2Y3QA

1.55a structure of apo bacterioferritin from e. coli
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
157
structure length
157
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monitoring and Validating Active Site Redox States in Protein Crystals.
pubmed doi rcsb
molecule keywords BACTERIOFERRITIN
source organism Escherichia coli
molecule tags Metal binding protein
total genus 77
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2y3qA00
2GYQA 5I4JA 2V2SA 4AM5A 4LQHA 3RE7A 4LPNA 2VXXA 1NF4A 1VEIA 4MUDA 1MOJA 1IERA 1O9IA 1JKVA 4ERUA 5GU0X 2JD60 3Q4OA 3Q4NA 3U90A 3BVKA 2ZA8A 3RGDA 1HRSA 3QHCA 4XGSA 4IWKA 4U3GA 4E6KA 3KXUA 1EUMA 3BVLA 3E2CA 2XKQA 2V2NA 1RCCA 3R2LA 2IB0A 4ML5A 4ISPA 5E2DA 3SE1A 2YJJA 2ZA6A 4RC7A 3WNWA 3KA4A 4ETRA 3EGMA 4ZKHA 2C2UA 3HL1A 4MY7A 3E1MA 1NNQA 1BFRA 5ERJA 3TA8A 5JKMA 4CMYV 1DVBA 4AM4A 3QB9A 5FFBA 1NF6A 1Z6OM 3AF8X 2BKCA 4TOBA 4ZL6A 4LYXA 1DPSA 1JI5A 3ES3A 4TOGA 4ZTTA 2ITBA 3F34A 2CF7A 2FG4A 4IXKA 3ERZA 2XJOA 3AK9A 4TW3A 4EVEA 3E1JA 1S30A 4PGKA 5D8PA 1L8IA 4M35A 2F7NA 3Q4QA 4LQVA 3F39A 3F32A 2GYDA 1F30A 3O7SA 1O9RA 5CMRA 1YV1A 3E1QA 1VELA 4MJYA 4PG1A 2V2LA 1JYBA 4AM2A 3SH6A 3IQ1A 5AXSA 4A25A 5K52A 2C6RA 5FFEA 4LPJA 3AF7X 2BJYA 3WVUA 1VJXA 1S2ZA 3EZUA 2OH3A 5JKMG 2JD80 3R2HA 3A68A 3UOFA 5GU2X 3PVTB 2CLBA 5FFDA 3E1LA 4RC6B 5FFAA 5D8XA 2FJCA 3NOZX 3PWFA 5JACA 3PWQC 1S3QA 1LB3A 4DYZA 4TODA 2VZBA 4DASA 5LBHA 4RC5B 3QVDA 3VNXA 2W0OA 3E6RA 1JIGA 5LG8A 5J93A 2VXIA 4MN9A 3BVIA 5D8SA 1H96A 1IESA 2XJMA 3A9QA 2FKZA 1QGHA 2C41A 3HIUA 3PZAA 2WLUA 4CYAA 4KVQA 2X170 1JKUA 4OYNA 5GOUA 1OTKA 2CN7A 1YUZA 2ZG7X 2YW6A 1JTSA 1BG7A 4ITWA 3GHQA 5CMQA 3AJPA 1FHAA 1RCGA 3E1PA 3KA9A 4LQJA 2CN6A 1RCIA 2ZG8X 2V2JA 3NP0X 1TKOA 4QUWA 4Z5SA 2QF9A 3O7RA 1RCEA 2HR5A 4ZKWA 1LKOA 4CY9A 4LQNA 2ZG9X 1VLGA 4II4B 4ZL5A 3R2SA 2C2JA 5GU1X 4M34A 3RD0A 5J8SA 3PW8C 2CEIA 3QHBA 3BVEA 3PVRB 1LKPA 1N1QA 2FHAA 4TOEA 4RC8A 2JD70 3FI6A 5E1UA 2G4HA 4DZ0A 2BK6A 3RAVA 5C6FA 3SHXA 1R03A 1ZS3A 3IS8A 3F36A 1QYBA 3KX9A 1Z6OA 3PW1B 2CHIA 3F38A 3KWOA 1SQ3A 1F33A 3PVYB 4TOAA 3EZ0A 2Z90A 4DYUA 2V2MA 3IS7A 4MKUA 5D8OA 3SIDA 1RCDA 4CVRA 4M32A 4TOHA 3F37A 4Z3BA 2GS4A 3MPSA 4EVBA 1RYTA 2XGWA 3KA8A 4CYBA 3R2OA 3AF9X 5HJHA 4IWJA 1VEQA 2FZFA 5J8WA 1BCFA 1TJOA 5D8QA 1JI4A 2CIHA 2CLUA 4TOFA 2V2IA 1XZ3A 3ISFA 3R2RA 1B71A 4XKTA 4EVDA 2CHPA 1SOFA 3KA6A 3RBCA 3F33A 4RC7B 4CVSA 4XKUA 5GU3X 3KA3A 2FG8A 3PVTA 3R2KA 4ISMA 5JKLA 5D8YA 3BVFA 3F35A 3AJQA 2V2OA 4RC6A 1ZUJA 3T9JA 3FVBA 3GVYA 3Q4RA 4CVPA 3H7GA 1JREA 3E1NA 4ZKXA 2YJKA 3BT5A 2WTLA 4RC5A 1J30A 3WVVA 3OGHA 2Z5RA 5J9VA 4CMYA 2IU2A 3GE4A 3PWQA 4XKSA 4PG0A 4KVRA 2V2PA 4TO9A 5HQOA 5FFCA 4TOCA 4PGIA 2QQYA 1LKMA 3E1OA 3QZ3A 1DATA 1UMNA 2ZURX 1TKPA 5GN8B 2Z5PA 2C2FA 3UNOA 5CZUA 5D8RA 4EVCA 2ZA7A 2YW7A 1KRQA 4ZJKA 2PYBA 4DE6A 2Z6MA 3UOIA 3WVWA 5IX6A 5LS9A 2FFXJ 2XJNA 1XZ1A 1GWGA 1UVHA 5JKLG 4DYXA 3NP2X 2D5KA 1Z4AA 4DI0A 2FL0A 3OJ5A 1AEWA 5K53A 3BKNA 2WLAA 4CVTA 4ZMCA 1JGCA 4II4A 1MFRA 1NFVA 5GN8A 2RBDA 4KVSA 3E6SA 2V15A 1TK6A 2Z5QA 3PVRA 4LYUA 4YKHA 4ZLWA 2BW1A 2Y3QA 2HTNA 4P18A 5HJFA 4M33A 4LPMA 5LG2A 2V2RA 1L8HA 2OC5A 4Y08A 3PW8A 3AJOA 3FSEA 4DYYA 3ISEA 3R2MA 4REUA 3AK8A 5FEJA 5ERKA 3QD8A 3PW1A 2UX1A 2IY4A 4ITTA 3PVYA 1YUXA 4R42A
