2Y34A

S-nitrosylated phd2 (no exposed) in complex with fe(ii) and un9
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
215
Chain Sequence
b'PLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVAYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EGL NINE HOMOLOG 1
publication title Studies on the reaction of nitric oxide with the hypoxia-inducible factor prolyl hydroxylase domain 2 (EGLN1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 64
structure length 215
sequence length 216
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2y34A00
4JZRA 4NAOA 5M0TA 5LBCA 4XAAA 4KBZA 3GJBA 4NMIA 3OUJA 3HQRA 3MGUA 4ZPIA 5L9BA 4BQWA 2Y34A 2RDRA 5EQUA 3GJAA 4NHXA 2OPWA 3NNMA 4Y5TA 4J25A 3OUIA 2Y33A 3KT7A 5ERLA 4Y5SA 5HV4A 5L9VA 5DAWA 5L9RA 4XACA 2RDQA 2RDSA 2G19A 3NNFA 4UWDA 3OUHA 3OBZA 4XCBA 4NHKA 4XCAA 5C5TA 2JIJA 2V4AA 5IATA 4MHRA 5C5UA 5DAPA 3GZEA 4ZONA 2FCVA 2HBTA 4MHUA 5EP9A 4NHYA 2RDNA 2JIGA 5LATA 3ITQA 4XABA 4BQXA 5IAXA 5LB6A 5EPAA 3PL0A 4Q5OA 3HQUA 5DAXA 3NNJA 5LBEA 5HV0A 5A3UA 2RG4A 2A1XA 5IAVA 3KT4A 3NNLA 4NHLA 2FCUA 3W21A 5LBBA 3DKQA 2G1MA 4XC9A 5LA9A 4IW3A 5LASA 3KT1A 3EMRA 3BVCA 4BQYA 5DAVA 4NHMA 2FCTA 3W20A 2HBUA 5LBFA 5DAQA
chains in the Genus database with same CATH superfamily
4CEWB 3IDCB 4XAEA 1F8VA 1WW5A 3DN7A 3KGLA 3KMHA 1A78A 4XBNA 2OXBA 2P3KA 4OVEA 3VBSB 4PDWC 1UX6A 2B42B 1G6NA 1PO22 5EJ1B 3RFRA 5JXJA 1K5MC 2WABA 2P3JA 4AEDA 1DQ4A 1QJY3 3H7YA 4MLOA 4WVWA 3OYWB 1UOBA 4HZFA 4F3JA 4CXXA 4XDPA 3C7HA 3O12A 1HX6A 1KJLA 3N7LA 2I45A 4BK4A 3LSEA 2DCYA 1ZM1A 2D6PA 4R4ZA 5J98B 3VBRA 4NIIA 2HYKA 3VKNA 4BIOA 4YNIA 3M7AA 3JB8A 4IV3A 2VGDA 1JXNA 2WL1A 3VD4A 3ILNA 4XACA 4RSUA 1HV0A 5C8WA 3M2MA 3MYXA 3O1TA 1PZ8A 1B09A 1OI6A 1E5IA 5C3RA 3K48A 1EV13 4XIKA 3A22A 4I3PA 2VG9A 2TEPA 3LOIA 1J83A 3ZMNA 3JU9A 2A3WA 1JS9A 2KD7A 1QJX1 3GF6A 1BCXA 5C8CB 1RGSA 2ENRA 4IE5A 1CAUB 4LMFA 5C5UA 4XPVA 2BERA 5FPXA 1YFUA 3AZZA 2HBTA 3ZN6B 2X29A 2IZWA 2ZHKA 2A71A 1WA4A 2VQTA 4MYEA 4LO5B 1NLSA 1AYN1 1YJLA 4BQ1A 4GMP1 2RS32 3WDTA 5DUVA 2OS2A 2V73A 1OLMA 5KHHA 2Y6HA 4KU7A 5CFCA 2BVVA 5FZ0A 2RS33 1JI6A 1FX5A 2VXJA 1PK6B 2D6OX 5F3GA 1ODMA 5CADA 3UKNA 3POEA 1GP4A 2Z2SB 3U0ZA 4JKMA 4QXHA 5T55A 1SPPA 4YW5A 2ZGRA 3N3HA 1WMEA 2R6QA 3W58A 4D3WA 5HPOA 1JOPA 2ZA9A 1B35C 1UQXA 2BNOA 3LAGA 1RHI1 5FBJA 3NKTA 1AR83 1P8JA 4BM8A 5C6CA 4P08A 4JTOA 5FUIA 3LWCA 2RG4A 5CFDB 1H8TC 1HXS2 1ULGA 5ACA1 4O61A 4EQVA 1EYBA 1XB9A 2E6VA 2FDHA 3FWEA 1VBD2 1DYPA 4TN7A 3PUHA 3ACIA 3WG3A 5IK8A 1HXS3 2BTVC 1J84A 3I54A 3HEIA 2GALA 1RUJ2 2UY8A 4META 2P34A 1NA1A 3LDBA 1QJY1 2IXJA 5JMCA 5CG9A 1IKPA 3E5UA 1HB2A 1NX9A 4UFIA 2QE3A 5IVJA 2CDOA 1E5RA 2PFWA 1DYOA 3MFAA 3POSA 4QQPA 5KHIA 4Z92B 1RUJ3 2RMU3 2IVIB 1IS5A 1UOJA 4QPYA 3T2QA 3HT2A 2Y0OA 4C1WA 1POV0 3UV9A 1N1TA 2PQQA 4JQRA 5DG1A 5F6LB 1W2NA 2GN7A 2ZEZA 2V5YA 4XXAA 3T0BA 2D3RA 4HN1A 2YROA 3VB9A 4NAMA 4RS5C 1CIYA 3VZKA 3Q8EA 1UF2C 2DCJA 4JC1A 3O14A 5T5LA 2FMDA 5F32A 1LB2A 2OA2A 3W20A 1DHKB 4W4ZA 1ZZ9A 2WT1A 3O1MA 3VKOA 4LO6B 4LHLA 3GGLA 1EV11 5A3MA 1TE1B 2WQ8A 4Y26A 1BKZA 1XC6A 1GLHA 1LEMA 1CAUA 2EALA 1XJAA 1SACA 1W2OA 2H6CA 1ZZCA 2DVFA 1O8PA 1FI2A 1W8FA 5IFTA 4COWA 4LLFA 4AQ6A 4Q4Y2 4KBBA 1W39A 4CEWC 4I30A 3HOBA 3HQXA 2WR9A 1YYNA 4QX7A 5LA2A 3VKMA 1H8VA 4OUSA 3ZSJA 3DCQA 3U1XA 2WS92 2AH2A 4UYBA 2X5IB 2YY1A 2E9QA 1ULOA 4BQ5A 5CA6A 2DUPA 4ET7A 4FPCA 2XB6C 1N1VA 4KGQA 2W95A 2WS93 2RS31 3IPVA 5IUQA 4KG0A 3V0AA 1GICA 3T1LA 1GKBA 3WHTA 2RDSA 3VL8A 5I91A 2IFWA 5AFEA 3H7JA 2VM9A 4O9GA 1RUD2 4QGMA 4YG3A 5F39A 2OYZA 3VHOA 3GHNA 4C0BA 3U4XA 4HMZA 4GMP0 4NJ4A 4DMIA 4MGYE 5FFOC 1AR81 1ND3B 3GDBA 4LIVA 1YXWA 3K3OA 2CNAA 3NAPB 1W6QB 1DU3D 5A3OA 4E27A 5A6XA 5AC92 1OF3A 1Y43B 1BBT2 1C28A 1UN1A 1X50A 1GFF2 1XNKA 3OGRA 4TWTA 4XQ4A 4I09A 3AKRA 1A3KA 2ID4A 2JDMA 3WQ7A 5ANNA 2XR4A 3MO4A 1HXS1 4BISA 1BBT3 4BLJA 4SBVA 1C8M2 2PA7A 2XL7A 2Y6JA 1S2BA 4PF1A 2R043 1OLQA 1PM4A 5C8CC 1MS4A 4E4SA 3B94A 1A34A 3PDQA 1C8M3 5KWRA 2RMU1 2VTXJ 3QCWA 3LGRA 5JVVA 4GD4A 1QGLA 1W8OA 2IXHA 2H0VA 1LOEA 3VHRA 3RJ2X 5JPNB 3OTFA 1REEA 3ES1A 3KV5A 5CKMA 4YG0A 4A6SA 4ATEA 2HWE2 3W59A 1RUOA 1H1MA 3AP7A 1F5FA 2XLGA 2ZKLA 1UXZA 3RQ0A 3PJYA 1QQP1 1PK6C 4AEKA 5T52A 2HWE3 1RJ8A 3RI9A 1YJKA 4C8DA 4XUNA 2TBVA 2LROA 3H8UA 1WCQA 1RMU2 3ABZA 1GZWB 2VZSA 5A1FA 4IERA 4RHV2 3J7NA 5FIXA 4EWEA 3USUB 3WP4A 1NXMA 1QH7A 4JGYB 1PX3A 3T2OA 5CFDC 4IEOA 3V0BA 4RHV3 3IAQA 4LHKA 1JUIA 2VNRA 1UIJA 1QKQA 1WMFA 4ZY9A 1ZREA 2FDFA 5C9AB 2WQZC 2XJVA 4JV4A 1OHFA 2YC2A 1V6MA 2R1BA 4OI0A 5BNOC 4QM8A 1WKYA 2WO1A 2VTXA 2YU1A 2ZMLA 3MHZA 2WS91 5EZWA 1QH6A 4P9JA 4Y1XA 1MZ5A 5DAVA 4QHOA 4ZXEA 1VAKA 4K3UA 4UFHA 2H0BA 2JG9B 2GN3A 2Q4SA 1GZTA 2JICA 1ND3A 2QKDA 4HKOA 3DXUA 1H2LA 4CU6A 3NJZA 4DO0A 3HBZA 1W0NA 3WDYA 1JU4A 4INDA 4YPJA 3VN4A 3DV8A 1Y9GA 4YZ5A 2NLRA 4LXLA 1OMIA 1NZCA 4E2SA 4O9EA 5FLJA 5FBZA 4BQ2A 2EXJA 1T6GC 3AMHA 2HYXA 2DVBA 1C1FA 1BBT1 4XFCA 2J1AA 3VLBB 3ZXFA 3UKVA 5FY7A 2OZ6A 3MFCA 2R041 5LCWL 3S30A 3K4DA 4CUBA 3WY6A 1I1EA 5KXBA 5HI0A 1CAWB 1FATA 1JN2P 2QTWB 3PUAA 1R1ZA 4Y5TA 3VDDB 1VBA2 3T0AA 2A6WA 4YW7A 3BGAA 4XMIA 3ZYHA 4CP9B 3S5AA 2X5IC 3DEMA 3Q8FA 2NP0A 3AFKA 2ZMNA 2CGNA 4TTGA 3A23A 4KH9A 3OGVA 4RN5A 3O1RA 3OBZA 2OW4A 2XUEA 4DEQA 3MUY1 3B02A 1PX4A 5AVPA 3ZSMA 3CL1A 4MGQA 2YHJA 4XIOA 1W6MA 1ZBA2 2BJSA 2Q1FA 4QWNA 2OVUA 2V4AA 4FTBA 3FUOA 2E63A 1UX7A 3LCPA 1LGCA 3B3QE 3HT1A 1EP0A 4YZ3A 3I3DA 4ZS2A 3RI8A 4MGSA 1NT0A 3RMYA 2B9UA 3N36A 2R0HA 3NAPC 1U0AA 5EYYA 1F15A 3AYCA 4RHV1 2JIGA 1SG3A 1VIWB 3KCXA 5DDJ3 4HFSA 5JI7A 2XJSA 4Q4X2 5FOJB 3WF1A 3VBUB 3BU0A 1DF0A 4IE0A 4Q5OA 4KG8A 3ZXLA 4FAGA 1RUG3 3O0WA 5F5IA 1WLWA 5FYUA 3ZYGA 4B4QA 2JWPA 1V9U2 2IVJA 2DV9A 1IS6A 1GZ9A 1WCDJ 2VMHA 3HIFA 5FXWA 2WT2A 1XRUA 4QDRA 1CVNA 4RA0A 2VPVA 4I2OA 4Y1YA 1V9U3 2LRPA 4OLLA 3PVBB 4UF0A 4XDOA 4YZ1A 3R05A 3H8XA 3BI3A 4NR1A 4NIHA 1TNRA 2XJPA 1NCRC 1MS1A 1TZOA 2VW0A 3VBFC 2HWD2 5IAVA 4AF9A 3TEZA 3EYPA 1VPHA 3A0KA 5GZDA 4QKFA 1OA4A 5FZFA 4ES8A 1K5JA 4BB3A 2ADEA 3SHRA 4AGRA 3P3PA 3DYOA 4FP2A 3WF2A 4YW4A 3L2HA 4QXCA 1RUE3 4YM0A 4FFFA 3IDBB 1SEFA 1J1TA 5FYMA 4QX1A 4JGYC 4RFRB 4JDMA 1ND2B 1UY4A 5FKBA 4LNVA 3E5QA 3I3BA 4X8NA 2BDRA 1H9PA 5K0UB 1FAYA 1UL9A 3Q8BA 4JRAA 4CSWA 3H8OA 2AC1A 5C9AC 5A7NA 1JZ6A 2VMGA 1GBGA 2PELA 3MW4A 1KGYA 2CAUA 2ET1A 3J26N 4A4AA 3WDUA 5BNOB 3OBRA 4PLMA 4YYOA 4CDUB 2CDPA 2VXRA 5B4XA 3PNAA 4IXLA 4MX3A 5FLIA 5J1XA 3VD9A 4FTEA 2VTFA 3DECA 3GYDA 4HN0A 1RC6A 1N47A 5LY2A 5M0TA 1XQNA 4IV1B 2JG9C 4ISQA 1IKQA 1KS5A 4HT1T 2W1UA 1FXZA 2VW1A 3O1PA 4EE2A 1LKNA 3AL5A 3AM2A 3AP5A 1D2SA 1WCKA 4OMDA 2C26A 3IB3A 4OI2A 1KJRA 1O5LA 3LA7A 5DDJ1 5FQ0A 3AC0A 1RL3A 3B93A 1W03A 2OPWA 5GZEA 3WDWA 3BALA 4CEYA 2YV8A 4Q0UA 3MIHA 4XF9A 1TNFA 2GMMA 2GSYA 3RMXA 2W0XA 1RUG1 2VNOA 3K77A 3OGSA 1O4YA 1BVP1 4MZUA 1H6YA 5CU1A 5K9YA 3GZTB 4N53B 5FR3A 3BB6A 2MEV2 4GKXA 4JDOA 4ARXA 2EXKA 2Y6GA 3LD8A 5JZGA 4QX0A 4K1YA 5LRSA 3OEAA 2RE9A 4XMAA 2ZEXA 2A6XA 2JDUA 1V9U1 4XQWA 1Q43A 2N7GA 2YFUA 2MEV3 4IGOA 4OUMA 1UOGA 3ENRA 4CP0A 1PO12 3I59B 4LQRA 5IATA 3FLTA 3P1IA 4YVWB 2AEYA 3N9NA 2R0FA 3SEEA 1OFSA 4LE4A 4JHZA 1BMV2 3UGHA 4RGGA 3KZ4C 3J7LA 4EN9B 3D0SA 4XFBA 1H4GA 5EYXA 1UWWA 2ZGSA 2PLV2 3UK9A 1VBB2 1YUDA 4IEQA 3KHCA 1RUE1 2C9KA 1LHWA 2ZX4A 4PIZA 2O1QA 1RUI3 5K0UA 3ELNA 1JYTA 1NQJA 5EPAA 4Z82A 4YFZA 3AL6A 1W0PA 2ZGKA 1XU1A 2UYBA 3HQUA 3RGBA 3VBUC 2SLIA 4AI3A 3NVCA 1MS3A 2QQVA 1EUTA 3WDXA 5J3UA 3E6CC 1JYNA 4CDUA 1MS9A 3A0NA 1YFXA 3T4VA 3U37A 2XBO2 1X33A 3E6DA 3CJIB 5HBAA 4XUOA 4YFWA 4IV1A 5L7OA 1YFYA 2WNEA 4RR3C 5FZ3A 5FPLA 1JODA 1XNDA 4XURA 5CISA 1G9FA 3JBG3 3RZZA 3MV11 2OUJA 5LRRA 4NHLA 4FPHA 5F8PA 1OQ1A 2ARAA 2CV6A 2OZJA 2QQKA 4Y20A 5SV8A 5KXDA 1OBNA 4NO4A 1RUH2 2IXKA 2W68A 5IVVA 1SDWA 2MNGA 2EF6A 1HKDA 3HVDA 2IFRA 4NIAA 4JX0A 3MIEA 3OBTA 2O8OA 1UNBA 4QKDA 2PHDA 5F3CA 1JUHA 4WM8C 1QJZA 3QOPA 2EIGA 1S0IA 3THTA 2XXZA 3VHPA 1X9PA 4LO7A 2OUHA 1PNFA 4UFMA 2FDGA 2WBKA 1ND2C 2W2IA 4NWVA 1ULEA 3ZKUA 1WCUA 2YBPA 2WINB 3ZFFC 2FCTA 4GH4B 5KBFA 1IG0A 3USSA 1DLLA 4FOYA 1W8WA 1QY4A 2KXLA 1GWKA 3R4UA 4I02A 5FCCA 5LBFA 5LK5A 2MEV1 1DIWA 2QNKA 4G9SB 4Y22B 3S0MA 4WV8A 4NAOA 3D82A 4Y1VA 3MV01 1BVVA 1GMMA 1WD3A 2WWJA 4YW2A 2XHKA 3OUJA 3HQRA 2VU9A 4KI5M 3RDIA 4YM3A 4BHPA 2XOMA 3MGUA 1WW7A 4C90A 1KD7A 4KNCA 1DQ1A 1ENRA 4ZPIA 2A3YA 3CKHA 2NPIA 1OOPA 1ODNA 1OPOA 1NCQB 3ES4A 2Z5WA 4NUBA 2W47A 3ACLA 3WNMA 3P3NA 3RPQA 5J7MA 1LTEA 1RUI1 1Q8VA 2BGCA 1LR5A 1J3PA 1H1IA 4H7MA 2WN2A 4K21A 4AVVA 2UY9A 4IEYA 5FUPA 3HNBM 3POIA 4GIQA 2Q8EA 1K5MB 1ZRFA 5F2WA 3H3ZA 5DZFA 1UU6A 1ULFA 1C5IA 2PMWB 3O0VA 4WBBA 3CJIA 5FOBB 1U5ZA 2CWSA 3SQOA 1PVC2 2J42A 3MDPA 1O3SA 1O6UA 4H3WA 1QJFA 3ALQA 4CCNA 4LA3A 4NHKA 4S2GA 1PGL2 4LEJA 4CCEA 3KVBA 5BNNB 3VZJA 5FZAA 3O1VA 3F2ZA 4CU7A 2DU1A 2J1VA 1H2NA 2DVDA 3JBG1 3M3CA 4L0PA 5EHDA 4QB6A 2GC1A 2WFPA 2BGPA 5FO9B 1VBE3 5EP9A 1XU2A 4U2AA 2BWAA 1BZWA 3N9PA 3FN9A 3SMHA 3VDBA 1LOCA 2E7TA 2QQNA 4AVCA 4OUEA 2WZR2 1UW8A 4CDXB 5LB6A 1UY0A 4AAPA 4XF3A 3HAGA 3POJA 5JR7B 4HVOA 5FYTA 3GNEA 2XLAA 2VCAA 2YU2A 1J3RA 3CEWA 4FOQA 3OGGA 1REDA 2VZRA 3SITA 1W6OB 1VAMA 1WWYA 1XSQA 2VL4A 3AKTA 3WVJA 3ZXJA 2YGLA 2QQOA 3WCSA 1NG0A 1SMVA 1PHMA 4H14A 5F5QA 2J1UA 4Y22A 3ZOIA 4E2QA 4Z2WA 1GV9A 2GMPA 1AR63 4GWIA 4PQQA 4XFGA 3TOJA 4X6RB 5A6YA 1Q8SA 4BYYA 2ETEA 5I0DA 1G9AA 3LZZA 4PIYA 4MH0E 2R073 2G1MA 2DUQA 1NCQA 4FSJA 1DYKA 2KR2A 3NV1A 1B35B 3KS7A 3OCPA 5F2SA 4AE2A 3RZKA 2VCMA 4FPFA 3VD3A 4KWKA 3RZJA 5CG8A 2WA3A 4MGKE 1VALA 2E7AA 2ZBJA 1H8TB 1HV1A 2GNBA 1WUVA 3DPRB 3QBQA 4PDWA 4YLZA 1FNYA 4E2GA 1K5MA 3WW3A 1JYXA 4GA9A 3OOXA 2C24A 2EIEA 1Y9QA 4AHYA 4V2VA 2J1TA 5E8AA 5F9TA 2VC9A 4LTAA 3UNPA 2WSVA 3ZYFA 5E89A 1NXD1 1W06A 2JDHA 1NOVA 1D0HA 1F4HA 4OCTA 3OD4A 2HWF2 4QX2A 2ARXA 1A8DA 1SFPA 2A70A 3BPSA 4GH4C 3GJBA 4Q0PA 5FYBA 3TEYA 3I49A 4FPYA 1AVBA 3N9MA 4W6WA 3CZUA 3DGTA 1NY72 2QZ2A 1QXPA 4A2UA 5FZIA 2HWF3 2FHRA 1FT9A 2ZAAA 4MXVA 1VBE1 1JH5A 1DP0A 2D7FA 5A33B 1I5PA 1CJPA 4J1WA 5IWFA 2JB8A 1RHI2 5IVFA 1UO9A 1HJFA 2BOIA 4XW3A 2FZ2A 1LJ7A 5BUVA 1G9DA 2IUWA 1XE8A 5ACA2 3ETPA 4YW1A 4Q1PA 1FYUA 5A32B 4ZS3A 4ASKA 3B5LB 4D6SA 4EJRA 2RR12 4HKLA 3BYWA 1YWKA 1M06G 1AR93 1HRI3 2VOKA 4HLTA 1W8UA 4UBHA 1W8NA 2D44A 3QACA 2RR13 5T5PA 1QJY2 3RWNA 1X8MA 2GH8A 5DG2A 5ABJA 3I2DA 1L7RA 4X6QB 1ASJ3 1YQ8A 4XCBA 4XF4A 5FZOB 5LW9A 1DGRA 5SV5A 3WNKA 2P6HA 1AR61 3AMPA 1UMIA 1YLLA 4ZU7A 2F17A 1F31A 2BBAA 3VKLA 3LIGA 3ZFEB 3VBOB 3WW2A 3RZGA 1CR7A 1EPZA 2YB7A 1B35A 1QWRA 2DURA 4MHUA 4HETA 3WSOA 4B8EA 5A3LA 2R071 2RDNA 5BNNC 5BNPB 4U36A 1MEC3 5IVCA 1MVEA 2AZ5A 3CLPA 5CVRA 4YSFA 1HJGA 5IHRA 3POWA 1RUC2 3BOPA 4N90A 1Q5OA 2D40A 4QX8A 1EV12 2B8MA 1VLNA 3KSCA 2ZABA 1OURA 1RUC3 3Q9OA 4QPGC 4A45A 1S0FA 3GXUA 3O5SA 4YRDA 2JG8B 1CESA 4EN6B 4CDXC 4EWAA 2RJ2A 2VZTA 2VULA 1DGWX 4D6QA 3E6BA 3N9QA 1WMXA 4JGZB 3OSDA 4UFJA 3SCGA 3ZIXA 4B29A 2LTNA 4GWNA 1BEV3 3A21A 1MS8A 2VMEA 2XKOA 1V6IA 1AJOA 3N7KA 4RS5A 3LEMA 2A73B 3M1HA 3BTXA 2ORXA 4CCOA 1YHFA 3AMQA 3CBNA 2QBXA 1HDKA 1GUIA 3G7DA 4MUVA 2HWF1 4RGAA 1VMFA 1V6KA 4XHXA 1AXZA 4XTMA 1F2NA 4UOJA 1LOAA 2DBIA 5FPBA 3RG0A 1NY71 5F7UA 5JIAA 1DGWA 2A6VA 4OHVA 1AR82 4FOVA 1GYKA 4C91A 1T2XA 3DKWA 3UESA 3KT1A 3VGIA 5JOZA 1W6NB 4CEWA 4H7LA 2GDFA 1VBC2 1OXCA 1W04A 3BVCA 4W65A 1ZZ8A 3DPRC 3VBSA 1ENSA 3V65A 4Q4W3 5GLZA 1AR91 1HRI1 2XVLA 3N35A 5F37A 4XJ8A 1VBC3 1AJKA 2XDVA 2RR11 4J1XA 3MLLA 5KR7A 4IGPA 3IDEA 1ASJ1 1HB4A 3OYWA 4KQ7A 4AEDC 4DOUA 2RMU2 2XONA 4WZCA 3U4SA 2PHWA 3K46A 4UW5A 2BNMA 3R4DB 5EIYB 1IS3A 5C4WC 1NQDA 2DCZA 1NE4A 3D3AA 3H1YA 5JCTA 3K4AA 1XE7A 4P02B 3TN93 1MEC1 1QQP2 5FK7A 4OYUA 2QDRA 1EAH2 1GNZA 2WLPA 1RB8G 1H2KA 2W52A 5H9QA 1OQEA 4MVTA 1O3QA 1QQP3 4ISRA 1MR5A 4AYUA 4HSLA 4CCKA 2G9FA 1EAH3 1O59A 3CU7A 4K8RB 5FZ4A 4CU8A 1AUYA 4YVSB 3ZO0B 1RUC1 2HWC2 2D3PA 2RDQA 3ZFGB 3MF9A 5IVYA 4ES9A 5FWJA 4NIGA 2WNOA 1X7NA 5C8CA 2XLFA 3T3YA 2F4PA 4ZXKA 4B1LA 5IYYA 2HWC3 3JUUA 3C3VA 4FXKB 4HK8A 2CU5A 4LIUA 3ZN6A 3IDAA 5A7WB 4AVBA 4BJ0A 4FQ4A 4XCAA 4L97A 3WW1A 1W28A 4AHWA 2ZAHA 1VRH1 1LU1A 1BEV1 3LB9A 2E7QA 3PIGA 5FPZA 3UGFA 2R49A 4V2WA 1U5YA 1J58A 4AHXA 4R8HA 3KGZA 5CFCC 2QDNA 1YRZA 5L36A 3M70A 4CRQA 4R9CA 1FPN1 1PK6A 1GOHA 3ST7A 1LULA 1RXGA 5LATA 3ITQA 2B4KA 1WD4A 2WKKA 3ZFEC 3B69A 3VBOC 2OKXA 4Y33A 2JX9A 1OKQA 3AYDA 3B9IA 5FYHA 3WQ1A 1ACCA 1CN1A 5BNPC 1W6NA 4OZOA 1DLCA 4YGEA 3AZVA 5CFDA 1MS0A 4P5YA 4KWUA 1CAXB 2WRAA 3HN1A 2X53S 4IEWA 5D8AB 5KXCA 1TMF3 1U12A 1LRHA 3CZJA 4B1MA 3P5BA 4Q4W1 4AI2A 2Y60A 1C4RA 4ORFA 1VBC1 3M3OA 4HVRA 4NROA 2JG8C 2R042 1ULPA 3LPGA 3MLJA 1CPNA 5I8YA 5IVBA 5CNAA 1NA1C 4LBLA 4EN0A 1SDDB 1XYNA 2Z79A 3AFGA 3J7HA 3S7EA 4AQ2A 4DNYA 5A70A 3EBRA 4NRMA 4AOCA 1RINA 2TUNA 3CNAA 4P00B 4JGZC 3ZSLA 3MIGA 4AVTA 3N4MA 4GQ7A 5L73A 2VY0A 3G6JB 2YG0A 3NKGA 1O4ZA 1QJU3 3NWKA 2Y6FA 3POYA 4LO4B 4AEMA 2VBPA 3TN91 3BTZA 3POFA 1CIWA 1ZRCA 4IW3A 1QJEA 1NCRB 3VBFB 4GALA 3VKFC 3MIFA 1SHWB 4IL7A 3MBWA 5HCHA 1EAH1 2R16A 2XKPA 2JDNA 1W2TA 1CGPA 2MPFA 4BMEA 1XSRA 4QPWA 1SLBA 3WLUA 4ONUA 4HONA 3OPZA 5D8AA 2HWC1 3ZM8A 1YC61 3FMGA 3A4UA 1JZ8A 1N3QA 2YBKA 2EIDA 4JZRA 1L7QA 3ZXEA 1UKGA 4I3GA 3AZYA 4XAAA 4P5HA 3ACFA 4AXOA 1UYXA 3FL7A 5I8SA 2X5IA 3ZDVA 2PQSA 3GHMA 4QGLA 4CA9A 2V5DA 4HL0A 2CGPA 1U5XA 1NE6A 5L9BA 1V00A 2Z4FA 4R4XA 2ZX2A 1FOD3 3I3EA 4LKEA 2B45X 4E8DA 5FPUA 2WNVC 2WJSA 4LO8A 2VUDA 2DYCA 3OUIA 2ZMKA 1QOSA 2XJRA 4KU8A 4LBOA 2WWSA 4QKBA 3NAPA 1W6QA 4ITCA 1POQA 2PHXA 4QQOA 1LAJA 1K42A 1FNZA 2BWCA 3H0OA 2E32A 1ONAA 2W39A 3OJBA 3QH7A 4JKKA 4RD7A 4UWDA 3TNPB 4MGTA 1TMF1 4YVSC 1MQTB 3WR0A 4DUWA 3ZFGC 5CAZA 3ECQA 1QOOA 5KC5A 4G3YC 2DTYA 1UZZA 2IWGB 4MADA 1PMJX 1PGSA 5A6ZA 3RZMA 3VZOA 3WD5A 1MZEA 5LZ6A 4TLFA 4CVUA 5KHJA 1CZTA 5GLVA 5IK5A 1QIQA 3WNLA 1ZNPA 3ZSKA 1QJU1 2BOJA 1APNA 1NCRA 1YEWA 2WC2A 5A7PA 2LALA 3I3MA 1X36A 4ZU4A 4DXTA 5FZ1A 1UPIA 2YZ4A 2R063 3I2HA 1O8SA 4QXBA 3WZ1A 4Q2FA 4AW7A 2E33A 4DPNA 1NLQA 4QQLA 3O7OA 4UAPA 1BJQA 3SKVA 3KV6A 5DAXA 5FMOL 1GZWA 5JPMB 5FZKA 4DUXA 1XNAA 2PXJA 5D21A 5HV0A 3USUA 2BZDA 4BE3A 4ZZ5A 4JGYA 2NM1A 4QQ2A 4YM1A 4AR2A 4PT6A 4OULA 2C0ZA 4HPKB 2IXCA 5FY9A 1DZQA 3BCWA 1CPMA 5DDJ2 2NMNA 1COV3 3P6BA 5D8AC 4IEPA 1O91A 1DZTA 2FDIA 5C9AA 3DYMA 5FZBA 1IPJA 3MZHA 1RUG2 4IE4A 3W21A 4N7UA 5LBBA 3DKQA 4GXLA 2ZZJA 1UD1A 4AL9A 1JYVA 3LKJA 2X05A 2ZGNA 1HRV1 4Z8BA 4Y24A 5FYZA 2GP3A 1KFXL 3IT8A 4XEZA 5D2AA 2XQRA 5J48A 1FOD1 4E4ZA 5FPVA 3NL1A 2JG9A 4RR3B 4QPIC 5IK7A 3UETA 4IDZA 3LA2A 2ZGTA 1H4HA 2XMLA 4M3CB 4OI1A 3SH5A 2MHFA 1UY3A 2JXAA 4XF0A 1BK0A 3CO2A 1H30A 4H55A 4BQYA 3BU7A 2HEVF 4L99A 4LHSA 4Z1VA 5FY1A 2JE9A 3L2YA 1YNAA 3OPTA 3ZIWA 4IEZA 4LOTA 1WLDA 3Q8AA 1IQDC 1RUE2 4QU1A 3BIWE 4GULA 2DFBA 2W1QA 3QLQA 3R6SA 4WM8B 3FJSA 1KITA 1LGNA 4XZUG 2DWRA 1ZYBA 3PUQA 1CAWA 1RTVA 4AGGA 3KCCA 3VDDA 2XVKA 3AVRA 2EXIA 3WQBA 3LOBA 5F6KA 3ZFFB 1D4M3 2PYTA 3MPBA 2XQXA 4QDQA 2J1SA 1H1AA 1W05A 4Q26A 4CP9A 5LEJA 4QQHA 5J96B 4TLGA 4ASMB 1OSGA 2R061 4LA2A 3SNMA 2VZ1A 4YZ4A 2CGOA 1GANA 4K20A 2ZGOA 2Q8CA 3EO6A 1D7PM 4A44A 3DUIA 4AFMA 2EIBA 2C1FA 2R1DA 4H2AA 2YFZA 1W0OA 1BQPA 1RITA 4CCDA 2A3XA 5DQ0A 3ZSEA 4CUGA 2UURA 1SBEA 2WSUA 1ZA4A 4GKYA 4DXZA 5FMOS 3AP9A 4M3CF 5BY5A 1UAIA 2JIJA 4QKNA 5G05L 1COV1 2WQ4A 4WVMB 5C5TA 4BXSV 5A7SA 3ATGA 1UZWA 3PURA 3VBUA 3WINE 2RV9A 1MQTC 1XPWA 1ULDA 3C2UA 1G9CA 1R083 4RQPB 1WLCA 1RUF3 3CJXA 4NHYA 2BPA2 1JBCA 2ZPXA 2CTVA 4M4RA 1IZ3A 2QQMA 3I2KA 2ZEYA 4Z2AA 4RR3A 4F7ZA 3K3NA 5FJHA 1V6LA 5DUWA 3C7OA 4K9SA 3VHNA 3FZ3A 1WLTA 5JXHA 2CYFA 1SLIA 2Q8DA 4M0NA 1ZX5A 1Q8QA 2HWB1 1EPWA 3ZXDA 1NLRA 1OD3A 1G7YA 3EJKA 1OH4A 3MF6A 4RL7A 4R52A 4XOGA 4CDWB 4CDQB 3VDCA 5I0TA 4CCCA 4L9BA 3AJZA 1UXXX 2VNGA 2QQUA 4CE8A 1PVXA 4MGZE 5A3PA 3NV4A 5AVAA 4Q27A 1RUI2 4CPBA 5FXXA 3WP6A 4I0WB 1W9WA 1ND2A 1C57A 4GB32 5A3NA 4AEJA 5EJ3A 3AP4A 2RS53 3ZFFA 3WNNA 2ADDA 3C7GA 4YGBA 1S0CA 4GB33 3S5QA 1QDCA 4MO3M 4WZFA 1V6JA 1D4M1 3I4IA 4LBNA 2YGMA 3WCRA 1GWMA 4XC9A 4PI0A 1WBLA 3TRSB 5LA9A 3ZR6A 5C3OA 5K8SA 1AR73 1I6XA 1LOBA 1UKRA 1UPSA 3K75B 3PVNA 3BUCA 5BNOA 5LA1A 2AEZA 2DFCA 4AI0A 1OVSA 4B7EA 2UYAA 4R9AA 2VH9A 3EMRA 3U14A 4CPBD 3JBG2 3LEGA 3IIIA 5JI9A 5FMDA 3DXTA 2LS6A 5FKCA 3T2TA 3ASIA 2XUMA 2WAAA 1FMD2 3FLPA 1XE0A 3ZDSA 3LA3A 1JU3A 2Q30A 3AB0A 5DAQA 2Z42A 2ZX0A 3MI8A 2RHPA 3CMGA 2XJUA 1FMD3 3I2GA 4GJZA 1QNYA 4DS0A 4NMIA 1ENQA 3WP3A 3JCIA 1U5IA 2ZHLA 3BPZA 3ZYBA 4AWDA 3PLQA 4K40A 4FT8A 2W5FA 1R081 4D6RA 3PVEA 3HD8B 1W9SA 1WMDA 1RUF1 4BQWA 4LBQB 1REFA 2D6NA 4N53A 4WM7B 2VCCA 4YGCA 5FMCA 5EV7A 3UJQA 3SLIA 5EQUA 3GJAA 4LBJA 2WO7A 1SCSA 3E1F1 3TEWA 1M4WA 5EWSA 4E4DX 4J25A 1D4VB 1UYPA 2RM22 3AKQA 1IQAA 1LNSA 5HV4A 1AXYA 2R30A 5L9VA 3IN9A 2A6YA 1HB1A 2WNUB 5JDBA 3RJRA 4JDNA 1HB3A 1NUKA 1WGPA 2V09A 2RM23 1MS5A 3I59A 4HANA 1QU0A 4P9GA 4YVWA 1LESA 5CB7A 1S55A 1PMHX 4N9IA 2WFF2 3HN3A 2ZOEB 4W6YA 5DABA 4BPZA 4Y3OA 1X9TA 2F6BA 1ZBE3 4DY5A 4QT6A 2WFF3 2E51A 3LEKA 4MHRA 1LENA 5DXDA 5T3NA 1F35A 1Y3TA 3WW4A 3WUCA 3GZEA 2VR4A 2CAVA 3EHKA 2FCVA 3LQCA 3OGJA 4GZ9A 2YDEA 5IT6A 2B39A 2RS51 2A6ZA 1AL0G 4LT5A 1H2MA 4PQ9A 1KXGA 1XBFA 2W94A 5C3PA 4GB31 5FXZA 2W9XA 4FAHA 5E1RA 4RQPC 1Q8PA 4Q8KA 1AR71 1VB2A 5J09A 5FY5A 1RVF3 2JEMA 1BHGA 1LOFC 2BFUL 1FV3A 4AGVA 2YPJA 1MZFA 3NJYA 2OX0A 5J36A 5L7OC 1KFUL 5E16A 1VP6A 2ZS6B 2ATFA 1Q56A 1YCIA 1ZRRA 5CBLA 5IFPA 3VBHC 1VBE2 1CAVB 2WIIB 2FZ1A 1NZIA 4LUKA 3EB7A 2VZVA 5FZLA 2YC4A 3HNMA 3CIHA 4FP3A 1LODA 2P17A 5A7OA 1FMD1 4CDQC 4CDWC 4M00A 3WV6A 4CXWA 2JD4A 3NNLA 4N43B 3THDA 2RS13 4QGNA 4QPGB 2FCUA 4P9XA 3BKZA 3GBFA 1OT5A 1QF3A 1S1AA 2VVFA 4B3NA 