1 2;  1Z78 A;  4HSJ A;  4CEY C;  2XJR A;  1E5I A;  4NHY A;  1E5H A;  1OT5 A;  1NA1 A;  1UZW A;  2W52 A;  4LUM A;  1FV3 A;  1QH7 A;  1W04 A;  1I6X A;  3VDD B;  3NV2 A;  3WW2 A;  4BOW A;  5DDJ 2;  3VD3 A;  2BBV A;  2ZS6 B;  4BQ4 A;  1SLL A;  4Q4X 1;  1W8O A;  4OHW A;  2DU0 A;  2DUP A;  2KR2 A;  2RMU 1;  1YQ5 A;  3DN7 A;  4LHK A;  2AR6 A;  2BW8 A;  3Q9O A;  1OH4 A;  4LLO A;  5FY1 A;  2A6W A;  4MGY E;  1WD4 A;  2WA3 A;  4Z2A A;  3MPB A;  4CUG A;  1ST8 A;  4RFT 0;  3O7O A;  4N43 C;  5CFD B;  1IOA A;  5L7O A;  4W6W A;  1ZRI A;  3LZZ A;  4S2G A;  5D21 A;  1LB2 A;  2VOW A;  1QJE A;  4NAO A;  1X8E A;  4Z82 A;  5L9R A;  4Q4W 3;  3WT3 A;  4EYU A;  3U14 A;  5DUW A;  3AXD A;  3VD5 A;  1YFU A;  1F5J A;  4LIT A;  2VY0 A;  4B1M A;  4L9B A;  1V00 A;  3KV5 A;  1C8N A;  4BK4 A;  1JYX A;  3BUC A;  5FYH A;  4Y22 B;  3CZU A;  4JGY A;  1VBD 2;  2IC1 A;  4N43 B;  2E63 A;  3ACH A;  3KVB A;  1X50 A;  4UW3 A;  4CDW C;  3D6E A;  1F8V A;  4QDQ A;  2IVJ A;  5A6Y A;  2EIB A;  5F6K A;  1HB1 A;  2R0F A;  4CDQ A;  4GH4 C;  3W20 A;  4PF5 A;  1RUJ 1;  2XUM A;  4Z07 A;  4D6Q A;  4RR3 A;  1WZX A;  3KV9 A;  4GMP 0;  3VL8 A;  1S0F A;  3UKT A;  4ZS3 A;  4TXW A;  3H42 B;  2Y0I A;  5ABJ A;  5D8A C;  1AR8 3;  1UYP A;  2D98 A;  4GKY A;  1OLQ A;  3PTR B;  1ENS A;  4HVR A;  2CAV A;  4HXC A;  1VBE 2;  1LNS A;  1NCR C;  3O5S A;  4I3G A;  4XW3 A;  3HWJ A;  4SLI A;  2Q8O A;  1IQA A;  1ZBA 3;  3WHU A;  3AL6 A;  3O1T A;  3ACL A;  3L2H A;  1IHM A;  4GH4 B;  5A7W A;  3B00 A;  4Q0P A;  5K4L A;  4AF9 A;  1FMD 2;  5IJR A;  2QQJ A;  5T3N A;  2WS9 3;  4JZR A;  4GIQ A;  2A73 B;  2YHJ A;  5DAB A;  3NJZ A;  1TEI A;  4JVA A;  1OBN A;  3ZFE C;  4BME A;  1ENX A;  4XCB A;  1H9P A;  2P6H A;  3TEW A;  5DG2 A;  1IPS A;  2BQP A;  2FBE A;  2PHU A;  2XJU A;  3ETP A;  4OCT A;  5LAT A;  1XPW A;  3I3B A;  1UW8 A;  1C28 A;  2J1A A;  4OI2 A;  2GC3 A;  4DEQ A;  4FPF A;  1VRH 1;  4KGG A;  2Y8K A;  3FFQ A;  5JIU A;  2RHP A;  5FBZ A;  1GMM A;  1YQ2 A;  2Q1M A;  1KS5 A;  2ZAH A;  3IAP A;  2C6S A;  2G19 A;  5A6X A;  3ZFE B;  2KD7 A;  2DTY A;  1V9U 1;  2VCC A;  5FBJ A;  1NA1 C;  2R32 A;  1O6U A;  1SLB A;  4BWO A;  1CZV A;  1RUC 2;  1BQP A;  2WT1 A;  3DCQ A;  1PM4 A;  1BK0 A;  2WSV A;  4KU8 A;  4QXH A;  1NCQ A;  1DIW A;  3ILN A;  3VHP A;  4GWJ A;  3POJ A;  3T2Q A;  1AR6 2;  4N53 A;  2HWE 3;  2VCA A;  2FDJ A;  4LIU A;  5DQ0 A;  5J1X A;  1MEC 3;  5DUX A;  3ZIW A;  4CCC A;  5IVE A;  1S0I A;  1LGB A;  1OFS A;  3IB3 A;  2RVA A;  3ZYB A;  2VCM A;  4KBB A;  1NA1 B;  2WNV B;  2ZAC A;  4GMP 1;  3MDP A;  5L7O C;  2E51 A;  1GBG A;  3AJY A;  4KI5 M;  5FV3 A;  4CA9 A;  3TEZ A;  1BCX A;  2VUL A;  1YLL A;  5EV7 A;  1JZ4 A;  3OTF A;  4HET A;  4LO8 A;  1OOP A;  3OGS A;  5LA1 A;  4J6G A;  4AK3 A;  1DGL A;  3U10 A;  1GQH A;  3URF A;  4JGY C;  1CZT A;  3I2K A;  3AZZ A;  3TAY A;  3OPZ A;  3I3E A;  2VZP A;  3OEB A;  4LO5 B;  1TME 2;  3CLP A;  1YFY A;  2WYF A;  3B9I A;  2P3I A;  5FJH A;  4B4P A;  1TG7 A;  1VAM A;  4CDQ C;  5KHJ A;  5FRA A;  2OII A;  2GNM A;  2VBB A;  1RUI 1;  3AK0 A;  3AKP A;  2FDH A;  1LJ7 A;  2VM9 A;  4RR3 C;  1UOB A;  4IGQ A;  1W2O A;  2VW0 A;  1R64 A;  1FOD 3;  4JGY B;  1ZZ7 A;  4PIZ A;  4AEK A;  3I49 A;  4AL9 A;  5FLI A;  4ASK A;  5FY0 A;  3ZFF A;  4RFR B;  3RZL A;  3D0S A;  4QHO A;  4DRV A;  5C8C A;  4K40 A;  1W6P B;  2JDZ A;  1YO8 A;  2RS3 1;  3CNA A;  3I2G A;  4KNC A;  1D4M 1;  4MGQ A;  5AVP A;  5A7P A;  1UU6 A;  3WDV A;  4IEO A;  4NRM A;  1JMU B;  4LPL A;  4BHP A;  5A1L A;  3ES4 A;  1GOH A;  1AYN 3;  3D82 A;  3SHR A;  3ZN5 A;  3HQX A;  2RR1 3;  1IPJ A;  1T2X A;  1VE0 A;  2G9G A;  4Y1V A;  3M70 A;  1YCI A;  1EUU A;  1S0C A;  3HNM A;  2ZGK A;  1OI6 A;  2FZ1 A;  2A3X A;  2P3Y A;  1W6Q B;  3WNX A;  4RGG A;  4G4F A;  1B35 A;  1QF3 A;  2CV6 A;  2RDR A;  1LHN A;  4Q8K A;  1X36 A;  1XSQ A;  4P5Y A;  3GJA A;  5EHD A;  4XIL A;  1MS0 A;  1F31 A;  2G9F A;  2P6C A;  4Y20 A;  5DAX A;  3WV6 A;  4HON A;  2AH2 A;  4COY A;  3WW4 A;  4NIA A;  3A23 A;  3RVH A;  2YMZ A;  3E5Q A;  2AEN A;  1N1T A;  1W3X A;  1QIQ A;  2E31 A;  2JG8 B;  1UY0 A;  2A6V A;  2WLQ A;  2JJ6 A;  4YW3 A;  3U78 A;  3NV1 A;  4ZS2 A;  2A3Y A;  1RIT A;  1J58 A;  1HV0 A;  1NCQ C;  1ENR A;  3Q8A A;  5JIA A;  3WQ7 A;  2WIN B;  3ZSJ A;  3JD7 1;  3T3Y A;  3OUJ A;  4Y5Z 0;  4BM8 A;  1LKN A;  1UNB A;  3O14 