2Y34A

S-nitrosylated phd2 (no exposed) in complex with fe(ii) and un9
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
215
Chain Sequence
PLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVAYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EGL NINE HOMOLOG 1
publication title Studies on the reaction of nitric oxide with the hypoxia-inducible factor prolyl hydroxylase domain 2 (EGLN1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 64
structure length 215
sequence length 216
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2y34A00
5LBBA 5C5UA 5L9BA 5IAXA 3W20A 3NNJA 4UWDA 3OUJA 5EP9A 2FCVA 3KT7A 5LBFA 4MHUA 2FCTA 5LATA 3OUIA 4XCAA 2G1MA 5EQUA 5M0TA 5LB6A 5L9VA 4JZRA 3BVCA 4NHLA 4IW3A 2JIJA 5LBEA 2HBTA 5DAQA 2OPWA 3PL0A 2Y34A 5ERLA 4MHRA 4Q5OA 4Y5SA 3OBZA 4Y5TA 4XCBA 3GJAA 3NNMA 4NAOA 4BQXA 5L9RA 3GZEA 2G19A 5C5TA 3KT1A 2Y33A 2RDRA 5LBCA 4XC9A 5HV0A 5A3UA 4ZONA 5DAWA 4XAAA 5IAVA 3GJBA 3MGUA 3OUHA 3EMRA 5IATA 5EPAA 2HBUA 3HQRA 4KBZA 4XACA 2FCUA 4NHMA 3NNLA 4NMIA 4NHYA 5LASA 4BQYA 2RG4A 3ITQA 3NNFA 2JIGA 2V4AA 4NHXA 5HV4A 4BQWA 2RDNA 4J25A 4NHKA 2RDQA 4XABA 5DAXA 3HQUA 5DAPA 2RDSA 3W21A 3KT4A 2A1XA 5DAVA 5LA9A 4ZPIA 3DKQA
chains in the Genus database with same CATH superfamily
3PMEA 1GBGA 3WG1A 1UMIA 1Q43A 1DU3D 1XQNA 5CFCB 3LOIA 3WSOA 4IEQA 2C26A 2HWD3 2VVEA 1TE1B 3PVNA 2Q8DA 3W20A 1Z7S1 4AYUA 2NPIA 2XH6A 1MS5A 2Y6GA 2EXIA 1PVC3 2JWPA 5HXVA 3WW3A 4XUTA 5H9PA 1L7QA 4LA3A 1REDA 5GLZA 3KWVA 4LBKA 5HCHA 2BWCA 3WF4A 2A73B 2F4LA 2VE1A 1BEV1 2X5IA 1D4M2 1JOJA 4FAHA 4C1WA 1UZYA 3QOPA 3B3QE 3N36A 4W8JA 3S5AA 4KWJA 1VAKA 3GYDA 1RUE1 1W8OA 2OW4A 4L9BA 4PI0A 3WY6A 5C9AA 3HPNA 5IWFA 1RIRA 4ZU5A 4DFSA 3VHPA 1RUI2 1V6OA 1VALA 2Y60A 1HJFA 2ATFA 3PHMA 1F4AA 1ULGA 3TN91 2TBVA 3TYJA 5CFCC 1VBE1 2WS93 4YZ5A 4QM8A 3J7HA 1PGL1 5C8CB 1DQ4A 3W59A 5FZOB 3ROUA 2K46A 3MLLA 4XXAA 4YW4A 2UURA 5FMOS 3HD8B 3NNMA 1AR93 3SC7X 4SLIA 4AEMA 4CUGA 4GMP3 2Y6FA 1TME1 5F5CA 4CUBA 4E27A 1OQ1A 1YI7A 3HVDA 2HWE1 4XMIA 3B01A 3HMYA 3H3ZA 3OSDA 2XWBB 3B69A 2EIGA 4FFHA 3S7EA 5JZGA 3HT1A 5HV0A 1H4HA 3IT8A 1PIV1 3K3NA 3VKOA 2QDRA 1EUUA 2ZOEB 3RNSA 2W1UA 1CAWA 1QQP2 2XKPA 2RS32 5BPXA 1A34A 1YQ6A 2R063 3W9AA 1PO22 1VBC2 1N3QA 2B42B 3AJZA 3SKJE 4LEJA 2WA3A 5FPAA 3FUOA 1W2NA 1W6OA 5I91A 1W3VA 1OKOA 1QJZA 4HPKA 4OUSA 1Z7S3 3HOBA 2YFUA 5FPVA 4AEDA 2E32A 3UJQA 5C8CC 1WLWA 1ZRCA 1S0JA 4CU8A 1NA1A 3AXEA 3DYMA 1BK1A 1V6IA 1WW5A 3BODA 4OHXA 5C4WA 2VZTA 3N7JA 1W28A 1YNAA 4OUEA 5FY8A 1YWKA 2WNUA 2XJUA 2ADEA 5TSWA 1BBT1 1ENRA 2J1TA 3O1UA 3VLBB 5ABJA 2ZBJA 2EALA 1BEV3 3WVJA 5DUVA 5KXDA 1IGOA 2QDNA 4YW7A 3I59B 4L11A 2XWJB 3U07A 4BK4A 1H2KA 3W5MA 1GNYA 4KWUA 5EYXA 2VUDA 2F4PA 3ASIA 4IERA 2JXAA 1RUE3 4COYA 4XABA 3JB8A 1BK0A 5J7MA 4W65A 3TN93 3KT4A 4WZCA 5AFEA 2IWGB 3EO6A 5GLUA 1VBE3 5LRRA 3ZX7A 5JSOA 5K9YA 1X7NA 1XSQA 2E31A 1EV12 3H3UA 2VZUA 2QQLA 2XPJA 2HWB2 1GQHA 1HQLA 2HH9A 1AYN2 1RUJ1 3MPBA 4TZDA 1TME3 3PJYA 3MIEA 2R071 3I3BA 4Y5Z0 5JZGC 2HWE3 3FJSA 4XUQA 4GMP0 4XURA 5EXOA 4EJRA 4FOYA 1C5HA 2BNMA 5FZKA 2J1UA 3I2KA 4HZFA 2ZCWA 3NAPB 4XJ8A 1PIV3 5A7OA 4YFWA 1U5IA 3N9MA 1MZEA 2GN7A 3IPVB 2E33A 5HCAA 1S0EA 3BB6A 1QJEA 4QXBA 2MEV3 4JV4A 1DYKA 3SHRA 1W6PB 5F8PA 3ES1A 3VBRB 4HLTA 3DF0A 3DPRC 1PO12 3GF6A 3ACIA 4Y1YA 3ZYGA 3UNPA 4ZS2A 1CESA 1XNAA 3S0MA 1VBA2 2FMDA 2D5HA 4CEWB 2RM22 2YV8A 4CU9A 3IDCB 1PVXA 2IZWA 4I30A 4YG6A 4MGTA 1LHNA 1XRUA 3RI8A 1CAXB 1RHI1 1S2EA 3IIIA 1BBT3 3GALA 3HQXA 2VM9A 3MDPA 3OGVA 2XJTA 5JWPA 1JH5A 3SKVA 4Y3OA 2R041 1VRH2 3OGJA 4K20A 5C8WA 5FMCA 2HEYF 2PHWA 3QD6A 1ZBA2 1ULCA 2R49A 4GB32 1FMD1 3NAPC 3ZYRA 1T6GC 1T2XA 1ULPA 5L36A 5B2GB 1DZTA 1QJFA 2WQ8A 1DQ1A 2RDRA 2QNKA 1VAVA 4Q4W1 4QPIB 1CD3G 2JG9A 1YEWA 2B46X 2XLGA 1VIWB 1WCQA 3CL1A 3LDRA 3VBRC 1LESA 2AUYA 4UBGA 2BJSA 2Z4FA 3K75B 4ZONA 1YC61 4P9JA 3SXWA 1XYOA 1W0OA 2MNGA 3CBNA 3R0RA 1C57A 1M4WA 5FV3A 1S0BA 3LEIA 4CEWC 4K1ZA 1AR82 1O5UA 1W2TA 1RUJ3 3KHBA 2I74A 2A6ZA 3OY8A 4M00A 3DXTA 4IV3A 4XUPA 1HX6A 2R073 5DUWA 3RWKX 3E97A 1Q5OA 2WO3A 4AEJA 3EHKA 3VBHA 3AVRA 2RG4A 4QT6A 4GKYA 2PELA 5A7WB 1OSGA 2Y38A 5I0DA 3KQ4B 1QIQA 3HNYM 2JIGA 3M3EA 3OD4A 3T0BA 2ZACA 2XG3A 4JDNA 1O6UA 4B7EA 4ZKTB 5C33A 2HKXA 1WBLA 4HN0A 1VMJA 1W8UA 4DUWA 5CAZA 2X09A 4A7YA 4YGEA 4PQ9A 3WDXA 2BGCA 4HSJA 4COZA 3URFA 2VW0A 4FP3A 2D97A 1O3TA 4P9WA 4E8CA 1YIFA 2HWF1 3ILFA 2P3KA 5DAXA 3KB5A 5FKCA 1IHMA 3RGBA 1W6MA 3MUZ1 1L7LA 3IBMA 4H55A 4RS5B 4E8DA 5FOBB 1LKNA 4P5HA 4IDZA 1QOSA 1F8VA 1SHWB 1RHI3 4NPLA 2WWUA 3AP5A 4MVTA 2WO2A 2IXCA 2WN3A 4Q4X2 4ASLA 4FBFA 1BMV2 4XJUA 2VULA 4BPZA 3MLKA 1DGRN 4QGNA 3T30A 4NE9A 3VBUB 2R043 3ZFGB 1UKGA 1PK6A 3ZYBA 4Z8BA 1F2NA 5CFDA 3ZSKA 2VUJA 1OF4A 2WNVA 5IVCA 1FMD3 4WZFA 1HIXA 2Q1ZB 2RS12 5KHHA 4A45A 4LIVA 3FLRA 1NY72 5IW0A 4Q4W3 2AEZA 2JDHA 4LKDA 3GBGA 3K77A 3KV4A 4YZ3A 2Q8EA 4BK5A 4DIQA 4FOQA 1O8PA 2OUJA 3K4ZA 3P5BA 3O1PA 4HMZA 5IK5A 2KXLA 3AL5A 3T4VA 4CPBA 1SFNA 3KS7A 1VPHA 2JD9A 2E51A 2DCJA 1GQGA 2BGOA 2O14A 4RS5C 1LHWA 4I3PA 2UWBA 1KJLA 4UF0B 3I7DA 3OD0A 4BQ5A 1WMFA 4CRQA 2NMOA 2R32A 3IKWA 4XF4A 1JHJA 2XQXA 3OBAA 4XBLA 2CU5A 1H9WA 1QQP1 3AKRA 4XE9A 1OVSA 1OQDA 2RS31 2WN2A 2XL7A 2W5FA 4OMDA 1GOGA 1PO21 1VBC1 1XYNA 3VBUC 3ZFGC 2BFUL 3V0BB 3OBZA 4LKSA 3GZTB 1GNZA 3ZIWA 4Y5TA 3DYOA 4EZ4A 1HRI1 1WMDA 1ZZCA 2WT1A 3B94A 4CCEA 4AAPA 1QJU2 1FT9A 2D6LX 2PHTA 4XW3A 2VXRA 3OGGA 1JYVA 3KV5A 2PLV2 4BQXA 1I1EA 3THCA 4O9GA 4LBNA 3WP5A 1EAH1 1GP5A 3CJIB 3NNGA 2WR9A 3RDIA 3SISA 2HWF3 3R4UA 3O0WA 3P3NA 4BA6A 3ZXEA 2WKKA 4FCAA 3VDDB 1UXXX 2XDVA 3M8LA 1IS6A 4QQHA 4BLJA 3AFGA 2VNRA 2VMDA 4NRQA 4QKBA 1IZ3A 4MUVA 1O7FA 3PU8A 4PJYA 2HBUA 2FQPA 3QLQA 5IJRA 3K3OA 4KH9A 4MX3A 2VAUA 2A6WA 1OH4A 3PIGA 1W06A 2DFBA 4HFSA 5L7OA 1N3OA 4HK8A 5G04L 4JKKA 3POGA 3TEZA 1W04A 2FCUA 4CDWB 5L73A 2VNVA 4HANA 5JMOA 2W1WA 4ATEA 4BQYA 1EV11 4I09A 5J98B 4RGAA 1J3PA 4ZZ5A 2R30A 2QVSB 4IEOA 1Q8QA 4O61A 1QOTA 3K2OA 2HWB1 3CDZB 2QQOA 3B5LB 3RRDA 1AYN1 3IDEA 4Y33A 1IS4A 2ORZA 3CJIC 2LRPA 4MO3M 1W90A 1GFF2 1ND2A 4QB6A 4D69A 3U1XA 5F6KA 4KGQA 5FZ6A 3HN3A 2NM1A 3MUY1 5A6YA 3AKPA 3G7DA 3I2DA 1LULA 3INAA 2VVFA 2VBDA 3KV6A 2JE9A 5T3NA 3DECA 1BVP1 5LK5A 3VDDC 3ZO0B 3HAGA 2RDSA 1U5XA 1SG3A 4HXCA 1JHNA 1QQP3 2ZGNA 3V0AB 2RS33 1PO23 1VBC3 2HWD2 3P3PA 1W8HA 1Y3TA 3MF6A 4QPYA 4YGDA 1OH3A 1PO11 1HRI3 1NKGA 1QDOA 2Q8CA 3VDAA 1IPKA 3M3QA 3N9OA 1MQTA 1WCDJ 1W2UA 2VQ0A 5FPBA 3PJQA 1VBA1 2ZEZA 1DZQA 3ZOIA 1W8ZA 4CDWC 3OPWA 2GNDA 2PHXA 3OJBA 2FDJA 5CG8A 4UYBA 3DKWA 2RM21 1D2SA 2PYTA 3KZ4C 1EAH3 4CEYB 1DCSA 1SPPA 5T5PA 2PHFA 3UKTA 5EP9A 4GH4A 4OFGA 1JS9A 3E6CC 2C4XA 2YBPA 3H9AA 1UY2A 4UFIA 3RG0A 4WM8B 3FFZA 5LATA 3SLIA 2Z5WA 5DUXA 4AK3A 1VRH1 1S0CA 1Y4WA 2GNTA 5CISA 1G7YA 2VGDA 5EQUA 4XILA 5FPUA 1OOPB 4AQSA 1ZBA1 5LA0A 4GB31 1O3SA 2JX9A 4JCKA 4JQTA 3VBOB 2K2SA 3GBWA 1V6MA 3NSTA 4BQ4A 4ITCA 2WS92 5CKNA 3VHOA 5AC92 3GDBA 1NLQA 3J7LA 5L19A 2VPVA 1SACA 5DXDA 2JDNA 2P2KA 3WG2A 1EV13 4I2OA 1WGPA 4CCMA 3OYWB 3H3LA 4YG0A 4EN7B 1SMVA 2HWB3 5I93A 4CEYC 1AYN3 5EJZB 4YM1A 2XLAA 1QH6A 1AXYA 2VQAA 2WO7A 4ONUA 4D7TA 3BU0A 4I02A 4R4ZA 3VKNA 4DMIA 2CL2A 2XKOA 2DTYA 1DZRA 2WSVA 4IXLA 4RFT0 1CJDA 1JUHA 1Q8OA 2WQ4A 4WM8C 3IWZA 2G19A 3KT1A 3O5SA 3C7HA 3UESA 3WXPA 4FFFA 3USUB 3KCYA 3GHNA 1OOPC 3A4UA 3ON7A 4LBOA 4A6OA 5FMOL 1LGBA 4EYUA 3VBOC 1VBD1 3NV1A 1Z7S2 4Q0VA 4Y22B 2X53S 4V1PA 4CDQA 1O4YA 2FZ2A 1PO13 2DVBA 5DPNA 1NG0A 2X8KA 1Z0HA 1VBA3 1CVNA 1H6YA 2J22A 4MSVA 4XUNA 2OT7A 5C3PA 2NQYA 2YY1A 2RM23 2A3XA 3KF5A 3MF9A 1G9FA 1NLSA 2QQWA 2ZX3A 2HEWF 4IEPA 3SH5A 4HG6B 1V6KA 3KGZA 1GZWA 4W4ZA 3OCPA 2JICA 1VJ2A 4XXPA 2BBAA 1OPOA 4MGSA 2FBEA 3ITQA 3TWIA 1OLME 5JIUA 3ZFEB 1BMV1 2ET1A 2ZGOA 3NNFA 2W95A 1I5PA 2AH2A 1RUE2 1ULFA 1VRH3 2VOVA 5FY5A 4CDXA 1JI6A 4ZZ8A 5HV4A 1ZBA3 4GB33 2WT2A 3P6BA 2H6BA 3VBFA 2RS11 4M3CB 4YW2A 2Z69A 1CJPA 1E57A 1NY71 2DVFA 1VBE2 5FTTC 5JPMB 5IVBA 1MZ6A 2W1QA 4E2QA 1H2NA 4MGZE 4NWWA 2P5BA 2GMEA 1XU1A 1W9FA 3PVBB 3HWJA 2PTMA 4NR1A 2B45X 1V0AA 2ERFA 5IVJA 2QQKA 2YYOA 1W6QB 5AFBA 4I01A 1ZZ6A 1NX9A 4PT6A 2ZGKA 2ARCA 4BQ3A 2HWE2 3LFIA 4P9XA 4GJYA 2ZPXA 5F3EA 4L97A 4BXFA 3FUQA 2LUWA 2GC1A 4K8FA 4LULA 5DZFA 4CCOA 1URXA 4IE5A 5IUQA 3SQOA 5HCBA 3LD8A 2ZKNA 4Z1VA 3ZFEC 3BI3A 1BJQA 3BOPA 4B4QA 4S2HA 5JSPA 3FBMA 4UFKA 1R64A 3NWKA 5I0UA 3HN1A 3I3MA 1OKQA 3K48A 4S2DA 3UKVA 1VBD3 4PQQA 3U4XA 1QJU1 2AGSA 2NYYA 4I0AA 4H7MA 4PLOA 2VCBA 4TWTA 2VJXA 2PLV1 2ZEYA 1AX1A 1S55A 4PF1A 4Y24A 3MIGA 1Q56A 4MYEA 4NHLA 1WMEA 4IW3A 5FZMA 2KA3A 4R9CA 3OGRA 4C90A 2VXJA 2VW2A 5DAQA 1GMMA 4EE2A 2OXBA 1OMIA 3B9IA 4AHZA 4DZGA 3HNBM 4CUCA 4H14A 1S2BA 2IUWA 5EHDA 4QQOA 1LOFC 1N1YA 3DN7A 5A33B 1TNRA 4RGGA 3U0ZA 5FYIA 3N4MA 3JCIA 3VD3A 2ZGQA 2VZRA 2RS13 2WO1A 3TB0A 1RVF2 