3M8LA 3WG2A 4XZPA 1VR3A 5FZ9A 3WG1A 3BOWA 3MICA 5HCBA 2B5HA 3I2FA 4PJYA 1UMHA 2QUOA 2XGXA 2XWBB 3B01A 3Q8CA 4GH4A 4AHZA 2QQPA 3ZYJB 2BBVA 1GSLA 1AR62 3CDZB 3NJXA 2DCKA 4E8CA 1J59A 1E5SA 4A3XA 5CKNA 4J6GA 1PGW2 4BU2A 2RM21 4LBQD 2R072 1SFNA 4COZA 5J37A 1ZA7A 2L9LA 1S0GA 3W9AA 2R32A 4M4PA 1TVGA 4S2HA 4AQSA 2K0GA 1ZBE1 1URXA 4NPRA 1H9WA 1S0JA 3ORJA 2WFF1 5FZ8A 5DUXA 4HVQA 1POV3 1C3HA 3OY8B 3MEPA 3F95A 3M4FA 2VCBA 4FPJA 3D0JA 4NPLA 4D94A 1JZ3A 1PIV3 4UFLA 1VRBA 3C7EA 3H3LA 3JD73 3KVAA 2ZX3A 2X09A 2PAEA 5JXIA 4XUTA 4AEDB 4DY3A 4FO9A 5GM0A 3AK0A 4Y4RA 3CHXA 3FHAA 5C3QA 3E5XA 1RVF1 4WM7C 3HNYM 1F9KA 5I0UA 3T4HB 2OPKA 4FPOB 5C33A 4CXYA 1W9TA 2ZGPA 5L9RA 3DYPA 3VD7A 1DG6A 5BXXA 2WN3A 2QZ3A 2W92A 5BNNA 1NKGA 4CP1A 5C4WB 5BPXA 1CAVA 3VBRB 4FFGA 3PTYA 4N8MA 4W6XA 1US2A 2WUHA 3J9SA 3LEIA 5FP8A 1AL23 4LK7A 3HJRA 2F4LA 3FBMA 1A8MA 2BFUS 2RVAA 2VBBA 2WNUC 3U78A 3WP5A 3ZYRA 4W8JA 5HCFA 2YYOA 2QFEA 1VB4A 4N9HA 4UXAA 3PTRB 2Q1MA 3PJQA 4WVZA 5FWEA 4UBGA 4ZONA 3I97A 5L19A 4CDXA 2FDKA 5F3EA 2RS11 3FLRA 4UFKA 1SZBA 2P3IA 1D2QA 1O7FA 1HN1A 1S4CA 4AFCA 4UT5A 1AR92 1AYM3 1HRI2 4KL1A 5JUVA 3NV2A 1W6OA 3BTAA 1W3VA 1MZ6A 3FFZA 1ASJ2 3GBWA 2BW8A 4PF5A 2O14A 1R1A2 1W6PB 1XYOA 1YQ2A 4LK6A 3NQHA 3GBGA 2XPJA 1AXKA 2KM2A 4DZGA 5FMBA 2K2SA 2GNDA 3AXDA 2P37A 3MLKA 4GJYA 5CFCB 2BVBA 4TSVA 1R1A3 2A75A 5I93A 2XH6A 3SCHA 1V70A 1US3A 2FQPA 2DTWA 3HMYA 3WNOA 1MEC2 1IOAA 1H6XA 2GAUA 5DUUA 3WX5A 3VD5A 3AKSA 1PGW1 2C5DA 3ZPOA 4QDSA 1ALYA 4QB2A 4RFT0 4AQTA 4RYDA 2ZTNA 2CY6A 2ZHMA 1W3XA 4LKDA 5JOWA 1H8TA 1POV1 3DPRA 4URTA 4L92A 3L9JT 4O65A 4IUGA 3UYJA 3U75A 1OD5A 4KGGA 3SC7X 4XUPA 4XXPA 1PIV1 4N43C 4ZZ8A 2BP6A 4BZ4A 1UY1A 4JQTA 3VDAA 2DUOA 1KDKA 1UZVA 3JD71 4QX5A 3WOGA 1PO23 3WXPA 1L7LA 2BUKA 4F83A 5JSPA 3OBAA 4IEUA 5LASA 4QMAA 2P3YA 1NA1B 4XJAA 1VRH2 2ET7A 1BEV2 5GLUA 5C4WA 4HSJA 3RYPA 3TB0A 4EN8B 4EROA 2VBDA 3R4SA 4QAWA 3AYEA 4XILA 1VRH3 2ZGLA 2RJKA 1FPN2 4L11A 2C6SA 1W9YA 2OQ7A 1JYCA 1AL21 2BRTA 5LEKA 4AI1A 4ZKTB 3W5NA 1FPN3 1YQ6A 3B00A 3MUZ1 5FZ7A 2PHFA 5A33A 5APAA 5T54A 4KWLA 3C7FA 3JXSA 4F8AA 4G4FA 1CONA 2JENA 3DL3A 3NW4A 4EN7B 5CKQA 5A32A 2VOXA 2VO5A 2JDAA 2RDRA 3PU8A 4JCKA 4Q4W2 5H9RA 1AYM1 3OPWA 1EY2A 1ULCA 3ACGA 5FZCA 4DFSA 1W6PA 2YBSA 4EV0A 3GZUC 5IVEA 2JD9A 2Q0AA 3PIJA 2AUYA 3PU3A 4AK3A 2VMFA 4DQAA 5FZOA 5ABJC 2XL9A 3O1OA 3WNXA 1OPMA 1Y4WA 4I0BA 3FBYA 5DN2A 1Y9MA 3SEPA 3JQWA 1TEIA 3D5OA 5FY8A 1SLAA 1XYPA 1R1A1 4CYDA 3ZFEA 2PN5A 3VBOA 2QCSB 1QOTA 3IPVB 3SH3A 3V0AB 2Y64A 3HBKA 1C1LA 3TN92 2XWJB 5BNPA 2DF7A 2J22A 2BEOA 4XFFA 3VBRC 1I9RA 2WNVB 4QHBA 4AG4A 4CUCA 2YPDA 3LF7A 4HBNA 4FBFA 2K9ZA 4CZSA 1PNGA 3RSJA 4IV3C 1FV2A 5A80A 2ZX1A 4OHWA 1O5UA 2JDKA 1HQLA 1TG7A 5ISLA 3PUIA 4FTSA 4WVVA 1UIKA 3R0RA 3ZXKA 1DQ6A 2ILMA 2J1RA 3BN6A 4M3CE 2JG8A 5FZDA 2FD8A 3J4UH 2ZXQA 4TXWA 4OQ9A 2B7YA 1OF4A 3WF3A 1VBD3 1JYIA 2UWBA 3PL0A 1JZ2A 1PO21 4BLIA 4UW4A 2NYYA 3KM5A 4GWJA 2Y6LA 4JGZA 4BQ3A 1O4TA 3THPA 5KXEA 4BK5A 2ZGQA 4B4RA 4Q0SA 2I07B 1WW6A 2VNVA 1K3IA 1C8NA 2Z69A 3H50A 2A5ZA 2HKXA 5FYVA 1X8EA 2G4IA 5FTTC 4XE9A 2NQYA 1S0EA 4DB5A 3AXEA 3WHUA 2EA7A 4FFHA 1IGOA 4B4PA 5FO7B 4XJ9A 1GNYA 2HEWF 3PVOA 4JKLA 3T09A 2E53A 2JDZA 3ETQA 5GZCA 4D8MA 5JSOA 4IE6A 4P9WA 4ZU5A 3JQXA 5AFBA 2BYVE 4QX3A 3SCFA 5C3SA 1QDOA 1DQ2A 2XVGA 4IESA 1TMF2 1YFWA 3BIEA 2C9AA 1W9FA 1PM7A 2HH9A 3GM8A 3VBSC 5DMYA 4Q4Y3 1DBNA 3V0BB 4M0HA 4NPMA 2ZGMA 4UW3A 4FI9A 1XNTA 3M3IA 2BQPA 4K8FA 5FP9A 3IMNA 3RYRA 1SCRA 4LKFA 3LE0A 1YI7A 1UYZA 2VZUA 3KHBA 4HKWA 3KB5A 3FFQA 5IK4A 5LY1A 1QJU2 2K46A 4LBKA 3WF0A 2WNVA 3O1SA 1PZ9A 3TAYA 1IG3A 4PHZA 2GMEA 4IQPA 5FZGA 4NN0A 1PMIA 5KHGA 4QPIB 1S2EA 2KA3A 3J8F2 5F5CA 5T5JA 4EZHA 4OHZA 4FXGB 5JMOA 1CQ9A 1JHJA 1OVPA 1RUD3 2QQWA 1QEXA 2VVDA 2C4XA 4MGIE 4OFGA 5A1LA 3O1UA 3J8F3 2JJ6A 2GP5A 1RYYA 5E88A 4ASLA 4YVSA 5AC93 3ZFGA 2BNNA 2HEYF 1G8WA 3RS6A 4LPLA 4DUVA 3TNQA 1LGBA 1VBD1 2WT0A 3POBA 3IZOA 2VZQA 4OHXA 4Y5SA 5FP3A 1LCLA 4LLOA 5A7WA 1RUJ1 2WZEA 5DAWA 2D6LX 3B9CA 1GQPA 1V6NA 1W2AX 3MW2A 2I2SA 1GZCA 2PTMA 2Y6KA 4LULA 2VUJA 5FPAA 1HRV2 1K45A 1S0DA 4AFBA 3AX4A 4B7KA 1HW5A 5C71A 3IMMA 5D1IA 1T6BX 1FOD2 3UJOA 1HRV3 4A3ZA 2VOWA 3ME2A 3ZX7A 1ST8A 1VAVA 3QH6A 1IS4A 3LIHA 1RUNA 1RIRA 2XJTA 1W6MB 3RRDA 1GU3A 2WAOA 5GALA 3V56A 1Y7BA 2YUEA 1RMU3 1CAXA 4Z07A 5FY4A 2D3SA 4CCJA 4E4HA 1BLZA 1MVQA 3KV9A 2QJVA 2DVGA 1LHVA 2J7MA 2V4VA 4FCAA 4HG6B 4P9IA 2LUWA 2JE8A 2G9ZA 4XFAA 3SKJE 3U10A 4DRRA 4Q4Y1 3LFIA 4N7IA 2I74A 1HLCA 3GCXA 4A7YA 1KRIA 4LJHA 4PBPA 1Z7S2 1CX4A 4AVAA 3IKWA 2X10A 4PCRA 3TEXA 4IEXA 4CUAA 1JZ4A 2B9VA 4NE9A 4ATFA 3RNSA 1ENXA 1Z7S3 3WEZA 1AX1A 3WQ0A 3KV4A 5KC6A 4NIDA 4E9KA 4Q8LA 4QPIA 2WYFA 1J1LA 2D6KA 3M3QA 1ZRDA 1NYWA 2EVXA 2BGOA 4XDQA 4FPEA 4LORA 1IPKA 1EUUA 1AX2A 2CWMA 2R062 3POGA 3KLSA 5FREA 4UF0B 1QHDA 4PLNA 5B4NA 3NJVA 1Z0HA 2FDJA 1OKOA 2QQIA 5T5OA 3A7QA 3VBFA 4CCLA 5GLTA 3OB8A 1RUD1 3NRUA 3CF6E 4JTNA 2XG3A 5HCAA 3J8F1 1V0AA 1JOJA 1DFQA 1DQ5A 4HOOA 5AC91 4FPGA 4XFHA 2CL2A 2PHRA 1TQ5A 3ZPYA 1J3QA 1MACA 3MW3A 2VQAA 2GNMA 4R9BA 2VOVA 4RGKA 1COV2 5C70A 1UYYA 3UKTA 1C8M1 3AZWA 4S2FA 4Y1ZA 1DCSA 1CWPA 4HK9A 1H0BA 4S2DA 2HBUA 4IGQA 2RJLA 5A3WA 2WYSA 5CEHA 1JHNA 4XUQA 2VW2A 3FE5A 3ILFA 3DF0A 1VBA3 2HLEA 3FUQA 3SH4A 3H9AA 2GNTA 2O0OA 4HXCA 5JWPA 1WA6X 2HWE1 4XBLA 2IXLA 1UU5A 1YO8A 2VJXA 2Y8KA 5EJZB 3KF5A 4IEVA 4COVA 2HWB2 4Y1UA 4O7XA 5ANQA 1YQ5A 4D7YA 1LHOA 1SLTA 3ON7A 3M3EA 3RWKX 3ZXAC 1ND3C 5I8TA 1ZBA3 2D5FA 4PI2A 4AI9A 1RMU1 2HWB3 3H1MA 3RZLA 5FRAA 5EFUA 3NNMA 3S57A 1XOYA 1DZRA 4MV2A 4XHBA 2OQ6A 1IHMA 3I7DA 2ZACA 4BIFA 1MQTA 1SQ4A 1N3OA 2W1WA 4BA6A 2GH2A 3HWJA 1GP6A 4R9DA 1UOFA 3PHMA 5FQ0B 3OD0A 4CEYB 3APBA 2WLQA 3NNFA 4Q4X3 5E6HA 3VZLA 1BYHA 3MIDA 3AMNA 3HPNA 4UW6A 1LOGA 3K51A 2E31A 1D4M2 1L3JA 3FC0A 1Z7S1 3KQRA 3AMMA 3VZNA 3OEBA 1G86A 3IAPA 3VL9A 3GZAA 5JZGB 2P6CA 4K6BA 1C5HA 2GC2A 4QD2A 4D69A 2V72A 3IBMA 4TZDA 1SFYA 2ZJCA 1JMUB 2PHLA 4BH9A 5C7GA 5GZGA 1HN0A 5EXOA 4XFIA 4OQ8A 3NV3A 3EQEA 5FYSA 3PMEA 4YW6A 2VECA 2D93A 2JB4A 3O0XA 2HWD3 3T2PA 1SLCA 1G9BA 3RYKA 1UU4A 4PLOA 4D0QA 1QMJA 1RXFA 3I2IA 4JAAA 3UGGA 5CIRA 1GR3A 4M01A 3VV1A 2X8KA 1I3HA 2P2KA 4LUMA 1AZDA 3CQOA 4HPKA 1GOGA 3WF4A 5JSRA 2AREA 1SBDA 2VMCA 3GCWA 5HXMA 5JLVA 4Q29A 5H9PA 5LBEA 2UU8A 1VMJA 2LW8A 3IM0A 3KWVA 1R082 1W8TA 1W8ZA 1RUF2 5I0RA 5A3UA 1OUSA 2PAMA 3IIAA 4BMBA 2AENA 1VBA1 2G9GA 2YC0A 1JZ7A 1W8HA 4FPLA 3MIBA 1ZZ7A 3U07A 2P5BA 2WZPP 4JVAA 4C0HA 3D4KA 1DDLA 2Y0IA 4DEVA 3AP6A 5BV6A 1UCXA 2YMZA 4UI9L 5L7OB 4BWOA 3I2OA 3LDKA 1CZSA 1S2KA 4M3CA 3WDVA 5F1RA 3VZMA 3WG4A 3ZXGA 2VZ3A 1UZYA 1YI9A 5DZGA 4FPKA 3VBHB 3FX3A 1ZBA1 4ARYA 4OHYA 5A6QA 3H3UA 4Y20B 4JHTA 4V1PA 1E5HA 3UL2A 4EWDA 3X29B 4LR4A 4MSVA 4PIXA 4AFDA 5FJKA 2OIIA 1CX1A 2ZKNA 1LU2A 3WNPA 1R092 1W90A 2DBNA 2VD7A 2E26A 4L2NA 4NHMA 4WM8A 2WDBA 5FZ6A 5JIUA 1GP5A 1OC1A 3D6EA 1OQDA 4P9YA 5H9SA 2RS52 2WO3A 3FHIB 4Q4X1 5IJRA 1OH3A 2EAAA 1R093 3LPFA 5A3TA 4LOSA 5FY0A 3VDDC 5LA0A 1RJ7A 5GZFA 4EYUA 5LBCA 1QNWA 4KBZA 2JDPA 1AR72 1S0BA 4I01A 4Q1RA 2SBAA 5FYCA 3H1WA 4DRVA 5BNQA 3KF3A 3T0DA 3I2JA 2VMIA 2Q8OA 2VQ0A 2ARCA 1JYWA 1BXHA 3N9OA 4COUA 2Y34A 4XYXA 5JOYA 1AHSA 3K2OA 2BU9A 2JKXA 1ZZBA 3BTYA 1PO13 2HWD1 3C8XA 4YW3A 3AYAA 5A7QA 3T30A 5DZEA 1OLME 3V64A 1SLLA 2O8QA 1HQNA 3KT7A 5ERLA 2JE7A 1OOPB 2AGSA 2D6MA 4GAZA 4XJUA 4XBQA 2VZOA 4BQ4A 4CU9A 2PLV3 1VBB3 1NAEA 4Q4V2 2IXIA 2P1BA 3VUOA 1O3RA 4WVMA 4QXKA 2G19A 2OT7A 2NMOA 3INAA 5GLWA 5BYNA 4BCUA 1OA2A 2NN8A 4AZZA 4NRPA 4QU2A 4NRQA 4D7SA 4Q4V3 4RQPA 4MXWB 5FYIA 1DGLA 2R7EB 4W50A 1LOFA 4CEYC 5JR2A 3AZXA 4KWJA 3RZHA 2W08A 5DAPA 2NZ9A 2WO2A 4DXSA 5JAXA 1CD3G 2ARBA 3JB4C 2PAKA 5KHKA 2XBO3 5FLHA 2VQUA 3VBHA 3I3QA 4GWMA 5CYYA 5FXVA 5JZGC 1GQHA 3N9LA 5CZKA 3SISA 2ZEWA 4URAA 1D0GA 4QHZA 2EICA 1W99A 5K4LA 5FP7A 2VE1A 4CDWA 4CDQA 4XF1A 1ZRIA 4XTPA 3N7MA 1Z78A 5A1AA 1LHNA 4LHNA 2DCTA 1Q3EA 1RUH3 1ZBE2 4A41A 2BV4A 2AYHA 3LSDA 3NNJA 5JXGA 1OUXA 3D8CA 4DINB 2DDUA 1XNBA 3TWIA 1GQGA 3NSTA 3TYJA 3ZR5A 2GU9A 4QM9A 4YZ2A 2VUAA 3ZN5A 3BODA 5GKAC 4P9LA 4PBOA 3ZMOA 2GC0A 1VMHA 2YXSA 4XVHA 3T1MA 3TBDA 1R091 3PMSA 2A7AA 2Y26A 2A1XA 2JECA 5K0UC 2WWUA 4A42A 1F4AA 3ZVXA 2GZWA 3AKPA 3QD6A 4YARA 4AAXA 4LE3A 5K7PA 1VJ2A 4K1ZA 1RVF2 5G04L 1XXNA 1MPXA 1HIXA 1STMA 1TME2 3WT3A 2JDYA 2VZPA 5FP4A 1LHUA 2FMYA 4CDUC 4BXFA 1F5JA 4XJZA 3FHQA 1TME3 2WA4A 1N3PA 2ZHNA 2ERFA 1PO11 1W2UA 5LK7B 4LBMA 4IV1C 1CZVA 5F3IA 1GWLA 2W3JA 4FVVA 4P14A 1BMV1 4YM2A 3J7MA 5LWBA 1K12A 4A7KA 2XHNA 2D5HA 2DU0A 2PLV1 5FYYA 2RS12 1VBB1 1CJDA 2LM3A 2DVAA 4X8PA 4PDWB 4MXWA 2Y38A 2VOTA 3OF1A 4TYSA 1LECA 2Q1ZB 2EXHA 4Q4V1 1O3TA 1R64A 2W46A 1UZ0A 4AVSA 2W87A 4CP2A 2VUCA 4LBQA 4FOWA 4WM7A 4XJWA 2ES3A 4N53C 1Q8OA 1QXRA 3HR9A 1YQCA 4D7TA 1PVC3 2VAUA 2XBO1 2HJIA 3ZLIA 