A;  4FPO B;  1AUY A;  1PX4 A;  4N53 C;  2VZ1 A;  4LHN A;  4WZF A;  3JU9 A;  4XF0 A;  1TMF 1;  4XMA A;  1RUE 3;  1PO1 1;  4CP2 A;  2WT0 A;  1CR7 A;  5T5P A;  2OVU A;  1PNF A;  1AL2 3;  3OY8 B;  3J8F 2;  4LJH A;  1RB8 G;  3AMM A;  4I0B A;  4IE6 A;  1TNR A;  1H1A A;  2V73 A;  3FLT A;  4EN8 B;  2BJS A;  2GAU A;  2Y6G A;  3D3A A;  4I3P A;  3OYW B;  5FZ3 A;  1JXN A;  4TLF A;  2ADD A;  2DVB A;  1OOP C;  1WGP A;  5I93 A;  1ND3 B;  2CAU A;  2E9Q A;  4AZZ A;  3WQ0 A;  3MEP A;  4RS5 B;  5K0U A;  3W21 A;  1JU4 A;  2VZO A;  3M3O A;  3MV1 1;  4Q4V 1;  3KCY A;  4AWD A;  3CJX A;  3EMR A;  4CXX A;  1SG3 A;  2X53 S;  3WCS A;  4QX7 A;  4LUK A;  2XHK A;  4AEJ A;  5KWR A;  4AAP A;  1OUR A;  3D0J A;  1JYI A;  1O3T A;  1AR8 1;  2R1B A;  1XXN A;  2E32 A;  2RS1 2;  2VCB A;  2XVK A;  4XFH A;  5C9A C;  3FFZ A;  5LW9 A;  1FMD 3;  2BNN A;  2Q8D A;  4JX0 A;  3ZSK A;  1FV2 A;  4JGZ A;  4Q4X 2;  5FQ0 A;  1ZBA 1;  4XAC A;  4AAX A;  5LBB A;  5C4W A;  1DHK B;  2HLE A;  1GV9 A;  1JOB A;  4EN7 B;  3MZH A;  1JOP A;  2RMU 2;  1RL3 A;  4PI0 A;  5L9V A;  4IL7 A;  5EYY A;  4I02 A;  4AI9 A;  4UYB A;  3B02 A;  4C91 A;  2BOI A;  3ZFF C;  4HK9 A;  4NJ4 A;  5C8C C;  2Q4S A;  1CX1 A;  2VMF A;  1DYO A;  3N7K A;  2D44 A;  4KWL A;  4K8R B;  5BNN C;  5JVV A;  1PMJ X;  4IW3 A;  3KCX A;  5FR3 A;  4LK6 A;  4Q4Y 1;  3UNP A;  4LBM A;  2QFE A;  4ORF A;  2PHT A;  5M0T A;  4A42 A;  1B35 C;  3ZFF B;  4Z92 B;  1CAV B;  1HKD A;  3IAQ A;  4PF1 A;  2VNV A;  4QQP A;  1QHD A;  1AR9 3;  1H1M A;  3LFI A;  1HRI 1;  1MS1 A;  5BNN B;  1U0A A;  3VD7 A;  4S2F A;  3T1M A;  1RUG 1;  4Q2F A;  5LA9 A;  1RUJ 2;  1ZBE 3;  2HWF 3;  2YGM A;  3H1M A;  1WMF A;  4AHW A;  4L99 A;  5EJ3 A;  5FXZ A;  4D94 A;  5I0U A;  5IVB A;  3O1M A;  2QUO A;  2F6B A;  1B35 B;  4DXR A;  3FX3 A;  1HB4 A;  2JD4 A;  2Q5T A;  5FMC A;  3VBF A;  1AR7 1;  3POS A;  4LE3 A;  3MW4 A;  4YW4 A;  2FMD A;  3OBA A;  4LT5 A;  2BER A;  2DVD A;  2XKO A;  2XQX A;  3T2T A;  4ZKT B;  2ZHN A;  2D93 A;  1V6L A;  1K3I A;  2XML A;  4P9G A;  2WNE A;  5DAV A;  2CYF A;  3LAG A;  5H9S A;  2NN8 A;  4L97 A;  3WLU A;  1DYK A;  5LY2 A;  4DEV A;  3GBG A;  3OPT A;  3EQE A;  2BDR A;  2DFB A;  3IT8 A;  1POV 3;  4GWM A;  2QQK A;  4CEW B;  2MEV 3;  4IES A;  5A33 B;  4I2O A;  4JDM A;  5K0U C;  2D5H A;  1ZX5 A;  3MUZ 1;  3R4D B;  3AVS A;  4KWJ A;  4A44 A;  5IW0 A;  3V64 A;  4LE4 A;  2ZGN A;  4ZON A;  4IEY A;  1S0B A;  1AXZ A;  3U1X A;  1S0E A;  3SCH A;  3H8O A;  3K4D A;  1V9U 2;  2ZZQ A;  5FYY A;  1AL0 G;  2EXJ A;  4YZ3 A;  2ENR A;  4IXL A;  2LTN A;  2HYK A;  3KB5 A;  4JGZ C;  5FZE A;  3UT0 A;  1PGS A;  2JIC A;  3DKQ A;  3OPW A;  3UGF A;  5C4W C;  2XHN A;  3QH7 A;  5J7M A;  3KT4 A;  2YG0 A;  3BI3 A;  2K46 A;  4AI1 A;  2XG3 A;  3BGA A;  4XBL A;  4YVW A;  4ATF A;  4FTB A;  1K42 A;  3JCI A;  2XVG A;  4FPY A;  3WNM A;  3ACG A;  2D3P A;  4DXT A;  1GZC A;  2ET7 A;  3CJI B;  4LO6 B;  2GSY A;  4QDS A;  1F35 A;  1W6M A;  3H9A A;  1FI2 A;  3Q8C A;  3U07 A;  3VKN A;  2GMP A;  3I2O A;  4NO4 A;  1QDC A;  2I74 A;  4EE2 A;  2RDN A;  4R9A A;  3ACI A;  3OF1 A;  5EXO A;  2O8O A;  1PK6 A;  1NY7 1;  1Z7S 3;  1RUF 2;  1UAI A;  1HN1 A;  3FBM A;  1QKQ A;  1WCS A;  1Y7B A;  2BNO A;  3ZMO A;  4FOV A;  4R9B A;  1KXG A;  1JN2 P;  4IE4 A;  4OYU A;  4LK7 A;  1OF3 A;  4RSU A;  3RS6 A;  4CRQ A;  4KL1 A;  2VL4 A;  3PVB B;  3AMN A;  1YJK A;  2WLP A;  1GP6 A;  1V6K A;  3DYO A;  4MXW A;  1PVC 1;  1I9R A;  5CAZ A;  3DPR B;  1EV1 3;  3R4U A;  1UQX A;  1WMX A;  3M3I A;  4JCK A;  1YIF A;  5D2A A;  4FAG A;  3APB A;  1XC6 A;  4UFK A;  5JOY A;  5LZ6 A;  3KS7 A;  4ZZ8 A;  2YY1 A;  4OHV A;  4A7Y A;  2WZR 3;  3GDB A;  5A1A A;  1W9F A;  5FXW A;  4EJR A;  5HCA A;  4XMI A;  1UWW A;  1HJF A;  1UOG A;  1B09 A;  4LA3 A;  5FY7 A;  4HPK A;  3RNS A;  5T55 A;  4QPI A;  2R06 1;  2X5I A;  3EYP A;  5FLJ A;  1HW5 A;  1PIV 1;  1ZZ6 A;  3VBF C;  5JOZ A;  4RHV 3;  1C3H A;  1VR3 A;  4NAM A;  1BBT 1;  3WD5 A;  1D4M 2;  2D6K A;  3I7D A;  3IDA A;  4IEQ A;  3WNL A;  4F7Z A;  1TNF A;  4H55 A;  1MQT A;  4ZU7 A;  1CPN A;  2WDB A;  2DDU A;  2ZEZ A;  3BB6 A;  1OVP A;  1BMV 2;  2UWA A;  3AMQ A;  3TN9 1;  4FAH A;  1NLR A;  4JQR A;  4OQ9 A;  5ISL A;  3ABZ A;  2WAA A;  1BVP 1;  2VQU A;  3LIH A;  4IND A;  3ZN6 B;  1ZYB A;  3M8L A;  2VUA A;  3N36 A;  4XAB A;  1RIR A;  4Q4X 3;  3AKQ A;  4LBQ A;  1Q8Q A;  3MLJ A;  2RMU 3;  3KT7 A;  3ECQ A;  3MW3 A;  4H2A A;  3C2U A;  4ZU4 A;  1KD7 A;  4XC9 A;  1PGW 2;  2PHW A;  1QMJ A;  5CFC A;  1L7R A;  3V0A A;  4BYY A;  1ZRE A;  2WO2 A;  3MLK A;  1PO2 1;  4LLF A;  2C24 A;  5FRE A;  3AP4 A;  1HJG A;  1J1T A;  2BTV C;  3JQW A;  4HAN A;  1W8F A;  4XFA A;  2EIC A;  5DPN A;  1MS4 A;  2CGO A;  4BPZ A;  1CES A;  2JDH A;  5F2S A;  4O9G A;  4PQQ A;  3FUO A;  3AM2 A;  1MS3 A;  4OVE A;  1O3Q A;  3GJB A;  4YGC A;  1G9D A;  4KG8 A;  4Q4W 2;  4YVW C;  4X8P A;  2BFU L;  5BPX A;  4GZ9 A;  4W65 A;  2D97 A;  2DV9 A;  5FIX A;  2XBO 1;  2LAL A;  2Y64 A;  2WR9 A;  3J7N A;  4H3W A;  3ZFG A;  4D3W A;  2WUH A;  2JWP A;  5CEH A;  5J48 A;  1G8W A;  3WQB A;  3ZN4 A;  4CTE A;  1QGL A;  2D3S A;  2EAA A;  5KHI A;  3JQX A;  2C4X A;  1RUJ 3;  2ES3 A;  1PK6 C;  5F39 A;  4C1X A;  3U75 A;  4YWA A;  5JZG A;  3NST A;  1KGY A;  1OH3 A;  1ULE A;  2B42 B;  3CEW A;  4HN1 A;  1MZ5 A;  4LOT A;  4QM8 A;  5FMB A;  1H4H A;  2YGL A;  2ZX1 A;  4OFG A;  5IVF A;  1XJA A;  1Y3T A;  1AX0 A;  2HWF 1;  2H0B A;  3NQH A;  2ET1 A;  2FD8 A;  2FCV A;  4QDR A;  3AP6 A;  1OQ1 A;  2A7A A;  5FO7 B;  1AR8 2;  1RUO A;  3JB4 C;  3MFA A;  5JAX A;  1H9W A;  4QB1 A;  4BH9 A;  3AL5 A;  4WVV A;  3S5A A;  1NLQ A;  1URX A;  1W9S A;  5FZ9 A;  4F83 A;  1ULO A;  1ZBA 2;  4QQO A;  3IPV A;  1D7P M;  2CTV A;  2QQM A;  1W2N A;  3B3Q E;  1LHV A;  2B5H A;  4XDQ A;  4Q1P A;  3VZJ A;  2I07 B;  3N3H A;  4QKF A;  5KBF A;  4MO3 M;  2WII B;  3ZR6 A;  2WS9 2;  3WDT A;  4OZO A;  4QPI C;  1COV 1;  4YFW A;  2X5I C;  3KMH A;  3I59 A;  4NIH A;  3LEG A;  4XJZ A;  3MPP G;  1O8S A;  2A6Y A;  1DQ1 A;  2JD9 A;  3POY A;  1CGP A;  3UKN A;  4P9J A;  1VRH 3;  1AF9 A;  2EF6 A;  4NRQ A;  2ETE A;  1MQT C;  4QU1 A;  4UFI A;  4CUB A;  4URT A;  4BCU A;  4AHY A;  4M3C E;  4CSW A;  3HAG A;  1N47 A;  4N90 A;  2MNG A;  4CUA A;  2DUR A;  3NNL A;  4D7Y A;  1V9U 3;  4BQ5 A;  5DAQ A;  3CDZ B;  3LIG A;  4BIS A;  5C9A A;  1XU1 A;  4Q4Y 2;  2WFP A;  2GH8 A;  5A3M A;  3LKJ A;  5FY8 A;  4KMQ A;  3T2O A;  5FXX A;  2AAC A;  5IT6 A;  2VMC A;  3LFM A;  1PMH X;  4C0B A;  5J36 A;  2GMM A;  2FDF A;  1HRI 2;  2DUO A;  4LA2 A;  3ZYH A;  1LR5 A;  1O3R A;  2UUR A;  1CIW A;  1PM7 A;  4YZ5 A;  2Y6L A;  3CBN A;  3MF9 A;  5CYY A;  1UY3 A;  5ERL A;  1NT0 A;  1VPH A;  5J96 B;  4GMP 3;  5JI9 A;  1L7L A;  3VBH B;  2Y33 A;  1POQ A;  3O12 A;  1MEC 2;  2P2K A;  4MAD A;  4COZ A;  4FPH A;  4DY5 A;  5F7U A;  3POG A;  4AGV A;  2ARE A;  5FPV A;  2JG9 A;  4M0N A;  3NV4 A;  2XWJ B;  4JKK A;  1L3J A;  1A3K A;  4QWN A;  1UY2 A;  5BNP A;  2BEO A;  1WLC A;  2Y6K A;  5K9Y A;  3NRU A;  4A6S A;  1TQ5 A;  4HVO A;  3AZV A;  3ZFG C;  1BK1 A;  1STM A;  5JI7 A;  4IDZ A;  1R08 1;  3CQO A;  4LBO A;  5LEK A;  1MAC A;  4AED A;  2BRT A;  3MO4 A;  1LAJ A;  4DMI A;  1ZNP A;  5A32 B;  3CO2 A;  3M1H A;  1ASJ 1;  2NYY A;  3KGZ A;  4BQ2 A;  5A3T A;  1UMH A;  4OHY A;  1WCD J;  1RUI 3;  2VUC A;  2ZGP A;  3MFC A;  4RN5 A;  4XIK A;  5DZG A;  5AVA A;  2EXH A;  4CUC A;  2QKD A;  2Z5W A;  4GWI A;  3VKF C;  5JZG C;  2GNT A;  2B8M A;  3BN6 A;  3OG2 A;  1Q5O A;  2D7F A;  1OSG A;  2D40 A;  3AZX A;  3DYP A;  1UZV A;  5FFO C;  5IAT A;  4P9W A;  5FPA A;  1CZS A;  4K8F A;  2R49 A;  3RDI A;  4XFI A;  5FO8 B;  5A3L A;  4P9L A;  4XYX A;  2R04 1;  3M4F A;  4Q1R A;  3SH3 A;  4CDU A;  5CKN A;  1A78 A;  4A6O A;  3BOP A;  3PLQ A;  1FPN 3;  1UF2 C;  2RS3 3;  2WO1 A;  1D4M 3;  1U5X A;  5DMY A;  2AGS A;  4AE2 A;  3HBZ A;  4MLO A;  5A3U A;  1H2N A;  1YQ8 A;  1GFF 2;  3V0B A;  1W8W A;  2OT7 A;  4K1Z A;  5CG9 A;  1WCU A;  1ULC A;  1ALY A;  4FFH A;  4Y4R A;  1BVV A;  1D0H A;  5HCH A;  1YNA A;  1LUL A;  1S2E A;  3BU7 A;  3KZ4 C;  1OF4 A;  3PUR A;  4FP2 A;  3VN4 A;  1AYN 2;  3BIW E;  5FP8 A;  5FPB A;  4MXV A;  2YXS A;  4P9X A;  1WLD A;  3OSD A;  4WZC A;  2R07 1;  1L7Q A;  1RVF 1;  5IVJ A;  5FZ6 A;  1ZRD A;  1X8M A;  3PUI A;  4B1L A;  4BZ4 A;  5FUI A;  3NKG A;  5BY5 A;  2XJP A;  4IEW A;  2QQI A;  2QTW B;  4MGS A;  2CNA A;  2W87 A;  3MBW A;  2HH9 A;  2UWB A;  2HKX A;  2VGD A;  4AI3 A;  1H2K A;  3S0M A;  1MPX A;  3WSO A;  4WVM A;  3P6B A;  2OPK A;  4HKO A;  4DS0 A;  3R0R A;  5FPL A;  4GB3 1;  3TNQ A;  5CA6 A;  3KQ4 B;  1RUD 1;  3E97 A;  2DVG A;  3IMM A;  3NNM A;  3MV0 1;  4M3C B;  1NQJ A;  4Q27 A;  4AHX A;  4WVZ A;  