chains in the Genus database with same CATH superfamily
2GYQA 5I4JA 2V2SA 4AM5A 4LQHA 3RE7A 4LPNA 2VXXA 1NF4A 1VEIA 4YXMA 4MUDA 1MOJA 3KHKA 1IERA 1O9IA 1JKVA 4ERUA 5GU0X 2JD60 3C23A 3Q4OA 3Q4NA 3U90A 3BVKA 2ZA8A 3RGDA 1HRSA 3QHCA 4XGSA 4IWKA 4U3GA 3UFBA 4E6KA 3KXUA 4X0JA 1EUMA 3BVLA 3E2CA 2XKQA 2V2NA 1RCCA 3R2LA 4W4KB 2IB0A 4ML5A 4ISPA 5E2DA 3SE1A 2YJJA 2ZA6A 4RC7A 3WNWA 3KA4A 4ETRA 3EGMA 4ZKHA 2C2UA 3HL1A 4MY7A 3E1MA 1NNQA 1BFRA 5ERJA 3TA8A 5JKMA 4CMYV 1DVBA 4AM4A 3QB9A 5FFBA 3VVAA 1NF6A 1Z6OM 3AF8X 2BKCA 4TOBA 4ZL6A 4LYXA 1DPSA 1JI5A 3ES3A 4TOGA 4ZTTA 2ITBA 3F34A 2CF7A 2FG4A 4IXKA 3ERZA 2XJOA 3AK9A 4TW3A 4EVEA 4YVZA 3E1JA 1S30A 4PGKA 5D8PA 1L8IA 2F7NA 4M35A 3Q4QA 4LQVA 3F39A 3F32A 2GYDA 1F30A 3O7SA 1O9RA 5CMRA 1YV1A 3E1QA 1VELA 4MJYA 4PG1A 2V2LA 1JYBA 4AM2A 3SH6A 3IQ1A 5AXSA 4A25A 3M6JA 5K52A 2C6RA 5FFEA 4LPJA 3AF7X 2BJYA 3WVUA 1VJXA 1S2ZA 2AR0A 3EZUA 3W54A 2OH3A 3C21A 3LKDA 5JKMG 2JD80 3R2HA 3A68A 3UOFA 5GU2X 3PVTB 2CLBA 5FFDA 3E1LA 4RC6B 5FFAA 5D8XA 2FJCA 3NOZX 3PWFA 5JACA 3PWQC 1S3QA 1LB3A 4DYZA 4TODA 2VZBA 4DASA 5LBHA 3V3KB 4RC5B 3QVDA 3VNXA 2OKCA 2W0OA 3E6RA 1JIGA 5LG8A 5J93A 3L0MA 2VXIA 4MN9A 4MXPA 3BVIA 2G38B 5D8SA 1H96A 1IESA 2XJMA 2V8TA 3A9QA 2FKZA 1QGHA 2C41A 3HIUA 3PZAA 2WLUA 4CYAA 4KVQA 2X170 1JKUA 4OYNA 5GOUA 3C1YA 1OTKA 5JDOB 2CN7A 1YUZA 2ZG7X 2YW6A 1JTSA 1BG7A 3N6OA 4ITWA 3GHQA 5CMQA 3AJPA 1FHAA 1RCGA 3E1PA 3KA9A 4LQJA 2CN6A 1RCIA 2ZG8X 3GGYA 3FRSA 2V2JA 3NP0X 1TKOA 4QUWA 4Z5SA 2QF9A 3O7RA 1RCEA 2HR5A 4ZKWA 1LKOA 4CY9A 4LQNA 2ZG9X 1VLGA 4II4B 4ZL5A 3DBYA 3R2SA 2C2JA 5GU1X 4M34A 3RD0A 5J8SA 3PW8C 2CEIA 3QHBA 3BVEA 3PVRB 1LKPA 1N1QA 2FHAA 4TOEA 4RC8A 2JD70 3FI6A 3JZ9A 5E1UA 4WJG4 2G4HA 4DZ0A 2BK6A 3RAVA 5C6FA 3SHXA 1R03A 1ZS3A 4YXJA 2WWXB 3IS8A 3F36A 3FRRA 1QYBA 3KX9A 1Z6OA 3PW1B 2CHIA 2N02A 3F38A 3VV9A 3KWOA 1SQ3A 1F33A 3PVYB 4TOAA 3EZ0A 2Z90A 4DYUA 2V2MA 3IS7A 4MKUA 5D8OA 3SIDA 1RCDA 4CVRA 4M32A 4TOHA 3F37A 4Z3BA 2GS4A 3MPSA 4EVBA 1RYTA 2XGWA 3KA8A 4CYBA 3R2OA 4KXRB 3AF9X 5HJHA 4IWJA 1VEQA 2FZFA 5J8WA 4E40A 1BCFA 1TJOA 5D8QA 1JI4A 2CIHA 2CLUA 4TOFA 2V2IA 1XZ3A 3ISFA 3R2RA 1B71A 4XKTA 4EVDA 2CHPA 2MGYA 1SOFA 3KA6A 3RBCA 2V8UA 3F33A 2CWLA 4RC7B 4CVSA 4XKUA 5GU3X 3KA3A 2FG8A 3PVTA 3R2KA 4ISMA 5JKLA 5D8YA 3BVFA 3F35A 3AJQA 2V2OA 4RC6A 1ZUJA 3T9JA 3FVBA 3GVYA 3Q4RA 4CVPA 3H7GA 3KDQA 2Y44A 1JREA 3E1NA 4ZKXA 2YJKA 3BT5A 2WTLA 4RC5A 1J30A 3WVVA 3OGHA 2Z5RA 5J9VA 4CMYA 2IU2A 3GE4A 3PWQA 3JZAB 4XKSA 4PG0A 4KVRA 2V2PA 3GGZA 4TO9A 5HQOA 5FFCA 