3PUIA 3H8OA 3BTYA 1HQNA 1KXGA 2WRAA 3M7AA 4GULA 3RMYA 2CDOA 3LZZA 1F4HA 2PXJA 4MV2A 4QX8A 4UOJA 5LBCA 1O91A 1PZ9A 1D0GA 2B5HA 4O65A 4LIUA 1XU2A 5FQ0B 3E5UA 5IAVA 4Q0QA 2BGPA 5JOZA 4NRPA 4AVAA 2O0OA 2W39A 2Y6KA 4R9AA 3NJYA 2IFWA 4XZUG 1KITA 5T54A 1PM7A 1NT0A 1W39A 1KQRA 1GWMA 3NKTA 3NL1A 3HQRA 4Q0PA 5ISLA 4E4ZA 1UZ0A 1LOEA 4GXLA 3PUAA 3VZJA 2CY6A 2W0XA 3AZWA 5JXGA 4AR2A 5K0UB 3BTZA 4DXZA 3AB0A 1BYHA 4AVCA 5CEHA 3Q8EA 1K3IA 4XPVA 4XZPA 5FAXA 1FOD2 1PX3A 4R8HA 5HPOA 3LIGA 1QJU3 1T6BX 4ATFA 3O1OA 3O0XA 2V4AA 2XJSA 3WINE 2PLV3 4A3XA 2PN5A 5FZ9A 4MOAA 3RSJA 4BQWA 2DUPA 2VOTA 4UT5A 4R9BA 5FY1A 1HKDA 1CONA 5EFUA 2VH9A 1WA6X 1DQ6A 2CV6A 2BVBA 4BIFA 5BNNB 3I2GA 3N7MA 1JYXA 5FIXA 1PM4A 1AL0G 3VDBA 4YVWA 1VMHA 2R0FA 3BTAA 1ZA4A 1WLCA 5D8AB 2VMGA 3MFAA 4QDRA 3FHAA 3OBRA 4J1WA 2YPJA 1JU4A 1UPIA 3LEMA 4LBQB 3MI8A 1TZOA 5F6LB 5LEJA 4LJHA 3ECQA 5AC91 2D6OX 1DDLA 3OGSA 5K0UC 2QQPA 4KNCA 4AW7A 3IN9A 5FBZA 1Q8VA 4YVSB 5KHKA 3KVBA 3T0DA 4D7SA 4X8PA 1GSLA 1NQJA 1VR3A 4BE3A 2D98A 3AYEA 4LLOA 5JPNB 4QX2A 5BY5A 3WW4A 1CAUA 4AQTA 2G1MA 2Y0IA 1LOGA 5FYMA 5AVAA 3B00A 5BNNC 4GZ9A 2P34A 2E9QA 4MXWB 1NCRB 1H0BA 2F6BA 3FLPA 3TRSB 4K3UA 5D8AC 2E7QA 4LE4A 3JBG2 5F3CA 5A6QA 3ZXGA 5LRSA 1LHOA 2RS51 5E1RA 4URTA 2WYFA 1NXMA 1AHSA 4FPKA 1YI9A 3PL0A 1NQDA 2VZVA 3H7JA 4LQRA 4BQ2A 4ASKA 4ES8A 2UU8A 3BCWA 2BU9A 2ZXQA 2CGOA 1UX7A 2YB7A 3RZKA 2HWF2 2OPKA 1FPN2 2BW8A 3ALQA 4OHYA 2LROA 4YVSC 1WWYA 3MLJA 1FAYA 3LPFA 4IGOA 2ZZJA 4WM7A 3FWEA 3TEYA 2IXKA 4QX7A 3AP4A 3J9SA 4YVWC 4XBNA 5LY1A 1YFYA 2SBAA 2VTXA 4A42A 4AWDA 5FWEA 3FHIB 4RYDA 1MS3A 2K0GA 2ZGUA 3NJVA 1NCRC 5FY9A 4JRLA 2TNFA 4GA9A 3WNPA 2BUKA 3VKFC 4AG4A 1ZZBA 2DVDA 4LORA 5E6HA 2ZS6B 5D21A 1PZ7A 1VAMA 5AC93 5FZOA 2VMEA 4Q1PA 4CCDA 2VOKA 4NIDA 4QQLA 3FMGA 1W99A 4JDMA 3WHTA 1X8EA 2W52A 1HDKA 4LKFA 1S2KA 3A0KA 4HSLA 4N7UA 2X5IB 1GP4A 1GQPA 2VCCA 2XOMA 3RZHA 1XNCA 4XDPA 2PAEA 3O1SA 2FDHA 2DU1A 3LDBA 3VB9A 3WG4A 1YJLA 4U2AA 1AYM2 4KQ7A 3UT0A 5JXIA 1VB4A 5C9AB 2WZEA 2Y8KA 4E2GA 3CNAA 3FX3A 2H6CA 4XFBA 1AVBA 2AYHA 3EYPA 3NJXA 3WQ1A 4CTEA 2A3WA 2A5ZA 4Q26A 2FDIA 4XOGA 1Y43B 4D0QA 1UZVA 2JKBA 3LDKA 2RDQA 3GBFA 4RHV1 3AX4A 1HRI2 2C1FA 2RR11 4FPOB 5DZEA 2RS53 3UETA 3LPGA 1BZWA 2IFRA 5CADA 1CPMA 1QXJA 2A1XA 5GZDA 3LSEA 2FHRA 4COUA 4WVVA 1EAH2 2YGMA 3D6EA 3EBRA 4MH0E 5FYYA 4F7ZA 1V6LA 4J1XA 1S1AA 3JXSA 4NIAA 1UO9A 1EUTA 4U36A 3WCRA 5JZGB 3GXUA 2X5IC 1GKBA 1SLLA 3N3HA 4GWJA 2UYAA 4LR4A 2YFZA 1Y9QA 4PF5A 4N43A 1CAWB 4XFCA 3AMMA 4FXKB 4LITA 3A21A 2AENA 1JZ8A 4LHKA 4IE6A 5C9AC 1W6OB 3T09A 2DWRA 4O9EA 1E5SA 4HPKB 4AI3A 2CYFA 2X29A 4XFAA 3DPRB 3ZXDA 4DINB 1Y9GA 1JBCA 3E6BA 1OPMA 2D3SA 2TUNA 4AEDB 1W3XA 2V72A 1RVF1 1IPJA 2DCTA 2WC2A 1LGNA 1NA1B 1UXZA 1C8NA 3H1WA 4INDA 5C4WB 1KFXL 4QHZA 3O1RA 2RE9A 5EJ3A 4AHWA 2A71A 2WNUB 1ZZ8A 2ZABA 4XBQA 5FZ0A 5JI7A 3SCFA 3O1TA 4Q8LA 5ABJB 3PTYA 2B8MA 4W6WA 2XUEA 4OHZA 1C1LA 3B7MA 2B4KA 4FTEA 1UKRA 2WLPA 4YM2A 1EYBA 4Q5OA 5CU1A 1B35A 4Y5SA 4QX1A 1QNWA 5E8AA 4H2AA 4M0NA 2BP6A 4HVRA 1HB2A 1W9TA 4TYSA 1FI2A 5IYYA 5C71A 4LUKA 3THDA 4ZXKA 5F32A 2GC2A 1KEXA 4YG3A 2ZX4A 2DTWA 5JI9A 5T52A 3ZM8A 2A3YA 4EWAA 2ZGLA 1REFA 1H4GA 1JZ3A 4RHV3 3POJA 4AEDC 2RR13 1HV0A 1F35A 1FOD1 5FRAA 2ZX0A 1AZDA 3BIEA 3S57A 4JDOA 4YYOA 1HLCA 1NA1C 3RJRA 5C4WC 3EQEA 1JUIA 4AGRA 1FV3A 3CIHA 3MGUA 3QCWA 4XQWA 2WNUC 4Y1XA 3SNMA 4DUVA 4WV8A 3RZGA 1FATA 4P9IA 5ABJC 3H50A 4OI4A 4N53A 2LTNA 4AHYA 1OD5A 1UL9A 2QZ3A 5FMDA 2X05A 4A44A 3IDAA 1AJKA 4G3YC 1RB8G 3VZOA 3TOJA 4AI9A 2P3YA 1MACA 2D3RA 1SLAA 4GIQA 5LASA 4QDQA 1W6NA 3WW1A 5CBLA 3LOBA 4MG2A 5FREA 4AAXA 5H9SA 4DXRA 3RYPA 2RJLA 4PDWA 4DS0A 3JQXA 3I4IA 1RVF3 4YW5A 4PBPA 3NVCA 2DVGA 5K8SA 2HYXA 1OFNA 2C0ZA 3IMMA 4DRVA 1LHVA 4AI1A 1SLIA 2VU9A 2MPFA 3RYRA 1W2AX 2YC2A 5EIYB 5F3IA 2QQIA 3MO4A 2CWSA 5T5LA 4CCKA 1OVPA 3AYDA 4Z07A 4GWIA 4RN5A 3AP7A 3IMNA 1RJ8A 3SITA 5CVRA 1OT5A 5LK7B 4YGCA 3AVSA 5BUVA 1NXD1 4LHSA 1NOVA 5LY2A 3NRUA 3SH3A 2IC1A 2J1SA 2K9ZA 4WBBA 1LTEA 2DVAA 5E88A 5GZGA 3C3VA 2G9GA 3ZMNA 2VBBA 3IAPA 1CIYA 2VUAA 1UIKA 5GJ6A 2JG9B 4LA2A 3W58A 2VZOA 2C6SA 1AJOA 1H1AA 2F17A 1AXKA 5FYBA 5FZFA 2V73A 1DGRA 3JBG1 3T2PA 1R091 1WCUA 3WNNA 3J8F1 3NNJA 4YARA 5IK4A 5JXHA 1VBD2 2WLQA 5SV8A 2IXHA 4LTAA 3GNEA 1ULOA 1ONAA 1I6XA 3I3QA 1FOD3 5FP9A 4KG8A 3ZFFA 1ND3A 1COV1 3PVEA 4XF1A 1OA2A 3OY8B 3WDTA 4IV3B 1FPN1 3DXUA 5FZ7A 3WQ0A 4AEKA 2AEYA 1S4CA 2V09A 2JDAA 4AZZA 1STMA 4RL7A 2W1SA 3VBHB 4BDVB 5T5OA 3HNMA 3BVCA 4LBJA 4CYDA 1DG6A 3ZSJA 1UAIA 4FOWA 2WYSA 1BHGA 3MV11 5J09A 5LBEA 2ZMNA 2D40A 2XBO2 1GUIA 4AFAA 2O8OA 1JYIA 2I2SA 3ES4A 4YNIA 3QH6A 2BVVA 4QDSA 3VD7A 2JG9C 2A7AA 2R1DA 5CKQA 1AR72 3ZSMA 4CXYA 1UCXA 1E5HA 1NE4A 4D8MA 4IE7A 4XDOA 1YFUA 2W9XA 3OG2A 5F5IA 1W6MB 1DLLA 2N7GA 3BALA 4CDXC 3GJAA 4W6YA 1I9RA 4S2GA 3UK9A 4N8MA 1WLDA 4Q29A 3WT3A 2D6KA 3WF0A 4BCUA 5IFTA 1SFPA 1JZ2A 4BYYA 4KBBA 3B9CA 4K9SA 4PIXA 4B3NA 4IV3C 1ENXA 3BU7A 3WF3A 2OX0A 1NCQA 5GZEA 5C3OA 3MIBA 5FYCA 3WQBA 3ZYHA 1H9PA 1AYM1 1PK6B 1UIJA 1ZZ9A 1OUXA 1PMIA 5CFDB 3VBHC 2WNVB 1O4ZA 2VMHA 5HBAA 1I3HA 1GOFA 1ODMA 5F2SA 2VG9A 1UY3A 1N3PA 3S30A 1GU3A 1JXNA 3N7LA 3MYXA 2QUOA 5FP7A 4BZ4A 4DXTA 2ZX1A 3LGRA 4IEZA 4Q8KA 4LHNA 1WLTA 4IUGA 3WNLA 5KBFA 2P3IA 2JKXA 2PQSA 3JBG3 1G8WA 1R093 4CA9A 3J8F3 2W47A 4FT8A 1ASJ2 5LA2A 5FKBA 2D93A 4NHMA 3JQWA 4Q2FA 2BRTA 2IXIA 1GWKA 1L3JA 2I45A 3D0SA 4H7LA 4UI9L 3ACLA 4XJAA 5FZDA 1COV3 1LRHA 2EICA 4L8QA 3LA3A 1FPN3 3U78A 5FDBA 1W0NA 3AKQA 1GZTA 3QH7A 1J83A 4ZU4A 4QXCA 4NHXA 5FZAA 5FR3A 3RVHA 1LJ7A 3AMHA 2A6VA 2RDNA 3VKMA 4WVMA 3R6SA 2YGLA 4DY5A 4M0HA 5FO7B 1SCRA 4NIIA 1YUDA 3U37A 4GKXA 2CSGA 1PK6C 5CFDC 4B4PA 3ZYIB 2WNVC 1A8DA 4NHKA 1GYKA 4Y4RA 4AVSA 4Z2AA 3TEWA 4IE0A 5AVPA 3WDUA 1B09A 1SBFA 3W21A 4OI0A 1DGWA 3L9JT 1RUD2 1UU4A 4GWMA 1DYPA 5A3TA 2J1VA 4NPMA 5KR7A 1L7RA 1UNBA 2ARAA 1JTZX 2ZGPA 3ATGA 5JLVA 1SBDA 1MVEA 1O8SA 5C5UA 4OHVA 1LOBA 3K4AA 2D5FA 5B4NA 5SV5A 1PMHX 2Q5TA 3LA2A 3O7OA 4IGPA 2QQUA 3WD5A 2VZQA 2JDPA 5JXJA 1W9SA 4CZSA 4BM8A 2VZSA 4YZ2A 5D1IA 2CWMA 2D6PA 1DQ0A 4YW6A 5FY7A 1AYM3 3KCCA 1F9KA 1QDCA 3M4FA 3PDQA 5LBFA 3DV8A 3RPQA 3UYJA 3THPA 4N90A 4AFBA 4LT5A 3OUIA 3ZYPA 3I49A 2YBKA 5JMCA 4CXXA 4BB3A 4RQPA 5L7OB 2E63A 4QX5A 2WFPA 1YFWA 1JU3A 3A23A 1PZ8A 4K1YA 1J1LA 5F7UA 1RTVA 2WFF2 2ZJCA 2ZKLA 5KC6A 2AACA 3D5OA 4JKLA 2QQMA 1SBEA 1ND2B 1YHFA 3Q9OA 4NUBA 3RFRA 1ZRIA 2YUEA 2ARBA 5A7PA 1W8WA 1JOPA 5ANNA 1CAVB 4JGZA 5EV7A 3RZZA 2G4IA 4CCJA 1XSRA 4UFLA 3SMHA 4B7KA 2WWSA 3GHMA 4Y1VA 1UW8A 1LHUA 2OYZA 1EY2A 2Q0AA 4PIYA 4TLGA 2CGPA 3H42B 3VV1A 2DYCA 2GZWA 1KS5A 3RI9A 3ZXFA 1ENSA 2JB8A 3WDVA 1WCSA 1QXRA 3DGTA 1ENQA 2B9UA 4FFIA 1UOJA 1GNHA 1NLRA 3RQ0A 4IEVA 4B1MA 1MQTB 3PNAA 4QAWA 4DRRA 3CHXA 5L7OC 4NAMA 4HKOA 1RXFA 3USSA 5C6CA 1QJY2 1JMUB 3U4SA 4HL0A 3P1IA 4XFHA 4AVVA 5A3UA 2A75A 5IK8A 3K4DA 3EXUA 1SPPB 1W9WA 4GH4B 4Y20B 3TNPB 3J4UH 4CCLA 3EB7A 3MICA 1ND2C 3G6JB 4KBZA 5IVEA 3M1HA 1WD3A 4AVTA 3AMPA 2Z42A 3HT2A 3N9PA 4NHYA 4RR3A 5IT6A 4FPJA 4QMAA 3B02A 3NKGA 5FYTA 2E7AA 1JYCA 1K5JA 1U0AA 1PGW2 1PGSA 5BV6A 5DUUA 1IKPA 2WBKA 1CR7A 3F95A 1YJKA 2RS52 4BU2A 5F5AA 5ACA2 1MQTC 3RJ2X 4EZHA 3S5QA 1WKYA 4A7ZA 1F5JA 1OA3A 5FCCA 5LW9A 1RUF2 1YYNA 3I2HA 3WP3A 2Z2SB 4IESA 4XJ9A 2IVJA 5JUVA 2Q30A 4GH4C 4QHBA 5EZWA 4BISA 5DAVA 4CP0A 2XJQA 4CDUA 1P8JA 2WL1A 4Y4YA 1K12A 1ZRDA 2DF7A 4FAGA 2QTWB 4FTSA 2VNGA 4IV1A 5LWBA 1V70A 1JZ4A 2ZZQA 1IPSA 5FUNA 3MW3A 1POQA 2ZHKA 4JGYA 2XBO1 4CP9A 4XFGA 1GZ9A 2VCAA 1TMF2 1W03A 4P5YA 2BEOA 4HONA 3I8TA 2JD4A 4XETA 5JAXA 4CDQB 1D0HA 4MGQA 1DBNA 4FPHA 3JZVA 4FPCA 4HBNA 4AGGA 5KHIA 3KM5A 1AR71 2Q8OA 2UWCA 1SDWA 4FO9A 2PMWB 1N1TA 3KQRA 5A7QA 4B4RA 2NLRA 4F83A 2OQ7A 2VOXA 3PUHA 4UFJA 1ZNPA 1GZWB 2GDFA 5M0TA 1UU5A 5LB6A 5JR2A 4FPEA 3VZMA 3ZN6A 3AK0A 4N7IA 5JSRA 1K5MA 2PHLA 3ILNA 4QPGA 5FPZA 5A32A 3B93A 4IQPA 1O59A 3C7GA 3OBTA 2EXJA 3WV6A 4CDXB 1YCIA 2E6VA 1RMU2 4XIOA 5FZEA 4BXSV 2EA7A 2NP0A 1J3RA 1HB1A 3VBFB 5LA1A 2GMPA 3R05A 4AHXA 4AXOA 1FNYA 3E5XA 5FZGA 2GSYA 4AI8A 5BNOA 3VBSA 4RHV2 2ZGSA 2EXHA 2W94A 4UW4A 5CB7A 1GP6A 2RR12 2W91A 4CDQC 3K51A 3T08A 4D94A 1WBFA 2ID4A 2YG0A 2ZGMA 1ASJ1 1D2QA 1LNSA 5CIRA 5BNPA 5GLVA 1VP6A 1ZX5A 2JDYA 4CCCA 4KG0A 3PMSA 3GZEA 4XYXA 2GP5A 1JZ5A 1HN0A 2VOWA 3M3OA 1BLZA 3VHRA 4YW3A 1UU6A 1ZM1A 1ALYA 3HR9A 3I2IA 4K6BA 2QZ2A 2XQRA 4ISQA 4OCTA 4JAAA 3BTXA 1KJRA 3HJRA 4CU6A 5IVFA 5IK7A 4AFMA 1XE8A 1S0FA 2VR4A 1H2LA 2ZAAA 2R1BA 1RC6A 2CAVA 2VQUA 2WZR2 4HN1A 1X36A 2JDZA 4PLMA 5EJ1B 2XBO3 3POYA 2ZEWA 3IIAA 3VBFC 5H9RA 4DY3A 1RUD1 2NZ9A 3ZYFA 2JG8A 1X8MA 3TNQA 3S7IA 1OF3A 2JDMA 1AR73 2DV9A 4CE8A 2CGNA 3UGHA 1C3HA 1JW6A 1NE6A 1E5IA 1FNZA 3ETPA 4OI1A 4K8RB 1MVQA 1HQWA 5I8SA 3KHCA 5GALA 5I8TA 3WNKA 2HYKA 2HJIA 2XONA 3ZLIA 3ABZA 2WUHA 2C5DA 3ZXAC 