3LFMA 1WBFA 3B7MA 4MOAA 1DQ0A 3E97A 4NWWA 3W5MA 2WNUA 4BOWA 2EAKA 3SXWA 3LDRA 3ZN4A 4DXRA 3H8RA 1VE0A 4NVPA 2JKBA 1YIFA 4NHXA 3MPPG 1JTZX 2D97A 4YG6A 1WZXA 1YIPA 3AVSA 2Y33A 2ZCWA 1WCSA 2ORZA 4XQDA 4YVWC 4A7ZA 5FZEA 4Y4YA 1JZ5A 1RUH1 1N1SA 3PUSA 1I5ZA 4OMCA 4Y5Z0 3GALA 3IWZA 2WZR3 1PZ7A 4I0AA 1OOPC 2CHHA 2PHUA 4C1XA 2P4EA 3OUHA 5FUNA 4BDVB 1PIV2 1QXJA 1OLRA 2VVEA 3KD4A 2ZZQA 1AX0A 2QQJA 3JD72 1V6OA 4IETA 4EZ4A 4ZHNA 2VMDA 3NMBA 1ZZ6A 2FBEA 1KS4A 4YWAA 1IPSA 2CSGA 2W91A 3THCA 2XJQA 1JOBA 4L8QA 5ABJB 5JOXA 4MG2A 4Q0VA 1A6CA 5DPNA 3N7JA 4SLIA 2UWAA 4COYA 5FK8A 2H6BA 4XETA 3CJIC 4XABA 3ZYIB 1GOFA 5T50A 3T08A 1TME1 4BQXA 5F5AA 5IAXA 4A6OA 1AL22 1KDMA 1OA3A 4OZXA 2GC3A 1X82A 4AFAA 3JZVA 4DIQA 5I0SA 3ZYPA 4YGDA 1LEDA 2UWCA 4IV3B 2PHTA 1UMZA 4KMQA 2ZGUA 3S7IA 3UT0A 2TNFA 1UY2A 4K7JA 1KQRA 1QJX2 4N43A 4QPGA 4Q0QA 1XNCA 1ZVFA 3AJYA 3K4ZA 4CTEA 3RVHA 4LITA 4CCMA 2W1SA 3EXUA 4LKSA 4IE7A 1AYM2 3URFA 1QJX3 3KT4A 1AYN2 2WZ8A 2AACA 2B46X 3NO8A 5FZHA 5FDBA 3I8TA 2D98A 5IW0A 1DGRN 3ZKYA 3H42B 2J1EA 3ILRA 1BK1A 1AYN3 1E57A 1OFNA 1PVC1 4GMP3 1WW4A 4OI4A 5HXVA 3U11A 5FO8B 1JW6A 3ACHA 2Q5TA 1PGL1 4RS5B 5FZMA 4NOTA 4QB1A 1SBFA 1AF9A 2QVSB 3OG2A 5FAXA 5B2GB 4AI8A 2QQLA 1HQWA 4FFIA 2D43A 2AR6A 3ROUA 3S6PA 1N1YA 1SPPB 1RHI3 3NNGA 1NCQC 5GJ6A 5TSWA 3WUDA 4FQZA 1GNHA 5FV3A 2IC1A 1KEXA 3KQ4B 3OY8A 2WZR1 4JRLA 5ACA3 3KCYA
chains in the Genus database with same CATH topology
4JZRA 4NAOA 5M0TA 5LBCA 4XAAA 4KBZA 3GJBA 4NMIA 3OUJA 3HQRA 3MGUA 4ZPIA 5L9BA 4BQWA 2Y34A 2RDRA 5EQUA 3GJAA 4NHXA 2OPWA 3NNMA 4Y5TA 4J25A 3OUIA 2Y33A 3KT7A 5ERLA 4Y5SA 5HV4A 5L9VA 5DAWA 5L9RA 4XACA 2RDQA 2RDSA 2G19A 3NNFA 4UWDA 3OUHA 3OBZA 4XCBA 4NHKA 4XCAA 5C5TA 2JIJA 2V4AA 5IATA 4MHRA 5C5UA 5DAPA 3GZEA 4ZONA 2FCVA 2HBTA 4MHUA 5EP9A 4NHYA 2RDNA 2JIGA 5LATA 3ITQA 4XABA 4BQXA 5IAXA 5LB6A 5EPAA 3PL0A 4Q5OA 3HQUA 5DAXA 3NNJA 5LBEA 5HV0A 5A3UA 2RG4A 2A1XA 5IAVA 3KT4A 3NNLA 4NHLA 2FCUA 3W21A 5LBBA 3DKQA 2G1MA 4XC9A 5LA9A 4IW3A 5LASA 3KT1A 3EMRA 3BVCA 4BQYA 5DAVA 4NHMA 2FCTA 3W20A 2HBUA 5LBFA 5DAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZR A;  4NAO A;  5M0T A;  5LBC A;  4XAA A;  4KBZ A;  3GJB A;  4NMI A;  3OUJ A;  3HQR A;  3MGU A;  4ZPI A;  5L9B A;  4BQW A;  2Y34 A;  2RDR A;  5EQU A;  3GJA A;  4NHX A;  2OPW A;  3NNM A;  4Y5T A;  4J25 A;  3OUI A;  2Y33 A;  3KT7 A;  5ERL A;  4Y5S A;  5HV4 A;  5L9V A;  5DAW A;  5L9R A;  4XAC A;  2RDQ A;  2RDS A;  2G19 A;  3NNF A;  4UWD A;  3OUH A;  3OBZ A;  4XCB A;  4NHK A;  4XCA A;  5C5T A;  2JIJ A;  2V4A A;  5IAT A;  4MHR A;  5C5U A;  5DAP A;  3GZE A;  4ZON A;  2FCV A;  2HBT A;  4MHU A;  5EP9 A;  4NHY A;  2RDN A;  2JIG A;  5LAT A;  3ITQ A;  4XAB A;  4BQX A;  5IAX A;  5LB6 A;  5EPA A;  3PL0 A;  4Q5O A;  3HQU A;  5DAX A;  3NNJ A;  5LBE A;  5HV0 A;  5A3U A;  2RG4 A;  2A1X A;  5IAV A;  3KT4 A;  3NNL A;  4NHL A;  2FCU A;  3W21 A;  5LBB A;  3DKQ A;  2G1M A;  4XC9 A;  5LA9 A;  4IW3 A;  5LAS A;  3KT1 A;  3EMR A;  3BVC A;  4BQY A;  5DAV A;  4NHM A;  2FCT A;  3W20 A;  2HBU A;  5LBF A;  5DAQ A; 
#chains in the Genus database with same CATH topology
 4CEW B;  3IDC B;  4XAE A;  1F8V A;  1WW5 A;  3DN7 A;  3KGL A;  3KMH A;  1A78 A;  4XBN A;  2OXB A;  2P3K A;  4OVE A;  3VBS B;  4PDW C;  1UX6 A;  2B42 B;  1G6N A;  1PO2 2;  5EJ1 B;  3RFR A;  5JXJ A;  1K5M C;  2WAB A;  2P3J A;  4AED A;  1DQ4 A;  1QJY 3;  3H7Y A;  4MLO A;  4WVW A;  3OYW B;  1UOB A;  4HZF A;  4F3J A;  4CXX A;  4XDP A;  3C7H A;  3O12 A;  1HX6 A;  1KJL A;  3N7L A;  2I45 A;  4BK4 A;  3LSE A;  2DCY A;  1ZM1 A;  2D6P A;  4R4Z A;  5J98 B;  3VBR A;  4NII A;  2HYK A;  3VKN A;  4BIO A;  4YNI A;  3M7A A;  3JB8 A;  4IV3 A;  2VGD A;  1JXN A;  2WL1 A;  3VD4 A;  3ILN A;  4XAC A;  4RSU A;  1HV0 A;  5C8W A;  3M2M A;  3MYX A;  3O1T A;  1PZ8 A;  1B09 A;  1OI6 A;  1E5I A;  5C3R A;  3K48 A;  1EV1 3;  4XIK A;  3A22 A;  4I3P A;  2VG9 A;  2TEP A;  3LOI A;  1J83 A;  3ZMN A;  3JU9 A;  2A3W A;  1JS9 A;  2KD7 A;  1QJX 1;  3GF6 A;  1BCX A;  5C8C B;  1RGS A;  2ENR A;  4IE5 A;  1CAU B;  4LMF A;  5C5U A;  4XPV A;  2BER A;  5FPX A;  1YFU A;  3AZZ A;  2HBT A;  3ZN6 B;  2X29 A;  2IZW A;  2ZHK A;  2A71 A;  1WA4 A;  2VQT A;  4MYE A;  4LO5 B;  1NLS A;  1AYN 1;  1YJL A;  4BQ1 A;  4GMP 1;  2RS3 2;  3WDT A;  5DUV A;  2OS2 A;  2V73 A;  1OLM A;  5KHH A;  2Y6H A;  4KU7 A;  5CFC A;  2BVV A;  5FZ0 A;  2RS3 3;  1JI6 A;  1FX5 A;  2VXJ A;  1PK6 B;  2D6O X;  5F3G A;  1ODM A;  5CAD A;  3UKN A;  3POE A;  1GP4 A;  2Z2S B;  3U0Z A;  4JKM A;  4QXH A;  5T55 A;  1SPP A;  4YW5 A;  2ZGR A;  3N3H A;  1WME A;  2R6Q A;  3W58 A;  4D3W A;  5HPO A;  1JOP A;  2ZA9 A;  1B35 C;  1UQX A;  2BNO A;  3LAG A;  1RHI 1;  5FBJ A;  3NKT A;  1AR8 3;  1P8J A;  4BM8 A;  5C6C A;  4P08 A;  4JTO A;  5FUI A;  3LWC A;  2RG4 A;  5CFD B;  1H8T C;  1HXS 2;  1ULG A;  5ACA 1;  4O61 A;  4EQV A;  1EYB A;  1XB9 A;  2E6V A;  2FDH A;  3FWE A;  1VBD 2;  1DYP A;  4TN7 A;  3PUH A;  3ACI A;  3WG3 A;  5IK8 A;  1HXS 3;  2BTV C;  1J84 A;  3I54 A;  3HEI A;  2GAL A;  1RUJ 2;  2UY8 A;  4MET A;  2P34 A;  1NA1 A;  3LDB A;  1QJY 1;  2IXJ A;  5JMC A;  5CG9 A;  1IKP A;  3E5U A;  1HB2 A;  1NX9 A;  4UFI A;  2QE3 A;  5IVJ A;  2CDO A;  1E5R A;  2PFW A;  1DYO A;  3MFA A;  3POS A;  4QQP A;  5KHI A;  4Z92 B;  1RUJ 3;  2RMU 3;  2IVI B;  1IS5 A;  1UOJ A;  4QPY A;  3T2Q A;  3HT2 A;  2Y0O A;  4C1W A;  1POV 0;  3UV9 A;  1N1T A;  2PQQ A;  4JQR A;  5DG1 A;  5F6L B;  1W2N A;  2GN7 A;  2ZEZ A;  2V5Y A;  4XXA A;  3T0B A;  2D3R A;  4HN1 A;  2YRO A;  3VB9 A;  4NAM A;  4RS5 C;  1CIY A;  3VZK A;  3Q8E A;  1UF2 C;  2DCJ A;  4JC1 A;  3O14 A;  5T5L A;  2FMD A;  5F32 A;  1LB2 A;  2OA2 A;  3W20 A;  1DHK B;  4W4Z A;  1ZZ9 A;  2WT1 A;  3O1M A;  3VKO A;  4LO6 B;  4LHL A;  3GGL A;  1EV1 1;  5A3M A;  1TE1 B;  2WQ8 A;  4Y26 A;  1BKZ A;  1XC6 A;  1GLH A;  1LEM A;  1CAU A;  2EAL A;  1XJA A;  1SAC A;  1W2O A;  2H6C A;  1ZZC A;  2DVF A;  1O8P A;  1FI2 A;  1W8F A;  5IFT A;  4COW A;  4LLF A;  4AQ6 A;  4Q4Y 2;  4KBB A;  1W39 A;  4CEW C;  4I30 A;  3HOB A;  3HQX A;  2WR9 A;  1YYN A;  4QX7 A;  5LA2 A;  3VKM A;  1H8V A;  4OUS A;  3ZSJ A;  3DCQ A;  3U1X A;  2WS9 2;  2AH2 A;  4UYB A;  2X5I B;  2YY1 A;  2E9Q A;  1ULO A;  4BQ5 A;  5CA6 A;  2DUP A;  4ET7 A;  4FPC A;  2XB6 C;  1N1V A;  4KGQ A;  2W95 A;  2WS9 3;  2RS3 1;  3IPV A;  5IUQ A;  4KG0 A;  3V0A A;  1GIC A;  3T1L A;  1GKB A;  3WHT A;  2RDS A;  3VL8 A;  5I91 A;  2IFW A;  5AFE A;  3H7J A;  2VM9 A;  4O9G A;  1RUD 2;  4QGM A;  4YG3 A;  5F39 A;  2OYZ A;  3VHO A;  3GHN A;  4C0B A;  3U4X A;  4HMZ A;  4GMP 0;  4NJ4 A;  4DMI A;  4MGY E;  5FFO C;  1AR8 1;  1ND3 B;  3GDB A;  4LIV A;  1YXW A;  3K3O A;  2CNA A;  3NAP B;  1W6Q B;  1DU3 D;  5A3O A;  4E27 A;  5A6X A;  5AC9 2;  1OF3 A;  1Y43 B;  1BBT 2;  1C28 A;  1UN1 A;  1X50 A;  1GFF 2;  1XNK A;  3OGR A;  4TWT A;  4XQ4 A;  4I09 A;  3AKR A;  1A3K A;  2ID4 A;  2JDM A;  3WQ7 A;  5ANN A;  2XR4 A;  3MO4 A;  1HXS 1;  4BIS A;  1BBT 3;  4BLJ A;  4SBV A;  1C8M 2;  2PA7 A;  2XL7 A;  2Y6J A;  1S2B A;  4PF1 A;  2R04 3;  1OLQ A;  1PM4 A;  5C8C C;  1MS4 A;  4E4S A;  3B94 A;  1A34 A;  3PDQ A;  1C8M 3;  5KWR A;  2RMU 1;  2VTX J;  3QCW A;  3LGR A;  5JVV A;  4GD4 A;  1QGL A;  1W8O A;  2IXH A;  2H0V A;  1LOE A;  3VHR A;  3RJ2 X;  5JPN B;  3OTF A;  1REE A;  3ES1 A;  3KV5 A;  5CKM A;  4YG0 A;  4A6S A;  4ATE A;  2HWE 2;  3W59 A;  1RUO A;  1H1M A;  3AP7 A;  1F5F A;  2XLG A;  2ZKL A;  1UXZ A;  3RQ0 A;  3PJY A;  1QQP 1;  1PK6 C;  4AEK A;  5T52 A;  2HWE 3;  1RJ8 A;  3RI9 A;  1YJK A;  4C8D A;  4XUN A;  2TBV A;  2LRO A;  3H8U A;  1WCQ A;  1RMU 2;  3ABZ A;  1GZW B;  2VZS A;  5A1F A;  4IER A;  4RHV 2;  3J7N A;  5FIX A;  4EWE A;  3USU B;  3WP4 A;  1NXM A;  1QH7 A;  4JGY B;  1PX3 A;  3T2O A;  5CFD C;  4IEO A;  3V0B A;  4RHV 3;  3IAQ A;  4LHK A;  1JUI A;  2VNR A;  1UIJ A;  1QKQ A;  1WMF A;  4ZY9 A;  1ZRE A;  2FDF A;  5C9A B;  2WQZ C;  2XJV A;  4JV4 A;  1OHF A;  2YC2 A;  1V6M A;  2R1B A;  4OI0 A;  5BNO C;  4QM8 A;  1WKY A;  2WO1 A;  2VTX A;  2YU1 A;  2ZML A;  3MHZ A;  2WS9 1;  5EZW A;  1QH6 A;  4P9J A;  4Y1X A;  1MZ5 A;  5DAV A;  4QHO A;  4ZXE A;  1VAK A;  4K3U A;  4UFH A;  2H0B A;  2JG9 B;  2GN3 A;  2Q4S A;  1GZT A;  2JIC A;  1ND3 A;  2QKD A;  4HKO A;  3DXU A;  1H2L A;  4CU6 A;  3NJZ A;  4DO0 A;  3HBZ A;  1W0N A;  3WDY A;  1JU4 A;  4IND A;  4YPJ A;  3VN4 A;  3DV8 A;  1Y9G A;  4YZ5 A;  2NLR A;  4LXL A;  1OMI A;  1NZC A;  4E2S A;  4O9E A;  5FLJ A;  5FBZ A;  4BQ2 A;  2EXJ A;  1T6G C;  3AMH A;  2HYX A;  2DVB A;  1C1F A;  1BBT 1;  4XFC A;  2J1A A;  3VLB B;  3ZXF A;  3UKV A;  5FY7 A;  2OZ6 A;  3MFC A;  2R04 1;  5LCW L;  3S30 A;  3K4D A;  4CUB A;  3WY6 A;  1I1E