2WN2 A;  5IK7 A;  3KCC A;  2PAM A;  4CEY B;  2WRA A;  4RGK A;  4AGG A;  5IK8 A;  5J37 A;  3GBF A;  3I59 B;  4FFG A;  2K0G A;  3JD7 3;  1RYY A;  2WZ8 A;  5LK7 B;  4DY3 A;  3S6P A;  2VZV A;  4PIX A;  1ND2 A;  4UW4 A;  2JIJ A;  1TMF 3;  5A6Z A;  3C8X A;  5FOB B;  4ISR A;  1PO1 3;  4XEZ A;  1DGW A;  5FZB A;  3VHR A;  2UWC A;  4FXG B;  2RJL A;  4Z2W A;  2VPV A;  5C9A B;  2V4V A;  4I0W B;  3U11 A;  3L9J T;  1CN1 A;  4ZZ5 A;  1RUE 2;  2XJQ A;  2GDF A;  3INA A;  3I4I A;  2Y60 A;  2YU2 A;  3NJV A;  2VBP A;  3POB A;  4Q0Q A;  5FUN A;  3GBW A;  3GF6 A;  5SV8 A;  4N7U A;  3RWN A;  1AL2 2;  1LOB A;  2J1V A;  1REF A;  2R06 2;  2W94 A;  4M0H A;  1PGL 1;  1PHM A;  4W6X A;  4OLL A;  5FZ0 A;  3F95 A;  5BNP C;  5EFU A;  1ENQ A;  1YJL A;  4Q4V 3;  1G6N A;  4RD7 A;  5FMO L;  3POF A;  3DEC A;  4G3Y C;  4BXS V;  4PBO A;  3AP9 A;  5CKM A;  1NX9 A;  3ZXL A;  5KXD A;  3I3M A;  3KF5 A;  2JE8 A;  4AED C;  5FTT C;  3TN9 2;  2LRP A;  2VMI A;  4URA A;  5H9R A;  1H8T A;  4CDW B;  4UBH A;  1UXX X;  3OB8 A;  4YW6 A;  4EN0 A;  2R7E B;  2ZX3 A;  1Y9M A;  3GZU C;  5FAX A;  5BXX A;  2B9V A;  1XE0 A;  3ZXA C;  2AYH A;  1US2 A;  1LRH A;  3IMN A;  2A71 A;  4DOU A;  2HEW F;  4PHZ A;  1CAX B;  5D8A B;  4HL0 A;  1GSL A;  2GP3 A;  2EXI A;  5GZG A;  5FZD A;  4DFS A;  5CBL A;  1JH5 A;  2XLA A;  3RRD A;  2VU9 A;  1LEC A;  1CJD A;  3POE A;  5KHK A;  4DUV A;  1NCR B;  1VAL A;  3M2M A;  2Q30 A;  4LOR A;  3EBR A;  1QNY A;  4OUL A;  5EJ1 B;  1YQ6 A;  3ZPO A;  1QOT A;  3USU A;  4ZXE A;  3RSJ A;  2IVI B;  4RA0 A;  4Q4Y 3;  1SHW B;  1YRZ A;  3RYP A;  3PTY A;  5C5U A;  4AQ6 A;  1GR3 A;  2CWM A;  3OD4 A;  1WA4 A;  3G7D A;  4JTN A;  4XTP A;  2BWA A;  4XFF A;  4ITC A;  2YRO A;  4OUS A;  5CNA A;  1HRI 3;  4EQV A;  1EAH 1;  2DYC A;  2CSG A;  2WWS A;  1JYC A;  3VHO A;  5KXC A;  2EID A;  2EA7 A;  2X10 A;  3D5O A;  1ZZ9 A;  5IVY A;  2VH9 A;  4NVP A;  1FNY A;  1RUG 3;  3BCW A;  3H8U A;  1NZC A;  3ZDV A;  5GLU A;  1AR9 2;  4JDO A;  4Y5S A;  5FK7 A;  2WZP P;  3GNE A;  4A3X A;  5FCC A;  1H2M A;  1XND A;  1LHU A;  3CU7 A;  2ARC A;  1O4T A;  3VBS A;  2C9K A;  3OCP A;  1S4C A;  1V0A A;  1UYZ A;  3WCR A;  4DXS A;  2A5Z A;  1RUH 1;  1YQC A;  2LUW A;  1JZ7 A;  1TVG A;  2C1F A;  4NPM A;  5FUP A;  1ZBE 2;  2HWF 2;  3SNM A;  4C8D A;  4AHZ A;  4QHB A;  1MS8 A;  4DRR A;  1ND2 C;  1AR7 3;  3OJB A;  1W99 A;  4DXZ A;  2PFW A;  1OHF A;  2HJI A;  2W3J A;  4G9S B;  1H8V A;  1Q8S A;  1O4Z A;  4D69 A;  2WNU A;  5F2W A;  4BK5 A;  2ZEY A;  1W05 A;  2R1D A;  3M3E A;  4IV3 A;  4JAA A;  4A41 A;  4B4R A;  1E57 A;  4B4Q A;  2G1M A;  1I1E A;  2Y6H A;  4OI4 A;  1YHF A;  2A6Z A;  3I2H A;  1S0D A;  2DCT A;  3KD4 A;  1SLC A;  2D3R A;  2JEN A;  2HBU A;  1YC6 1;  3PUQ A;  2WO7 A;  3TEX A;  4NHL A;  3E1F 1;  5L7O B;  2I2S A;  3HQU A;  4AVT A;  1ND2 B;  2AEZ A;  3LQC A;  4Y1X A;  4CPB D;  3AFG A;  2ZML A;  1MVQ A;  3AJZ A;  1Q8O A;  5FZ7 A;  4QX1 A;  2VME A;  1XYP A;  2BUK A;  2BVV A;  4Q8L A;  2MEV 2;  2BWC A;  3FMG A;  2JKX A;  1GUI A;  2B4K A;  5ABJ C;  4UT5 A;  5L36 A;  1SDW A;  1VBC 1;  2H6C A;  4UOJ A;  1ZM1 A;  4M3C F;  4AVC A;  5IHR A;  1GIC A;  4E8D A;  1KEX A;  3BAL A;  1FPN 1;  1JZ5 A;  2MPF A;  4CDQ B;  1MZE A;  4X6Q B;  2RM2 1;  4QPW A;  2YC0 A;  1ZZ8 A;  2F4L A;  4K6B A;  1U5Z A;  4N7I A;  1G86 A;  1AHS A;  3N9O A;  5KC5 A;  5A7Q A;  4RR3 B;  2PTM A;  4L2N A;  2OX0 A;  2PEL A;  5LK5 A;  1YEW A;  5ABJ B;  5JDB A;  3ZKY A;  3C7O A;  2QZ3 A;  3FHI B;  2UYA A;  3N9N A;  3A4U A;  5T50 A;  2BV4 A;  1NE4 A;  4QGM A;  5FXV A;  1SCS A;  2XJT A;  4YFZ A;  3N7J A;  5DG1 A;  2J1R A;  1CD3 G;  1CON A;  3MUY 1;  2R0H A;  5A7W B;  1G9A A;  4MSV A;  4CU9 A;  4LEJ A;  4GUL A;  1MZF A;  4XET A;  3VZN A;  4PT6 A;  3DEM A;  2ARA A;  5FP7 A;  5FY4 A;  1NE6 A;  1UKR A;  1QJY 1;  4ERO A;  2BNM A;  1PVC 3;  1Z7S 2;  3JUU A;  4LR4 A;  4CZS A;  4PI2 A;  2OQ6 A;  1OPM A;  4IEX A;  4FOQ A;  3BTY A;  3NAP A;  3WG3 A;  1UCX A;  1KQR A;  5FZ1 A;  2VVF A;  3O1R A;  1EY2 A;  4XZP A;  1EV1 2;  1TZO A;  3VBS C;  2GND A;  3H3Z A;  1IKP A;  3TOJ A;  1GWK A;  1U5Y A;  1SQ4 A;  3IBM A;  2P17 A;  3VV1 A;  4IGP A;  1KJL A;  4FXK B;  4ZU5 A;  1Q3E A;  3NWK A;  4XE9 A;  1WA6 X;  2R06 3;  1X33 A;  2WZR 2;  1PIV 3;  3ILR A;  2KA3 A;  4Y33 A;  3SKJ E;  1NXM A;  2VXR A;  4ES9 A;  1U12 A;  3HNY M;  