1RYYA 4RD7A 4NVPA 1YQ5A 1H8TA 4TXWA 3LSDA 3WOGA 1YRZA 2FMYA 4P02B 3THTA 4QWNA 2W92A 2WZ8A 5FY4A 3WP6A 5BNOC 4JQRA 3O14A 3RWNA 4L2NA 4FPYA 4CVUA 3GZUC 5FPLA 3ZYJB 5J1XA 4S2FA 5I0TA 3CKHA 4C1XA 1QH7A 4FPGA 5E89A 1SEFA 2R7EB 3T4HB 5F9TA 2WFF1 2AC1A 5FZ1A 2WT0A 3T2OA 3E6DA 5FJHA 3KD4A 1ASJ3 1J3QA 3L2YA 5T55A 3H1MA 5DZGA 3RYKA 3ACGA 4XFFA 1G9BA 2DDUA 4AI2A 1XNDA 1TG7A 3POBA 1Q8SA 4UXAA 1VE0A 4M3CE 1WW6A 2W68A 2BTVC 3LQCA 4EV0A 1WUVA 1C8M2 2YXSA 4COWA 4NIHA 4QGMA 1KD7A 4W6XA 4ARXA 4HOOA 4W50A 3AZYA 1G86A 4XMAA 1RUNA 2G9FA 3M3CA 2GH2A 4Q4Y2 2GNBA 4DQAA 3R4DB 5CG9A 4LOSA 4JHTA 3Q8AA 2JG8C 3HBKA 1YXWA 1DF0A 4LO8A 2ZHLA 1RUD3 1QJY1 3CO2A 3NW4A 4ZU7A 2VZPA 2UWAA 1RUG2 2OPWA 5CZKA 1QF3A 3WF2A 3QACA 2YU1A 4A3ZA 1QU0A 1F5FA 2XXZA 1A6CA 3BKZA 4CSWA 5T50A 2DCZA 2VZ3A 2QBXA 1TQ5A 3M3IA 4BMBA 4YPJA 3VD5A 4HK9A 4EN6B 2FDFA 2Q4SA 3WUCA 4P00B 4YVWB 1SLTA 2VY0A 3D82A 3K46A 4PIZA 1KFUL 4BWOA 1ACCA 3ORJA 5L9RA 4OZOA 1C1FA 4YWAA 2VCMA 3MHZA 5DDJ2 4DEQA 1SCSA 3C7EA 1CX4A 3ZDVA 1BCXA 4KGGA 5CFCA 1IKQA 1PGW1 4Y1UA 3AL6A 2JDUA 2ORXA 1R092 1US3A 3J8F2 5JR7B 3JD72 2CDPA 4FI9A 5ACA1 5F37A 4LO5B 4G9SB 4XJZA 3ZMOA 4GMP1 4K40A 4ES9A 3EMRA 1JOBA 2BZDA 5EPAA 1RUF1 1UOFA 2WFF3 5EYYA 2VQTA 4QM9A 1XBFA 1COV2 3WF1A 4C0BA 2D6NA 2WDBA 4Q4V2 5GZFA 3N9QA 1CAUB 1LENA 4B8EA 3CZUA 1XPWA 3NNLA 3L2HA 1ZZ7A 2P1BA 2VMFA 4LUMA 4M4RA 4BLIA 1H8VA 1BXHA 3ZXKA 3ZN4A 4YZ4A 1HXS2 1FX5A 1YIPA 2VZ1A 3I54A 4YFZA 2P3JA 4X6RB 3H1YA 4XF0A 5FXVA 4ARYA 5C3RA 1J84A 4PHZA 1HB3A 1TMF1 1A8MA 3AC0A 3AYCA 4O7XA 1QKQA 4WVZA 5FJKA 4HT1T 3HIFA 5A6ZA 4XHBA 5BXXA 4XAEA 3C2UA 2BOIA 2R0HA 2LW8A 3ZKYA 5C8CA 3OF1A 1W8TA 1QJY3 1OI6A 4RFRB 1UY0A 1WCKA 3AJYA 1OQEA 4GWNA 1QNYA 3NMBA 4MGKE 1JYNA 5G05L 1PHMA 1MZ5A 3ELNA 4WM7B 3BOWA 5FLIA 5F1RA 4MADA 5FYVA 3ZSLA 4FSJA 1GOHA 2W08A 1YQCA 3LFMA 4FQ4A 3OPZA 2OVUA 5DN2A 3NQHA 1PNFA 3V64A 3J7MA 3R4SA 4PLNA 2GN3A 5FK8A 1UOBA 5FXWA 1EPWA 2XHNA 2V4VA 3CU7A 1RMU1 2XMLA 4Z82A 1YO8A 1Q3EA 4UFMA 5FYHA 2CNAA 4LXLA 5FZBA 3VUOA 1RINA 1R082 2GC0A 4ISRA 3UL2A 1LOCA 2GNMA 1SLCA 2P4EA 3UGFA 2DURA 3I2JA 3T1MA 3RZLA 1RL3A 3FBYA 4DO0A 4A4AA 1OFSA 4CXWA 3OEAA 2UYBA 5ACA3 2IXJA 3MW4A 3LA7A 5FXXA 4A7KA 3I2FA 5C70A 5A3WA 4ZHNA 1LCLA 2RMU2 1RUF3 1IS5A 2D44A 2ZA9A 2ZEXA 3AM2A 2PAMA 1UZWA 1OC1A 2JDKA 4JVAA 1I5ZA 5L9VA 5LZ6A 1GZCA 5CYYA 2QFEA 3MW2A 2GH8A 4HKWA 1APNA 5A1LA 1XJAA 3OEBA 4WM7C 5GZCA 1US2A 5CKMA 3OPTA 3H8XA 5DG1A 3GZAA 3IB3A 3M70A 1IS3A 2MEV1 2WJSA 2XGXA 3I59A 4GJZA 2B39A 5D2AA 2BQPA 1GICA 4META 2WZR1 4QD2A 3V56A 3LEKA 1SDDB 1SZBA 5CA6A 3IZOA 3DPRA 5EWSA 3VGIA 1OA4A 1TMF3 5GLTA 4C8DA 4C91A 3SEPA 3C7FA 4LLFA 4P9LA 5IAXA 1H1IA 4QB2A 4N9IA 3BGAA 3WP4A 4QQ2A 5FP8A 2BNNA 5FZCA 4L92A 4OULA 4V2VA 2Y33A 4F8AA 2ETEA 3AKTA 4XDQA 4Z2WA 4HETA 4YZ1A 5FZIA 1QWRA 3DEMA 1AL22 4AF9A 4J6GA 4QX3A 5J37A 4N43B 1UYYA 3MFCA 1QMJA 5DAWA 1U5YA 1J58A 1IG0A 3GJBA 3KLSA 3T3YA 5FYUA 3UJOA 2WNOA 2OS2A 5IATA 1Q8PA 4AQ6A 4JC1A 5T5JA 2YC4A 1XC6A 2VTXJ 2YC0A 3NAPA 1HW5A 1WMXA 4AL9A 5A3PA 1RMU3 4BJ0A 4HVOA 3IPVA 1KDKA 2W3JA 2HWC1 2YMZA 4FPFA 4NROA 1XNTA 2B7YA 3AP9A 1W6PA 3VBRA 3A7QA 4ORFA 5JOWA 1JN2P 2BYVE 1ZA7A 1TNFA 2KM2A 5F39A 3D3AA 4CEWA 3LB9A 3U75A 1CGPA 3HEIA 5C3SA 5LCWL 1JYTA 4DNYA 1LEMA 3MV01 3KMHA 3JUUA 2UY9A 1B35B 1S0DA 1ST8A 1CAXA 1OURA 3PUSA 3ME2A 4IGQA 5CNAA 5C3QA 2PQQA 1TVGA 4N43C 1DHKB 1OLQA 1CWPA 2XJRA 3HQUA 4I3GA 4LK6A 4PBOA 1C8M1 4RGKA 5DAPA 3VKLA 5LEKA 2VMCA 5FO8B 1POV1 4URAA 1UN1A 4KWKA 1CQ9A 4ZPIA 4IEUA 3IDBB 3ACFA 3DKQA 4V2WA 2ENRA 2CHHA 3E1F1 2WZR3 4KWLA 3U10A 2P17A 2W87A 4Q4Y1 5IVVA 1PNGA 1JZ7A 5LBBA 4QPIA 2AREA 4B29A 1ULDA 1O5LA 3TEXA 1LU2A 3UKNA 3WNMA 3AMQA 1MS1A 1V9U1 1OXCA 3PURA 3PU3A 1RUG1 5JVVA 4XVHA 1AR62 2D43A 1UOGA 1UZZA 2FCVA 2DCYA 2KD7A 2O8QA 3KT7A 3AXDA 4D3WA 1S0GA 2AZ5A 4N53B 2WIIB 2Q1FA 1LECA 2C24A 1YQ2A 2ZHMA 1LOAA 3NO8A 2XLFA 4QKFA 1G9CA 1IQDC 2WWJA 4OI2A 1DGWX 5IHRA 2XVLA 1B35C 3WHUA 4NIGA 4BMEA 4MGYE 2BOJA 3JB4C 1WA4A 2WAAA 3LKJA 1W6NB 5DDJ1 4PI2A 5A7WA 2WZPP 1BVVA 2VMIA 3ZXJA 2JJ6A 5FUPA 4I0BA 4PDWB 2HWC3 2GC3A 1CPNA 2VBPA 4L99A 5FYZA 1J59A 2J1AA 1DQ2A 2Y64A 1LAJA 1MZFA 3JD71 5KXBA 1QXPA 2OQ6A 4EN8B 1MS0A 4Y26A 5C7GA 1KGYA 1NZCA 1R1A1 3ST7A 3PUQA 3ZR6A 4KI5M 3RS6A 1GANA 2ADDA 5FY0A 2NN8A 1CZVA 4RS5A 4Q4V1 5FP4A 3LE0A 4NAOA 3X29B 4LNVA 4YM0A 4N53C 3LF7A 4XF3A 2DUOA 1DFQA 1XOYA 3NJZA 5FLJA 1C8M3 2VTFA 4NPRA 5DMYA 4LBQD 5KC5A 1POV3 1N47A 5DQ0A 5FLHA 1HXS1 3VBUA 1NUKA 3ZFGA 1D7PM 1QJX2 1GWLA 3QBQA 2ZTNA 4QXHA 2WINB 4MXVA 1H30A 4QPIC 1X9TA 3OUHA 4Q4Y3 4PDWC 4PCRA 5A3NA 5FP3A 2X10A 5A7SA 1CN1A 1RUH2 3VZLA 1ND3B 2Y0OA 3ZFFB 1RGSA 3A0NA 5I8YA 1V9U3 2EXKA 2Z79A 2XHKA 2ES3A 1RUG3 1K42A 3WQ7A 5HCFA 3DYPA 3U14A 1U5ZA 2XR4A 1D4M1 2Q1MA 2ET7A 5FMBA 2CTVA 4XTMA 4JRAA 3H0OA 1MPXA 4UF0A 3AZZA 3ACHA 2YROA 4Q27A 1RUOA 3FZ3A 4OLLA 1O4TA 1RUI1 3PLQA 1Y7BA 4LMFA 5A6XA 5JOYA 5B4XA 1VB2A 2ILMA 2LALA 5DDJ3 4D6RA 2B9VA 3V0BA 2YZ4A 1R081 4EROA 5ANQA 4LBMA 4IEXA 3EJKA 3KF3A 3TBDA 4QU1A 1JYWA 2EIDA 4OQ8A 3JD73 4ASMB 2C9AA 3VD4A 3BYWA 3KV9A 4R4XA 1R1A3 1AX2A 1ND3C 1WW4A 5FZ3A 4XEZA 2Y6JA 5JIAA 2RMU1 3ZFFC 3CJIA 4AFCA 2ZGTA 3T2QA 2D7FA 3APBA 4D7YA 1UY1A 1NCQB 2BV4A 1NZIA 4OZXA 3VHNA 5BNQA 5KXCA 4Q4V3 3MIDA 2YDEA 3ETQA 1AX0A 4UAPA 5FBJA 1ZRRA 1LODA 1VBB2 1MEC2 5FUIA 5L9BA 1RUC2 1CIWA 1XYPA 3VDDA 2JECA 1HRV2 2V5YA 4FFGA 3WNOA 2J7MA 4RA0A 3NV2A 3POFA 4F3JA 1V00A 3KCXA 4OVEA 4R52A 4DUXA 3W5NA 3VDCA 2JB4A 2PA7A 1ODNA 4OYUA 1HXS3 4M3CF 3ZR5A 1RXGA 1TEIA 4MHUA 1POV0 4GALA 3RZMA 2GU9A 3FE5A 3AMNA 4YSFA 2AR6A 2WABA 4L0PA 5FXZA 4EWEA 4HKLA 1H1MA 3AP6A 4KU7A 4CDWA 2OZJA 4DXSA 3WG3A 1OLMA 4JZRA 1ZBE2 2EIEA 4LO4B 4YGBA 4CUAA 2OA2A 3ZPOA 4P08A 1UWWA 2XUMA 3OOXA 1GR3A 4K7JA 5FPXA 2FDGA 2ARXA 3I2OA 1AL21 3IAQA 5JCTA 1D4M3 3FHQA 1SLBA 2WA4A 4IEYA 1NCQC 4SBVA 4WVMB 5A70A 2Y34A 2O1QA 2GALA 4MHRA 1F31A 3ILRA 2E7TA 4XQ4A 1E5RA 2EAKA 1Z78A 2PAKA 1X33A 3BIWE 5FZ8A 2DU0A 4FXGB 4NJ4A 4XCBA 4YRDA 3OB8A 5J96B 1RUI3 3WCSA 4GD4A 1OUSA 4JHZA 3V0AA 3O0VA 4D6SA 5FWJA 1C5IA 4JKMA 3CEWA 4QKNA 3T2TA 1R083 2L9LA 5FOJB 4XF9A 3CZJA 2ZMLA 2QQVA 4GAZA 5E16A 1H2MA 4ZS3A 1LEDA 1FXZA 3D4KA 4LPLA 5FZHA 4CEYA 2RMU3 2OZ6A 4NO4A 5KWRA 4K21A 2PFWA 2DBIA 3WR0A 4BH9A 1CAVA 3MIFA 3PVOA 5A80A 1JZ6A 1G9DA 4RSUA 2XJVA 1UYZA 3VN4A 5JDBA 1IQAA 3WNXA 4YW1A 1A78A 2J1EA 4WM8A 5GLWA 2OKXA 3A22A 4AFDA 4Q1RA 4RQPB 1GV9A 3N9NA 3ZPYA 2E53A 3AFKA 3POSA 4P14A 5A1FA 5KXEA 2D6MA 1OOPA 2R6QA 1QOOA 4NMIA 3VBOA 1UPSA 3C7OA 5HI0A 4LBLA 1PVC2 3LCPA 1XE0A 4KU8A 4OUMA 4AE2A 2VECA 4A41A 1WD4A 3J26N 4X6QB 1REEA 2MHFA 1FV2A 2RV9A 3FC0A 3OTFA 4G4FA 2E26A 5BYNA 1EP0A 4Y20A 1A3KA 1AR61 1SFYA 1IG3A 5A7NA 4JGZB 4AGVA 2RJKA 1WW7A 4N9HA 3MPPG 5I0SA 3OYWA 3E5QA 5FZ4A 2VD7A 1O3RA 1AL23 3DL3A 4CP1A 4IETA 1XB9A 1YLLA 4OHWA 2H0BA 4B1LA 3KVAA 2R16A 5KHJA 3RZJA 1C4RA 3ZIXA 4MGIE 3WDYA 2ZMKA 3CMGA 3CQOA 1BQPA 4QXKA 5FK7A 4AI0A 4RQPC 2P6HA 2EVXA 3I97A 3SCGA 3CJXA 3USUA 2J1RA 4OMCA 4Z92B 1LR5A 2BBVA 5FFOC 1LU1A 4IEWA 4BIOA 4LKEA 3OUJA 1AR92 2P6CA 1AUYA 3NV4A 4MLOA 4Y22A 2OUHA 2VL4A 3LIHA 1DP0A 1UX6A 1XE7A 3AKSA 4M4PA 3MZHA 1UMZA 5A3MA 4QU2A 2ZHNA 4XQDA 2OIIA 1N1SA 1AR81 4BOWA 1LB2A 4XJWA 3Q8FA 4QGLA 2FCTA 3WW2A 1MS4A 5FYSA 2UY8A 3VL8A 2RJ2A 4JTOA 3ZN5A 4JGZC 2RVAA 3FLTA 5IFPA 1W8FA 2YPDA 3BPSA 4X8NA 3PTRB 1ULEA 4DB5A 4RR3B 2R062 1DLCA 1ZVFA 3DUIA 3ZFEA 4UBHA 1J1TA 2HBTA 4A6SA 3RMXA 3ZVXA 1QJX1 1QY4A 1VLNA 2WAOA 3H7YA 3UV9A 3WEZA 4ET7A 4E4HA 4HVQA 4LK7A 4M3CA 2YHJA 3F2ZA 5K4LA 2BDRA 3POIA 2FD8A 1RUH1 1ZRFA 4C0HA 4QKDA 4E4SA 4COVA 4UW3A 2FDKA 1UF2C 2DCKA 5I0RA 1QGLA 2ZX2A 1AR63 4FVVA 4ZXEA 1BEV2 1HB4A 1QEXA 1W6QA 2NMNA 3UGGA 1Y9MA 1YFXA 4A2UA 4BQ1A 4QHOA 4CDUB 3FL7A 2C9KA 2DUQA 1F15A 4Q4X1 5C5TA 2EIBA 3POEA 3DCQA 4IV1B 4XTPA 1SQ4A 1W9YA 3VZKA 3J7NA 1ZYBA 4XC9A 1LOFA 4JGYB 3ZKUA 4CP9B 4RR3C 1VMFA 1G6NA 1NAEA 2WQZC 3TN92 4D6QA 4QX0A 5DABA 4XAAA 5J36A 2GMMA 1X50A 4TSVA 5J48A 1RJ7A 1ZREA 2QJVA 1PGL2 2W46A 3AZVA 1BKZA 2CAUA 3D0JA 2A6XA 3GCXA 5FZLA 2QE3A 4EN0A 4MZUA 4I0WB 4GQ7A 1XXNA 4EQVA 3WDWA 2RHPA 3TAYA 5A3OA 4TN7A 3SH4A 1OD3A 4LO6B 4AOCA 4LE3A 4XACA 4DOUA 1TME2 2EF6A 1UMHA 1AXZA 3D8CA 1AR83 4DEVA 4DPNA 3ZN6B 3ZXLA 1K5MB 1S0IA 4QPGB 5A32B 2VVDA 4OQ9A 5DG2A 4KL1A 1AF9A 4EN9B 4Y1ZA 2J42A 1PIV2 1UQXA 2LS6A 5JOXA 4CDUC 2QQNA 3KGLA 3ZSEA 2FZ1A 1VBB1 1MEC1 4XHXA 5J3UA 1RUC1 3WLUA 4IV1C 1HRV1 2JE8A 2MEV2 4H3WA 5GKAC 5BNOB 1M06G 3ZDSA 3VBSB 4JGYC 3BUCA 2ZAHA 2A6YA 3VZNA 3C8XA 1X9PA 2JENA 5A33A 3I3EA 2VC9A 4KMQA 1QJX3 1KRIA 2XJPA 3HBZA 2DFCA 3WUDA 5LA9A 3GGLA 5BNPB 3O1VA 4NRMA 1RUH3 1QHDA 4E4DX 1ZBE1 2QKDA 4XFIA 4P9YA 4FP2A 1BBT2 4QPWA 3GM8A 2IXLA 2EAAA 2XL9A 2HLEA 3SEEA 2Y6HA 4UWDA 1C28A 4FQZA 5F3GA 4EWDA 1K5MC 4QPGC 3POWA 5FQ0A 4Q4X3 3M2MA 2ZGRA 5F5QA 1CZTA 4CCNA 