A;  5KXB A;  5HI0 A;  1CAW B;  1FAT A;  1JN2 P;  2QTW B;  3PUA A;  1R1Z A;  4Y5T A;  3VDD B;  1VBA 2;  3T0A A;  2A6W A;  4YW7 A;  3BGA A;  4XMI A;  3ZYH A;  4CP9 B;  3S5A A;  2X5I C;  3DEM A;  3Q8F A;  2NP0 A;  3AFK A;  2ZMN A;  2CGN A;  4TTG A;  3A23 A;  4KH9 A;  3OGV A;  4RN5 A;  3O1R A;  3OBZ A;  2OW4 A;  2XUE A;  4DEQ A;  3MUY 1;  3B02 A;  1PX4 A;  5AVP A;  3ZSM A;  3CL1 A;  4MGQ A;  2YHJ A;  4XIO A;  1W6M A;  1ZBA 2;  2BJS A;  2Q1F A;  4QWN A;  2OVU A;  2V4A A;  4FTB A;  3FUO A;  2E63 A;  1UX7 A;  3LCP A;  1LGC A;  3B3Q E;  3HT1 A;  1EP0 A;  4YZ3 A;  3I3D A;  4ZS2 A;  3RI8 A;  4MGS A;  1NT0 A;  3RMY A;  2B9U A;  3N36 A;  2R0H A;  3NAP C;  1U0A A;  5EYY A;  1F15 A;  3AYC A;  4RHV 1;  2JIG A;  1SG3 A;  1VIW B;  3KCX A;  5DDJ 3;  4HFS A;  5JI7 A;  2XJS A;  4Q4X 2;  5FOJ B;  3WF1 A;  3VBU B;  3BU0 A;  1DF0 A;  4IE0 A;  4Q5O A;  4KG8 A;  3ZXL A;  4FAG A;  1RUG 3;  3O0W A;  5F5I A;  1WLW A;  5FYU A;  3ZYG A;  4B4Q A;  2JWP A;  1V9U 2;  2IVJ A;  2DV9 A;  1IS6 A;  1GZ9 A;  1WCD J;  2VMH A;  3HIF A;  5FXW A;  2WT2 A;  1XRU A;  4QDR A;  1CVN A;  4RA0 A;  2VPV A;  4I2O A;  4Y1Y A;  1V9U 3;  2LRP A;  4OLL A;  3PVB B;  4UF0 A;  4XDO A;  4YZ1 A;  3R05 A;  3H8X A;  3BI3 A;  4NR1 A;  4NIH A;  1TNR A;  2XJP A;  1NCR C;  1MS1 A;  1TZO A;  2VW0 A;  3VBF C;  2HWD 2;  5IAV A;  4AF9 A;  3TEZ A;  3EYP A;  1VPH A;  3A0K A;  5GZD A;  4QKF A;  1OA4 A;  5FZF A;  4ES8 A;  1K5J A;  4BB3 A;  2ADE A;  3SHR A;  4AGR A;  3P3P A;  3DYO A;  4FP2 A;  3WF2 A;  4YW4 A;  3L2H A;  4QXC A;  1RUE 3;  4YM0 A;  4FFF A;  3IDB B;  1SEF A;  1J1T A;  5FYM A;  4QX1 A;  4JGY C;  4RFR B;  4JDM A;  1ND2 B;  1UY4 A;  5FKB A;  4LNV A;  3E5Q A;  3I3B A;  4X8N A;  2BDR A;  1H9P A;  5K0U B;  1FAY A;  1UL9 A;  3Q8B A;  4JRA A;  4CSW A;  3H8O A;  2AC1 A;  5C9A C;  5A7N A;  1JZ6 A;  2VMG A;  1GBG A;  2PEL A;  3MW4 A;  1KGY A;  2CAU A;  2ET1 A;  3J26 N;  4A4A A;  3WDU A;  5BNO B;  3OBR A;  4PLM A;  4YYO A;  4CDU B;  2CDP A;  2VXR A;  5B4X A;  3PNA A;  4IXL A;  4MX3 A;  5FLI A;  5J1X A;  3VD9 A;  4FTE A;  2VTF A;  3DEC A;  3GYD A;  4HN0 A;  1RC6 A;  1N47 A;  5LY2 A;  5M0T A;  1XQN A;  4IV1 B;  2JG9 C;  4ISQ A;  1IKQ A;  1KS5 A;  4HT1 T;  2W1U A;  1FXZ A;  2VW1 A;  3O1P A;  4EE2 A;  1LKN A;  3AL5 A;  3AM2 A;  3AP5 A;  1D2S A;  1WCK A;  4OMD A;  2C26 A;  3IB3 A;  4OI2 A;  1KJR A;  1O5L A;  3LA7 A;  5DDJ 1;  5FQ0 A;  3AC0 A;  1RL3 A;  3B93 A;  1W03 A;  2OPW A;  5GZE A;  3WDW A;  3BAL A;  4CEY A;  2YV8 A;  4Q0U A;  3MIH A;  4XF9 A;  1TNF A;  2GMM A;  2GSY A;  3RMX A;  2W0X A;  1RUG 1;  2VNO A;  3K77 A;  3OGS A;  1O4Y A;  1BVP 1;  4MZU A;  1H6Y A;  5CU1 A;  5K9Y A;  3GZT B;  4N53 B;  5FR3 A;  3BB6 A;  2MEV 2;  4GKX A;  4JDO A;  4ARX A;  2EXK A;  2Y6G A;  3LD8 A;  5JZG A;  4QX0 A;  4K1Y A;  5LRS A;  3OEA A;  2RE9 A;  4XMA A;  2ZEX A;  2A6X A;  2JDU A;  1V9U 1;  4XQW A;  1Q43 A;  2N7G A;  2YFU A;  2MEV 3;  4IGO A;  4OUM A;  1UOG A;  3ENR A;  4CP0 A;  1PO1 2;  3I59 B;  4LQR A;  5IAT A;  3FLT A;  3P1I A;  4YVW B;  2AEY A;  3N9N A;  2R0F A;  3SEE A;  1OFS A;  4LE4 A;  4JHZ A;  1BMV 2;  3UGH A;  4RGG A;  3KZ4 C;  3J7L A;  4EN9 B;  3D0S A;  4XFB A;  1H4G A;  5EYX A;  1UWW A;  2ZGS A;  2PLV 2;  3UK9 A;  1VBB 2;  1YUD A;  4IEQ A;  3KHC A;  1RUE 1;  2C9K A;  1LHW A;  2ZX4 A;  4PIZ A;  2O1Q A;  1RUI 3;  5K0U A;  3ELN A;  1JYT A;  1NQJ A;  5EPA A;  4Z82 A;  4YFZ A;  3AL6 A;  1W0P A;  2ZGK A;  1XU1 A;  2UYB A;  3HQU A;  3RGB A;  3VBU C;  2SLI A;  4AI3 A;  3NVC A;  1MS3 A;  2QQV A;  1EUT A;  3WDX A;  5J3U A;  3E6C C;  1JYN A;  4CDU A;  1MS9 A;  3A0N A;  1YFX A;  3T4V A;  3U37 A;  2XBO 2;  1X33 A;  3E6D A;  3CJI B;  5HBA A;  4XUO A;  4YFW A;  4IV1 A;  5L7O A;  1YFY A;  2WNE A;  4RR3 C;  5FZ3 A;  5FPL A;  1JOD A;  1XND A;  4XUR A;  5CIS A;  1G9F A;  3JBG 3;  3RZZ A;  3MV1 1;  2OUJ A;  5LRR A;  4NHL A;  4FPH A;  5F8P A;  1OQ1 A;  2ARA A;  2CV6 A;  2OZJ A;  2QQK A;  4Y20 A;  5SV8 A;  5KXD A;  1OBN A;  4NO4 A;  1RUH 2;  2IXK A;  2W68 A;  5IVV A;  1SDW A;  2MNG A;  2EF6 A;  1HKD A;  3HVD A;  2IFR A;  4NIA A;  4JX0 A;  3MIE A;  3OBT A;  2O8O A;  1UNB A;  4QKD A;  2PHD A;  5F3C A;  1JUH A;  4WM8 C;  1QJZ A;  3QOP A;  2EIG A;  1S0I A;  3THT A;  2XXZ A;  3VHP A;  1X9P A;  4LO7 A;  2OUH A;  1PNF A;  4UFM A;  2FDG A;  2WBK A;  1ND2 C;  2W2I A;  4NWV A;  1ULE A;  3ZKU A;  1WCU A;  2YBP A;  2WIN B;  3ZFF C;  2FCT A;  4GH4 B;  5KBF A;  1IG0 A;  3USS A;  1DLL A;  4FOY A;  1W8W A;  1QY4 A;  2KXL A;  1GWK A;  3R4U A;  4I02 A;  5FCC A;  5LBF A;  5LK5 A;  2MEV 1;  1DIW A;  2QNK A;  4G9S B;  4Y22 B;  3S0M A;  4WV8 A;  4NAO A;  3D82 A;  4Y1V A;  3MV0 1;  1BVV A;  1GMM A;  1WD3 A;  2WWJ A;  4YW2 A;  2XHK A;  3OUJ A;  3HQR A;  2VU9 A;  4KI5 M;  3RDI A;  4YM3 A;  4BHP A;  2XOM A;  3MGU A;  1WW7 A;  4C90 A;  1KD7 A;  4KNC A;  1DQ1 A;  1ENR A;  4ZPI A;  2A3Y A;  3CKH A;  2NPI A;  1OOP A;  1ODN A;  1OPO A;  1NCQ B;  3ES4 A;  2Z5W A;  4NUB A;  2W47 A;  3ACL A;  3WNM A;  3P3N A;  3RPQ A;  5J7M A;  1LTE A;  1RUI 1;  1Q8V A;  2BGC A;  1LR5 A;  1J3P A;  1H1I A;  4H7M A;  2WN2 A;  4K21 A;  4AVV A;  2UY9 A;  4IEY A;  5FUP A;  3HNB M;  3POI A;  4GIQ A;  2Q8E A;  1K5M B;  1ZRF A;  5F2W A;  3H3Z A;  5DZF A;  1UU6 A;  1ULF A;  1C5I A;  2PMW B;  3O0V A;  4WBB A;  3CJI A;  5FOB B;  1U5Z A;  2CWS A;  3SQO A;  1PVC 2;  2J42 A;  3MDP A;  1O3S A;  1O6U A;  4H3W A;  1QJF A;  3ALQ A;  4CCN A;  4LA3 A;  4NHK A;  4S2G A;  1PGL 2;  4LEJ A;  4CCE A;  3KVB A;  5BNN B;  3VZJ A;  5FZA A;  3O1V A;  3F2Z A;  4CU7 A;  2DU1 A;  2J1V A;  1H2N A;  2DVD A;  3JBG 1;  3M3C A;  4L0P A;  5EHD A;  4QB6 A;  2GC1 A;  2WFP A;  2BGP A;  5FO9 B;  1VBE 3;  5EP9 A;  1XU2 A;  4U2A A;  2BWA A;  1BZW A;  3N9P A;  3FN9 A;  3SMH A;  3VDB A;  1LOC A;  2E7T A;  2QQN A;  4AVC A;  4OUE A;  2WZR 2;  1UW8 A;  4CDX B;  5LB6 A;  1UY0 A;  4AAP A;  4XF3 A;  3HAG A;  3POJ A;  5JR7 B;  4HVO A;  5FYT A;  3GNE A;  2XLA A;  2VCA A;  2YU2 A;  1J3R A;  3CEW A;  4FOQ A;  3OGG A;  1RED A;  2VZR A;  3SIT A;  1W6O B;  1VAM A;  1WWY A;  1XSQ A;  2VL4 A;  3AKT A;  3WVJ A;  3ZXJ A;  2YGL A;  2QQO A;  3WCS A;  1NG0 A;  1SMV A;  1PHM A;  4H14 A;  5F5Q A;  2J1U A;  4Y22 A;  3ZOI A;  4E2Q A;  4Z2W A;  1GV9 A;  2GMP A;  1AR6 3;  4GWI A;  4PQQ A;  4XFG A;  3TOJ A;  4X6R B;  5A6Y A;  1Q8S A;  4BYY A;  2ETE A;  5I0D A;  1G9A A;  3LZZ A;  4PIY A;  4MH0 E;  2R07 3;  2G1M A;  2DUQ A;  1NCQ A;  4FSJ A;  1DYK A;  2KR2 A;  3NV1 A;  1B35 B;  3KS7 A;  3OCP A;  5F2S A;  4AE2 A;  3RZK A;  2VCM A;  4FPF A;  3VD3 A;  4KWK A;  3RZJ A;  5CG8 A;  2WA3 A;  4MGK E;  1VAL A;  2E7A A;  2ZBJ A;  1H8T B;  1HV1 A;  2GNB A;  1WUV A;  3DPR B;  3QBQ A;  4PDW A;  4YLZ A;  1FNY A;  4E2G A;  1K5M A;  3WW3 A;  1JYX A;  4GA9 A;  3OOX A;  2C24 A;  2EIE A;  1Y9Q A;  4AHY A;  4V2V A;  2J1T A;  5E8A A;  5F9T A;  2VC9 A;  4LTA A;  3UNP A;  2WSV A;  3ZYF A;  5E89 A;  1NXD 1;  1W06 A;  2JDH A;  1NOV A;  1D0H A;  1F4H A;  4OCT A;  3OD4 A;  2HWF 2;  4QX2 A;  2ARX A;  1A8D A;  1SFP A;  2A70 A;  3BPS A;  4GH4 C;  3GJB A;  4Q0P A;  5FYB A;  3TEY A;  3I49 A;  4FPY A;  1AVB A;  3N9M A;  4W6W A;  3CZU A;  3DGT A;  1NY7 2;  2QZ2 A;  1QXP A;  4A2U A;  5FZI A;  2HWF 3;  2FHR A;  1FT9 A;  2ZAA A;  4MXV A;  1VBE 1;  1JH5 A;  1DP0 A;  2D7F A;  5A33 B;  1I5P A;  1CJP A;  4J1W A;  5IWF A;  2JB8 A;  1RHI 2;  5IVF A;  1UO9 A;  1HJF A;  2BOI A;  4XW3 A;  2FZ2 A;  1LJ7 A;  5BUV A;  1G9D A;  2IUW A;  1XE8 A;  5ACA 2;  3ETP A;  4YW1 A;  4Q1P A;  1FYU A;  5A32 B;  4ZS3 A;  4ASK A;  3B5L B;  4D6S A;  4EJR A;  2RR1 2;  4HKL A;  3BYW A;  1YWK A;  1M06 G;  1AR9 3;  1HRI 3;  2VOK A;  4HLT A;  1W8U A;  4UBH A;  1W8N A;  2D44 A;  3QAC A;  2RR1 3;  5T5P A;  1QJY 2;  3RWN A;  1X8M A;  2GH8 A;  5DG2 A;  5ABJ A;  3I2D A;  1L7R A;  4X6Q B;  1ASJ 3;  1YQ8 A;  4XCB A;  4XF4 A;  5FZO B;  5LW9 A;  1DGR A;  5SV5 A;  3WNK A;  2P6H A;  1AR6 1;  3AMP A;  1UMI A;  1YLL A;  4ZU7 A;  2F17 A;  1F31 A;  2BBA A;  3VKL A;  3LIG A;  3ZFE B;  3VBO B;  3WW2 A;  3RZG A;  1CR7 A;  1EPZ A;  2YB7 A;  1B35 A;  1QWR A;  2DUR A;  4MHU A;  4HET A;  3WSO A;  4B8E A;  5A3L A;  2R07 1;  2RDN A;  5BNN C;  5BNP B;  4U36 A;  1MEC 3;  5IVC A;  1MVE A;  2AZ5 A;  3CLP A;  5CVR A;  4YSF A;  1HJG A;  5IHR A;  3POW A;  1RUC 2;  3BOP A;  4N90 A;  1Q5O A;  2D40 A;  4QX8 A;  1EV1 2;  2B8M A;  1VLN A;  3KSC A;  2ZAB A;  1OUR A;  1RUC 3;  3Q9O A;  4QPG C;  4A45 A;  1S0F A;  3GXU A;  3O5S A;  4YRD A;  2JG8 B;  1CES A;  4EN6 B;  4CDX C;  4EWA A;  2RJ2 A;  2VZT A;  2VUL A;  1DGW X;  4D6Q A;  3E6B A;  3N9Q A;  1WMX A;  4JGZ B;  3OSD A;  4UFJ A;  3SCG A;  3ZIX A;  4B29 A;  2LTN