4TOCA 4PGIA 4W4LB 2QQYA 1LKMA 3E1OA 3QZ3A 1DATA 5HU6D 1UMNA 2ZURX 1TKPA 5GN8B 2Z5PA 2C2FA 5JDOA 3UNOA 5CZUA 5D8RA 4EVCA 2ZA7A 2YW7A 1KRQA 4ZJKA 3C1ZA 2PYBA 4DE6A 2Z6MA 3UOIA 3WVWA 5IX6A 5LS9A 2FFXJ 2XJNA 1XZ1A 1GWGA 1UVHA 5JKLG 4DYXA 3NP2X 2D5KA 1Z4AA 4DI0A 2FL0A 3OJ5A 1AEWA 5K53A 3BKNA 2WLAA 4CVTA 4ZMCA 1JGCA 4II4A 1MFRA 1NFVA 5GN8A 2RBDA 4KVSA 3E6SA 2V15A 1TK6A 2Z5QA 3PVRA 4LYUA 3D19A 4YKHA 4ZLWA 2BW1A 2Y3QA 2HTNA 4P18A 5HJFA 4M33A 4LPMA 5LG2A 2V2RA 1L8HA 2OC5A 4Y08A 3PW8A 3AJOA 3FSEA 4DYYA 3ISEA 3R2MA 4REUA 3AK8A 5FEJA 5ERKA 3QD8A 3PW1A 2UX1A 2IY4A 4ITTA 3PVYA 1YUXA 4R42A
chains in the Genus database with same CATH topology
2GYQA 5I4JA 2V2SA 4AM5A 4LQHA 3RE7A 4LPNA 2VXXA 1NF4A 1VEIA 4YXMA 4MUDA 1MOJA 3KHKA 1IERA 1O9IA 1JKVA 4ERUA 5GU0X 2JD60 3C23A 3Q4OA 3Q4NA 3U90A 3BVKA 2ZA8A 3RGDA 1HRSA 3QHCA 4XGSA 4IWKA 4U3GA 3UFBA 4E6KA 3KXUA 4X0JA 1EUMA 3BVLA 3E2CA 2XKQA 2V2NA 1RCCA 3R2LA 4W4KB 2IB0A 4ML5A 4ISPA 5E2DA 3SE1A 2YJJA 2ZA6A 4RC7A 3WNWA 3KA4A 4ETRA 3EGMA 4ZKHA 2C2UA 3HL1A 4MY7A 3E1MA 1NNQA 1BFRA 5ERJA 3TA8A 5JKMA 4CMYV 1DVBA 4AM4A 3QB9A 5FFBA 3VVAA 1NF6A 1Z6OM 3AF8X 2BKCA 4TOBA 4ZL6A 4LYXA 1DPSA 1JI5A 3ES3A 4TOGA 4ZTTA 2ITBA 3F34A 2CF7A 2FG4A 4IXKA 3ERZA 2XJOA 3AK9A 4TW3A 4EVEA 4YVZA 3E1JA 1S30A 4PGKA 5D8PA 1L8IA 2F7NA 4M35A 3Q4QA 4LQVA 3F39A 3F32A 2GYDA 1F30A 3O7SA 1O9RA 5CMRA 1YV1A 3E1QA 1VELA 4MJYA 4PG1A 2V2LA 1JYBA 4AM2A 3SH6A 3IQ1A 5AXSA 4A25A 3M6JA 5K52A 2C6RA 5FFEA 4LPJA 3AF7X 2BJYA 3WVUA 1VJXA 1S2ZA 2AR0A 3EZUA 3W54A 2OH3A 3C21A 3LKDA 5JKMG 2JD80 3R2HA 3A68A 3UOFA 5GU2X 3PVTB 2CLBA 5FFDA 3E1LA 4RC6B 5FFAA 5D8XA 2FJCA 3NOZX 3PWFA 5JACA 3PWQC 1S3QA 1LB3A 4DYZA 4TODA 2VZBA 4DASA 5LBHA 3V3KB 4RC5B 3QVDA 3VNXA 2OKCA 2W0OA 3E6RA 1JIGA 5LG8A 5J93A 3L0MA 2VXIA 4MN9A 4MXPA 3BVIA 2G38B 5D8SA 1H96A 1IESA 2XJMA 2V8TA 3A9QA 2FKZA 1QGHA 2C41A 3HIUA 3PZAA 2WLUA 4CYAA 4KVQA 2X170 1JKUA 4OYNA 5GOUA 3C1YA 1OTKA 5JDOB 2CN7A 1YUZA 2ZG7X 2YW6A 1JTSA 1BG7A 3N6OA 4ITWA 3GHQA 5CMQA 3AJPA 1FHAA 1RCGA 3E1PA 3KA9A 4LQJA 2CN6A 1RCIA 2ZG8X 3GGYA 3FRSA 2V2JA 3NP0X 1TKOA 4QUWA 4Z5SA 2QF9A 3O7RA 1RCEA 2HR5A 4ZKWA 1LKOA 4CY9A 4LQNA 2ZG9X 1VLGA 4II4B 4ZL5A 3DBYA 3R2SA 2C2JA 5GU1X 4M34A 3RD0A 5J8SA 3PW8C 2CEIA 3QHBA 3BVEA 3PVRB 1LKPA 1N1QA 2FHAA 4TOEA 4RC8A 2JD70 3FI6A 3JZ9A 5E1UA 4WJG4 2G4HA 4DZ0A 2BK6A 3RAVA 5C6FA 3SHXA 1R03A 1ZS3A 4YXJA 2WWXB 3IS8A 3F36A 3FRRA 1QYBA 3KX9A 1Z6OA 3PW1B 2CHIA 2N02A 3F38A 3VV9A 3KWOA 1SQ3A 1F33A 3PVYB 4TOAA 3EZ0A 2Z90A 4DYUA 2V2MA 3IS7A 4MKUA 5D8OA 3SIDA 1RCDA 4CVRA 4M32A 4TOHA 3F37A 4Z3BA 2GS4A 3MPSA 4EVBA 1RYTA 2XGWA 3KA8A 4CYBA 3R2OA 4KXRB 3AF9X 5HJHA 4IWJA 1VEQA 2FZFA 5J8WA 4E40A 1BCFA 1TJOA 5D8QA 1JI4A 2CIHA 2CLUA 4TOFA 2V2IA 1XZ3A 3ISFA 3R2RA 1B71A 4XKTA 4EVDA 2CHPA 2MGYA 1SOFA 3KA6A 3RBCA 2V8UA 3F33A 2CWLA 4RC7B 4CVSA 4XKUA 5GU3X 3KA3A 2FG8A 3PVTA 3R2KA 4ISMA 5JKLA 5D8YA 3BVFA 3F35A 