1W8NA 2WSUA 1UY4A 4FPLA 2VW1A 4IL7A 1PMJX 3JU9A 3CF6E 1HN1A 1KS4A 1UYPA 2BNOA 1K45A 1OHFA 1O3QA 5HXMA 1PX4A 4E2SA 4XCAA 2HWC2 3U11A 1GLHA 2YBSA 2DBNA 3VBSC 2JG8B 1V6NA 3I3DA 3T0AA 4CPBD 5K0UA 2BERA 4R9DA 5A1AA 4FTBA 2BFUS 1W2OA 3BN6A 4YM3A 4UW5A 2G9ZA 2JIJA 1XNBA 5BNPC 2P37A 5K7PA 1RUJ2 1WZXA 3GCWA 1V6JA 1H6XA 3Q8CA 2R072 4ZY9A 3IM0A 4CP2A 3AYAA 4XUOA 5ERLA 1R1ZA 2XVKA 3MEPA 3N9LA 3O1MA 2BPA2 5GM0A 1H8TB 2PHUA 4CU7A 4JX0A 2A70A 1DGLA 1OLRA 3N7KA 4UW6A 5IVYA 3VD9A 4P9GA 3S6PA 5BNNA 4LOTA 2BWAA 1VBB3 1MEC3 3WZ1A 1RUC3 3NV3A 1G9AA 1OBNA 1EPZA 1HRV3 4UFHA 1KDMA 3LEGA 3LWCA 2PHDA 1IOAA 2HWD1 5D8AA 3WX5A 4WVWA 1DYOA 4QB1A 4LBQA 3VL9A 1PVC1 3BPZA 1MS8A 4Q0UA 1W05A 2QCSB 3CLPA 2Y6LA 3KSCA 2XVGA 4LO7A 1UD1A 1V9U2 2PHRA 2JE7A 4E9KA 3H8UA 3O12A 1D4VB 4YVSA 4NOTA 1ZBE3 1RHI2 2GAUA 5APAA 4Q0SA 4TLFA 3ENRA 3FFQA 1DQ5A 1XNKA 4M01A 2VO5A 2R042 1YQ8A 1MR5A 1H8TC 2JEMA 4FOVA 1FMD2 4AQ2A 4LHLA 2HEVF 1CZSA 2YU2A 2QQJA 4MXWA 4YLZA 5F2WA 1NCRA 1HJGA 3N35A 2LM3A 4TTGA 2WS91 4Q4W2 4NN0A 3H8RA 2XB6C 1CX1A 3PIJA 5FO9B 2D3PA 1NYWA 1U12A 2WNEA 3V65A 4JTNA 2IVIB 1JODA 5H9QA 2Y26A 2H0VA 2V5DA 1UYXA 3T1LA 4AVBA 4IE4A 2VNOA 3MBWA 4BHPA 1AR91 4NWVA 1LGCA 3LAGA 4QQPA 4J25A 1R1A2 1RITA 3SCHA 1W0PA 2VUCA 2W2IA 2KR2A 5A3LA 1HV1A 2I07B 5KHGA 3FN9A 1X82A 1N1VA 2GP3A 1FYUA 2SLIA 3Q8BA 4XIKA 2TEPA 1VRBA 3MIHA 1MS9A 3AZXA 1DIWA 2R061
chains in the Genus database with same CATH topology
5LBBA 5C5UA 5L9BA 5IAXA 3W20A 3NNJA 4UWDA 3OUJA 5EP9A 2FCVA 3KT7A 5LBFA 4MHUA 2FCTA 5LATA 3OUIA 4XCAA 2G1MA 5EQUA 5M0TA 5LB6A 5L9VA 4JZRA 3BVCA 4NHLA 4IW3A 2JIJA 5LBEA 2HBTA 5DAQA 2OPWA 3PL0A 2Y34A 5ERLA 4MHRA 4Q5OA 4Y5SA 3OBZA 4Y5TA 4XCBA 3GJAA 3NNMA 4NAOA 4BQXA 5L9RA 3GZEA 2G19A 5C5TA 3KT1A 2Y33A 2RDRA 5LBCA 4XC9A 5HV0A 5A3UA 4ZONA 5DAWA 4XAAA 5IAVA 3GJBA 3MGUA 3OUHA 3EMRA 5IATA 5EPAA 2HBUA 3HQRA 4KBZA 4XACA 2FCUA 4NHMA 3NNLA 4NMIA 4NHYA 5LASA 4BQYA 2RG4A 3ITQA 3NNFA 2JIGA 2V4AA 4NHXA 5HV4A 4BQWA 2RDNA 4J25A 4NHKA 2RDQA 4XABA 5DAXA 3HQUA 5DAPA 2RDSA 3W21A 3KT4A 2A1XA 5DAVA 5LA9A 4ZPIA 3DKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LBB A;  5C5U A;  5L9B A;  5IAX A;  3W20 A;  3NNJ A;  4UWD A;  3OUJ A;  5EP9 A;  2FCV A;  3KT7 A;  5LBF A;  4MHU A;  2FCT A;  5LAT A;  3OUI A;  4XCA A;  2G1M A;  5EQU A;  5M0T A;  5LB6 A;  5L9V A;  4JZR A;  3BVC A;  4NHL A;  4IW3 A;  2JIJ A;  5LBE A;  2HBT A;  5DAQ A;  2OPW A;  3PL0 A;  2Y34 A;  5ERL A;  4MHR A;  4Q5O A;  4Y5S A;  3OBZ A;  4Y5T A;  4XCB A;  3GJA A;  3NNM A;  4NAO A;  4BQX A;  5L9R A;  3GZE A;  2G19 A;  5C5T A;  3KT1 A;  2Y33 A;  2RDR A;  5LBC A;  4XC9 A;  5HV0 A;  5A3U A;  4ZON A;  5DAW A;  4XAA A;  5IAV A;  3GJB A;  3MGU A;  3OUH A;  3EMR A;  5IAT A;  5EPA A;  2HBU A;  3HQR A;  4KBZ A;  4XAC A;  2FCU A;  4NHM A;  3NNL A;  4NMI A;  4NHY A;  5LAS A;  4BQY A;  2RG4 A;  3ITQ A;  3NNF A;  2JIG A;  2V4A A;  4NHX A;  5HV4 A;  4BQW A;  2RDN A;  4J25 A;  4NHK A;  2RDQ A;  4XAB A;  5DAX A;  3HQU A;  5DAP A;  2RDS A;  3W21 A;  3KT4 A;  2A1X A;  5DAV A;  5LA9 A;  4ZPI A;  3DKQ A; 
#chains in the Genus database with same CATH topology
 3PME A;  1GBG A;  3WG1 A;  1UMI A;  1Q43 A;  1DU3 D;  1XQN A;  5CFC B;  3LOI A;  3WSO A;  4IEQ A;  2C26 A;  2HWD 3;  2VVE A;  1TE1 B;  3PVN A;  2Q8D A;  3W20 A;  1Z7S 1;  4AYU A;  2NPI A;  2XH6 A;  1MS5 A;  2Y6G A;  2EXI A;  1PVC 3;  2JWP A;  5HXV A;  3WW3 A;  4XUT A;  5H9P A;  1L7Q A;  4LA3 A;  1RED A;  5GLZ A;  3KWV A;  4LBK A;  5HCH A;  2BWC A;  3WF4 A;  2A73 B;  2F4L A;  2VE1 A;  1BEV 1;  2X5I A;  1D4M 2;  1JOJ A;  4FAH A;  4C1W A;  1UZY A;  3QOP A;  3B3Q E;  3N36 A;  4W8J A;  3S5A A;  4KWJ A;  1VAK A;  3GYD A;  1RUE 1;  1W8O A;  2OW4 A;  4L9B A;  4PI0 A;  3WY6 A;  5C9A A;  3HPN A;  5IWF A;  1RIR A;  4ZU5 A;  4DFS A;  3VHP A;  1RUI 2;  1V6O A;  1VAL A;  2Y60 A;  1HJF A;  2ATF A;  3PHM A;  1F4A A;  1ULG A;  3TN9 1;  2TBV A;  3TYJ A;  5CFC C;  1VBE 1;  2WS9 3;  4YZ5 A;  4QM8 A;  3J7H A;  1PGL 1;  5C8C B;  1DQ4 A;  3W59 A;  5FZO B;  3ROU A;  2K46 A;  3MLL A;  4XXA A;  4YW4 A;  2UUR A;  5FMO S;  3HD8 B;  3NNM A;  1AR9 3;  3SC7 X;  4SLI A;  4AEM A;  4CUG A;  4GMP 3;  2Y6F A;  1TME 1;  5F5C A;  4CUB A;  4E27 A;  1OQ1 A;  1YI7 A;  3HVD A;  2HWE 1;  4XMI A;  3B01 A;  3HMY A;  3H3Z A;  3OSD A;  2XWB B;  3B69 A;  2EIG A;  4FFH A;  3S7E A;  5JZG A;  3HT1 A;  5HV0 A;  1H4H A;  3IT8 A;  1PIV 1;  3K3N A;  3VKO A;  2QDR A;  1EUU A;  2ZOE B;  3RNS A;  2W1U A;  1CAW A;  1QQP 2;  2XKP A;  2RS3 2;  5BPX A;  1A34 A;  1YQ6 A;  2R06 3;  3W9A A;  1PO2 2;  1VBC 2;  1N3Q A;  2B42 B;  3AJZ A;  3SKJ E;  4LEJ A;  2WA3 A;  5FPA A;  3FUO A;  1W2N A;  1W6O A;  5I91 A;  1W3V A;  1OKO A;  1QJZ A;  4HPK A;  4OUS A;  1Z7S 3;  3HOB A;  2YFU A;  5FPV A;  4AED A;  2E32 A;  3UJQ A;  5C8C C;  1WLW A;  1ZRC A;  1S0J A;  4CU8 A;  1NA1 A;  3AXE A;  3DYM A;  1BK1 A;  1V6I A;  1WW5 A;  3BOD A;  4OHX A;  5C4W A;  2VZT A;  3N7J A;  1W28 A;  1YNA A;  4OUE A;  5FY8 A;  1YWK A;  2WNU A;  2XJU A;  2ADE A;  5TSW A;  1BBT 1;  1ENR A;  2J1T A;  3O1U A;  3VLB B;  5ABJ A;  2ZBJ A;  2EAL A;  1BEV 3;  3WVJ A;  5DUV A;  5KXD A;  1IGO A;  2QDN A;  4YW7 A;  3I59 B;  4L11 A;  2XWJ B;  3U07 A;  4BK4 A;  1H2K A;  3W5M A;  1GNY A;  4KWU A;  5EYX A;  2VUD A;  2F4P A;  3ASI A;  4IER A;  2JXA A;  1RUE 3;  4COY A;  4XAB A;  3JB8 A;  1BK0 A;  5J7M A;  4W65 A;  3TN9 3;  3KT4 A;  4WZC A;  5AFE A;  2IWG B;  3EO6 A;  5GLU A;  1VBE 3;  5LRR A;  3ZX7 A;  5JSO A;  5K9Y A;  1X7N A;  1XSQ A;  2E31 A;  1EV1 2;  3H3U A;  2VZU A;  2QQL A;  2XPJ A;  2HWB 2;  1GQH A;  1HQL A;  2HH9 A;  1AYN 2;  1RUJ 1;  3MPB A;  4TZD A;  1TME 3;  3PJY A;  3MIE A;  2R07 1;  3I3B A;  4Y5Z 0;  5JZG C;  2HWE 3;  3FJS A;  4XUQ A;  4GMP 0;  4XUR A;  5EXO A;  4EJR A;  4FOY A;  1C5H A;  2BNM A;  5FZK A;  2J1U A;  3I2K A;  4HZF A;  2ZCW A;  3NAP B;  4XJ8 A;  1PIV 3;  5A7O A;  4YFW A;  1U5I A;  3N9M A;  1MZE A;  2GN7 A;  3IPV B;  2E33 A;  5HCA A;  1S0E A;  3BB6 A;  1QJE A;  4QXB A;  2MEV 3;  4JV4 A;  1DYK A;  3SHR A;  1W6P B;  5F8P A;  3ES1 A;  3VBR B;  4HLT A;  3DF0 A;  3DPR C;  1PO1 2;  3GF6 A;  3ACI A;  4Y1Y A;  3ZYG A;  3UNP A;  4ZS2 A;  1CES A;  1XNA A;  3S0M A;  1VBA 2;  2FMD A;  2D5H A;  4CEW B;  2RM2 2;  2YV8 A;  4CU9 A;  3IDC B;  1PVX A;  2IZW A;  4I30 A;  4YG6 A;  4MGT A;  1LHN A;  1XRU A;  3RI8 A;  1CAX B;  1RHI 1;  1S2E A;  3III A;  1BBT 3;  3GAL A;  3HQX A;  2VM9 A;  3MDP A;  3OGV A;  2XJT A;  5JWP A;  1JH5 A;  3SKV A;  4Y3O A;  2R04 1;  1VRH 2;  3OGJ A;  4K20 A;  5C8W A;  5FMC A;  2HEY F;  2PHW A;  3QD6 A;  1ZBA 2;  1ULC A;  2R49 A;  4GB3 2;  1FMD 1;  3NAP C;  3ZYR A;  1T6G C;  1T2X A;  1ULP A;  5L36 A;  5B2G B;  1DZT A;  1QJF A;  2WQ8 A;  1DQ1 A;  2RDR A;  2QNK A;  1VAV A;  4Q4W 1;  4QPI B;  1CD3 G;  2JG9 A;  1YEW A;  2B46 X;  2XLG A;  1VIW B;  1WCQ A;  3CL1 A;  3LDR A;  3VBR C;  1LES A;  2AUY A;  4UBG A;  2BJS A;  2Z4F A;  3K75 B;  4ZON A;  1YC6 1;  4P9J A;  3SXW A;  1XYO A;  1W0O A;  2MNG A;  3CBN A;  3R0R A;  1C57 A;  1M4W A;  5FV3 A;  1S0B A;  3LEI A;  4CEW C;  4K1Z A;  1AR8 2;  1O5U A;  1W2T A;  1RUJ 3;  3KHB A;  2I74 A;  2A6Z A;  3OY8 A;  4M00 A;  3DXT A;  4IV3 A;  4XUP A;  1HX6 A;  2R07 3;  5DUW A;  3RWK X;  3E97 A;  1Q5O A;  2WO3 A;  4AEJ A;  3EHK A;  3VBH A;  3AVR A;  2RG4 A;  4QT6 A;  4GKY A;  2PEL A;  5A7W B;  1OSG A;  2Y38 A;  5I0D A;  3KQ4 B;  1QIQ A;  3HNY M;  2JIG A;  3M3E A;  3OD4 A;  3T0B A;  2ZAC A;  2XG3 A;  4JDN A;  1O6U A;  4B7E A;  4ZKT B;  5C33 A;  2HKX A;  1WBL A;  4HN0 A;  1VMJ A;  1W8U A;  4DUW A;  5CAZ A;  2X09 A;  4A7Y A;  4YGE A;  4PQ9 A;  3WDX A;  2BGC A;  4HSJ A;  4COZ A;  3URF A;  2VW0 A;  4FP3 A;  2D97 A;  1O3T A;  4P9W A;  4E8C A;  1YIF A;  2HWF 1;  3ILF A;  2P3K A;  5DAX A;  3KB5 A;  5FKC A;  1IHM A;  3RGB A;  1W6M A;  3MUZ 1;  1L7L A;  3IBM A;  4H55 A;  4RS5 B;  4E8D A;  5FOB B;  1LKN A;  4P5H A;  4IDZ A;  1QOS A;  1F8V A;  1SHW B;  1RHI 3;  4NPL A;  2WWU A;  3AP5 A;  4MVT A;  2WO2 A;  2IXC A;  2WN3 A;  4Q4X 2;  4ASL A;  4FBF A;  1BMV 2;  4XJU A;  2VUL A;  4BPZ A;  3MLK A;  1DGR N;  4QGN A;  3T30 A;  4NE9 A;  3VBU B;  2R04 3;  3ZFG B;  1UKG A;  1PK6 A;  3ZYB A;  4Z8B A;  1F2N A;  5CFD A;  3ZSK A;  2VUJ A;  1OF4 A;  2WNV A;  5IVC A;  1FMD 3;  4WZF A;  1HIX A;  2Q1Z B;  2RS1 2;  5KHH A;  4A45 A;  4LIV A;  3FLR A;  1NY7 2;  5IW0 A;  4Q4W 3;  2AEZ A;  2JDH A;  4LKD A;  3GBG A;  3K77 A;  3KV4 A;  4YZ3 A;  2Q8E A;  4BK5 A;  4DIQ A;  4FOQ A;  1O8P A;  2OUJ A;  3K4Z A;  3P5B A;  3O1P A;  4HMZ A;  5IK5 A;  2KXL A;  3AL5 A;  3T4V A;  4CPB A;  1SFN A;  3KS7 A;  1VPH A;  2JD9 A;  2E51 A;  2DCJ A;  1GQG A;  2BGO A;  2O14 A;  4RS5 C;  1LHW