1BBT 3;  1NCQ B;  3EXU A;  1VMH A;  1J3Q A;  1R09 1;  2F4P A;  3W9A A;  4BQW A;  3E5X A;  5EQU A;  3C7H A;  3NMB A;  3AFK A;  1W8H A;  2BFU S;  1C57 A;  2EXK A;  4IV3 C;  4UI9 L;  3P3N A;  3IDE A;  3JB8 A;  4N53 B;  3F2Z A;  2VNG A;  2LW8 A;  4RYD A;  4RHV 2;  1LGN A;  1PZ7 A;  2ZXQ A;  3TN9 3;  3IWZ A;  1LEN A;  1O8P A;  3OUH A;  4YYO A;  2Y6F A;  4ASL A;  4DPN A;  3P5B A;  2Y0O A;  3FE5 A;  1SFP A;  3K46 A;  4BIF A;  4CCK A;  4E4Z A;  1IGO A;  1NAE A;  4QX3 A;  3J4U H;  1CAU A;  1DCS A;  1UIJ A;  3FHA A;  2BYV E;  4XJ8 A;  2YU1 A;  2K9Z A;  3USS A;  1H30 A;  4R8H A;  3ZSE A;  1XNA A;  1VIW B;  4ONU A;  4NHM A;  1DQ6 A;  3UK9 A;  1OOP B;  4GQ7 A;  1X7N A;  4IV3 B;  3VLB B;  1RJ7 A;  1PO2 3;  3OBZ A;  1DDL A;  1RHI 1;  1PZ8 A;  1SLA A;  4GB3 2;  4B3N A;  2VE1 A;  1RUD 2;  2WN3 A;  2BGC A;  2IWG B;  2WQ4 A;  3WDU A;  2DVA A;  3KQR A;  1OXC A;  3VKL A;  1VMJ A;  2LRO A;  2KM2 A;  5KC6 A;  2DFC A;  1W03 A;  1W6O A;  3SIS A;  2R6Q A;  5EPA A;  4K9S A;  4BE3 A;  2IXJ A;  2GME A;  1W6N A;  3ZLI A;  1PZ9 A;  4JDN A;  3AMP A;  3H3L A;  2E7A A;  1JYN A;  5GLT A;  1ULP A;  4IE0 A;  4U36 A;  2NMN A;  4CCN A;  2DCJ A;  4K7J A;  5IWF A;  3RI8 A;  2XBO 3;  3ZPY A;  5CIS A;  3I3D A;  3O1V A;  3NNJ A;  2GN7 A;  4YGD A;  5EJZ B;  1QWR A;  1F4H A;  3GYD A;  2XDV A;  4YGB A;  4D0Q A;  3AYD A;  5F5Q A;  1OA2 A;  1OA4 A;  5C8C B;  1NLS A;  1OA3 A;  2N7G A;  2PHR A;  1S0J A;  4YG0 A;  2XPJ A;  3A0N A;  2ZGQ A;  4BQY A;  1J83 A;  1V6M A;  1ZRC A;  2IXH A;  1OD3 A;  2VW2 A;  5FPZ A;  2VQA A;  2RDS A;  3BOD A;  4CYD A;  1PGL 2;  1NYW A;  4QPG A;  4B8E A;  4HMZ A;  1PX3 A;  3VZM A;  5C3Q A;  5GJ6 A;  3QD6 A;  4AFD A;  1D4V B;  2CY6 A;  1HRV 3;  1EPZ A;  2JDA A;  4BMB A;  1JOD A;  4FFF A;  4ARX A;  5APA A;  4FOY A;  4AQ2 A;  5FYC A;  1UOF A;  1LES A;  4TTG A;  3UKV A;  5JMC A;  1WKY A;  3I2D A;  3NAP C;  1GWM A;  1BYH A;  2WFF 1;  5H9P A;  5CAD A;  3W5M A;  4Y20 B;  5FKB A;  4CU6 A;  1I5Z A;  3KV6 A;  4BLJ A;  2RDQ A;  5CVR A;  3OGV A;  5E6H A;  4OI1 A;  3RJ2 X;  3P3P A;  4NHK A;  3S7E A;  1QJU 1;  1COV 3;  2ZKN A;  5GKA C;  1CVN A;  3TEY A;  5JCT A;  4IV1 A;  2CU5 A;  4V2W A;  5I8S A;  4XZU G;  1AVB A;  3THD A;  4KWU A;  4AI8 A;  3HNB M;  3T2P A;  3V56 A;  4UXA A;  1YXW A;  1HQN A;  5FPU A;  2NQY A;  3NJY A;  3K77 A;  3ME2 A;  1WW4 A;  2GC0 A;  3WF4 A;  1AYM 1;  2VTF A;  4Y1Y A;  3C7F A;  2VD7 A;  1VRH 2;  5CB7 A;  2Y38 A;  4AG4 A;  3K4Z A;  3LWC A;  1JYV A;  3T08 A;  4HFS A;  1OMI A;  2VXJ A;  1W9T A;  1A6C A;  1W9W A;  2PHL A;  1XYN A;  1IS4 A;  1AX2 A;  4MV2 A;  3AMH A;  3PIJ A;  5C3S A;  3WUC A;  3SQO A;  2VTX A;  4TZD A;  3PUS A;  3RZK A;  3UET A;  5K0U B;  4AW7 A;  2P4E A;  4NE9 A;  2O14 A;  4CCL A;  3LF7 A;  3MIH A;  2D6N A;  3BTX A;  4I30 A;  5GM0 A;  2W95 A;  2VVD A;  1C1F A;  2ZCW A;  4GAL A;  2RG4 A;  1VBB 3;  5ACA 1;  1RUH 2;  3JXS A;  3BOW A;  5GAL A;  1BZW A;  1HDK A;  5HI0 A;  3ZIX A;  1HLC A;  1IQD C;  1DGR A;  1R1Z A;  1SFY A;  1MZ6 A;  2PLV 1;  2RS5 1;  1LCL A;  4KBZ A;  4JGZ B;  2Y6J A;  4NPL A;  5FQ0 B;  4FTE A;  4GD4 A;  4CDX A;  5C4W B;  1DZR A;  4QX8 A;  3JBG 1;  2IXC A;  3DF0 A;  4OUM A;  5CU1 A;  5KXE A;  1R08 3;  4WM7 A;  3ENR A;  2X29 A;  2JEM A;  4BLI A;  2VQ0 A;  5H9Q A;  1W6O B;  5E1R A;  1ASJ 3;  2FDI A;  4YZ2 A;  1GOF A;  4H14 A;  2YZ4 A;  5CIR A;  2A70 A;  4IE5 A;  1CIY A;  5FZH A;  2HWB 1;  5DDJ 1;  1JYW A;  1M4W A;  1VAV A;  4QPG C;  2QJV A;  4BJ0 A;  5GZC A;  3FLR A;  1KS4 A;  2P37 A;  2V5D A;  3GAL A;  4HG6 B;  2R04 3;  4I09 A;  5DXD A;  1RUI 2;  3OOX A;  1N1Y A;  3MGU A;  2VAU A;  3WW3 A;  5C6C A;  4HKL A;  2DUQ A;  1RGS A;  1F5F A;  2BBA A;  3MLL A;  2BP6 A;  1SLT A;  3OGR A;  4Y4Y A;  4CU7 A;  4MHR A;  2DCZ A;  1VBC 2;  3PVE A;  3U4S A;  2ZPX A;  4QPY A;  1ZA4 A;  4MGK E;  5JXG A;  1KFU L;  5G04 L;  4PQ9 A;  1GAN A;  4X8N A;  4JKL A;  4Z1V A;  1LTE A;  3GZE A;  4I01 A;  5FJK A;  1CJP A;  4EWD A;  2D6O X;  1GYK A;  1FPN 2;  2RS3 2;  1XOY A;  4XUO A;  1NUK A;  3SXW A;  1RIN A;  1C1L A;  3K3N A;  2P5B A;  3RZZ A;  3H8R A;  1O59 A;  1NZI A;  2O1Q A;  1RVF 3;  2R07 3;  5EP9 A;  2XJS A;  5FY9 A;  4HSL A;  4IV1 C;  3NL1 A;  4HT1 T;  4A3Z A;  4K20 A;  4B29 A;  3H0O A;  2ZGR A;  5HBA A;  4KQ7 A;  1VBD 1;  5JPN B;  4FO9 A;  3OEA A;  5FMO S;  3VBF B;  4YLZ A;  