3AJQA 2V2OA 4RC6A 1ZUJA 3T9JA 3FVBA 3GVYA 3Q4RA 4CVPA 3H7GA 3KDQA 2Y44A 1JREA 3E1NA 4ZKXA 2YJKA 3BT5A 2WTLA 4RC5A 1J30A 3WVVA 3OGHA 2Z5RA 5J9VA 4CMYA 2IU2A 3GE4A 3PWQA 3JZAB 4XKSA 4PG0A 4KVRA 2V2PA 3GGZA 4TO9A 5HQOA 5FFCA 4TOCA 4PGIA 4W4LB 2QQYA 1LKMA 3E1OA 3QZ3A 1DATA 5HU6D 1UMNA 2ZURX 1TKPA 5GN8B 2Z5PA 2C2FA 5JDOA 3UNOA 5CZUA 5D8RA 4EVCA 2ZA7A 2YW7A 1KRQA 4ZJKA 3C1ZA 2PYBA 4DE6A 2Z6MA 3UOIA 3WVWA 5IX6A 5LS9A 2FFXJ 2XJNA 1XZ1A 1GWGA 1UVHA 5JKLG 4DYXA 3NP2X 2D5KA 1Z4AA 4DI0A 2FL0A 3OJ5A 1AEWA 5K53A 3BKNA 2WLAA 4CVTA 4ZMCA 1JGCA 4II4A 1MFRA 1NFVA 5GN8A 2RBDA 4KVSA 3E6SA 2V15A 1TK6A 2Z5QA 3PVRA 4LYUA 3D19A 4YKHA 4ZLWA 2BW1A 2Y3QA 2HTNA 4P18A 5HJFA 4M33A 4LPMA 5LG2A 2V2RA 1L8HA 2OC5A 4Y08A 3PW8A 3AJOA 3FSEA 4DYYA 3ISEA 3R2MA 4REUA 3AK8A 5FEJA 5ERKA 3QD8A 3PW1A 2UX1A 2IY4A 4ITTA 3PVYA 1YUXA 4R42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GYQ A;  5I4J A;  2V2S A;  4AM5 A;  4LQH A;  3RE7 A;  4LPN A;  2VXX A;  1NF4 A;  1VEI A;  4MUD A;  1MOJ A;  1IER A;  1O9I A;  1JKV A;  4ERU A;  5GU0 X;  2JD6 0;  3Q4O A;  3Q4N A;  3U90 A;  3BVK A;  2ZA8 A;  3RGD A;  1HRS A;  3QHC A;  4XGS A;  4IWK A;  4U3G A;  4E6K A;  3KXU A;  1EUM A;  3BVL A;  3E2C A;  2XKQ A;  2V2N A;  1RCC A;  3R2L A;  2IB0 A;  4ML5 A;  4ISP A;  5E2D A;  3SE1 A;  2YJJ A;  2ZA6 A;  4RC7 A;  3WNW A;  3KA4 A;  4ETR A;  3EGM A;  4ZKH A;  2C2U A;  3HL1 A;  4MY7 A;  3E1M A;  1NNQ A;  1BFR A;  5ERJ A;  3TA8 A;  5JKM A;  4CMY V;  1DVB A;  4AM4 A;  3QB9 A;  5FFB A;  1NF6 A;  1Z6O M;  3AF8 X;  2BKC A;  4TOB A;  4ZL6 A;  4LYX A;  1DPS A;  1JI5 A;  3ES3 A;  4TOG A;  4ZTT A;  2ITB A;  3F34 A;  2CF7 A;  2FG4 A;  4IXK A;  3ERZ A;  2XJO A;  3AK9 A;  4TW3 A;  4EVE A;  3E1J A;  1S30 A;  4PGK A;  5D8P A;  1L8I A;  4M35 A;  2F7N A;  3Q4Q A;  4LQV A;  3F39 A;  3F32 A;  2GYD A;  1F30 A;  3O7S A;  1O9R A;  5CMR A;  1YV1 A;  3E1Q A;  1VEL A;  4MJY A;  4PG1 A;  2V2L A;  1JYB A;  4AM2 A;  3SH6 A;  3IQ1 A;  5AXS A;  4A25 A;  5K52 A;  2C6R A;  5FFE A;  4LPJ A;  3AF7 X;  2BJY A;  3WVU A;  1VJX A;  1S2Z A;  3EZU A;  2OH3 A;  5JKM G;  2JD8 0;  3R2H A;  3A68 A;  3UOF A;  5GU2 X;  3PVT B;  2CLB A;  5FFD A;  3E1L A;  4RC6 B;  5FFA A;  5D8X A;  2FJC A;  3NOZ X;  3PWF A;  5JAC A;  3PWQ C;  1S3Q A;  1LB3 A;  4DYZ A;  4TOD A;  2VZB A;  4DAS A;  5LBH A;  4RC5 B;  3QVD A;  3VNX A;  2W0O A;  3E6R A;  1JIG A;  5LG8 A;  5J93 A;  2VXI A;  4MN9 A;  3BVI A;  5D8S A;  1H96 A;  1IES A;  2XJM A;  3A9Q A;  2FKZ A;  1QGH A;  2C41 A;  3HIU A;  3PZA A;  2WLU A;  4CYA A;  4KVQ A;  2X17 0;  1JKU A;  4OYN A;  5GOU A;  1OTK A;  2CN7 A;  1YUZ A;  2ZG7 X;  2YW6 A;  1JTS A;  1BG7 A;  4ITW A;  3GHQ A;  5CMQ A;  3AJP A;  1FHA A;  1RCG A;  3E1P A;  3KA9 A;  4LQJ A;  2CN6 A;  1RCI A;  2ZG8 X;  2V2J A;  3NP0 X;  1TKO A;  4QUW A;  4Z5S A;  2QF9 A;  3O7R A;  1RCE A;  2HR5 A;  4ZKW A;  1LKO A;  4CY9 A;  