A;  4I3P A;  2UWB A;  1KJL A;  4UF0 B;  3I7D A;  3OD0 A;  4BQ5 A;  1WMF A;  4CRQ A;  2NMO A;  2R32 A;  3IKW A;  4XF4 A;  1JHJ A;  2XQX A;  3OBA A;  4XBL A;  2CU5 A;  1H9W A;  1QQP 1;  3AKR A;  4XE9 A;  1OVS A;  1OQD A;  2RS3 1;  2WN2 A;  2XL7 A;  2W5F A;  4OMD A;  1GOG A;  1PO2 1;  1VBC 1;  1XYN A;  3VBU C;  3ZFG C;  2BFU L;  3V0B B;  3OBZ A;  4LKS A;  3GZT B;  1GNZ A;  3ZIW A;  4Y5T A;  3DYO A;  4EZ4 A;  1HRI 1;  1WMD A;  1ZZC A;  2WT1 A;  3B94 A;  4CCE A;  4AAP A;  1QJU 2;  1FT9 A;  2D6L X;  2PHT A;  4XW3 A;  2VXR A;  3OGG A;  1JYV A;  3KV5 A;  2PLV 2;  4BQX A;  1I1E A;  3THC A;  4O9G A;  4LBN A;  3WP5 A;  1EAH 1;  1GP5 A;  3CJI B;  3NNG A;  2WR9 A;  3RDI A;  3SIS A;  2HWF 3;  3R4U A;  3O0W A;  3P3N A;  4BA6 A;  3ZXE A;  2WKK A;  4FCA A;  3VDD B;  1UXX X;  2XDV A;  3M8L A;  1IS6 A;  4QQH A;  4BLJ A;  3AFG A;  2VNR A;  2VMD A;  4NRQ A;  4QKB A;  1IZ3 A;  4MUV A;  1O7F A;  3PU8 A;  4PJY A;  2HBU A;  2FQP A;  3QLQ A;  5IJR A;  3K3O A;  4KH9 A;  4MX3 A;  2VAU A;  2A6W A;  1OH4 A;  3PIG A;  1W06 A;  2DFB A;  4HFS A;  5L7O A;  1N3O A;  4HK8 A;  5G04 L;  4JKK A;  3POG A;  3TEZ A;  1W04 A;  2FCU A;  4CDW B;  5L73 A;  2VNV A;  4HAN A;  5JMO A;  2W1W A;  4ATE A;  4BQY A;  1EV1 1;  4I09 A;  5J98 B;  4RGA A;  1J3P A;  4ZZ5 A;  2R30 A;  2QVS B;  4IEO A;  1Q8Q A;  4O61 A;  1QOT A;  3K2O A;  2HWB 1;  3CDZ B;  2QQO A;  3B5L B;  3RRD A;  1AYN 1;  3IDE A;  4Y33 A;  1IS4 A;  2ORZ A;  3CJI C;  2LRP A;  4MO3 M;  1W90 A;  1GFF 2;  1ND2 A;  4QB6 A;  4D69 A;  3U1X A;  5F6K A;  4KGQ A;  5FZ6 A;  3HN3 A;  2NM1 A;  3MUY 1;  5A6Y A;  3AKP A;  3G7D A;  3I2D A;  1LUL A;  3INA A;  2VVF A;  2VBD A;  3KV6 A;  2JE9 A;  5T3N A;  3DEC A;  1BVP 1;  5LK5 A;  3VDD C;  3ZO0 B;  3HAG A;  2RDS A;  1U5X A;  1SG3 A;  4HXC A;  1JHN A;  1QQP 3;  2ZGN A;  3V0A B;  2RS3 3;  1PO2 3;  1VBC 3;  2HWD 2;  3P3P A;  1W8H A;  1Y3T A;  3MF6 A;  4QPY A;  4YGD A;  1OH3 A;  1PO1 1;  1HRI 3;  1NKG A;  1QDO A;  2Q8C A;  3VDA A;  1IPK A;  3M3Q A;  3N9O A;  1MQT A;  1WCD J;  1W2U A;  2VQ0 A;  5FPB A;  3PJQ A;  1VBA 1;  2ZEZ A;  1DZQ A;  3ZOI A;  1W8Z A;  4CDW C;  3OPW A;  2GND A;  2PHX A;  3OJB A;  2FDJ A;  5CG8 A;  4UYB A;  3DKW A;  2RM2 1;  1D2S A;  2PYT A;  3KZ4 C;  1EAH 3;  4CEY B;  1DCS A;  1SPP A;  5T5P A;  2PHF A;  3UKT A;  5EP9 A;  4GH4 A;  4OFG A;  1JS9 A;  3E6C C;  2C4X A;  2YBP A;  3H9A A;  1UY2 A;  4UFI A;  3RG0 A;  4WM8 B;  3FFZ A;  5LAT A;  3SLI A;  2Z5W A;  5DUX A;  4AK3 A;  1VRH 1;  1S0C A;  1Y4W A;  2GNT A;  5CIS A;  1G7Y A;  2VGD A;  5EQU A;  4XIL A;  5FPU A;  1OOP B;  4AQS A;  1ZBA 1;  5LA0 A;  4GB3 1;  1O3S A;  2JX9 A;  4JCK A;  4JQT A;  3VBO B;  2K2S A;  3GBW A;  1V6M A;  3NST A;  4BQ4 A;  4ITC A;  2WS9 2;  5CKN A;  3VHO A;  5AC9 2;  3GDB A;  1NLQ A;  3J7L A;  5L19 A;  2VPV A;  1SAC A;  5DXD A;  2JDN A;  2P2K A;  3WG2 A;  1EV1 3;  4I2O A;  1WGP A;  4CCM A;  3OYW B;  3H3L A;  4YG0 A;  4EN7 B;  1SMV A;  2HWB 3;  5I93 A;  4CEY C;  1AYN 3;  5EJZ B;  4YM1 A;  2XLA A;  1QH6 A;  1AXY A;  2VQA A;  2WO7 A;  4ONU A;  4D7T A;  3BU0 A;  4I02 A;  4R4Z A;  3VKN A;  4DMI A;  2CL2 A;  2XKO A;  2DTY A;  1DZR A;  2WSV A;  4IXL A;  4RFT 0;  1CJD A;  1JUH A;  1Q8O A;  2WQ4 A;  4WM8 C;  3IWZ A;  2G19 A;  3KT1 A;  3O5S A;  3C7H A;  3UES A;  3WXP A;  4FFF A;  3USU B;  3KCY A;  3GHN A;  1OOP C;  3A4U A;  3ON7 A;  4LBO A;  4A6O A;  5FMO L;  1LGB A;  4EYU A;  3VBO C;  1VBD 1;  3NV1 A;  1Z7S 2;  4Q0V A;  4Y22 B;  2X53 S;  4V1P A;  4CDQ A;  1O4Y A;  2FZ2 A;  1PO1 3;  2DVB A;  5DPN A;  1NG0 A;  2X8K A;  1Z0H A;  1VBA 3;  1CVN A;  1H6Y A;  2J22 A;  4MSV A;  4XUN A;  2OT7 A;  5C3P A;  2NQY A;  2YY1 A;  2RM2 3;  2A3X A;  3KF5 A;  3MF9 A;  1G9F A;  1NLS A;  2QQW A;  2ZX3 A;  2HEW F;  4IEP A;  3SH5 A;  4HG6 B;  1V6K A;  3KGZ A;  1GZW A;  4W4Z A;  3OCP A;  2JIC A;  1VJ2 A;  4XXP A;  2BBA A;  1OPO A;  4MGS A;  2FBE A;  3ITQ A;  3TWI A;  1OLM E;  5JIU A;  3ZFE B;  1BMV 1;  2ET1 A;  2ZGO A;  3NNF A;  2W95 A;  1I5P A;  2AH2 A;  1RUE 2;  1ULF A;  1VRH 3;  2VOV A;  5FY5 A;  4CDX A;  1JI6 A;  4ZZ8 A;  5HV4 A;  1ZBA 3;  4GB3 3;  2WT2 A;  3P6B A;  2H6B A;  3VBF A;  2RS1 1;  4M3C B;  4YW2 A;  2Z69 A;  1CJP A;  1E57 A;  1NY7 1;  2DVF A;  1VBE 2;  5FTT C;  5JPM B;  5IVB A;  1MZ6 A;  2W1Q A;  4E2Q A;  1H2N A;  4MGZ E;  4NWW A;  2P5B A;  2GME A;  1XU1 A;  1W9F A;  3PVB B;  3HWJ A;  2PTM A;  4NR1 A;  2B45 X;  1V0A A;  2ERF A;  5IVJ A;  2QQK A;  2YYO A;  1W6Q B;  5AFB A;  4I01 A;  1ZZ6 A;  1NX9 A;  4PT6 A;  2ZGK A;  2ARC A;  4BQ3 A;  2HWE 2;  3LFI A;  4P9X A;  4GJY A;  2ZPX A;  5F3E A;  4L97 A;  4BXF A;  3FUQ A;  2LUW A;  2GC1 A;  4K8F A;  4LUL A;  5DZF A;  4CCO A;  1URX A;  4IE5 A;  5IUQ A;  3SQO A;  5HCB A;  3LD8 A;  2ZKN A;  4Z1V A;  3ZFE C;  3BI3 A;  1BJQ A;  3BOP A;  4B4Q A;  4S2H A;  5JSP A;  3FBM A;  4UFK A;  1R64 A;  3NWK A;  5I0U A;  3HN1 A;  3I3M A;  1OKQ A;  3K48 A;  4S2D A;  3UKV A;  1VBD 3;  4PQQ A;  3U4X A;  1QJU 1;  2AGS A;  2NYY A;  4I0A A;  4H7M A;  4PLO A;  2VCB A;  4TWT A;  2VJX A;  2PLV 1;  2ZEY A;  1AX1 A;  1S55 A;  4PF1 A;  4Y24 A;  3MIG A;  1Q56 A;  4MYE A;  4NHL A;  1WME A;  4IW3 A;  5FZM A;  2KA3 A;  4R9C A;  3OGR A;  4C90 A;  2VXJ A;  2VW2 A;  5DAQ A;  1GMM A;  4EE2 A;  2OXB A;  1OMI A;  3B9I A;  4AHZ A;  4DZG A;  3HNB M;  4CUC A;  4H14 A;  1S2B A;  2IUW A;  5EHD A;  4QQO A;  1LOF C;  1N1Y A;  3DN7 A;  5A33 B;  1TNR A;  4RGG A;  3U0Z A;  5FYI A;  3N4M A;  3JCI A;  3VD3 A;  2ZGQ A;  2VZR A;  2RS1 3;  2WO1 A;  3TB0 A;  1RVF 2;  3PUI A;  3H8O A;  3BTY A;  1HQN A;  1KXG A;  2WRA A;  3M7A A;  4GUL A;  3RMY A;  2CDO A;  3LZZ A;  1F4H A;  2PXJ A;  4MV2 A;  4QX8 A;  4UOJ A;  5LBC A;  1O91 A;  1PZ9 A;  1D0G A;  2B5H A;  4O65 A;  4LIU A;  1XU2 A;  5FQ0 B;  3E5U A;  5IAV A;  4Q0Q A;  2BGP A;  5JOZ A;  4NRP A;  4AVA A;  2O0O A;  2W39 A;  2Y6K A;  4R9A A;  3NJY A;  2IFW A;  4XZU G;  1KIT A;  5T54 A;  1PM7 A;  1NT0 A;  1W39 A;  1KQR A;  1GWM A;  3NKT A;  3NL1 A;  3HQR A;  4Q0P A;  5ISL A;  4E4Z A;  1UZ0 A;  1LOE A;  4GXL A;  3PUA A;  3VZJ A;  2CY6 A;  2W0X A;  3AZW A;  5JXG A;  4AR2 A;  5K0U B;  3BTZ A;  4DXZ A;  3AB0 A;  1BYH A;  4AVC A;  5CEH A;  3Q8E A;  1K3I A;  4XPV A;  4XZP A;  5FAX A;  1FOD 2;  1PX3 A;  4R8H A;  5HPO A;  3LIG A;  1QJU 3;  1T6B X;  4ATF A;  3O1O A;  3O0X A;  2V4A A;  2XJS A;  3WIN E;  2PLV 3;  4A3X A;  2PN5 A;  5FZ9 A;  4MOA A;  3RSJ A;  4BQW A;  2DUP A;  2VOT A;  4UT5 A;  4R9B A;  5FY1 A;  1HKD A;  1CON A;  5EFU A;  2VH9 A;  1WA6 X;  1DQ6 A;  2CV6 A;  2BVB A;  4BIF A;  5BNN B;  3I2G A;  3N7M A;  1JYX A;  5FIX A;  1PM4 A;  1AL0 G;  3VDB A;  4YVW A;  1VMH A;  2R0F A;  3BTA A;  1ZA4 A;  1WLC A;  5D8A B;  2VMG A;  3MFA A;  4QDR A;  3FHA A;  3OBR A;  4J1W A;  2YPJ A;  1JU4 A;  1UPI A;  3LEM A;  4LBQ B;  3MI8 A;  1TZO A;  5F6L B;  5LEJ A;  4LJH A;  3ECQ A;  5AC9 1;  2D6O X;  1DDL A;  3OGS A;  5K0U C;  2QQP A;  4KNC A;  4AW7 A;  3IN9 A;  5FBZ A;  1Q8V A;  4YVS B;  5KHK A;  3KVB A;  3T0D A;  4D7S A;  4X8P A;  1GSL A;  1NQJ A;  1VR3 A;  4BE3 A;  2D98 A;  3AYE A;  4LLO A;  5JPN B;  4QX2 A;  5BY5 A;  3WW4 A;  1CAU A;  4AQT A;  2G1M A;  2Y0I A;  1LOG A;  5FYM A;  5AVA A;  3B00 A;  5BNN C;  4GZ9 A;  2P34 A;  2E9Q A;  4MXW B;  1NCR B;  1H0B A;  2F6B A;  3FLP A;  3TRS B;  4K3U A;  5D8A C;  2E7Q A;  4LE4 A;  3JBG 2;  5F3C A;  5A6Q A;  3ZXG A;  5LRS A;  1LHO A;  2RS5 1;  5E1R A;  4URT A;  2WYF A;  1NXM A;  1AHS A;  4FPK A;  1YI9 A;  3PL0 A;  1NQD A;  2VZV A;  3H7J A;  4LQR A;  4BQ2 A;  4ASK A;  4ES8 A;  2UU8 A;  3BCW A;  2BU9 A;  2ZXQ A;  2CGO A;  1UX7 A;  2YB7 A;  3RZK A;  2HWF 2;  2OPK A;  1FPN 2;  2BW8 A;  3ALQ A;  4OHY A;  2LRO A;  4YVS C;  1WWY A;  3MLJ A;  1FAY A;  3LPF A;  4IGO A;  2ZZJ A;  4WM7 A;  3FWE A;  3TEY A;  2IXK A;  4QX7 A;  3AP4 A;  3J9S A;  4YVW C;  4XBN A;  5LY1 A;  1YFY A;  2SBA A;  2VTX A;  4A42 A;  4AWD A;  5FWE A;  3FHI B;  4RYD A;  1MS3 A;  2K0G A;  2ZGU A;  3NJV A;  1NCR C;  5FY9 A;  4JRL A;  2TNF A;  4GA9 A;  3WNP A;  2BUK A;  3VKF C;  4AG4 A;  1ZZB A;  2DVD A;  4LOR A;  5E6H A;  2ZS6 B;  5D21 A;  1PZ7 A;  1VAM A;  5AC9 3;  5FZO A;  2VME A;  4Q1P A;  4CCD A;  2VOK A;  4NID A;  4QQL A;  3FMG A;  1W99 A;  4JDM A;  3WHT A;  1X8E A;  2W52 A;  1HDK A;  4LKF A;  1S2K A;  3A0K A;  4HSL A;  4N7U A;  2X5I B;  1GP4 A;  1GQP A;  2VCC A;  2XOM A;  3RZH A;  1XNC A;  4XDP A;  2PAE A;  3O1S A;  2FDH A;  2DU1 A;  3LDB A;  3VB9 A;  3WG4 A;  1YJL A;  4U2A A;  1AYM 2;  4KQ7 A;  3UT0 A;  5JXI A;  1VB4 A;  5C9A B;  2WZE A;  2Y8K A;  4E2G A;  3CNA A;  3FX3 A;  2H6C A;  4XFB A;  1AVB A;  2AYH A;  3EYP A;  3NJX A;  3WQ1 A;  4CTE A;  2A3W A;  2A5Z