A;  4GWN A;  1BEV 3;  3A21 A;  1MS8 A;  2VME A;  2XKO A;  1V6I A;  1AJO A;  3N7K A;  4RS5 A;  3LEM A;  2A73 B;  3M1H A;  3BTX A;  2ORX A;  4CCO A;  1YHF A;  3AMQ A;  3CBN A;  2QBX A;  1HDK A;  1GUI A;  3G7D A;  4MUV A;  2HWF 1;  4RGA A;  1VMF A;  1V6K A;  4XHX A;  1AXZ A;  4XTM A;  1F2N A;  4UOJ A;  1LOA A;  2DBI A;  5FPB A;  3RG0 A;  1NY7 1;  5F7U A;  5JIA A;  1DGW A;  2A6V A;  4OHV A;  1AR8 2;  4FOV A;  1GYK A;  4C91 A;  1T2X A;  3DKW A;  3UES A;  3KT1 A;  3VGI A;  5JOZ A;  1W6N B;  4CEW A;  4H7L A;  2GDF A;  1VBC 2;  1OXC A;  1W04 A;  3BVC A;  4W65 A;  1ZZ8 A;  3DPR C;  3VBS A;  1ENS A;  3V65 A;  4Q4W 3;  5GLZ A;  1AR9 1;  1HRI 1;  2XVL A;  3N35 A;  5F37 A;  4XJ8 A;  1VBC 3;  1AJK A;  2XDV A;  2RR1 1;  4J1X A;  3MLL A;  5KR7 A;  4IGP A;  3IDE A;  1ASJ 1;  1HB4 A;  3OYW A;  4KQ7 A;  4AED C;  4DOU A;  2RMU 2;  2XON A;  4WZC A;  3U4S A;  2PHW A;  3K46 A;  4UW5 A;  2BNM A;  3R4D B;  5EIY B;  1IS3 A;  5C4W C;  1NQD A;  2DCZ A;  1NE4 A;  3D3A A;  3H1Y A;  5JCT A;  3K4A A;  1XE7 A;  4P02 B;  3TN9 3;  1MEC 1;  1QQP 2;  5FK7 A;  4OYU A;  2QDR A;  1EAH 2;  1GNZ A;  2WLP A;  1RB8 G;  1H2K A;  2W52 A;  5H9Q A;  1OQE A;  4MVT A;  1O3Q A;  1QQP 3;  4ISR A;  1MR5 A;  4AYU A;  4HSL A;  4CCK A;  2G9F A;  1EAH 3;  1O59 A;  3CU7 A;  4K8R B;  5FZ4 A;  4CU8 A;  1AUY A;  4YVS B;  3ZO0 B;  1RUC 1;  2HWC 2;  2D3P A;  2RDQ A;  3ZFG B;  3MF9 A;  5IVY A;  4ES9 A;  5FWJ A;  4NIG A;  2WNO A;  1X7N A;  5C8C A;  2XLF A;  3T3Y A;  2F4P A;  4ZXK A;  4B1L A;  5IYY A;  2HWC 3;  3JUU A;  3C3V A;  4FXK B;  4HK8 A;  2CU5 A;  4LIU A;  3ZN6 A;  3IDA A;  5A7W B;  4AVB A;  4BJ0 A;  4FQ4 A;  4XCA A;  4L97 A;  3WW1 A;  1W28 A;  4AHW A;  2ZAH A;  1VRH 1;  1LU1 A;  1BEV 1;  3LB9 A;  2E7Q A;  3PIG A;  5FPZ A;  3UGF A;  2R49 A;  4V2W A;  1U5Y A;  1J58 A;  4AHX A;  4R8H A;  3KGZ A;  5CFC C;  2QDN A;  1YRZ A;  5L36 A;  3M70 A;  4CRQ A;  4R9C A;  1FPN 1;  1PK6 A;  1GOH A;  3ST7 A;  1LUL A;  1RXG A;  5LAT A;  3ITQ A;  2B4K A;  1WD4 A;  2WKK A;  3ZFE C;  3B69 A;  3VBO C;  2OKX A;  4Y33 A;  2JX9 A;  1OKQ A;  3AYD A;  3B9I A;  5FYH A;  3WQ1 A;  1ACC A;  1CN1 A;  5BNP C;  1W6N A;  4OZO A;  1DLC A;  4YGE A;  3AZV A;  5CFD A;  1MS0 A;  4P5Y A;  4KWU A;  1CAX B;  2WRA A;  3HN1 A;  2X53 S;  4IEW A;  5D8A B;  5KXC A;  1TMF 3;  1U12 A;  1LRH A;  3CZJ A;  4B1M A;  3P5B A;  4Q4W 1;  4AI2 A;  2Y60 A;  1C4R A;  4ORF A;  1VBC 1;  3M3O A;  4HVR A;  4NRO A;  2JG8 C;  2R04 2;  1ULP A;  3LPG A;  3MLJ A;  1CPN A;  5I8Y A;  5IVB A;  5CNA A;  1NA1 C;  4LBL A;  4EN0 A;  1SDD B;  1XYN A;  2Z79 A;  3AFG A;  3J7H A;  3S7E A;  4AQ2 A;  4DNY A;  5A70 A;  3EBR A;  4NRM A;  4AOC A;  1RIN A;  2TUN A;  3CNA A;  4P00 B;  4JGZ C;  3ZSL A;  3MIG A;  4AVT A;  3N4M A;  4GQ7 A;  5L73 A;  2VY0 A;  3G6J B;  2YG0 A;  3NKG A;  1O4Z A;  1QJU 3;  3NWK A;  2Y6F A;  3POY A;  4LO4 B;  4AEM A;  2VBP A;  3TN9 1;  3BTZ A;  3POF A;  1CIW A;  1ZRC A;  4IW3 A;  1QJE A;  1NCR B;  3VBF B;  4GAL A;  3VKF C;  3MIF A;  1SHW B;  4IL7 A;  3MBW A;  5HCH A;  1EAH 1;  2R16 A;  2XKP A;  2JDN A;  1W2T A;  1CGP A;  2MPF A;  4BME A;  1XSR A;  4QPW A;  1SLB A;  3WLU A;  4ONU A;  4HON A;  3OPZ A;  5D8A A;  2HWC 1;  3ZM8 A;  1YC6 1;  3FMG A;  3A4U A;  1JZ8 A;  1N3Q A;  2YBK A;  2EID A;  4JZR A;  1L7Q A;  3ZXE A;  1UKG A;  4I3G A;  3AZY A;  4XAA A;  4P5H A;  3ACF A;  4AXO A;  1UYX A;  3FL7 A;  5I8S A;  2X5I A;  3ZDV A;  2PQS A;  3GHM A;  4QGL A;  4CA9 A;  2V5D A;  4HL0 A;  2CGP A;  1U5X A;  1NE6 A;  5L9B A;  1V00 A;  2Z4F A;  4R4X A;  2ZX2 A;  1FOD 3;  3I3E A;  4LKE A;  2B45 X;  4E8D A;  5FPU A;  2WNV C;  2WJS A;  4LO8 A;  2VUD A;  2DYC A;  3OUI A;  2ZMK A;  1QOS A;  2XJR A;  4KU8 A;  4LBO A;  2WWS A;  4QKB A;  3NAP A;  1W6Q A;  4ITC A;  1POQ A;  2PHX A;  4QQO A;  1LAJ A;  1K42 A;  1FNZ A;  2BWC A;  3H0O A;  2E32 A;  1ONA A;  2W39 A;  3OJB A;  3QH7 A;  4JKK A;  4RD7 A;  4UWD A;  3TNP B;  4MGT A;  1TMF 1;  4YVS C;  1MQT B;  3WR0 A;  4DUW A;  3ZFG C;  5CAZ A;  3ECQ A;  1QOO A;  5KC5 A;  4G3Y C;  2DTY A;  1UZZ A;  2IWG B;  4MAD A;  1PMJ X;  1PGS A;  5A6Z A;  3RZM A;  3VZO A;  3WD5 A;  1MZE A;  5LZ6 A;  4TLF A;  4CVU A;  5KHJ A;  1CZT A;  5GLV A;  5IK5 A;  1QIQ A;  3WNL A;  1ZNP A;  3ZSK A;  1QJU 1;  2BOJ A;  1APN A;  1NCR A;  1YEW A;  2WC2 A;  5A7P A;  2LAL A;  3I3M A;  1X36 A;  4ZU4 A;  4DXT A;  5FZ1 A;  1UPI A;  2YZ4 A;  2R06 3;  3I2H A;  1O8S A;  4QXB A;  3WZ1 A;  4Q2F A;  4AW7 A;  2E33 A;  4DPN A;  1NLQ A;  4QQL A;  3O7O A;  4UAP A;  1BJQ A;  3SKV A;  3KV6 A;  5DAX A;  5FMO L;  1GZW A;  5JPM B;  5FZK A;  4DUX A;  1XNA A;  2PXJ A;  5D21 A;  5HV0 A;  3USU A;  2BZD A;  4BE3 A;  4ZZ5 A;  4JGY A;  2NM1 A;  4QQ2 A;  4YM1 A;  4AR2 A;  4PT6 A;  4OUL A;  2C0Z A;  4HPK B;  2IXC A;  5FY9 A;  1DZQ A;  3BCW A;  1CPM A;  5DDJ 2;  2NMN A;  1COV 3;  3P6B A;  5D8A C;  4IEP A;  1O91 A;  1DZT A;  2FDI A;  5C9A A;  3DYM A;  5FZB A;  1IPJ A;  3MZH A;  1RUG 2;  4IE4 A;  3W21 A;  4N7U A;  5LBB A;  3DKQ A;  4GXL A;  2ZZJ A;  1UD1 A;  4AL9 A;  1JYV A;  3LKJ A;  2X05 A;  2ZGN A;  1HRV 1;  4Z8B A;  4Y24 A;  5FYZ A;  2GP3 A;  1KFX L;  3IT8 A;  4XEZ A;  5D2A A;  2XQR A;  5J48 A;  1FOD 1;  4E4Z A;  5FPV A;  3NL1 A;  2JG9 A;  4RR3 B;  4QPI C;  5IK7 A;  3UET A;  4IDZ A;  3LA2 A;  2ZGT A;  1H4H A;  2XML A;  4M3C B;  4OI1 A;  3SH5 A;  2MHF A;  1UY3 A;  2JXA A;  4XF0 A;  1BK0 A;  3CO2 A;  1H30 A;  4H55 A;  4BQY A;  3BU7 A;  2HEV F;  4L99 A;  4LHS A;  4Z1V A;  5FY1 A;  2JE9 A;  3L2Y A;  1YNA A;  3OPT A;  3ZIW A;  4IEZ A;  4LOT A;  1WLD A;  3Q8A A;  1IQD C;  1RUE 2;  4QU1 A;  3BIW E;  4GUL A;  2DFB A;  2W1Q A;  3QLQ A;  3R6S A;  4WM8 B;  3FJS A;  1KIT A;  1LGN A;  4XZU G;  2DWR A;  1ZYB A;  3PUQ A;  1CAW A;  1RTV A;  4AGG A;  3KCC A;  3VDD A;  2XVK A;  3AVR A;  2EXI A;  3WQB A;  3LOB A;  5F6K A;  3ZFF B;  1D4M 3;  2PYT A;  3MPB A;  2XQX A;  4QDQ A;  2J1S A;  1H1A A;  1W05 A;  4Q26 A;  4CP9 A;  5LEJ A;  4QQH A;  5J96 B;  4TLG A;  4ASM B;  1OSG A;  2R06 1;  4LA2 A;  3SNM A;  2VZ1 A;  4YZ4 A;  2CGO A;  1GAN A;  4K20 A;  2ZGO A;  2Q8C A;  3EO6 A;  1D7P M;  4A44 A;  3DUI A;  4AFM A;  2EIB A;  2C1F A;  2R1D A;  4H2A A;  2YFZ A;  1W0O A;  1BQP A;  1RIT A;  4CCD A;  2A3X A;  5DQ0 A;  3ZSE A;  4CUG A;  2UUR A;  1SBE A;  2WSU A;  1ZA4 A;  4GKY A;  4DXZ A;  5FMO S;  3AP9 A;  4M3C F;  5BY5 A;  1UAI A;  2JIJ A;  4QKN A;  5G05 L;  1COV 1;  2WQ4 A;  4WVM B;  5C5T A;  4BXS V;  5A7S A;  3ATG A;  1UZW A;  3PUR A;  3VBU A;  3WIN E;  2RV9 A;  1MQT C;  1XPW A;  1ULD A;  3C2U A;  1G9C A;  1R08 3;  4RQP B;  1WLC A;  1RUF 3;  3CJX A;  4NHY A;  2BPA 2;  1JBC A;  2ZPX A;  2CTV A;  4M4R A;  1IZ3 A;  2QQM A;  3I2K A;  2ZEY A;  4Z2A A;  4RR3 A;  4F7Z A;  3K3N A;  5FJH A;  1V6L A;  5DUW A;  3C7O A;  4K9S A;  3VHN A;  3FZ3 A;  1WLT A;  5JXH A;  2CYF A;  1SLI A;  2Q8D A;  4M0N A;  1ZX5 A;  1Q8Q A;  2HWB 1;  1EPW A;  3ZXD A;  1NLR A;  1OD3 A;  1G7Y A;  3EJK A;  1OH4 A;  3MF6 A;  4RL7 A;  4R52 A;  4XOG A;  4CDW B;  4CDQ B;  3VDC A;  5I0T A;  4CCC A;  4L9B A;  3AJZ A;  1UXX X;  2VNG A;  2QQU A;  4CE8 A;  1PVX A;  4MGZ E;  5A3P A;  3NV4 A;  5AVA A;  4Q27 A;  1RUI 2;  4CPB A;  5FXX A;  3WP6 A;  4I0W B;  1W9W A;  1ND2 A;  1C57 A;  4GB3 2;  5A3N A;  4AEJ A;  5EJ3 A;  3AP4 A;  2RS5 3;  3ZFF A;  3WNN A;  2ADD A;  3C7G A;  4YGB A;  1S0C A;  4GB3 3;  3S5Q A;  1QDC A;  4MO3 M;  4WZF A;  1V6J A;  1D4M 1;  3I4I A;  4LBN A;  2YGM A;  3WCR A;  1GWM A;  4XC9 A;  4PI0 A;  1WBL A;  3TRS B;  5LA9 A;  3ZR6 A;  5C3O A;  5K8S A;  1AR7 3;  1I6X A;  1LOB A;  1UKR A;  1UPS A;  3K75 B;  3PVN A;  3BUC A;  5BNO A;  5LA1 A;  2AEZ A;  2DFC A;  4AI0 A;  1OVS A;  4B7E A;  2UYA A;  4R9A A;  2VH9 A;  3EMR A;  3U14 A;  4CPB D;  3JBG 2;  3LEG A;  3III A;  5JI9 A;  5FMD A;  3DXT A;  2LS6 A;  5FKC A;  3T2T A;  3ASI A;  2XUM A;  2WAA A;  1FMD 2;  3FLP A;  1XE0 A;  3ZDS A;  3LA3 A;  1JU3 A;  2Q30 A;  3AB0 A;  5DAQ A;  2Z42 A;  2ZX0 A;  3MI8 A;  2RHP A;  3CMG A;  2XJU A;  1FMD 3;  3I2G A;  4GJZ A;  1QNY A;  4DS0 A;  4NMI A;  1ENQ A;  3WP3 A;  3JCI A;  1U5I A;  2ZHL A;  3BPZ A;  3ZYB A;  4AWD A;  3PLQ A;  4K40 A;  4FT8 A;  2W5F A;  1R08 1;  4D6R A;  3PVE A;  3HD8 B;  1W9S A;  1WMD A;  1RUF 1;  4BQW A;  4LBQ B;  1REF A;  2D6N A;  4N53 A;  4WM7 B;  2VCC A;  4YGC A;  5FMC A;  5EV7 A;  3UJQ A;  3SLI A;  5EQU A;  3GJA A;  4LBJ A;  2WO7 A;  1SCS A;  3E1F 1;  3TEW A;  1M4W A;  5EWS A;  4E4D X;  4J25 A;  1D4V B;  1UYP A;  2RM2 2;  3AKQ A;  1IQA A;  1LNS A;  5HV4 A;  1AXY A;  2R30 A;  5L9V A;  3IN9 A;  2A6Y A;  1HB1 A;  2WNU B;  5JDB A;  3RJR A;  4JDN A;  1HB3 A;  1NUK A;  1WGP A;  2V09 A;  2RM2 3;  1MS5 A;  3I59 A;  