4LQN A;  2ZG9 X;  1VLG A;  4II4 B;  4ZL5 A;  3R2S A;  2C2J A;  5GU1 X;  4M34 A;  3RD0 A;  5J8S A;  3PW8 C;  2CEI A;  3QHB A;  3BVE A;  3PVR B;  1LKP A;  1N1Q A;  2FHA A;  4TOE A;  4RC8 A;  2JD7 0;  3FI6 A;  5E1U A;  2G4H A;  4DZ0 A;  2BK6 A;  3RAV A;  5C6F A;  3SHX A;  1R03 A;  1ZS3 A;  3IS8 A;  3F36 A;  1QYB A;  3KX9 A;  1Z6O A;  3PW1 B;  2CHI A;  3F38 A;  3KWO A;  1SQ3 A;  1F33 A;  3PVY B;  4TOA A;  3EZ0 A;  2Z90 A;  4DYU A;  2V2M A;  3IS7 A;  4MKU A;  5D8O A;  3SID A;  1RCD A;  4CVR A;  4M32 A;  4TOH A;  3F37 A;  4Z3B A;  2GS4 A;  3MPS A;  4EVB A;  1RYT A;  2XGW A;  3KA8 A;  4CYB A;  3R2O A;  3AF9 X;  5HJH A;  4IWJ A;  1VEQ A;  2FZF A;  5J8W A;  1BCF A;  1TJO A;  5D8Q A;  1JI4 A;  2CIH A;  2CLU A;  4TOF A;  2V2I A;  1XZ3 A;  3ISF A;  3R2R A;  1B71 A;  4XKT A;  4EVD A;  2CHP A;  1SOF A;  3KA6 A;  3RBC A;  3F33 A;  4RC7 B;  4CVS A;  4XKU A;  5GU3 X;  3KA3 A;  2FG8 A;  3PVT A;  3R2K A;  4ISM A;  5JKL A;  5D8Y A;  3BVF A;  3F35 A;  3AJQ A;  2V2O A;  4RC6 A;  1ZUJ A;  3T9J A;  3FVB A;  3GVY A;  3Q4R A;  4CVP A;  3H7G A;  1JRE A;  3E1N A;  4ZKX A;  2YJK A;  3BT5 A;  2WTL A;  4RC5 A;  1J30 A;  3WVV A;  3OGH A;  2Z5R A;  5J9V A;  4CMY A;  2IU2 A;  3GE4 A;  3PWQ A;  4XKS A;  4PG0 A;  4KVR A;  2V2P A;  4TO9 A;  5HQO A;  5FFC A;  4TOC A;  4PGI A;  2QQY A;  1LKM A;  3E1O A;  3QZ3 A;  1DAT A;  1UMN A;  2ZUR X;  1TKP A;  5GN8 B;  2Z5P A;  2C2F A;  3UNO A;  5CZU A;  5D8R A;  4EVC A;  2ZA7 A;  2YW7 A;  1KRQ A;  4ZJK A;  2PYB A;  4DE6 A;  2Z6M A;  3UOI A;  3WVW A;  5IX6 A;  5LS9 A;  2FFX J;  2XJN A;  1XZ1 A;  1GWG A;  1UVH A;  5JKL G;  4DYX A;  3NP2 X;  2D5K A;  1Z4A A;  4DI0 A;  2FL0 A;  3OJ5 A;  1AEW A;  5K53 A;  3BKN A;  2WLA A;  4CVT A;  4ZMC A;  1JGC A;  4II4 A;  1MFR A;  1NFV A;  5GN8 A;  2RBD A;  4KVS A;  3E6S A;  2V15 A;  1TK6 A;  2Z5Q A;  3PVR A;  4LYU A;  4YKH A;  4ZLW A;  2BW1 A;  2Y3Q A;  2HTN A;  4P18 A;  5HJF A;  4M33 A;  4LPM A;  5LG2 A;  2V2R A;  1L8H A;  2OC5 A;  4Y08 A;  3PW8 A;  3AJO A;  3FSE A;  4DYY A;  3ISE A;  3R2M A;  4REU A;  3AK8 A;  5FEJ A;  5ERK A;  3QD8 A;  3PW1 A;  2UX1 A;  2IY4 A;  4ITT A;  3PVY A;  1YUX A;  4R42 A; 
#chains in the Genus database with same CATH topology
 2GYQ A;  5I4J A;  2V2S A;  4AM5 A;  4LQH A;  3RE7 A;  4LPN A;  2VXX A;  1NF4 A;  1VEI A;  4YXM A;  4MUD A;  1MOJ A;  3KHK A;  1IER A;  1O9I A;  1JKV A;  4ERU A;  5GU0 X;  2JD6 0;  3C23 A;  3Q4O A;  3Q4N A;  3U90 A;  3BVK A;  2ZA8 A;  3RGD A;  1HRS A;  3QHC A;  4XGS A;  4IWK A;  4U3G A;  3UFB A;  4E6K A;  3KXU A;  4X0J A;  1EUM A;  3BVL A;  3E2C A;  2XKQ A;  2V2N A;  1RCC A;  3R2L A;  4W4K B;  2IB0 A;  4ML5 A;  4ISP A;  5E2D A;  3SE1 A;  2YJJ A;  2ZA6 A;  4RC7 A;  3WNW A;  3KA4 A;  4ETR A;  3EGM A;  4ZKH A;  2C2U A;  3HL1 A;  4MY7 A;  3E1M A;  1NNQ A;  1BFR A;  5ERJ A;  3TA8 A;  5JKM A;  4CMY V;  1DVB A;  4AM4 