2E7Q A;  2ZMK A;  2FHR A;  2XQR A;  5KHG A;  1REE A;  3WDY A;  3HOB A;  5DAW A;  4GB3 3;  2WT2 A;  1RUD 3;  2VZU A;  2VOX A;  1JZ3 A;  1JUH A;  1GP4 A;  4BB3 A;  4C1W A;  3OD0 A;  2FQP A;  2YC2 A;  1LOA A;  2J1U A;  3BTA A;  4NUB A;  3H3U A;  1QJY 2;  1A8M A;  5KXB A;  3H8X A;  3UYJ A;  4GAZ A;  3OBR A;  3WG2 A;  5C3P A;  4N9I A;  3VBO A;  4AVV A;  1VBE 1;  4XXA A;  2V72 A;  1CAW A;  4IUG A;  1OLM A;  4P9Y A;  3JD7 2;  3LA2 A;  2Y34 A;  3KV4 A;  4EZH A;  4XIO A;  2W92 A;  4BIO A;  2OZ6 A;  3VUO A;  3MW2 A;  1JUI A;  5LBC A;  1TMF 2;  3CHX A;  3HMY A;  2Q8E A;  4CCE A;  1CX4 A;  1RC6 A;  3ZVX A;  1PO1 2;  4AR2 A;  4LKD A;  4QT6 A;  4QX2 A;  1UZZ A;  2H6B A;  3O0V A;  1S0G A;  4O7X A;  5FZI A;  1LED A;  2QQV A;  1Z0H A;  4XF3 A;  3ZYJ B;  4J1X A;  4YAR A;  4W6Y A;  2W9X A;  5JXI A;  3ZXK A;  4XF1 A;  2VNR A;  3PHM A;  4CDX C;  3VDB A;  2ERF A;  1W2T A;  4OQ8 A;  4IQP A;  2EVX A;  4CP9 A;  1ZA7 A;  4R52 A;  4AYU A;  4WM7 C;  4YVW B;  1LHW A;  4LXL A;  2V5Y A;  3ELN A;  4HK8 A;  4Q4V 2;  3ZXF A;  1RJ8 A;  3ZR5 A;  3BPS A;  4EV0 A;  1IS6 A;  1HRV 1;  2IXI A;  2WO3 A;  5A6Q A;  2QZ2 A;  5FZG A;  3PME A;  3WF3 A;  1W6M B;  5FZO A;  4DZG A;  3EB7 A;  3J26 N;  3PDQ A;  3DYM A;  5DUV A;  2ZAA A;  4QXB A;  3SCF A;  1RUC 1;  3HEI A;  1QH6 A;  4P9I A;  5F6L B;  4TN7 A;  4GJZ A;  4AEM A;  1XNB A;  2FDG A;  2Q1Z B;  1PK6 B;  3RMX A;  3WF0 A;  3BYW A;  5LWB A;  2ZHL A;  4PLN A;  1RXG A;  1YYN A;  2PAK A;  3C7E A;  4QB6 A;  1AR6 1;  5FK8 A;  2GH2 A;  2HYX A;  4AVB A;  3P1I A;  1DGR N;  4XFG A;  3T1L A;  3DUI A;  3I2F A;  3PMS A;  4XVH A;  2C26 A;  1RMU 1;  1X9T A;  3CKH A;  4J1W A;  4WM8 A;  4MXW B;  3K3O A;  4ZPI A;  3O1P A;  1LOG A;  4Q5O A;  4WVW A;  1N1V A;  1UOJ A;  4XAA A;  1QXR A;  5FZL A;  1AXY A;  2ARX A;  3WXP A;  4EZ4 A;  2JDY A;  3M7A A;  4CCJ A;  5LY1 A;  4UFJ A;  3S57 A;  5FYS A;  1XRU A;  2J1E A;  3AKR A;  4FPJ A;  1WW7 A;  3SKV A;  3VDD A;  4D6S A;  5I0D A;  2YBS A;  3B7M A;  3RG0 A;  1SDD B;  3K4A A;  1GNY A;  2UY8 A;  3HT2 A;  4XUQ A;  5B4N A;  4Y1U A;  2XL7 A;  1WLT A;  1EAH 3;  1J3P A;  5LBE A;  1AXK A;  4HPK B;  2ZEX A;  3B01 A;  3HN3 A;  1UIK A;  4FPL A;  4QPI B;  4YW7 A;  3UGG A;  4D6R A;  2X5I B;  4GKX A;  1N3O A;  4LBK A;  5IYY A;  5IK5 A;  5F3G A;  1QQP 1;  1TME 1;  5CFD A;  3W5N A;  5A1F A;  4BDV B;  1MQT B;  1S55 A;  2TEP A;  4FPK A;  3LSD A;  1F9K A;  2W91 A;  2WWJ A;  4TLG A;  3H50 A;  1RUH 3;  1G9F A;  1BEV 3;  1RUG 2;  1PVX A;  3KSC A;  2FCT A;  4Y5T A;  4AFC A;  1F4A A;  2XWB B;  4PJY A;  1MS5 A;  1CPM A;  4OHZ A;  1H6X A;  3I97 A;  3O0X A;  4JRA A;  3U37 A;  3VBO C;  4X6R B;  4IGO A;  3POW A;  1VBB 1;  4JTO A;  3PVO A;  4Y22 A;  4LBQ B;  3WVJ A;  1I5P A;  1UMI A;  4XQD A;  2WFF 2;  1O5U A;  3QH6 A;  2TUN A;  1N1S A;  2ZGU A;  4LO7 A;  2UU8 A;  4FQ4 A;  3G6J B;  1AR7 2;  2I45 A;  3HIF A;  4AXO A;  5BV6 A;  2YUE A;  3V0A B;  3CIH A;  4JRL A;  2Z79 A;  5C3R A;  1V6O A;  3VBR A;  3NNG A;  4DO0 A;  2PXJ A;  1QJU 2;  1OUX A;  4AGR A;  1H1I A;  2ZGM A;  1GP5 A;  4Y1Z A;  5F1R A;  1DGW X;  4E2G A;  3AKT A;  3M3Q A;  2OW4 A;  3J7L A;  2D5F A;  4XJW A;  5FY5 A;  2BGO A;  3N7M A;  1F2N A;  4ZXK A;  5IUQ A;  3LD8 A;  3VL9 A;  4UWD A;  2QBX A;  2B45 X;  1XNT A;  3WG4 A;  1JI6 A;  1VBC 3;  3WP5 A;  4O9E A;  5GLZ A;  5JLV A;  3ZDS A;  4GH4 A;  2ORZ A;  3ZFG B;  2VZQ A;  2P3J A;  1O91 A;  4QB2 A;  3WF2 A;  4P02 B;  2JXA A;  4CP0 A;  5A3N A;  3PJY A;  3GZA A;  3H7J A;  2WQ8 A;  2YV8 A;  2ZGO A;  2RM2 3;  4GA9 A;  2X8K A;  4XPV A;  3IDC B;  5HCB A;  5A80 A;  4UBG A;  1IKQ A;  4B7K A;  5JMO A;  1OFN A;  1TE1 B;  1R1A 1;  2YPJ A;  1KFX L;  3D4K A;  4YPJ A;  1W90 A;  5JZG B;  2HWD 1;  5EYX A;  3ZXD A;  4ATE A;  2C0Z A;  1W0O A;  2CDP A;  3GXU A;  4FQZ A;  5FP4 A;  3ST7 A;  4NR1 A;  4WM8 C;  2BVB A;  3WUD A;  2OA2 A;  3UV9 A;  4MOA A;  5FZO B;  5B4X A;  1XNK A;  2VEC A;  5ACA 2;  4F3J A;  2VOV A;  1YUD A;  1VB2 A;  4LHL A;  1VBA 1;  3ZFE A;  3A7Q A;  4XBN A;  1JS9 A;  4XF4 A;  3HPN A;  2AC1 A;  2DU1 A;  3H7Y A;  4JQT A;  3VDD C;  2PLV 2;  3DGT A;  2RS5 2;  5B2G B;  3WNP A;  1QJY 3;  3D8C A;  4ARY A;  2XR4 A;  3J7H A;  4QQH A;  1NY7 2;  5FZC A;  3IPV B;  2XJV A;  4DUX A;  2B9U A;  1OLR A;  3MIF A;  5E89 A;  1YWK A;  3E5U A;  2DF7 A;  2JEC A;  3SC7 X;  3VZL A;  2XON A;  2W46 