A;  4Q26 A;  2FDI A;  4XOG A;  1Y43 B;  4D0Q A;  1UZV A;  2JKB A;  3LDK A;  2RDQ A;  3GBF A;  4RHV 1;  3AX4 A;  1HRI 2;  2C1F A;  2RR1 1;  4FPO B;  5DZE A;  2RS5 3;  3UET A;  3LPG A;  1BZW A;  2IFR A;  5CAD A;  1CPM A;  1QXJ A;  2A1X A;  5GZD A;  3LSE A;  2FHR A;  4COU A;  4WVV A;  1EAH 2;  2YGM A;  3D6E A;  3EBR A;  4MH0 E;  5FYY A;  4F7Z A;  1V6L A;  4J1X A;  1S1A A;  3JXS A;  4NIA A;  1UO9 A;  1EUT A;  4U36 A;  3WCR A;  5JZG B;  3GXU A;  2X5I C;  1GKB A;  1SLL A;  3N3H A;  4GWJ A;  2UYA A;  4LR4 A;  2YFZ A;  1Y9Q A;  4PF5 A;  4N43 A;  1CAW B;  4XFC A;  3AMM A;  4FXK B;  4LIT A;  3A21 A;  2AEN A;  1JZ8 A;  4LHK A;  4IE6 A;  5C9A C;  1W6O B;  3T09 A;  2DWR A;  4O9E A;  1E5S A;  4HPK B;  4AI3 A;  2CYF A;  2X29 A;  4XFA A;  3DPR B;  3ZXD A;  4DIN B;  1Y9G A;  1JBC A;  3E6B A;  1OPM A;  2D3S A;  2TUN A;  4AED B;  1W3X A;  2V72 A;  1RVF 1;  1IPJ A;  2DCT A;  2WC2 A;  1LGN A;  1NA1 B;  1UXZ A;  1C8N A;  3H1W A;  4IND A;  5C4W B;  1KFX L;  4QHZ A;  3O1R A;  2RE9 A;  5EJ3 A;  4AHW A;  2A71 A;  2WNU B;  1ZZ8 A;  2ZAB A;  4XBQ A;  5FZ0 A;  5JI7 A;  3SCF A;  3O1T A;  4Q8L A;  5ABJ B;  3PTY A;  2B8M A;  4W6W A;  2XUE A;  4OHZ A;  1C1L A;  3B7M A;  2B4K A;  4FTE A;  1UKR A;  2WLP A;  4YM2 A;  1EYB A;  4Q5O A;  5CU1 A;  1B35 A;  4Y5S A;  4QX1 A;  1QNW A;  5E8A A;  4H2A A;  4M0N A;  2BP6 A;  4HVR A;  1HB2 A;  1W9T A;  4TYS A;  1FI2 A;  5IYY A;  5C71 A;  4LUK A;  3THD A;  4ZXK A;  5F32 A;  2GC2 A;  1KEX A;  4YG3 A;  2ZX4 A;  2DTW A;  5JI9 A;  5T52 A;  3ZM8 A;  2A3Y A;  4EWA A;  2ZGL A;  1REF A;  1H4G A;  1JZ3 A;  4RHV 3;  3POJ A;  4AED C;  2RR1 3;  1HV0 A;  1F35 A;  1FOD 1;  5FRA A;  2ZX0 A;  1AZD A;  3BIE A;  3S57 A;  4JDO A;  4YYO A;  1HLC A;  1NA1 C;  3RJR A;  5C4W C;  3EQE A;  1JUI A;  4AGR A;  1FV3 A;  3CIH A;  3MGU A;  3QCW A;  4XQW A;  2WNU C;  4Y1X A;  3SNM A;  4DUV A;  4WV8 A;  3RZG A;  1FAT A;  4P9I A;  5ABJ C;  3H50 A;  4OI4 A;  4N53 A;  2LTN A;  4AHY A;  1OD5 A;  1UL9 A;  2QZ3 A;  5FMD A;  2X05 A;  4A44 A;  3IDA A;  1AJK A;  4G3Y C;  1RB8 G;  3VZO A;  3TOJ A;  4AI9 A;  2P3Y A;  1MAC A;  2D3R A;  1SLA A;  4GIQ A;  5LAS A;  4QDQ A;  1W6N A;  3WW1 A;  5CBL A;  3LOB A;  4MG2 A;  5FRE A;  4AAX A;  5H9S A;  4DXR A;  3RYP A;  2RJL A;  4PDW A;  4DS0 A;  3JQX A;  3I4I A;  1RVF 3;  4YW5 A;  4PBP A;  3NVC A;  2DVG A;  5K8S A;  2HYX A;  1OFN A;  2C0Z A;  3IMM A;  4DRV A;  1LHV A;  4AI1 A;  1SLI A;  2VU9 A;  2MPF A;  3RYR A;  1W2A X;  2YC2 A;  5EIY B;  5F3I A;  2QQI A;  3MO4 A;  2CWS A;  5T5L A;  4CCK A;  1OVP A;  3AYD A;  4Z07 A;  4GWI A;  4RN5 A;  3AP7 A;  3IMN A;  1RJ8 A;  3SIT A;  5CVR A;  1OT5 A;  5LK7 B;  4YGC A;  3AVS A;  5BUV A;  1NXD 1;  4LHS A;  1NOV A;  5LY2 A;  3NRU A;  3SH3 A;  2IC1 A;  2J1S A;  2K9Z A;  4WBB A;  1LTE A;  2DVA A;  5E88 A;  5GZG A;  3C3V A;  2G9G A;  3ZMN A;  2VBB A;  3IAP A;  1CIY A;  2VUA A;  1UIK A;  5GJ6 A;  2JG9 B;  4LA2 A;  3W58 A;  2VZO A;  2C6S A;  1AJO A;  1H1A A;  2F17 A;  1AXK A;  5FYB A;  5FZF A;  2V73 A;  1DGR A;  3JBG 1;  3T2P A;  1R09 1;  1WCU A;  3WNN A;  3J8F 1;  3NNJ A;  4YAR A;  5IK4 A;  5JXH A;  1VBD 2;  2WLQ A;  5SV8 A;  2IXH A;  4LTA A;  3GNE A;  1ULO A;  1ONA A;  1I6X A;  3I3Q A;  1FOD 3;  5FP9 A;  4KG8 A;  3ZFF A;  1ND3 A;  1COV 1;  3PVE A;  4XF1 A;  1OA2 A;  3OY8 B;  3WDT A;  4IV3 B;  1FPN 1;  3DXU A;  5FZ7 A;  3WQ0 A;  4AEK A;  2AEY A;  1S4C A;  2V09 A;  2JDA A;  4AZZ A;  1STM A;  4RL7 A;  2W1S A;  3VBH B;  4BDV B;  5T5O A;  3HNM A;  3BVC A;  4LBJ A;  4CYD A;  1DG6 A;  3ZSJ A;  1UAI A;  4FOW A;  2WYS A;  1BHG A;  3MV1 1;  5J09 A;  5LBE A;  2ZMN A;  2D40 A;  2XBO 2;  1GUI A;  4AFA A;  2O8O A;  1JYI A;  2I2S A;  3ES4 A;  4YNI A;  3QH6 A;  2BVV A;  4QDS A;  3VD7 A;  2JG9 C;  2A7A A;  2R1D A;  5CKQ A;  1AR7 2;  3ZSM A;  4CXY A;  1UCX A;  1E5H A;  1NE4 A;  4D8M A;  4IE7 A;  4XDO A;  1YFU A;  2W9X A;  3OG2 A;  5F5I A;  1W6M B;  1DLL A;  2N7G A;  3BAL A;  4CDX C;  3GJA A;  4W6Y A;  1I9R A;  4S2G A;  3UK9 A;  4N8M A;  1WLD A;  4Q29 A;  3WT3 A;  2D6K A;  3WF0 A;  4BCU A;  5IFT A;  1SFP A;  1JZ2 A;  4BYY A;  4KBB A;  3B9C A;  4K9S A;  4PIX A;  4B3N A;  4IV3 C;  1ENX A;  3BU7 A;  3WF3 A;  2OX0 A;  1NCQ A;  5GZE A;  5C3O A;  3MIB A;  5FYC A;  3WQB A;  3ZYH A;  1H9P A;  1AYM 1;  1PK6 B;  1UIJ A;  1ZZ9 A;  1OUX A;  1PMI A;  5CFD B;  3VBH C;  2WNV B;  1O4Z A;  2VMH A;  5HBA A;  1I3H A;  1GOF A;  1ODM A;  5F2S A;  2VG9 A;  1UY3 A;  1N3P A;  3S30 A;  1GU3 A;  1JXN A;  3N7L A;  3MYX A;  2QUO A;  5FP7 A;  4BZ4 A;  4DXT A;  2ZX1 A;  3LGR A;  4IEZ A;  4Q8K A;  4LHN A;  1WLT A;  4IUG A;  3WNL A;  5KBF A;  2P3I A;  2JKX A;  2PQS A;  3JBG 3;  1G8W A;  1R09 3;  4CA9 A;  3J8F 3;  2W47 A;  4FT8 A;  1ASJ 2;  5LA2 A;  5FKB A;  2D93 A;  4NHM A;  3JQW A;  4Q2F A;  2BRT A;  2IXI A;  1GWK A;  1L3J A;  2I45 A;  3D0S A;  4H7L A;  4UI9 L;  3ACL A;  4XJA A;  5FZD A;  1COV 3;  1LRH A;  2EIC A;  4L8Q A;  3LA3 A;  1FPN 3;  3U78 A;  5FDB A;  1W0N A;  3AKQ A;  1GZT A;  3QH7 A;  1J83 A;  4ZU4 A;  4QXC A;  4NHX A;  5FZA A;  5FR3 A;  3RVH A;  1LJ7 A;  3AMH A;  2A6V A;  2RDN A;  3VKM A;  4WVM A;  3R6S A;  2YGL A;  4DY5 A;  4M0H A;  5FO7 B;  1SCR A;  4NII A;  1YUD A;  3U37 A;  4GKX A;  2CSG A;  1PK6 C;  5CFD C;  4B4P A;  3ZYI B;  2WNV C;  1A8D A;  4NHK A;  1GYK A;  4Y4R A;  4AVS A;  4Z2A A;  3TEW A;  4IE0 A;  5AVP A;  3WDU A;  1B09 A;  1SBF A;  3W21 A;  4OI0 A;  1DGW A;  3L9J T;  1RUD 2;  1UU4 A;  4GWM A;  1DYP A;  5A3T A;  2J1V A;  4NPM A;  5KR7 A;  1L7R A;  1UNB A;  2ARA A;  1JTZ X;  2ZGP A;  3ATG A;  5JLV A;  1SBD A;  1MVE A;  1O8S A;  5C5U A;  4OHV A;  1LOB A;  3K4A A;  2D5F A;  5B4N A;  5SV5 A;  1PMH X;  2Q5T A;  3LA2 A;  3O7O A;  4IGP A;  2QQU A;  3WD5 A;  2VZQ A;  2JDP A;  5JXJ A;  1W9S A;  4CZS A;  4BM8 A;  2VZS A;  4YZ2 A;  5D1I A;  2CWM A;  2D6P A;  1DQ0 A;  4YW6 A;  5FY7 A;  1AYM 3;  3KCC A;  1F9K A;  1QDC A;  3M4F A;  3PDQ A;  5LBF A;  3DV8 A;  3RPQ A;  3UYJ A;  3THP A;  4N90 A;  4AFB A;  4LT5 A;  3OUI A;  3ZYP A;  3I49 A;  2YBK A;  5JMC A;  4CXX A;  4BB3 A;  4RQP A;  5L7O B;  2E63 A;  4QX5 A;  2WFP A;  1YFW A;  1JU3 A;  3A23 A;  1PZ8 A;  4K1Y A;  1J1L A;  5F7U A;  1RTV A;  2WFF 2;  2ZJC A;  2ZKL A;  5KC6 A;  2AAC A;  3D5O A;  4JKL A;  2QQM A;  1SBE A;  1ND2 B;  1YHF A;  3Q9O A;  4NUB A;  3RFR A;  1ZRI A;  2YUE A;  2ARB A;  5A7P A;  1W8W A;  1JOP A;  5ANN A;  1CAV B;  4JGZ A;  5EV7 A;  3RZZ A;  2G4I A;  4CCJ A;  1XSR A;  4UFL A;  3SMH A;  4B7K A;  2WWS A;  3GHM A;  4Y1V A;  1UW8 A;  1LHU A;  2OYZ A;  1EY2 A;  2Q0A A;  4PIY A;  4TLG A;  2CGP A;  3H42 B;  3VV1 A;  2DYC A;  2GZW A;  1KS5 A;  3RI9 A;  3ZXF A;  1ENS A;  2JB8 A;  3WDV A;  1WCS A;  1QXR A;  3DGT A;  1ENQ A;  2B9U A;  4FFI A;  1UOJ A;  1GNH A;  1NLR A;  3RQ0 A;  4IEV A;  4B1M A;  1MQT B;  3PNA A;  4QAW A;  4DRR A;  3CHX A;  5L7O C;  4NAM A;  4HKO A;  1RXF A;  3USS A;  5C6C A;  1QJY 2;  1JMU B;  3U4S A;  4HL0 A;  3P1I A;  4XFH A;  4AVV A;  5A3U A;  2A75 A;  5IK8 A;  3K4D A;  3EXU A;  1SPP B;  1W9W A;  4GH4 B;  4Y20 B;  3TNP B;  3J4U H;  4CCL A;  3EB7 A;  3MIC A;  1ND2 C;  3G6J B;  4KBZ A;  5IVE A;  3M1H A;  1WD3 A;  4AVT A;  3AMP A;  2Z42 A;  3HT2 A;  3N9P A;  4NHY A;  4RR3 A;  5IT6 A;  4FPJ A;  4QMA A;  3B02 A;  3NKG A;  5FYT A;  2E7A A;  1JYC A;  1K5J A;  1U0A A;  1PGW 2;  1PGS A;  5BV6 A;  5DUU A;  1IKP A;  2WBK A;  1CR7 A;  3F95 A;  1YJK A;  2RS5 2;  4BU2 A;  5F5A A;  5ACA 2;  1MQT C;  3RJ2 X;  4EZH A;  3S5Q A;  1WKY A;  4A7Z A;  1F5J A;  1OA3 A;  5FCC A;  5LW9 A;  1RUF 2;  1YYN A;  3I2H A;  3WP3 A;  2Z2S B;  4IES A;  4XJ9 A;  2IVJ A;  5JUV A;  2Q30 A;  4GH4 C;  4QHB A;  5EZW A;  4BIS A;  5DAV A;  4CP0 A;  2XJQ A;  4CDU A;  1P8J A;  2WL1 A;  4Y4Y A;  1K12 A;  1ZRD A;  2DF7 A;  4FAG A;  2QTW B;  4FTS A;  2VNG A;  4IV1 A;  5LWB A;  1V70 A;  1JZ4 A;  2ZZQ A;  1IPS A;  5FUN A;  3MW3 A;  1POQ A;  2ZHK A;  4JGY A;  2XBO 1;  4CP9 A;  4XFG A;  1GZ9 A;  2VCA A;  1TMF 2;  1W03 A;  4P5Y A;  2BEO A;  4HON A;  3I8T A;  2JD4 A;  4XET A;  5JAX A;  4CDQ B;  1D0H A;  4MGQ A;  1DBN A;  4FPH A;  3JZV A;  4FPC A;  4HBN A;  4AGG A;  5KHI A;  3KM5 A;  1AR7 1;  2Q8O A;  2UWC A;  1SDW A;  4FO9 A;  2PMW B;  1N1T A;  3KQR A;  5A7Q A;  4B4R A;  2NLR A;  4F83 A;  2OQ7 A;  2VOX A;  3PUH A;  4UFJ A;  1ZNP A;  1GZW B;  2GDF A;  5M0T A;  1UU5 A;  5LB6 A;  5JR2 A;  4FPE A;  3VZM A;  3ZN6 A;  3AK0 A;  4N7I A;  5JSR A;  1K5M A;  2PHL A;  3ILN A;  4QPG A;  5FPZ A;  5A32 A;  3B93 A;  4IQP A;  1O59 A;  3C7G A;  3OBT A;  2EXJ A;  3WV6 A;  4CDX B;  1YCI A;  2E6V A;  1RMU 2;  4XIO A;  5FZE A;  4BXS V;  2EA7 A;  2NP0 A;  1J3R A;  1HB1 A;  3VBF B;  5LA1 A;  