A;  3QB9 A;  5FFB A;  3VVA A;  1NF6 A;  1Z6O M;  3AF8 X;  2BKC A;  4TOB A;  4ZL6 A;  4LYX A;  1DPS A;  1JI5 A;  3ES3 A;  4TOG A;  4ZTT A;  2ITB A;  3F34 A;  2CF7 A;  2FG4 A;  4IXK A;  3ERZ A;  2XJO A;  3AK9 A;  4TW3 A;  4EVE A;  4YVZ A;  3E1J A;  1S30 A;  4PGK A;  5D8P A;  1L8I A;  2F7N A;  4M35 A;  3Q4Q A;  4LQV A;  3F39 A;  3F32 A;  2GYD A;  1F30 A;  3O7S A;  1O9R A;  5CMR A;  1YV1 A;  3E1Q A;  1VEL A;  4MJY A;  4PG1 A;  2V2L A;  1JYB A;  4AM2 A;  3SH6 A;  3IQ1 A;  5AXS A;  4A25 A;  3M6J A;  5K52 A;  2C6R A;  5FFE A;  4LPJ A;  3AF7 X;  2BJY A;  3WVU A;  1VJX A;  1S2Z A;  2AR0 A;  3EZU A;  3W54 A;  2OH3 A;  3C21 A;  3LKD A;  5JKM G;  2JD8 0;  3R2H A;  3A68 A;  3UOF A;  5GU2 X;  3PVT B;  2CLB A;  5FFD A;  3E1L A;  4RC6 B;  5FFA A;  5D8X A;  2FJC A;  3NOZ X;  3PWF A;  5JAC A;  3PWQ C;  1S3Q A;  1LB3 A;  4DYZ A;  4TOD A;  2VZB A;  4DAS A;  5LBH A;  3V3K B;  4RC5 B;  3QVD A;  3VNX A;  2OKC A;  2W0O A;  3E6R A;  1JIG A;  5LG8 A;  5J93 A;  3L0M A;  2VXI A;  4MN9 A;  4MXP A;  3BVI A;  2G38 B;  5D8S A;  1H96 A;  1IES A;  2XJM A;  2V8T A;  3A9Q A;  2FKZ A;  1QGH A;  2C41 A;  3HIU A;  3PZA A;  2WLU A;  4CYA A;  4KVQ A;  2X17 0;  1JKU A;  4OYN A;  5GOU A;  3C1Y A;  1OTK A;  5JDO B;  2CN7 A;  1YUZ A;  2ZG7 X;  2YW6 A;  1JTS A;  1BG7 A;  3N6O A;  4ITW A;  3GHQ A;  5CMQ A;  3AJP A;  1FHA A;  1RCG A;  3E1P A;  3KA9 A;  4LQJ A;  2CN6 A;  1RCI A;  2ZG8 X;  3GGY A;  3FRS A;  2V2J A;  3NP0 X;  1TKO A;  4QUW A;  4Z5S A;  2QF9 A;  3O7R A;  1RCE A;  2HR5 A;  4ZKW A;  1LKO A;  4CY9 A;  4LQN A;  2ZG9 X;  1VLG A;  4II4 B;  4ZL5 A;  3DBY A;  3R2S A;  2C2J A;  5GU1 X;  4M34 A;  3RD0 A;  5J8S A;  3PW8 C;  2CEI A;  3QHB A;  3BVE A;  3PVR B;  1LKP A;  1N1Q A;  2FHA A;  4TOE A;  4RC8 A;  2JD7 0;  3FI6 A;  3JZ9 A;  5E1U A;  4WJG 4;  2G4H A;  4DZ0 A;  2BK6 A;  3RAV A;  5C6F A;  3SHX A;  1R03 A;  1ZS3 A;  4YXJ A;  2WWX B;  3IS8 A;  3F36 A;  3FRR A;  1QYB A;  3KX9 A;  1Z6O A;  3PW1 B;  2CHI A;  2N02 A;  3F38 A;  3VV9 A;  3KWO A;  1SQ3 A;  1F33 A;  3PVY B;  4TOA A;  3EZ0 A;  2Z90 A;  4DYU A;  2V2M A;  3IS7 A;  4MKU A;  5D8O A;  3SID A;  1RCD A;  4CVR A;  4M32 A;  4TOH A;  3F37 A;  4Z3B A;  2GS4 A;  3MPS A;  4EVB A;  1RYT A;  2XGW A;  3KA8 A;  4CYB A;  3R2O A;  4KXR B;  3AF9 X;  5HJH A;  4IWJ A;  1VEQ A;  2FZF A;  5J8W A;  4E40 A;  1BCF A;  1TJO A;  5D8Q A;  1JI4 A;  2CIH A;  2CLU A;  4TOF A;  2V2I A;  1XZ3 A;  3ISF A;  3R2R A;  1B71 A;  4XKT A;  4EVD A;  2CHP A;  2MGY A;  1SOF A;  3KA6 A;  3RBC A;  2V8U A;  3F33 A;  2CWL A;  4RC7 B;  4CVS A;  4XKU A;  5GU3 X;  3KA3 A;  2FG8 A;  3PVT A;  3R2K A;  4ISM A;  5JKL A;  5D8Y A;  3BVF A;  3F35 A;  3AJQ A;  2V2O A;  4RC6 A;  1ZUJ A;  3T9J A;  3FVB A;  3GVY A;  3Q4R A;  4CVP A;  3H7G A;  3KDQ A;  2Y44 A;  1JRE A;  3E1N A;  4ZKX A;  2YJK A;  3BT5 A;  2WTL A;  4RC5 A;  1J30 A;  3WVV A;  3OGH