A;  3DKW A;  2X09 A;  3RZH A;  1PVC 2;  5CFD C;  5I0R A;  5BNO A;  1SCR A;  1C8M 1;  2RS1 1;  2WNV A;  2ORX A;  3AKS A;  2JE7 A;  3DL3 A;  3LSE A;  3WP3 A;  1JZ6 A;  3THT A;  3SCG A;  2HWB 2;  4A4A A;  1ZVF A;  3CL1 A;  1QJX 1;  3HJR A;  2ZGL A;  3AP7 A;  4BQ3 A;  2VMG A;  1GZW A;  3WR0 A;  1IS3 A;  1XU2 A;  5IK4 A;  3OUI A;  5FP3 A;  1HN0 A;  1QNW A;  2E53 A;  1US3 A;  2TBV A;  2VZT A;  1HXS 3;  4MZU A;  4O61 A;  2R30 A;  3Q8F A;  2RV9 A;  3CF6 E;  3LGR A;  4LBN A;  3ZYG A;  2RJK A;  1UZ0 A;  1G7Y A;  1KDK A;  1R09 3;  2XVL A;  1QY4 A;  2HWC 1;  2ZX0 A;  3B93 A;  1J84 A;  4K3U A;  3AXE A;  2HBT A;  5F5A A;  2X05 A;  4AFA A;  4CCM A;  3ZYR A;  4CP1 A;  2JG9 C;  5JSP A;  1JZ2 A;  2PQS A;  3PVN A;  1PIV 2;  1QOS A;  1T6B X;  4MH0 E;  1ODN A;  5GLW A;  1BBT 2;  2P34 A;  2XXZ A;  4AFB A;  1AJO A;  1JOJ A;  1OQD A;  1Q56 A;  4LKE A;  4DQA A;  2JB4 A;  1WD3 A;  3VBR C;  1QU0 A;  2RJ2 A;  5JPM B;  3ZYI B;  1HQW A;  3ZXJ A;  5J3U A;  5L9B A;  5FZM A;  1BXH A;  2MHF A;  3H1W A;  4UAP A;  5IAV A;  4MGI E;  1W8T A;  2QQL A;  4LKF A;  4NMI A;  2YDE A;  5F5C A;  4EN9 B;  2JG9 B;  5FOJ B;  2XL9 A;  4AQS A;  1DQ2 A;  5I8T A;  1FYU A;  3ILF A;  2GNB A;  5BNP B;  2J22 A;  2W0X A;  1RHI 3;  1ULG A;  3AYC A;  3THP A;  1W6P A;  4NWW A;  2ZX2 A;  4FT8 A;  4EWE A;  1SPP A;  3WNK A;  2R16 A;  2WSU A;  3VBR B;  1UN1 A;  4D7S A;  2ARB A;  4CDU C;  1A8D A;  2ADE A;  2P3K A;  3QAC A;  1XBF A;  4KGQ A;  4OZX A;  1PO2 2;  4PIY A;  3AZY A;  3T4H B;  4AED B;  5FYB A;  3TWI A;  3LEK A;  4WV8 A;  4C90 A;  3JZV A;  4YSF A;  5BUV A;  2EAL A;  1APN A;  1S1A A;  3T0B A;  1W6Q A;  2QQN A;  5DZF A;  5F3I A;  3R6S A;  4ASM B;  1XE8 A;  3ALQ A;  3VDA A;  1M06 G;  1NG0 A;  4Z8B A;  1D0G A;  1QEX A;  2VVE A;  3MIG A;  5AC9 1;  3U0Z A;  1UPS A;  5A3O A;  4CDU B;  1N3P A;  3IDB B;  1Q8P A;  4QHZ A;  4ET7 A;  5HV4 A;  2XBO 2;  4LBQ D;  2QQP A;  5L19 A;  1Y43 B;  3VGI A;  2OUJ A;  3NV3 A;  2XLG A;  1Q43 A;  2JG8 A;  2OZJ A;  1JTZ X;  2AZ5 A;  3I3Q A;  1T6G C;  1LOC A;  4XBQ A;  1UPI A;  2WAB A;  3V0B B;  1JBC A;  2QCS B;  2VR4 A;  1JW6 A;  1WMD A;  2RE9 A;  4XDP A;  2FCU A;  3WDX A;  4YRD A;  5LB6 A;  1I3H A;  2JX9 A;  5FO9 B;  2DCY A;  2DCK A;  2ID4 A;  4M4P A;  3S5Q A;  2ZMN A;  1Q8V A;  2NMO A;  3GHN A;  3VBU A;  3ZYF A;  1EP0 A;  3TNP B;  1BEV 1;  1KIT A;  2IFW A;  2WFF 3;  3N9Q A;  3ROU A;  1HRV 2;  1UY4 A;  1SZB A;  2VQT A;  2ZEW A;  4TWT A;  2D6M A;  3N4M A;  3RZG A;  5BNO C;  5GZD A;  3OY8 A;  1VAK A;  2WNV C;  5T5O A;  2DVF A;  2YFZ A;  4IET A;  4WVM B;  2WQZ C;  3MHZ A;  4YM1 A;  4XXP A;  3VZO A;  3OYW A;  1NQD A;  1G9B A;  1QJU 3;  3ITQ A;  2Z69 A;  1ND3 A;  3FJS A;  3DXT A;  2A6X A;  1DF0 A;  1HQL A;  3PJQ A;  3HN1 A;  4KH9 A;  5AFE A;  1SBD A;  4RS5 A;  1RMU 2;  3QOP A;  3RMY A;  4Q26 A;  1EPW A;  5F3E A;  5C71 A;  2XGX A;  1ZZC A;  1UO9 A;  1COV 2;  4TYS A;  1XSR A;  5BNO B;  1WW5 A;  3W59 A;  5IVV A;  4AVA A;  1K5J A;  1AYM 3;  4E2Q A;  3SEP A;  5GLV A;  1GZW B;  2W1Q A;  1H6Y A;  4RL7 A;  1RUF 1;  2CGP A;  4ES8 A;  1VLN A;  5G05 L;  1DG6 A;  1AZD A;  3O1U A;  3HBK A;  4LMF A;  1H8T C;  1HV1 A;  2YFU A;  3KVA A;  1XE7 A;  1VB4 A;  3R05 A;  4XF9 A;  3FWE A;  3EHK A;  3LB9 A;  1ULF A;  4NRO A;  5FZA A;  5JXJ A;  3K51 A;  3ZXE A;  5I91 A;  5I8Y A;  2CGN A;  2ZGT A;  4KWK A;  2QQU A;  2ZTN A;  3MIE A;  4YW5 A;  1DBN A;  1QQP 2;  1BLZ A;  3I8T A;  3MIB A;  5F9T A;  4C0H A;  1UXZ A;  2ZGS A;  3VHN A;  1J59 A;  5LRR A;  4CVU A;  1ZRR A;  4GJY A;  4JKM A;  5ACA 3;  1OKQ A;  2SBA A;  1DQ5 A;  3ZO0 B;  3N9P A;  1H8T B;  1K5M A;  1OC1 A;  2JDN A;  3TYJ A;  1QXJ A;  4YM2 A;  2PLV 3;  2RS5 3;  3ZKU A;  4DIQ A;  1VBB 2;  3N9L A;  1LOE A;  1LOF A;  1W8N A;  4U2A A;  1CAV A;  1LGC A;  4COU A;  1NKG A;  2WA4 A;  3JBG 3;  3O1O A;  3T09 A;  1D2S A;  4E4D X;  1SPP B;  5A7O A;  2Z4F A;  1F15 A;  1ULD A;  5BNN A;  3ZX7 A;  2V09 A;  2ZOE B;  1LHO A;  2GAL A;  4OUE A;  2FZ2 A;  2QNK A;  5JR7 B;  2XOM A;  2YPD A;  1BMV 1;  2W08 A;  1DQ0 A;  3A22 A;  1Y4W A;  4UW5 A;  1XQN A;  2J42 A;  1R08 2;  2WZE A;  3ZYP A;  2WWU A;  2JG8 C;  4QXK A;  2HWB 3;  5DDJ 3;  5DN2 A;  3ZSL A;  2Q1F A;  5F3C A;  2D6P A;  4Y3O A;  1ASJ 2;  2YBP A;  1GQP A;  3NJX A;  4UF0 A;  2GC1 A;  4XFC A;  5E16 A;  3RFR A;  3USU B;  3VB9 A;  5HV0 A;  4RGA