4HAN A;  1QU0 A;  4P9G A;  4YVW A;  1LES A;  5CB7 A;  1S55 A;  1PMH X;  4N9I A;  2WFF 2;  3HN3 A;  2ZOE B;  4W6Y A;  5DAB A;  4BPZ A;  4Y3O A;  1X9T A;  2F6B A;  1ZBE 3;  4DY5 A;  4QT6 A;  2WFF 3;  2E51 A;  3LEK A;  4MHR A;  1LEN A;  5DXD A;  5T3N A;  1F35 A;  1Y3T A;  3WW4 A;  3WUC A;  3GZE A;  2VR4 A;  2CAV A;  3EHK A;  2FCV A;  3LQC A;  3OGJ A;  4GZ9 A;  2YDE A;  5IT6 A;  2B39 A;  2RS5 1;  2A6Z A;  1AL0 G;  4LT5 A;  1H2M A;  4PQ9 A;  1KXG A;  1XBF A;  2W94 A;  5C3P A;  4GB3 1;  5FXZ A;  2W9X A;  4FAH A;  5E1R A;  4RQP C;  1Q8P A;  4Q8K A;  1AR7 1;  1VB2 A;  5J09 A;  5FY5 A;  1RVF 3;  2JEM A;  1BHG A;  1LOF C;  2BFU L;  1FV3 A;  4AGV A;  2YPJ A;  1MZF A;  3NJY A;  2OX0 A;  5J36 A;  5L7O C;  1KFU L;  5E16 A;  1VP6 A;  2ZS6 B;  2ATF A;  1Q56 A;  1YCI A;  1ZRR A;  5CBL A;  5IFP A;  3VBH C;  1VBE 2;  1CAV B;  2WII B;  2FZ1 A;  1NZI A;  4LUK A;  3EB7 A;  2VZV A;  5FZL A;  2YC4 A;  3HNM A;  3CIH A;  4FP3 A;  1LOD A;  2P17 A;  5A7O A;  1FMD 1;  4CDQ C;  4CDW C;  4M00 A;  3WV6 A;  4CXW A;  2JD4 A;  3NNL A;  4N43 B;  3THD A;  2RS1 3;  4QGN A;  4QPG B;  2FCU A;  4P9X A;  3BKZ A;  3GBF A;  1OT5 A;  1QF3 A;  1S1A A;  2VVF A;  4B3N A;  3M8L A;  3WG2 A;  4XZP A;  1VR3 A;  5FZ9 A;  3WG1 A;  3BOW A;  3MIC A;  5HCB A;  2B5H A;  3I2F A;  4PJY A;  1UMH A;  2QUO A;  2XGX A;  2XWB B;  3B01 A;  3Q8C A;  4GH4 A;  4AHZ A;  2QQP A;  3ZYJ B;  2BBV A;  1GSL A;  1AR6 2;  3CDZ B;  3NJX A;  2DCK A;  4E8C A;  1J59 A;  1E5S A;  4A3X A;  5CKN A;  4J6G A;  1PGW 2;  4BU2 A;  2RM2 1;  4LBQ D;  2R07 2;  1SFN A;  4COZ A;  5J37 A;  1ZA7 A;  2L9L A;  1S0G A;  3W9A A;  2R32 A;  4M4P A;  1TVG A;  4S2H A;  4AQS A;  2K0G A;  1ZBE 1;  1URX A;  4NPR A;  1H9W A;  1S0J A;  3ORJ A;  2WFF 1;  5FZ8 A;  5DUX A;  4HVQ A;  1POV 3;  1C3H A;  3OY8 B;  3MEP A;  3F95 A;  3M4F A;  2VCB A;  4FPJ A;  3D0J A;  4NPL A;  4D94 A;  1JZ3 A;  1PIV 3;  4UFL A;  1VRB A;  3C7E A;  3H3L A;  3JD7 3;  3KVA A;  2ZX3 A;  2X09 A;  2PAE A;  5JXI A;  4XUT A;  4AED B;  4DY3 A;  4FO9 A;  5GM0 A;  3AK0 A;  4Y4R A;  3CHX A;  3FHA A;  5C3Q A;  3E5X A;  1RVF 1;  4WM7 C;  3HNY M;  1F9K A;  5I0U A;  3T4H B;  2OPK A;  4FPO B;  5C33 A;  4CXY A;  1W9T A;  2ZGP A;  5L9R A;  3DYP A;  3VD7 A;  1DG6 A;  5BXX A;  2WN3 A;  2QZ3 A;  2W92 A;  5BNN A;  1NKG A;  4CP1 A;  5C4W B;  5BPX A;  1CAV A;  3VBR B;  4FFG A;  3PTY A;  4N8M A;  4W6X A;  1US2 A;  2WUH A;  3J9S A;  3LEI A;  5FP8 A;  1AL2 3;  4LK7 A;  3HJR A;  2F4L A;  3FBM A;  1A8M A;  2BFU S;  2RVA A;  2VBB A;  2WNU C;  3U78 A;  3WP5 A;  3ZYR A;  4W8J A;  5HCF A;  2YYO A;  2QFE A;  1VB4 A;  4N9H A;  4UXA A;  3PTR B;  2Q1M A;  3PJQ A;  4WVZ A;  5FWE A;  4UBG A;  4ZON A;  3I97 A;  5L19 A;  4CDX A;  2FDK A;  5F3E A;  2RS1 1;  3FLR A;  4UFK A;  1SZB A;  2P3I A;  1D2Q A;  1O7F A;  1HN1 A;  1S4C A;  4AFC A;  4UT5 A;  1AR9 2;  1AYM 3;  1HRI 2;  4KL1 A;  5JUV A;  3NV2 A;  1W6O A;  3BTA A;  1W3V A;  1MZ6 A;  3FFZ A;  1ASJ 2;  3GBW A;  2BW8 A;  4PF5 A;  2O14 A;  1R1A 2;  1W6P B;  1XYO A;  1YQ2 A;  4LK6 A;  3NQH A;  3GBG A;  2XPJ A;  1AXK A;  2KM2 A;  4DZG A;  5FMB A;  2K2S A;  2GND A;  3AXD A;  2P37 A;  3MLK A;  4GJY A;  5CFC B;  2BVB A;  4TSV A;  1R1A 3;  2A75 A;  5I93 A;  2XH6 A;  3SCH A;  1V70 A;  1US3 A;  2FQP A;  2DTW A;  3HMY A;  3WNO A;  1MEC 2;  1IOA A;  1H6X A;  2GAU A;  5DUU A;  3WX5 A;  3VD5 A;  3AKS A;  1PGW 1;  2C5D A;  3ZPO A;  4QDS A;  1ALY A;  4QB2 A;  4RFT 0;  4AQT A;  4RYD A;  2ZTN A;  2CY6 A;  2ZHM A;  1W3X A;  4LKD A;  5JOW A;  1H8T A;  1POV 1;  3DPR A;  4URT A;  4L92 A;  3L9J T;  4O65 A;  4IUG A;  3UYJ A;  3U75 A;  1OD5 A;  4KGG A;  3SC7 X;  4XUP A;  4XXP A;  1PIV 1;  4N43 C;  4ZZ8 A;  2BP6 A;  4BZ4 A;  1UY1 A;  4JQT A;  3VDA A;  2DUO A;  1KDK A;  1UZV A;  3JD7 1;  4QX5 A;  3WOG A;  1PO2 3;  3WXP A;  1L7L A;  2BUK A;  4F83 A;  5JSP A;  3OBA A;  4IEU A;  5LAS A;  4QMA A;  2P3Y A;  1NA1 B;  4XJA A;  1VRH 2;  2ET7 A;  1BEV 2;  5GLU A;  5C4W A;  4HSJ A;  3RYP A;  3TB0 A;  4EN8 B;  4ERO A;  2VBD A;  3R4S A;  4QAW A;  3AYE A;  4XIL A;  1VRH 3;  2ZGL A;  2RJK A;  1FPN 2;  4L11 A;  2C6S A;  1W9Y A;  2OQ7 A;  1JYC A;  1AL2 1;  2BRT A;  5LEK A;  4AI1 A;  4ZKT B;  3W5N A;  1FPN 3;  1YQ6 A;  3B00 A;  3MUZ 1;  5FZ7 A;  2PHF A;  5A33 A;  5APA A;  5T54 A;  4KWL A;  3C7F A;  3JXS A;  4F8A A;  4G4F A;  1CON A;  2JEN A;  3DL3 A;  3NW4 A;  4EN7 B;  5CKQ A;  5A32 A;  2VOX A;  2VO5 A;  2JDA A;  2RDR A;  3PU8 A;  4JCK A;  4Q4W 2;  5H9R A;  1AYM 1;  3OPW A;  1EY2 A;  1ULC A;  3ACG A;  5FZC A;  4DFS A;  1W6P A;  2YBS A;  4EV0 A;  3GZU C;  5IVE A;  2JD9 A;  2Q0A A;  3PIJ A;  2AUY A;  3PU3 A;  4AK3 A;  2VMF A;  4DQA A;  5FZO A;  5ABJ C;  2XL9 A;  3O1O A;  3WNX A;  1OPM A;  1Y4W A;  4I0B A;  3FBY A;  5DN2 A;  1Y9M A;  3SEP A;  3JQW A;  1TEI A;  3D5O A;  5FY8 A;  1SLA A;  1XYP A;  1R1A 1;  4CYD A;  3ZFE A;  2PN5 A;  3VBO A;  2QCS B;  1QOT A;  3IPV B;  3SH3 A;  3V0A B;  2Y64 A;  3HBK A;  1C1L A;  3TN9 2;  2XWJ B;  5BNP A;  2DF7 A;  2J22 A;  2BEO A;  4XFF A;  3VBR C;  1I9R A;  2WNV B;  4QHB A;  4AG4 A;  4CUC A;  2YPD A;  3LF7 A;  4HBN A;  4FBF A;  2K9Z A;  4CZS A;  1PNG A;  3RSJ A;  4IV3 C;  1FV2 A;  5A80 A;  2ZX1 A;  4OHW A;  1O5U A;  2JDK A;  1HQL A;  1TG7 A;  5ISL A;  3PUI A;  4FTS A;  4WVV A;  1UIK A;  3R0R A;  3ZXK A;  1DQ6 A;  2ILM A;  2J1R A;  3BN6 A;  4M3C E;  2JG8 A;  5FZD A;  2FD8 A;  3J4U H;  2ZXQ A;  4TXW A;  4OQ9 A;  2B7Y A;  1OF4 A;  3WF3 A;  1VBD 3;  1JYI A;  2UWB A;  3PL0 A;  1JZ2 A;  1PO2 1;  4BLI A;  4UW4 A;  2NYY A;  3KM5 A;  4GWJ A;  2Y6L A;  4JGZ A;  4BQ3 A;  1O4T A;  3THP A;  5KXE A;  4BK5 A;  2ZGQ A;  4B4R A;  4Q0S A;  2I07 B;  1WW6 A;  2VNV A;  1K3I A;  1C8N A;  2Z69 A;  3H50 A;  2A5Z A;  2HKX A;  5FYV A;  1X8E A;  2G4I A;  5FTT C;  4XE9 A;  2NQY A;  1S0E A;  4DB5 A;  3AXE A;  3WHU A;  2EA7 A;  4FFH A;  1IGO A;  4B4P A;  5FO7 B;  4XJ9 A;  1GNY A;  2HEW F;  3PVO A;  4JKL A;  3T09 A;  2E53 A;  2JDZ A;  3ETQ A;  5GZC A;  4D8M A;  5JSO A;  4IE6 A;  4P9W A;  4ZU5 A;  3JQX A;  5AFB A;  2BYV E;  4QX3 A;  3SCF A;  5C3S A;  1QDO A;  1DQ2 A;  2XVG A;  4IES A;  1TMF 2;  1YFW A;  3BIE A;  2C9A A;  1W9F A;  1PM7 A;  2HH9 A;  3GM8 A;  3VBS C;  5DMY A;  4Q4Y 3;  1DBN A;  3V0B B;  4M0H A;  4NPM A;  2ZGM A;  4UW3 A;  4FI9 A;  1XNT A;  3M3I A;  2BQP A;  4K8F A;  5FP9 A;  3IMN A;  3RYR A;  1SCR A;  4LKF A;  3LE0 A;  1YI7 A;  1UYZ A;  2VZU A;  3KHB A;  4HKW A;  3KB5 A;  3FFQ A;  5IK4 A;  5LY1 A;  1QJU 2;  2K46 A;  4LBK A;  3WF0 A;  2WNV A;  3O1S A;  1PZ9 A;  3TAY A;  1IG3 A;  4PHZ A;  2GME A;  4IQP A;  5FZG A;  4NN0 A;  1PMI A;  5KHG A;  4QPI B;  1S2E A;  2KA3 A;  3J8F 2;  5F5C A;  5T5J A;  4EZH A;  4OHZ A;  4FXG B;  5JMO A;  1CQ9 A;  1JHJ A;  1OVP A;  1RUD 3;  2QQW A;  1QEX A;  2VVD A;  2C4X A;  4MGI E;  4OFG A;  5A1L A;  3O1U A;  3J8F 3;  2JJ6 A;  2GP5 A;  1RYY A;  5E88 A;  4ASL A;  4YVS A;  5AC9 3;  3ZFG A;  2BNN A;  2HEY F;  1G8W A;  3RS6 A;  4LPL A;  4DUV A;  3TNQ A;  1LGB A;  1VBD 1;  2WT0 A;  3POB A;  3IZO A;  2VZQ A;  4OHX A;  4Y5S A;  5FP3 A;  1LCL A;  4LLO A;  5A7W A;  1RUJ 1;  2WZE A;  5DAW A;  2D6L X;  3B9C A;  1GQP A;  1V6N A;  1W2A X;  3MW2 A;  2I2S A;  1GZC A;  2PTM A;  2Y6K A;  4LUL A;  2VUJ A;  5FPA A;  1HRV 2;  1K45 A;  1S0D A;  4AFB A;  3AX4 A;  4B7K A;  1HW5 A;  5C71 A;  3IMM A;  5D1I A;  1T6B X;  1FOD 2;  3UJO A;  1HRV 3;  4A3Z A;  2VOW A;  3ME2 A;  3ZX7 A;  1ST8 A;  1VAV A;  3QH6 A;  1IS4 A;  3LIH A;  1RUN A;  1RIR A;  2XJT A;  1W6M B;  3RRD A;  1GU3 A;  2WAO A;  5GAL A;  3V56 A;  1Y7B A;  2YUE A;  1RMU 3;  1CAX A;  4Z07 A;  5FY4 A;  2D3S A;  4CCJ A;  4E4H A;  1BLZ A;  1MVQ A;  3KV9 A;  2QJV A;  2DVG A;  1LHV A;  2J7M A;  2V4V A;  4FCA A;  4HG6 B;  4P9I A;  2LUW A;  2JE8 A;  2G9Z A;  4XFA A;  3SKJ E;  3U10 A;  4DRR A;  4Q4Y 1;  3LFI A;  4N7I A;  2I74 A;  1HLC A;  3GCX A;  4A7Y A;  1KRI A;  4LJH A;  4PBP A;  1Z7S 2;  1CX4 A;  4AVA A;  3IKW A;  2X10 A;  4PCR A;  3TEX A;  4IEX A;  4CUA A;  1JZ4 A;  2B9V A;  4NE9 A;  4ATF A;  3RNS A;  1ENX A;  1Z7S 3;  3WEZ A;  1AX1 A;  3WQ0 A;  3KV4 A;  5KC6 A;  4NID A;  4E9K A;  4Q8L A;  4QPI A;  2WYF A;  1J1L A;  2D6K A;  3M3Q A;  1ZRD A;  1NYW A;  2EVX A;  2BGO A;  4XDQ A;  4FPE A;  4LOR A;  1IPK A;  1EUU A;  1AX2 A;  2CWM A;  2R06 2;  3POG A;  3KLS A;  5FRE A;  4UF0 B;  1QHD A;  4PLN A;  5B4N A;  3NJV A;  1Z0H A;  2FDJ A;  1OKO A;  2QQI A;  5T5O A;  3A7Q A;  3VBF A;  4CCL A;  5GLT A;  3OB8 A;  1RUD 1;  3NRU A;  3CF6 E;  4JTN A;  2XG3 A;  5HCA A;  3J8F 1;  1V0A A;  1JOJ A;  1DFQ A;  1DQ5 A;  4HOO A;  5AC9 1;  4FPG A;  4XFH A;  2CL2 A;  2PHR A;  1TQ5 A;  3ZPY A;  1J3Q A;  1MAC A;  3MW3 