A;  2Z5R A;  5J9V A;  4CMY A;  2IU2 A;  3GE4 A;  3PWQ A;  3JZA B;  4XKS A;  4PG0 A;  4KVR A;  2V2P A;  3GGZ A;  4TO9 A;  5HQO A;  5FFC A;  4TOC A;  4PGI A;  4W4L B;  2QQY A;  1LKM A;  3E1O A;  3QZ3 A;  1DAT A;  5HU6 D;  1UMN A;  2ZUR X;  1TKP A;  5GN8 B;  2Z5P A;  2C2F A;  5JDO A;  3UNO A;  5CZU A;  5D8R A;  4EVC A;  2ZA7 A;  2YW7 A;  1KRQ A;  4ZJK A;  3C1Z A;  2PYB A;  4DE6 A;  2Z6M A;  3UOI A;  3WVW A;  5IX6 A;  5LS9 A;  2FFX J;  2XJN A;  1XZ1 A;  1GWG A;  1UVH A;  5JKL G;  4DYX A;  3NP2 X;  2D5K A;  1Z4A A;  4DI0 A;  2FL0 A;  3OJ5 A;  1AEW A;  5K53 A;  3BKN A;  2WLA A;  4CVT A;  4ZMC A;  1JGC A;  4II4 A;  1MFR A;  1NFV A;  5GN8 A;  2RBD A;  4KVS A;  3E6S A;  2V15 A;  1TK6 A;  2Z5Q A;  3PVR A;  4LYU A;  3D19 A;  4YKH A;  4ZLW A;  2BW1 A;  2Y3Q A;  2HTN A;  4P18 A;  5HJF A;  4M33 A;  4LPM A;  5LG2 A;  2V2R A;  1L8H A;  2OC5 A;  4Y08 A;  3PW8 A;  3AJO A;  3FSE A;  4DYY A;  3ISE A;  3R2M A;  4REU A;  3AK8 A;  5FEJ A;  5ERK A;  3QD8 A;  3PW1 A;  2UX1 A;  2IY4 A;  4ITT A;  3PVY A;  1YUX A;  4R42 A; 
#chains in the Genus database with same CATH homology
 2GYQ A;  5I4J A;  2V2S A;  4AM5 A;  4LQH A;  3RE7 A;  4LPN A;  2VXX A;  1NF4 A;  1VEI A;  4YXM A;  4MUD A;  1MOJ A;  3KHK A;  1IER A;  1O9I A;  1JKV A;  4ERU A;  5GU0 X;  2JD6 0;  3C23 A;  3Q4O A;  3Q4N A;  3U90 A;  3BVK A;  2ZA8 A;  3RGD A;  1HRS A;  3QHC A;  4XGS A;  4IWK A;  4U3G A;  3UFB A;  4E6K A;  3KXU A;  4X0J A;  1EUM A;  3BVL A;  3E2C A;  2XKQ A;  2V2N A;  1RCC A;  3R2L A;  4W4K B;  2IB0 A;  4ML5 A;  4ISP A;  5E2D A;  3SE1 A;  2YJJ A;  2ZA6 A;  4RC7 A;  3WNW A;  3KA4 A;  4ETR A;  3EGM A;  4ZKH A;  2C2U A;  3HL1 A;  4MY7 A;  3E1M A;  1NNQ A;  1BFR A;  5ERJ A;  3TA8 A;  5JKM A;  4CMY V;  1DVB A;  4AM4 A;  3QB9 A;  5FFB A;  3VVA A;  1NF6 A;  1Z6O M;  3AF8 X;  2BKC A;  4TOB A;  4ZL6 A;  4LYX A;  1DPS A;  1JI5 A;  3ES3 A;  4TOG A;  4ZTT A;  2ITB A;  3F34 A;  2CF7 A;  2FG4 A;  4IXK A;  3ERZ A;  2XJO A;  3AK9 A;  4TW3 A;  4EVE A;  4YVZ A;  3E1J A;  1S30 A;  4PGK A;  5D8P A;  1L8I A;  2F7N A;  4M35 A;  3Q4Q A;  4LQV A;  3F39 A;  3F32 A;  2GYD A;  1F30 A;  3O7S A;  1O9R A;  5CMR A;  1YV1 A;  3E1Q A;  1VEL A;  4MJY A;  4PG1 A;  2V2L A;  1JYB A;  4AM2 A;  3SH6 A;  3IQ1 A;  5AXS A;  4A25 A;  3M6J A;  5K52 A;  2C6R A;  5FFE A;  4LPJ A;  3AF7 X;  2BJY A;  3WVU A;  1VJX A;  1S2Z A;  2AR0 A;  3EZU A;  3W54 A;  2OH3 A;  3C21 A;  3LKD A;  5JKM G;  2JD8 0;  3R2H A;  3A68 A;  3UOF A;  5GU2 X;  3PVT B;  2CLB A;  5FFD A;  3E1L A;  4RC6 B;  5FFA A;  5D8X A;  2FJC A;  3NOZ X;  3PWF A;  5JAC A;  3PWQ C;  1S3Q A;  1LB3 A;  4DYZ A;  4TOD A;  2VZB A;  4DAS A;  5LBH A;  3V3K B;  4RC5 B;  3QVD A;  3VNX A;  2OKC A;  2W0O A;  3E6R A;  1JIG A;  5LG8 A;  5J93 A;  3L0M A;  2VXI A;  4MN9 A;  4MXP A;  3BVI A;  2G38 B;  5D8S A;  1H96 A;  1IES A;  2XJM A;  2V8T A;  3A9Q A;  2FKZ A;  1QGH A;  2C41 A;  3HIU A;  3PZA A;  2WLU A;  4CYA A;  4KVQ A;  2X17 0;  1JKU A;  4OYN A;  5GOU A;  3C1Y A;  1OTK A;  5JDO B;  2CN7 A;  1YUZ A;  2ZG7 X;  2YW6 A;  1JTS A;  1BG7 A;  3N6O A;  4ITW A;  3GHQ A;  5CMQ A;  3AJP A;  1FHA A;  1RCG A;  3E1P A;  3KA9 A;  4LQJ A;  2CN6 A;  1RCI A;  2ZG8 X;  3GGY A;  3FRS A;  2V2J A;  3NP0 X;  1TKO A;  4QUW A;  4Z5S A;  2QF9 A;  3O7R A;  1RCE A;  2HR5 A;  4ZKW A;  1LKO A;  4CY9 A;  4LQN A;  2ZG9 X;  1VLG A;  4II4 B;  4ZL5 A;  3DBY A;  3R2S A;  2C2J A;  5GU1 X;  4M34 A;  3RD0 A;  5J8S A;  3PW8 C;  2CEI A;  3QHB A;  3BVE A;  3PVR B;  1LKP A;  1N1Q A;  2FHA A;  4TOE A;  4RC8 A;  2JD7 0;  3FI6 A;  3JZ9 A;  5E1U A;  4WJG 4;  2G4H A;  4DZ0 A;  2BK6 A;  3RAV A;  5C6F A;  3SHX A;  1R03 A;  1ZS3 A;  4YXJ A;  2WWX B;  3IS8 A;  3F36 A;  3FRR A;  1QYB A;  3KX9 A;  1Z6O A;  3PW1 B;  2CHI A;  2N02 A;  3F38 A;  3VV9 A;  3KWO A;  1SQ3 A;  1F33 A;  3PVY B;  4TOA A;  3EZ0 A;  2Z90 A;  4DYU A;  2V2M A;  3IS7 A;  4MKU A;  5D8O A;  3SID A;  1RCD A;  4CVR A;  4M32 A;  4TOH A;  3F37 A;  4Z3B A;  2GS4 A;  3MPS A;  4EVB A;  1RYT A;  2XGW A;  3KA8 A;  4CYB A;  3R2O A;  4KXR B;  3AF9 X;  5HJH A;  4IWJ A;  1VEQ A;  2FZF A;  5J8W A;  4E40 A;  1BCF A;  1TJO A;  5D8Q A;  1JI4 A;  2CIH A;  2CLU A;  4TOF A;  2V2I A;  1XZ3 A;  3ISF A;  3R2R A;  1B71 A;  4XKT A;  4EVD A;  2CHP A;  2MGY A;  1SOF A;  3KA6 A;  3RBC A;  2V8U A;  3F33 A;  2CWL A;  4RC7 B;  4CVS A;  4XKU A;  5GU3 X;  3KA3 A;  2FG8 A;  3PVT A;  3R2K A;  4ISM A;  5JKL A;  5D8Y A;  3BVF A;  3F35 A;  3AJQ A;  2V2O A;  4RC6 A;  1ZUJ A;  3T9J A;  3FVB A;  3GVY A;  3Q4R A;  4CVP A;  3H7G A;  3KDQ A;  2Y44 A;  1JRE A;  3E1N A;  4ZKX A;  2YJK A;  3BT5 A;  2WTL A;  4RC5 A;  1J30 A;  3WVV A;  3OGH A;  2Z5R A;  5J9V A;  4CMY A;  2IU2 A;  3GE4 A;  3PWQ A;  3JZA B;  4XKS A;  4PG0 A;  4KVR A;  2V2P A;  3GGZ A;  4TO9 A;  5HQO A;  5FFC A;  4TOC A;  4PGI A;  4W4L B;  2QQY A;  1LKM A;  3E1O A;  3QZ3 A;  1DAT A;  5HU6 D;  1UMN A;  2ZUR X;  1TKP A;  5GN8 B;  2Z5P A;  2C2F A;  5JDO A;  3UNO A;  5CZU A;  5D8R A;  4EVC A;  2ZA7 A;  2YW7 A;  1KRQ A;  4ZJK A;  3C1Z A;  2PYB A;  4DE6 A;  2Z6M A;  3UOI A;  3WVW A;  5IX6 A;  5LS9 A;  2FFX J;  2XJN A;  1XZ1 A;  1GWG A;  1UVH A;  5JKL G;  4DYX A;  3NP2 X;  2D5K A;  1Z4A A;  4DI0 A;  2FL0 A;  3OJ5 A;  1AEW A;  5K53 A;  3BKN A;  2WLA A;  4CVT A;  4ZMC A;  1JGC A;  4II4 A;  1MFR A;  1NFV A;  5GN8 A;  2RBD A;  4KVS A;  3E6S A;  2V15 A;  1TK6 A;  2Z5Q A;  3PVR A;  4LYU A;  3D19 A;  4YKH A;  4ZLW A;  2BW1 A;  2Y3Q A;  2HTN A;  4P18 A;  5HJF A;  4M33 A;  4LPM A;  5LG2 A;  2V2R A;  1L8H A;  2OC5 A;  4Y08 A;  3PW8 A;  3AJO A;  3FSE A;  4DYY A;  3ISE A;  3R2M A;  4REU A;  3AK8 A;  5FEJ A;  5ERK A;  3QD8 A;  3PW1 A;  2UX1 A;  2IY4 A;  4ITT A;  3PVY A;  1YUX A;  4R42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...