A;  3WG1 A;  3O0W A;  5A3W A;  2ZX4 A;  3UES A;  2CDO A;  4NID A;  5FYT A;  4COV A;  5T5J A;  2LM3 A;  4YG3 A;  3RPQ A;  1S2B A;  3VBU C;  1GOG A;  1V6I A;  1PGW 1;  3ORJ A;  2QDR A;  3E6D A;  2R04 2;  4PLM A;  3T0A A;  1HXS 1;  2VOK A;  1J1L A;  2FDK A;  1MS9 A;  4M4R A;  4XCA A;  2XUE A;  2KXL A;  1OVS A;  4FOW A;  5EZW A;  5BYN A;  2WNU C;  2JKB A;  1NXD 1;  3RZM A;  1WLW A;  1R1A 2;  2WBK A;  4QKD A;  3VBS B;  4CEW A;  1ND3 C;  2HWD 2;  3OGJ A;  1UU4 A;  4NHX A;  2A3W A;  2J1S A;  4XOG A;  4YGE A;  4XJU A;  1YFX A;  5A33 A;  4LOS A;  4Q4W 1;  4RS5 C;  3VBU B;  4BU2 A;  3KGL A;  1VP6 A;  2WJS A;  3DV8 A;  1VBD 3;  4LIV A;  5FLH A;  5FKC A;  3I2I A;  1SAC A;  4COW A;  3TBD A;  3AZW A;  3BKZ A;  2R07 2;  1RVF 2;  3WW1 A;  1FAT A;  4QQL A;  5BNQ A;  3B69 A;  2WNU B;  1VBA 2;  2B7Y A;  1QJZ A;  3SIT A;  1FT9 A;  3ASI A;  5JSR A;  5J98 B;  1RTV A;  1DQ4 A;  3I54 A;  5DZE A;  1UKG A;  1GU3 A;  2E7T A;  3T0D A;  5KR7 A;  4AVS A;  1IG0 A;  5FZ4 A;  4NN0 A;  1DFQ A;  1VBE 3;  2VW1 A;  3FUQ A;  1Y9Q A;  3Q8B A;  1WBF A;  3WP6 A;  4QMA A;  3HT1 A;  3CJI A;  4FPC A;  1C8M 2;  2PYT A;  2QDN A;  1OD5 A;  5GZE A;  4FP3 A;  3WOG A;  3OGG A;  1QJX 2;  4XQW A;  4LUL A;  2ZKL A;  2WL1 A;  1YI9 A;  3PUA A;  4IE7 A;  4UFM A;  3VD4 A;  1UYY A;  4XTM A;  2L9L A;  5FYM A;  1K5M C;  3RJR A;  1DU3 D;  4YM0 A;  2WS9 1;  2HWC 2;  2LS6 A;  2DTW A;  3ZOI A;  1LOF C;  4B7E A;  1N3Q A;  4RQP A;  3RGB A;  4XUR A;  3DPR A;  3O1S A;  2XH6 A;  4ZY9 A;  1E5R A;  4KG0 A;  4HKW A;  4R9D A;  2VC9 A;  2ZJC A;  1K5M B;  3MF6 A;  4JV4 A;  3THC A;  2EIE A;  3KHB A;  1RUC 3;  3RQ0 A;  4ZHN A;  2W1U A;  3IIA A;  4L8Q A;  4NPR A;  5KHH A;  4Q0V A;  3OBT A;  5FYU A;  5JUV A;  3EO6 A;  3LE0 A;  3FLP A;  1W28 A;  2VG9 A;  2GZW A;  3PU8 A;  2G4I A;  5T54 A;  1AR6 3;  3WNN A;  1GZT A;  1HB3 A;  1AX1 A;  3J9S A;  2HEY F;  4MHU A;  2GN3 A;  1IS5 A;  1X82 A;  4JHT A;  1RMU 3;  3ATG A;  2AEY A;  4HZF A;  2WC2 A;  4LHS A;  1KRI A;  2PHF A;  2VMH A;  4YVS A;  5C8W A;  5HXM A;  4MX3 A;  1PNG A;  1W2A X;  2JDK A;  4LNV A;  5ANN A;  1SBE A;  4K1Y A;  2HWE 1;  1FNZ A;  4E27 A;  1MEC 1;  3NAP B;  3WIN E;  3N9M A;  2VOT A;  2J7M A;  4UF0 B;  2ZA9 A;  2O8Q A;  4NRP A;  4AI0 A;  3ZN6 A;  4PLO A;  3WF1 A;  1PMI A;  3N35 A;  3W58 A;  4E4S A;  3GM8 A;  2DWR A;  4XQ4 A;  4CEW C;  4Q0U A;  1C5I A;  4QGL A;  2OKX A;  5A70 A;  4OMD A;  5AC9 2;  1W0P A;  2BGP A;  4UFL A;  1V70 A;  4BQX A;  3KT1 A;  3HQR A;  3ES1 A;  4FPE A;  4Y26 A;  1DLL A;  1H2L A;  1HB2 A;  4NWV A;  4LTA A;  4PCR A;  1QQP 3;  1TME 3;  4IER A;  3RWK X;  3WP4 A;  1EAH 2;  4FI9 A;  4XHB A;  1OKO A;  1OUS A;  4L11 A;  3ON7 A;  4IEU A;  4F8A A;  3N7L A;  5HPO A;  3M3C A;  4FSJ A;  3NKT A;  1IZ3 A;  4I0A A;  3B9C A;  4QQ2 A;  2GP5 A;  1ZZB A;  2Z42 A;  2B39 A;  3NNF A;  1NOV A;  1QJF A;  3KLS A;  1CAU B;  3B5L B;  2WNO A;  5FPX A;  3NW4 A;  1BEV 2;  3IM0 A;  3SH5 A;  5LAS A;  5IFT A;  4P08 A;  5A7S A;  3TB0 A;  4AOC A;  1IG3 A;  1FOD 1;  4A2U A;  2C5D A;  3CJI C;  2TNF A;  2Q8C A;  4FPG A;  5C70 A;  1S2K A;  3ETQ A;  1LEM A;  2VUD A;  1GZ9 A;  1WUV A;  2A75 A;  2A1X A;  3KF3 A;  3ZSM A;  1UD1 A;  4CCO A;  3LDK A;  1AYN 1;  4YW1 A;  4EN6 B;  4OMC A;  5AFB A;  2RR1 1;  1O5L A;  3BIE A; 
#chains in the Genus database with same CATH homology
 2HBT A;  5EP9 A;  3PL0 A;  4ZON A;  2FCT A;  3GJB A;  4Y5T A;  4NHY A;  2RDQ A;  5DAW A;  5IAT A;  4NHK A;  5L9B A;  5IAV A;  3W21 A;  5DAP A;  4NMI A;  3EMR A;  3DKQ A;  3KT4 A;  5C5U A;  5A3U A;  2Y34 A;  4XAC A;  5LBB A;  5C5T A;  4NAO A;  5L9R A;  4Y5S A;  2RDN A;  2FCV A;  5LBC A;  4BQW A;  5L9V A;  5EQU A;  4MHU A;  4UWD A;  5IAX A;  3OUH A;  5HV0 A;  3NNM A;  4IW3 A;  5HV4 A;  2RG4 A;  4NHM A;  2G1M A;  3W20 A;  5M0T A;  4XCA A;  2HBU A;  3OBZ A;  2JIJ A;  4BQX A;  2FCU A;  3KT1 A;  4KBZ A;  4NHL A;  3HQR A;  5LB6 A;  3HQU A;  3NNL A;  5DAQ A;  3BVC A;  5EPA A;  4NHX A;  5LA9 A;  5LBF A;  4J25 A;  2RDR A;  3GJA A;  4ZPI A;  5DAX A;  4Q5O A;  3NNF A;  4JZR A;  4XAA A;  3NNJ A;  2V4A A;  5ERL A;  3ITQ A;  2OPW A;  4XCB A;  5LAS A;  4XAB A;  2Y33 A;  3MGU A;  4MHR A;  5LAT A;  3KT7 A;  4BQY A;  2RDS A;  4XC9 A;  2A1X A;  3OUJ A;  5DAV A;  5LBE A;  3GZE A;  3OUI A;  2G19 A;  2JIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...