A;  2VQA A;  2GNM A;  4R9B A;  2VOV A;  4RGK A;  1COV 2;  5C70 A;  1UYY A;  3UKT A;  1C8M 1;  3AZW A;  4S2F A;  4Y1Z A;  1DCS A;  1CWP A;  4HK9 A;  1H0B A;  4S2D A;  2HBU A;  4IGQ A;  2RJL A;  5A3W A;  2WYS A;  5CEH A;  1JHN A;  4XUQ A;  2VW2 A;  3FE5 A;  3ILF A;  3DF0 A;  1VBA 3;  2HLE A;  3FUQ A;  3SH4 A;  3H9A A;  2GNT A;  2O0O A;  4HXC A;  5JWP A;  1WA6 X;  2HWE 1;  4XBL A;  2IXL A;  1UU5 A;  1YO8 A;  2VJX A;  2Y8K A;  5EJZ B;  3KF5 A;  4IEV A;  4COV A;  2HWB 2;  4Y1U A;  4O7X A;  5ANQ A;  1YQ5 A;  4D7Y A;  1LHO A;  1SLT A;  3ON7 A;  3M3E A;  3RWK X;  3ZXA C;  1ND3 C;  5I8T A;  1ZBA 3;  2D5F A;  4PI2 A;  4AI9 A;  1RMU 1;  2HWB 3;  3H1M A;  3RZL A;  5FRA A;  5EFU A;  3NNM A;  3S57 A;  1XOY A;  1DZR A;  4MV2 A;  4XHB A;  2OQ6 A;  1IHM A;  3I7D A;  2ZAC A;  4BIF A;  1MQT A;  1SQ4 A;  1N3O A;  2W1W A;  4BA6 A;  2GH2 A;  3HWJ A;  1GP6 A;  4R9D A;  1UOF A;  3PHM A;  5FQ0 B;  3OD0 A;  4CEY B;  3APB A;  2WLQ A;  3NNF A;  4Q4X 3;  5E6H A;  3VZL A;  1BYH A;  3MID A;  3AMN A;  3HPN A;  4UW6 A;  1LOG A;  3K51 A;  2E31 A;  1D4M 2;  1L3J A;  3FC0 A;  1Z7S 1;  3KQR A;  3AMM A;  3VZN A;  3OEB A;  1G86 A;  3IAP A;  3VL9 A;  3GZA A;  5JZG B;  2P6C A;  4K6B A;  1C5H A;  2GC2 A;  4QD2 A;  4D69 A;  2V72 A;  3IBM A;  4TZD A;  1SFY A;  2ZJC A;  1JMU B;  2PHL A;  4BH9 A;  5C7G A;  5GZG A;  1HN0 A;  5EXO A;  4XFI A;  4OQ8 A;  3NV3 A;  3EQE A;  5FYS A;  3PME A;  4YW6 A;  2VEC A;  2D93 A;  2JB4 A;  3O0X A;  2HWD 3;  3T2P A;  1SLC A;  1G9B A;  3RYK A;  1UU4 A;  4PLO A;  4D0Q A;  1QMJ A;  1RXF A;  3I2I A;  4JAA A;  3UGG A;  5CIR A;  1GR3 A;  4M01 A;  3VV1 A;  2X8K A;  1I3H A;  2P2K A;  4LUM A;  1AZD A;  3CQO A;  4HPK A;  1GOG A;  3WF4 A;  5JSR A;  2ARE A;  1SBD A;  2VMC A;  3GCW A;  5HXM A;  5JLV A;  4Q29 A;  5H9P A;  5LBE A;  2UU8 A;  1VMJ A;  2LW8 A;  3IM0 A;  3KWV A;  1R08 2;  1W8T A;  1W8Z A;  1RUF 2;  5I0R A;  5A3U A;  1OUS A;  2PAM A;  3IIA A;  4BMB A;  2AEN A;  1VBA 1;  2G9G A;  2YC0 A;  1JZ7 A;  1W8H A;  4FPL A;  3MIB A;  1ZZ7 A;  3U07 A;  2P5B A;  2WZP P;  4JVA A;  4C0H A;  3D4K A;  1DDL A;  2Y0I A;  4DEV A;  3AP6 A;  5BV6 A;  1UCX A;  2YMZ A;  4UI9 L;  5L7O B;  4BWO A;  3I2O A;  3LDK A;  1CZS A;  1S2K A;  4M3C A;  3WDV A;  5F1R A;  3VZM A;  3WG4 A;  3ZXG A;  2VZ3 A;  1UZY A;  1YI9 A;  5DZG A;  4FPK A;  3VBH B;  3FX3 A;  1ZBA 1;  4ARY A;  4OHY A;  5A6Q A;  3H3U A;  4Y20 B;  4JHT A;  4V1P A;  1E5H A;  3UL2 A;  4EWD A;  3X29 B;  4LR4 A;  4MSV A;  4PIX A;  4AFD A;  5FJK A;  2OII A;  1CX1 A;  2ZKN A;  1LU2 A;  3WNP A;  1R09 2;  1W90 A;  2DBN A;  2VD7 A;  2E26 A;  4L2N A;  4NHM A;  4WM8 A;  2WDB A;  5FZ6 A;  5JIU A;  1GP5 A;  1OC1 A;  3D6E A;  1OQD A;  4P9Y A;  5H9S A;  2RS5 2;  2WO3 A;  3FHI B;  4Q4X 1;  5IJR A;  1OH3 A;  2EAA A;  1R09 3;  3LPF A;  5A3T A;  4LOS A;  5FY0 A;  3VDD C;  5LA0 A;  1RJ7 A;  5GZF A;  4EYU A;  5LBC A;  1QNW A;  4KBZ A;  2JDP A;  1AR7 2;  1S0B A;  4I01 A;  4Q1R A;  2SBA A;  5FYC A;  3H1W A;  4DRV A;  5BNQ A;  3KF3 A;  3T0D A;  3I2J A;  2VMI A;  2Q8O A;  2VQ0 A;  2ARC A;  1JYW A;  1BXH A;  3N9O A;  4COU A;  2Y34 A;  4XYX A;  5JOY A;  1AHS A;  3K2O A;  2BU9 A;  2JKX A;  1ZZB A;  3BTY A;  1PO1 3;  2HWD 1;  3C8X A;  4YW3 A;  3AYA A;  5A7Q A;  3T30 A;  5DZE A;  1OLM E;  3V64 A;  1SLL A;  2O8Q A;  1HQN A;  3KT7 A;  5ERL A;  2JE7 A;  1OOP B;  2AGS A;  2D6M A;  4GAZ A;  4XJU A;  4XBQ A;  2VZO A;  4BQ4 A;  4CU9 A;  2PLV 3;  1VBB 3;  1NAE A;  4Q4V 2;  2IXI A;  2P1B A;  3VUO A;  1O3R A;  4WVM A;  4QXK A;  2G19 A;  2OT7 A;  2NMO A;  3INA A;  5GLW A;  5BYN A;  4BCU A;  1OA2 A;  2NN8 A;  4AZZ A;  4NRP A;  4QU2 A;  4NRQ A;  4D7S A;  4Q4V 3;  4RQP A;  4MXW B;  5FYI A;  1DGL A;  2R7E B;  4W50 A;  1LOF A;  4CEY C;  5JR2 A;  3AZX A;  4KWJ A;  3RZH A;  2W08 A;  5DAP A;  2NZ9 A;  2WO2 A;  4DXS A;  5JAX A;  1CD3 G;  2ARB A;  3JB4 C;  2PAK A;  5KHK A;  2XBO 3;  5FLH A;  2VQU A;  3VBH A;  3I3Q A;  4GWM A;  5CYY A;  5FXV A;  5JZG C;  1GQH A;  3N9L A;  5CZK A;  3SIS A;  2ZEW A;  4URA A;  1D0G A;  4QHZ A;  2EIC A;  1W99 A;  5K4L A;  5FP7 A;  2VE1 A;  4CDW A;  4CDQ A;  4XF1 A;  1ZRI A;  4XTP A;  3N7M A;  1Z78 A;  5A1A A;  1LHN A;  4LHN A;  2DCT A;  1Q3E A;  1RUH 3;  1ZBE 2;  4A41 A;  2BV4 A;  2AYH A;  3LSD A;  3NNJ A;  5JXG A;  1OUX A;  3D8C A;  4DIN B;  2DDU A;  1XNB A;  3TWI A;  1GQG A;  3NST A;  3TYJ A;  3ZR5 A;  2GU9 A;  4QM9 A;  4YZ2 A;  2VUA A;  3ZN5 A;  3BOD A;  5GKA C;  4P9L A;  4PBO A;  3ZMO A;  2GC0 A;  1VMH A;  2YXS A;  4XVH A;  3T1M A;  3TBD A;  1R09 1;  3PMS A;  2A7A A;  2Y26 A;  2A1X A;  2JEC A;  5K0U C;  2WWU A;  4A42 A;  1F4A A;  3ZVX A;  2GZW A;  3AKP A;  3QD6 A;  4YAR A;  4AAX A;  4LE3 A;  5K7P A;  1VJ2 A;  4K1Z A;  1RVF 2;  5G04 L;  1XXN A;  1MPX A;  1HIX A;  1STM A;  1TME 2;  3WT3 A;  2JDY A;  2VZP A;  5FP4 A;  1LHU A;  2FMY A;  4CDU C;  4BXF A;  1F5J A;  4XJZ A;  3FHQ A;  1TME 3;  2WA4 A;  1N3P A;  2ZHN A;  2ERF A;  1PO1 1;  1W2U A;  5LK7 B;  4LBM A;  4IV1 C;  1CZV A;  5F3I A;  1GWL A;  2W3J A;  4FVV A;  4P14 A;  1BMV 1;  4YM2 A;  3J7M A;  5LWB A;  1K12 A;  4A7K A;  2XHN A;  2D5H A;  2DU0 A;  2PLV 1;  5FYY A;  2RS1 2;  1VBB 1;  1CJD A;  2LM3 A;  2DVA A;  4X8P A;  4PDW B;  4MXW A;  2Y38 A;  2VOT A;  3OF1 A;  4TYS A;  1LEC A;  2Q1Z B;  2EXH A;  4Q4V 1;  1O3T A;  1R64 A;  2W46 A;  1UZ0 A;  4AVS A;  2W87 A;  4CP2 A;  2VUC A;  4LBQ A;  4FOW A;  4WM7 A;  4XJW A;  2ES3 A;  4N53 C;  1Q8O A;  1QXR A;  3HR9 A;  1YQC A;  4D7T A;  1PVC 3;  2VAU A;  2XBO 1;  2HJI A;  3ZLI A;  3LFM A;  1WBF A;  3B7M A;  4MOA A;  1DQ0 A;  3E97 A;  4NWW A;  3W5M A;  2WNU A;  4BOW A;  2EAK A;  3SXW A;  3LDR A;  3ZN4 A;  4DXR A;  3H8R A;  1VE0 A;  4NVP A;  2JKB A;  1YIF A;  4NHX A;  3MPP G;  1JTZ X;  2D97 A;  4YG6 A;  1WZX A;  1YIP A;  3AVS A;  2Y33 A;  2ZCW A;  1WCS A;  2ORZ A;  4XQD A;  4YVW C;  4A7Z A;  5FZE A;  4Y4Y A;  1JZ5 A;  1RUH 1;  1N1S A;  3PUS A;  1I5Z A;  4OMC A;  4Y5Z 0;  3GAL A;  3IWZ A;  2WZR 3;  1PZ7 A;  4I0A A;  1OOP C;  2CHH A;  2PHU A;  4C1X A;  2P4E A;  3OUH A;  5FUN A;  4BDV B;  1PIV 2;  1QXJ A;  1OLR A;  2VVE A;  3KD4 A;  2ZZQ A;  1AX0 A;  2QQJ A;  3JD7 2;  1V6O A;  4IET A;  4EZ4 A;  4ZHN A;  2VMD A;  3NMB A;  1ZZ6 A;  2FBE A;  1KS4 A;  4YWA A;  1IPS A;  2CSG A;  2W91 A;  3THC A;  2XJQ A;  1JOB A;  4L8Q A;  5ABJ B;  5JOX A;  4MG2 A;  4Q0V A;  1A6C A;  5DPN A;  3N7J A;  4SLI A;  2UWA A;  4COY A;  5FK8 A;  2H6B A;  4XET A;  3CJI C;  4XAB A;  3ZYI B;  1GOF A;  5T50 A;  3T08 A;  1TME 1;  4BQX A;  5F5A A;  5IAX A;  4A6O A;  1AL2 2;  1KDM A;  1OA3 A;  4OZX A;  2GC3 A;  1X82 A;  4AFA A;  3JZV A;  4DIQ A;  5I0S A;  3ZYP A;  4YGD A;  1LED A;  2UWC A;  4IV3 B;  2PHT A;  1UMZ A;  4KMQ A;  2ZGU A;  3S7I A;  3UT0 A;  2TNF A;  1UY2 A;  4K7J A;  1KQR A;  1QJX 2;  4N43 A;  4QPG A;  4Q0Q A;  1XNC A;  1ZVF A;  3AJY A;  3K4Z A;  4CTE A;  3RVH A;  4LIT A;  4CCM A;  2W1S A;  3EXU A;  4LKS A;  4IE7 A;  1AYM 2;  3URF A;  1QJX 3;  3KT4 A;  1AYN 2;  2WZ8 A;  2AAC A;  2B46 X;  3NO8 A;  5FZH A;  5FDB A;  3I8T A;  2D98 A;  5IW0 A;  1DGR N;  3ZKY A;  3H42 B;  2J1E A;  3ILR A;  1BK1 A;  1AYN 3;  1E57 A;  1OFN A;  1PVC 1;  4GMP 3;  1WW4 A;  4OI4 A;  5HXV A;  3U11 A;  5FO8 B;  1JW6 A;  3ACH A;  2Q5T A;  1PGL 1;  4RS5 B;  5FZM A;  4NOT A;  4QB1 A;  1SBF A;  1AF9 A;  2QVS B;  3OG2 A;  5FAX A;  5B2G B;  4AI8 A;  2QQL A;  1HQW A;  4FFI A;  2D43 A;  2AR6 A;  3ROU A;  3S6P A;  1N1Y A;  1SPP B;  1RHI 3;  3NNG A;  1NCQ C;  5GJ6 A;  5TSW A;  3WUD A;  4FQZ A;  1GNH A;  5FV3 A;  2IC1 A;  1KEX A;  3KQ4 B;  3OY8 A;  2WZR 1;  4JRL A;  5ACA 3;  3KCY A; 
#chains in the Genus database with same CATH homology
 4JZR A;  4NAO A;  5M0T A;  5LBC A;  4XAA A;  4KBZ A;  3GJB A;  4NMI A;  3OUJ A;  3HQR A;  3MGU A;  4ZPI A;  5L9B A;  4BQW A;  2Y34 A;  2RDR A;  5EQU A;  3GJA A;  4NHX A;  2OPW A;  3NNM A;  4Y5T A;  4J25 A;  3OUI A;  2Y33 A;  3KT7 A;  5ERL A;  4Y5S A;  5HV4 A;  5L9V A;  5DAW A;  5L9R A;  4XAC A;  2RDQ A;  2RDS A;  2G19 A;  3NNF A;  4UWD A;  3OUH A;  3OBZ A;  4XCB A;  4NHK A;  4XCA A;  5C5T A;  2JIJ A;  2V4A A;  5IAT A;  4MHR A;  5C5U A;  5DAP A;  3GZE A;  4ZON A;  2FCV A;  2HBT A;  4MHU A;  5EP9 A;  4NHY A;  2RDN A;  2JIG A;  5LAT A;  3ITQ A;  4XAB A;  4BQX A;  5IAX A;  5LB6 A;  5EPA A;  3PL0 A;  4Q5O A;  3HQU A;  5DAX A;  3NNJ A;  5LBE A;  5HV0 A;  5A3U A;  2RG4 A;  2A1X A;  5IAV A;  3KT4 A;  3NNL A;  4NHL A;  2FCU A;  3W21 A;  5LBB A;  3DKQ A;  2G1M A;  4XC9 A;  5LA9 A;  4IW3 A;  5LAS A;  3KT1 A;  3EMR A;  3BVC A;  4BQY A;  5DAV A;  4NHM A;  2FCT A;  3W20 A;  2HBU A;  5LBF A;  5DAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...