2GMP A;  3R05 A;  4AHX A;  4AXO A;  1FNY A;  3E5X A;  5FZG A;  2GSY A;  4AI8 A;  5BNO A;  3VBS A;  4RHV 2;  2ZGS A;  2EXH A;  2W94 A;  4UW4 A;  5CB7 A;  1GP6 A;  2RR1 2;  2W91 A;  4CDQ C;  3K51 A;  3T08 A;  4D94 A;  1WBF A;  2ID4 A;  2YG0 A;  2ZGM A;  1ASJ 1;  1D2Q A;  1LNS A;  5CIR A;  5BNP A;  5GLV A;  1VP6 A;  1ZX5 A;  2JDY A;  4CCC A;  4KG0 A;  3PMS A;  3GZE A;  4XYX A;  2GP5 A;  1JZ5 A;  1HN0 A;  2VOW A;  3M3O A;  1BLZ A;  3VHR A;  4YW3 A;  1UU6 A;  1ZM1 A;  1ALY A;  3HR9 A;  3I2I A;  4K6B A;  2QZ2 A;  2XQR A;  4ISQ A;  4OCT A;  4JAA A;  3BTX A;  1KJR A;  3HJR A;  4CU6 A;  5IVF A;  5IK7 A;  4AFM A;  1XE8 A;  1S0F A;  2VR4 A;  1H2L A;  2ZAA A;  2R1B A;  1RC6 A;  2CAV A;  2VQU A;  2WZR 2;  4HN1 A;  1X36 A;  2JDZ A;  4PLM A;  5EJ1 B;  2XBO 3;  3POY A;  2ZEW A;  3IIA A;  3VBF C;  5H9R A;  4DY3 A;  1RUD 1;  2NZ9 A;  3ZYF A;  2JG8 A;  1X8M A;  3TNQ A;  3S7I A;  1OF3 A;  2JDM A;  1AR7 3;  2DV9 A;  4CE8 A;  2CGN A;  3UGH A;  1C3H A;  1JW6 A;  1NE6 A;  1E5I A;  1FNZ A;  3ETP A;  4OI1 A;  4K8R B;  1MVQ A;  1HQW A;  5I8S A;  3KHC A;  5GAL A;  5I8T A;  3WNK A;  2HYK A;  2HJI A;  2XON A;  3ZLI A;  3ABZ A;  2WUH A;  2C5D A;  3ZXA C;  1RYY A;  4RD7 A;  4NVP A;  1YQ5 A;  1H8T A;  4TXW A;  3LSD A;  3WOG A;  1YRZ A;  2FMY A;  4P02 B;  3THT A;  4QWN A;  2W92 A;  2WZ8 A;  5FY4 A;  3WP6 A;  5BNO C;  4JQR A;  3O14 A;  3RWN A;  4L2N A;  4FPY A;  4CVU A;  3GZU C;  5FPL A;  3ZYJ B;  5J1X A;  4S2F A;  5I0T A;  3CKH A;  4C1X A;  1QH7 A;  4FPG A;  5E89 A;  1SEF A;  2R7E B;  3T4H B;  5F9T A;  2WFF 1;  2AC1 A;  5FZ1 A;  2WT0 A;  3T2O A;  3E6D A;  5FJH A;  3KD4 A;  1ASJ 3;  1J3Q A;  3L2Y A;  5T55 A;  3H1M A;  5DZG A;  3RYK A;  3ACG A;  4XFF A;  1G9B A;  2DDU A;  4AI2 A;  1XND A;  1TG7 A;  3POB A;  1Q8S A;  4UXA A;  1VE0 A;  4M3C E;  1WW6 A;  2W68 A;  2BTV C;  3LQC A;  4EV0 A;  1WUV A;  1C8M 2;  2YXS A;  4COW A;  4NIH A;  4QGM A;  1KD7 A;  4W6X A;  4ARX A;  4HOO A;  4W50 A;  3AZY A;  1G86 A;  4XMA A;  1RUN A;  2G9F A;  3M3C A;  2GH2 A;  4Q4Y 2;  2GNB A;  4DQA A;  3R4D B;  5CG9 A;  4LOS A;  4JHT A;  3Q8A A;  2JG8 C;  3HBK A;  1YXW A;  1DF0 A;  4LO8 A;  2ZHL A;  1RUD 3;  1QJY 1;  3CO2 A;  3NW4 A;  4ZU7 A;  2VZP A;  2UWA A;  1RUG 2;  2OPW A;  5CZK A;  1QF3 A;  3WF2 A;  3QAC A;  2YU1 A;  4A3Z A;  1QU0 A;  1F5F A;  2XXZ A;  1A6C A;  3BKZ A;  4CSW A;  5T50 A;  2DCZ A;  2VZ3 A;  2QBX A;  1TQ5 A;  3M3I A;  4BMB A;  4YPJ A;  3VD5 A;  4HK9 A;  4EN6 B;  2FDF A;  2Q4S A;  3WUC A;  4P00 B;  4YVW B;  1SLT A;  2VY0 A;  3D82 A;  3K46 A;  4PIZ A;  1KFU L;  4BWO A;  1ACC A;  3ORJ A;  5L9R A;  4OZO A;  1C1F A;  4YWA A;  2VCM A;  3MHZ A;  5DDJ 2;  4DEQ A;  1SCS A;  3C7E A;  1CX4 A;  3ZDV A;  1BCX A;  4KGG A;  5CFC A;  1IKQ A;  1PGW 1;  4Y1U A;  3AL6 A;  2JDU A;  2ORX A;  1R09 2;  1US3 A;  3J8F 2;  5JR7 B;  3JD7 2;  2CDP A;  4FI9 A;  5ACA 1;  5F37 A;  4LO5 B;  4G9S B;  4XJZ A;  3ZMO A;  4GMP 1;  4K40 A;  4ES9 A;  3EMR A;  1JOB A;  2BZD A;  5EPA A;  1RUF 1;  1UOF A;  2WFF 3;  5EYY A;  2VQT A;  4QM9 A;  1XBF A;  1COV 2;  3WF1 A;  4C0B A;  2D6N A;  2WDB A;  4Q4V 2;  5GZF A;  3N9Q A;  1CAU B;  1LEN A;  4B8E A;  3CZU A;  1XPW A;  3NNL A;  3L2H A;  1ZZ7 A;  2P1B A;  2VMF A;  4LUM A;  4M4R A;  4BLI A;  1H8V A;  1BXH A;  3ZXK A;  3ZN4 A;  4YZ4 A;  1HXS 2;  1FX5 A;  1YIP A;  2VZ1 A;  3I54 A;  4YFZ A;  2P3J A;  4X6R B;  3H1Y A;  4XF0 A;  5FXV A;  4ARY A;  5C3R A;  1J84 A;  4PHZ A;  1HB3 A;  1TMF 1;  1A8M A;  3AC0 A;  3AYC A;  4O7X A;  1QKQ A;  4WVZ A;  5FJK A;  4HT1 T;  3HIF A;  5A6Z A;  4XHB A;  5BXX A;  4XAE A;  3C2U A;  2BOI A;  2R0H A;  2LW8 A;  3ZKY A;  5C8C A;  3OF1 A;  1W8T A;  1QJY 3;  1OI6 A;  4RFR B;  1UY0 A;  1WCK A;  3AJY A;  1OQE A;  4GWN A;  1QNY A;  3NMB A;  4MGK E;  1JYN A;  5G05 L;  1PHM A;  1MZ5 A;  3ELN A;  4WM7 B;  3BOW A;  5FLI A;  5F1R A;  4MAD A;  5FYV A;  3ZSL A;  4FSJ A;  1GOH A;  2W08 A;  1YQC A;  3LFM A;  4FQ4 A;  3OPZ A;  2OVU A;  5DN2 A;  3NQH A;  1PNF A;  3V64 A;  3J7M A;  3R4S A;  4PLN A;  2GN3 A;  5FK8 A;  1UOB A;  5FXW A;  1EPW A;  2XHN A;  2V4V A;  3CU7 A;  1RMU 1;  2XML A;  4Z82 A;  1YO8 A;  1Q3E A;  4UFM A;  5FYH A;  2CNA A;  4LXL A;  5FZB A;  3VUO A;  1RIN A;  1R08 2;  2GC0 A;  4ISR A;  3UL2 A;  1LOC A;  2GNM A;  1SLC A;  2P4E A;  3UGF A;  2DUR A;  3I2J A;  3T1M A;  3RZL A;  1RL3 A;  3FBY A;  4DO0 A;  4A4A A;  1OFS A;  4CXW A;  3OEA A;  2UYB A;  5ACA 3;  2IXJ A;  3MW4 A;  3LA7 A;  5FXX A;  4A7K A;  3I2F A;  5C70 A;  5A3W A;  4ZHN A;  1LCL A;  2RMU 2;  1RUF 3;  1IS5 A;  2D44 A;  2ZA9 A;  2ZEX A;  3AM2 A;  2PAM A;  1UZW A;  1OC1 A;  2JDK A;  4JVA A;  1I5Z A;  5L9V A;  5LZ6 A;  1GZC A;  5CYY A;  2QFE A;  3MW2 A;  2GH8 A;  4HKW A;  1APN A;  5A1L A;  1XJA A;  3OEB A;  4WM7 C;  5GZC A;  1US2 A;  5CKM A;  3OPT A;  3H8X A;  5DG1 A;  3GZA A;  3IB3 A;  3M70 A;  1IS3 A;  2MEV 1;  2WJS A;  2XGX A;  3I59 A;  4GJZ A;  2B39 A;  5D2A A;  2BQP A;  1GIC A;  4MET A;  2WZR 1;  4QD2 A;  3V56 A;  3LEK A;  1SDD B;  1SZB A;  5CA6 A;  3IZO A;  3DPR A;  5EWS A;  3VGI A;  1OA4 A;  1TMF 3;  5GLT A;  4C8D A;  4C91 A;  3SEP A;  3C7F A;  4LLF A;  4P9L A;  5IAX A;  1H1I A;  4QB2 A;  4N9I A;  3BGA A;  3WP4 A;  4QQ2 A;  5FP8 A;  2BNN A;  5FZC A;  4L92 A;  4OUL A;  4V2V A;  2Y33 A;  4F8A A;  2ETE A;  3AKT A;  4XDQ A;  4Z2W A;  4HET A;  4YZ1 A;  5FZI A;  1QWR A;  3DEM A;  1AL2 2;  4AF9 A;  4J6G A;  4QX3 A;  5J37 A;  4N43 B;  1UYY A;  3MFC A;  1QMJ A;  5DAW A;  1U5Y A;  1J58 A;  1IG0 A;  3GJB A;  3KLS A;  3T3Y A;  5FYU A;  3UJO A;  2WNO A;  2OS2 A;  5IAT A;  1Q8P A;  4AQ6 A;  4JC1 A;  5T5J A;  2YC4 A;  1XC6 A;  2VTX J;  2YC0 A;  3NAP A;  1HW5 A;  1WMX A;  4AL9 A;  5A3P A;  1RMU 3;  4BJ0 A;  4HVO A;  3IPV A;  1KDK A;  2W3J A;  2HWC 1;  2YMZ A;  4FPF A;  4NRO A;  1XNT A;  2B7Y A;  3AP9 A;  1W6P A;  3VBR A;  3A7Q A;  4ORF A;  5JOW A;  1JN2 P;  2BYV E;  1ZA7 A;  1TNF A;  2KM2 A;  5F39 A;  3D3A A;  4CEW A;  3LB9 A;  3U75 A;  1CGP A;  3HEI A;  5C3S A;  5LCW L;  1JYT A;  4DNY A;  1LEM A;  3MV0 1;  3KMH A;  3JUU A;  2UY9 A;  1B35 B;  1S0D A;  1ST8 A;  1CAX A;  1OUR A;  3PUS A;  3ME2 A;  4IGQ A;  5CNA A;  5C3Q A;  2PQQ A;  1TVG A;  4N43 C;  1DHK B;  1OLQ A;  1CWP A;  2XJR A;  3HQU A;  4I3G A;  4LK6 A;  4PBO A;  1C8M 1;  4RGK A;  5DAP A;  3VKL A;  5LEK A;  2VMC A;  5FO8 B;  1POV 1;  4URA A;  1UN1 A;  4KWK A;  1CQ9 A;  4ZPI A;  4IEU A;  3IDB B;  3ACF A;  3DKQ A;  4V2W A;  2ENR A;  2CHH A;  3E1F 1;  2WZR 3;  4KWL A;  3U10 A;  2P17 A;  2W87 A;  4Q4Y 1;  5IVV A;  1PNG A;  1JZ7 A;  5LBB A;  4QPI A;  2ARE A;  4B29 A;  1ULD A;  1O5L A;  3TEX A;  1LU2 A;  3UKN A;  3WNM A;  3AMQ A;  1MS1 A;  1V9U 1;  1OXC A;  3PUR A;  3PU3 A;  1RUG 1;  5JVV A;  4XVH A;  1AR6 2;  2D43 A;  1UOG A;  1UZZ A;  2FCV A;  2DCY A;  2KD7 A;  2O8Q A;  3KT7 A;  3AXD A;  4D3W A;  1S0G A;  2AZ5 A;  4N53 B;  2WII B;  2Q1F A;  1LEC A;  2C24 A;  1YQ2 A;  2ZHM A;  1LOA A;  3NO8 A;  2XLF A;  4QKF A;  1G9C A;  1IQD C;  2WWJ A;  4OI2 A;  1DGW X;  5IHR A;  2XVL A;  1B35 C;  3WHU A;  4NIG A;  4BME A;  4MGY E;  2BOJ A;  3JB4 C;  1WA4 A;  2WAA A;  3LKJ A;  1W6N B;  5DDJ 1;  4PI2 A;  5A7W A;  2WZP P;  1BVV A;  2VMI A;  3ZXJ A;  2JJ6 A;  5FUP A;  4I0B A;  4PDW B;  2HWC 3;  2GC3 A;  1CPN A;  2VBP A;  4L99 A;  5FYZ A;  1J59 A;  2J1A A;  1DQ2 A;  2Y64 A;  1LAJ A;  1MZF A;  3JD7 1;  5KXB A;  1QXP A;  2OQ6 A;  4EN8 B;  1MS0 A;  4Y26 A;  5C7G A;  1KGY A;  1NZC A;  1R1A 1;  3ST7 A;  3PUQ A;  3ZR6 A;  4KI5 M;  3RS6 A;  1GAN A;  2ADD A;  5FY0 A;  2NN8 A;  1CZV A;  4RS5 A;  4Q4V 1;  5FP4 A;  3LE0 A;  4NAO A;  3X29 B;  4LNV A;  4YM0 A;  4N53 C;  3LF7 A;  4XF3 A;  2DUO A;  1DFQ A;  1XOY A;  3NJZ A;  5FLJ A;  1C8M 3;  2VTF A;  4NPR A;  5DMY A;  4LBQ D;  5KC5 A;  1POV 3;  1N47 A;  5DQ0 A;  5FLH A;  1HXS 1;  3VBU A;  1NUK A;  3ZFG A;  1D7P M;  1QJX 2;  1GWL A;  3QBQ A;  2ZTN A;  4QXH A;  2WIN B;  4MXV A;  1H30 A;  4QPI C;  1X9T A;  3OUH A;  4Q4Y 3;  4PDW C;  4PCR A;  5A3N A;  5FP3 A;  2X10 A;  5A7S A;  1CN1 A;  1RUH 2;  3VZL A;  1ND3 B;  2Y0O A;  3ZFF B;  1RGS A;  3A0N A;  5I8Y A;  1V9U 3;  2EXK A;  2Z79 A;  2XHK A;  2ES3 A;  1RUG 3;  1K42 A;  3WQ7 A;  5HCF A;  3DYP A;  3U14 A;  1U5Z A;  2XR4 A;  1D4M 1;  2Q1M A;  2ET7 A;  5FMB A;  2CTV A;  4XTM A;  4JRA A;  3H0O A;  1MPX A;  4UF0 A;  3AZZ A;  3ACH A;  2YRO A;  4Q27 A;  1RUO A;  3FZ3 A;  4OLL A;  1O4T A;  1RUI 1;  3PLQ A;  1Y7B A;  4LMF A;  5A6X A;  5JOY A;  5B4X A;  1VB2 A;  2ILM A;  2LAL A;  5DDJ 3;  4D6R A;  2B9V A;  3V0B A;  2YZ4 A;  1R08 1;  4ERO A;  5ANQ A;  4LBM A;  4IEX A;  3EJK A;  3KF3 A;  3TBD A;  4QU1 A;  1JYW A;  2EID A;  4OQ8 A;  3JD7 3;  4ASM B;  2C9A A;  3VD4 A;  3BYW A;  3KV9 A;  4R4X A;  1R1A 3;  1AX2 A;  1ND3 C;  1WW4 A;  5FZ3 A;  4XEZ A;  2Y6J A;  5JIA A;  2RMU 1;  3ZFF C;  3CJI A;  4AFC A;  2ZGT A;  3T2Q A;  2D7F A;  3APB A;  4D7Y A;  1UY1 A;  1NCQ B;  2BV4 A;  1NZI A;  4OZX A;  3VHN A;  5BNQ A;  5KXC A;  4Q4V 3;  3MID A;  2YDE A;  3ETQ A;  1AX0 A;  4UAP A;  5FBJ A;  1ZRR A;  1LOD A;  1VBB 2;  1MEC 2;  5FUI A;  5L9B A;  1RUC 2;  1CIW A;  1XYP A;  3VDD A;  2JEC A;  1HRV 2;  2V5Y A;  4FFG A;  3WNO A;  2J7M A;  4RA0 A;  3NV2 A;  3POF A;  4F3J A;  1V00 A;  3KCX A;  4OVE A;  4R52 A;  4DUX A;  3W5N A;  3VDC A;  2JB4 A;  2PA7 A;  1ODN A;  4OYU A;  1HXS 3;  4M3C F;  3ZR5 A;  1RXG A;  1TEI A;  4MHU A;  1POV 0;  4GAL A;  3RZM A;  2GU9 A;  3FE5 A;  3AMN A;  4YSF A;  2AR6 A;  2WAB A;  4L0P A;  5FXZ A;  4EWE A;  4HKL A;  1H1M A;  3AP6 A;  4KU7 A;  4CDW A;  2OZJ A;  4DXS A;  3WG3 A;  1OLM A;  4JZR A;  1ZBE 2;  2EIE A;  4LO4 B;  4YGB A;  4CUA A;  2OA2 A;  3ZPO A;  4P08 A;  1UWW A;  2XUM A;  3OOX A;  1GR3 A;  4K7J A;  5FPX A;  2FDG A;  2ARX A;  3I2O A;  1AL2 1;  3IAQ A;  5JCT A;  1D4M 3;  3FHQ A;  1SLB A;  2WA4 A;  4IEY A;  1NCQ C;  4SBV A;  4WVM B;  5A70 A;  2Y34 A;  2O1Q A;  2GAL A;  4MHR A;  1F31 A;  3ILR A;  2E7T A;  4XQ4 A;  1E5R A;  2EAK A;  1Z78 A;  2PAK A;  1X33 A;  3BIW E;  5FZ8 A;  2DU0 A;  4FXG B;  4NJ4 A;  4XCB A;  4YRD A;  3OB8 A;  5J96 B;  1RUI 3;  3WCS A;  4GD4 A;  1OUS A;  4JHZ A;  3V0A A;  3O0V A;  4D6S A;  5FWJ A;  1C5I A;  4JKM A;  3CEW A;  4QKN A;  3T2T A;  1R08 3;  2L9L A;  5FOJ B;  4XF9 A;  3CZJ A;  2ZML A;  2QQV A;  4GAZ A;  5E16 A;  1H2M A;  4ZS3 A;  1LED A;  1FXZ A;  3D4K A;  4LPL A;  5FZH A;  4CEY A;  2RMU 3;  2OZ6 A;  4NO4 A;  5KWR A;  4K21 A;  2PFW A;  2DBI A;  3WR0 A;  4BH9 A;  1CAV A;  3MIF A;  3PVO A;  5A80 A;  1JZ6 A;  1G9D A;  4RSU A;  2XJV A;  1UYZ A;  3VN4 A;  5JDB A;  1IQA A;  3WNX A;  4YW1 A;  1A78 A;  2J1E A;  4WM8 A;  5GLW A;  2OKX A;  3A22 A;  4AFD A;  4Q1R A;  4RQP B;  1GV9 A;  3N9N A;  3ZPY A;  2E53 A;  3AFK A;  3POS A;  4P14 A;  5A1F A;  5KXE A;  2D6M A;  1OOP A;  2R6Q A;  1QOO A;  4NMI A;  3VBO A;  1UPS A;  3C7O A;  5HI0 A;  4LBL A;  1PVC 2;  3LCP A;  1XE0 A;  4KU8 A;  4OUM A;  4AE2 A;  2VEC A;  4A41 A;  1WD4 A;  3J26 N;  4X6Q B;  1REE A;  2MHF A;  1FV2 A;  2RV9 A;  3FC0 A;  3OTF A;  4G4F A;  2E26 A;  5BYN A;  1EP0 A;  4Y20 A;  1A3K A;  1AR6 1;  1SFY A;  1IG3 A;  5A7N A;  4JGZ B;  4AGV A;  2RJK A;  1WW7 A;  4N9H A;  3MPP G;  5I0S A;  3OYW A;  3E5Q A;  5FZ4 A;  2VD7 A;  1O3R A;  1AL2 3;  3DL3 A;  4CP1 A;  4IET A;  1XB9 A;  1YLL A;  4OHW A;  2H0B A;  4B1L A;  3KVA A;  2R16 A;  5KHJ A;  3RZJ A;  1C4R A;  3ZIX A;  4MGI E;  3WDY A;  2ZMK A;  3CMG A;  3CQO A;  1BQP A;  4QXK A;  5FK7 A;  4AI0 A;  4RQP C;  2P6H A;  2EVX A;  3I97 A;  3SCG A;  3CJX A;  3USU A;  2J1R A;  4OMC A;  4Z92 B;  1LR5 A;  2BBV A;  5FFO C;  1LU1 A;  4IEW A;  4BIO A;  4LKE A;  3OUJ A;  1AR9 2;  2P6C A;  1AUY A;  3NV4 A;  4MLO A;  4Y22 A;  2OUH A;  2VL4 A;  3LIH A;  1DP0 A;  1UX6 A;  1XE7 A;  3AKS A;  4M4P A;  3MZH A;  1UMZ A;  5A3M A;  4QU2 A;  2ZHN A;  4XQD A;  2OII A;  1N1S A;  1AR8 1;  4BOW A;  1LB2 A;  4XJW A;  3Q8F A;  4QGL A;  2FCT A;  3WW2 A;  1MS4 A;  5FYS A;  2UY8 A;  3VL8 A;  2RJ2 A;  4JTO A;  3ZN5 A;  4JGZ C;  2RVA A;  3FLT A;  5IFP A;  1W8F A;  2YPD A;  3BPS A;  4X8N A;  3PTR B;  1ULE A;  4DB5 A;  4RR3 B;  2R06 2;  1DLC A;  1ZVF A;  3DUI A;  3ZFE A;  4UBH A;  1J1T A;  2HBT A;  4A6S A;  3RMX A;  3ZVX A;  1QJX 1;  1QY4 A;  1VLN A;  2WAO A;  3H7Y A;  3UV9 A;  3WEZ A;  4ET7 A;  4E4H A;  4HVQ A;  4LK7 A;  4M3C A;  2YHJ A;  3F2Z A;  5K4L A;  2BDR A;  3POI A;  2FD8 A;  1RUH 1;  1ZRF A;  4C0H A;  4QKD A;  4E4S A;  4COV A;  4UW3 A;  2FDK A;  1UF2 C;  2DCK A;  5I0R A;  1QGL A;  2ZX2 A;  1AR6 3;  4FVV A;  4ZXE A;  1BEV 2;  1HB4 A;  1QEX A;  1W6Q A;  2NMN A;  3UGG A;  1Y9M A;  1YFX A;  4A2U A;  4BQ1 A;  4QHO A;  4CDU B;  3FL7 A;  2C9K A;  2DUQ A;  1F15 A;  4Q4X 1;  5C5T A;  2EIB A;  3POE A;  3DCQ A;  4IV1 B;  4XTP A;  1SQ4 A;  1W9Y A;  3VZK A;  3J7N A;  1ZYB A;  4XC9 A;  1LOF A;  4JGY B;  3ZKU A;  4CP9 B;  4RR3 C;  1VMF A;  1G6N A;  1NAE A;  2WQZ C;  3TN9 2;  4D6Q A;  4QX0 A;  5DAB A;  4XAA A;  5J36 A;  2GMM A;  1X50 A;  4TSV A;  5J48 A;  1RJ7 A;  1ZRE A;  2QJV A;  1PGL 2;  2W46 A;  3AZV A;  1BKZ A;  2CAU A;  3D0J A;  2A6X A;  3GCX A;  5FZL A;  2QE3 A;  4EN0 A;  4MZU A;  4I0W B;  4GQ7 A;  1XXN A;  4EQV A;  3WDW A;  2RHP A;  3TAY A;  5A3O A;  4TN7 A;  3SH4 A;  1OD3 A;  4LO6 B;  4AOC A;  4LE3 A;  4XAC A;  4DOU A;  1TME 2;  2EF6 A;  1UMH A;  1AXZ A;  3D8C A;  1AR8 3;  4DEV A;  4DPN A;  3ZN6 B;  3ZXL A;  1K5M B;  1S0I A;  4QPG B;  5A32 B;  2VVD A;  4OQ9 A;  5DG2 A;  4KL1 A;  1AF9 A;  4EN9 B;  4Y1Z A;  2J42 A;  1PIV 2;  1UQX A;  2LS6 A;  5JOX A;  4CDU C;  2QQN A;  3KGL A;  3ZSE A;  2FZ1 A;  1VBB 1;  1MEC 1;  4XHX A;  5J3U A;  1RUC 1;  3WLU A;  4IV1 C;  1HRV 1;  2JE8 A;  2MEV 2;  4H3W A;  5GKA C;  5BNO B;  1M06 G;  3ZDS A;  3VBS B;  4JGY C;  3BUC A;  2ZAH A;  2A6Y A;  3VZN A;  3C8X A;  1X9P A;  2JEN A;  5A33 A;  3I3E A;  2VC9 A;  4KMQ A;  1QJX 3;  1KRI A;  2XJP A;  3HBZ A;  2DFC A;  3WUD A;  5LA9 A;  3GGL A;  5BNP B;  3O1V A;  4NRM A;  1RUH 3;  1QHD A;  4E4D X;  1ZBE 1;  2QKD A;  4XFI A;  4P9Y A;  4FP2 A;  1BBT 2;  4QPW A;  3GM8 A;  2IXL A;  2EAA A;  2XL9 A;  2HLE A;  3SEE A;  2Y6H A;  4UWD A;  1C28 A;  4FQZ A;  5F3G A;  4EWD A;  1K5M C;  4QPG C;  3POW A;  5FQ0 A;  4Q4X 3;  3M2M A;  2ZGR A;  5F5Q A;  1CZT A;  4CCN A;  1W8N A;  2WSU A;  1UY4 A;  4FPL A;  2VW1 A;  4IL7 A;  1PMJ X;  3JU9 A;  3CF6 E;  1HN1 A;  1KS4 A;  1UYP A;  2BNO A;  1K45 A;  1OHF A;  1O3Q A;  5HXM A;  1PX4 A;  4E2S A;  4XCA A;  2HWC 2;  3U11 A;  1GLH A;  2YBS A;  2DBN A;  3VBS C;  2JG8 B;  1V6N A;  3I3D A;  3T0A A;  4CPB D;  5K0U A;  2BER A;  4R9D A;  5A1A A;  4FTB A;  2BFU S;  1W2O A;  3BN6 A;  4YM3 A;  4UW5 A;  2G9Z A;  2JIJ A;  1XNB A;  5BNP C;  2P37 A;  5K7P A;  1RUJ 2;  1WZX A;  3GCW A;  1V6J A;  1H6X A;  3Q8C A;  2R07 2;  4ZY9 A;  3IM0 A;  4CP2 A;  3AYA A;  4XUO A;  5ERL A;  1R1Z A;  2XVK A;  3MEP A;  3N9L A;  3O1M A;  2BPA 2;  5GM0 A;  1H8T B;  2PHU A;  4CU7 A;  4JX0 A;  2A70 A;  1DGL A;  1OLR A;  3N7K A;  4UW6 A;  5IVY A;  3VD9 A;  4P9G A;  3S6P A;  5BNN A;  4LOT A;  2BWA A;  1VBB 3;  1MEC 3;  3WZ1 A;  1RUC 3;  3NV3 A;  1G9A A;  1OBN A;  1EPZ A;  1HRV 3;  4UFH A;  1KDM A;  3LEG A;  3LWC A;  2PHD A;  1IOA A;  2HWD 1;  5D8A A;  3WX5 A;  4WVW A;  1DYO A;  4QB1 A;  4LBQ A;  3VL9 A;  1PVC 1;  3BPZ A;  1MS8 A;  4Q0U A;  1W05 A;  2QCS B;  3CLP A;  2Y6L A;  3KSC A;  2XVG A;  4LO7 A;  1UD1 A;  1V9U 2;  2PHR A;  2JE7 A;  4E9K A;  3H8U A;  3O12 A;  1D4V B;  4YVS A;  4NOT A;  1ZBE 3;  1RHI 2;  2GAU A;  5APA A;  4Q0S A;  4TLF A;  3ENR A;  3FFQ A;  1DQ5 A;  1XNK A;  4M01 A;  2VO5 A;  2R04 2;  1YQ8 A;  1MR5 A;  1H8T C;  2JEM A;  4FOV A;  1FMD 2;  4AQ2 A;  4LHL A;  2HEV F;  1CZS A;  2YU2 A;  2QQJ A;  4MXW A;  4YLZ A;  5F2W A;  1NCR A;  1HJG A;  3N35 A;  2LM3 A;  4TTG A;  2WS9 1;  4Q4W 2;  4NN0 A;  3H8R A;  2XB6 C;  1CX1 A;  3PIJ A;  5FO9 B;  2D3P A;  1NYW A;  1U12 A;  2WNE A;  3V65 A;  4JTN A;  2IVI B;  1JOD A;  5H9Q A;  2Y26 A;  2H0V A;  2V5D A;  1UYX A;  3T1L A;  4AVB A;  4IE4 A;  2VNO A;  3MBW A;  4BHP A;  1AR9 1;  4NWV A;  1LGC A;  3LAG A;  4QQP A;  4J25 A;  1R1A 2;  1RIT A;  3SCH A;  1W0P A;  2VUC A;  2W2I A;  2KR2 A;  5A3L A;  1HV1 A;  2I07 B;  5KHG A;  3FN9 A;  1X82 A;  1N1V A;  2GP3 A;  1FYU A;  2SLI A;  3Q8B A;  4XIK A;  2TEP A;  1VRB A;  3MIH A;  1MS9 A;  3AZX A;  1DIW A;  2R06 1; 
#chains in the Genus database with same CATH homology
 5LBB A;  5C5U A;  5L9B A;  5IAX A;  3W20 A;  3NNJ A;  4UWD A;  3OUJ A;  5EP9 A;  2FCV A;  3KT7 A;  5LBF A;  4MHU A;  2FCT A;  5LAT A;  3OUI A;  4XCA A;  2G1M A;  5EQU A;  5M0T A;  5LB6 A;  5L9V A;  4JZR A;  3BVC A;  4NHL A;  4IW3 A;  2JIJ A;  5LBE A;  2HBT A;  5DAQ A;  2OPW A;  3PL0 A;  2Y34 A;  5ERL A;  4MHR A;  4Q5O A;  4Y5S A;  3OBZ A;  4Y5T A;  4XCB A;  3GJA A;  3NNM A;  4NAO A;  4BQX A;  5L9R A;  3GZE A;  2G19 A;  5C5T A;  3KT1 A;  2Y33 A;  2RDR A;  5LBC A;  4XC9 A;  5HV0 A;  5A3U A;  4ZON A;  5DAW A;  4XAA A;  5IAV A;  3GJB A;  3MGU A;  3OUH A;  3EMR A;  5IAT A;  5EPA A;  2HBU A;  3HQR A;  4KBZ A;  4XAC A;  2FCU A;  4NHM A;  3NNL A;  4NMI A;  4NHY A;  5LAS A;  4BQY A;  2RG4 A;  3ITQ A;  3NNF A;  2JIG A;  2V4A A;  4NHX A;  5HV4 A;  4BQW A;  2RDN A;  4J25 A;  4NHK A;  2RDQ A;  4XAB A;  5DAX A;  3HQU A;  5DAP A;  2RDS A;  3W21 A;  3KT4 A;  2A1X A;  5DAV A;  5LA9 A;  4ZPI A;  3DKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...