2Y3QA

1.55a structure of apo bacterioferritin from e. coli
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
157
structure length
157
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIOFERRITIN
publication title Monitoring and Validating Active Site Redox States in Protein Crystals.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 77
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2y3qA00
3R2OA 1DPSA 2CIHA 3WNWA 1S30A 1SOFA 4M35A 3F32A 3ES3A 2F7NA 3E6SA 2WTLA 4CVPA 3H7GA 5GN8A 5D8PA 1JREA 1F30A 1N1QA 1RCGA 4KVQA 3A68A 3UNOA 3E6RA 3E1MA 2XJMA 4Z5SA 2ZA7A 1B71A 1TKOA 2V2IA 1OTKA 2BW1A 3A9QA 5HQOA 1RCDA 3GE4A 5E1UA 5D8SA 4CYBA 4LPMA 1NF6A 3R2MA 5J8SA 5J9VA 5I4JA 1YUZA 3RAVA 2CEIA 1JTSA 4YKHA 5K52A 3KWOA 2C2UA 4TOGA 2V2LA 4ZKXA 3R2SA 4LQVA 4Z3BA 3E1PA 3ISEA 3PWQC 4XKTA 5GU3X 1BCFA 4TOEA 3F35A 4ITTA 2FJCA 5FFEA 1ZUJA 3PWFA 4IWKA 2WLAA 3IS8A 5ERJA 2FG8A 2V2NA 1J30A 1VJXA 4AM2A 4TODA 4RC8A 3HL1A 2ZG7X 4ISMA 3O7SA 5GOUA 3BVIA 3KA6A 1LKMA 4CVTA 4KVSA 4ZJKA 4DYXA 4EVEA 4CYAA 3R2KA 5HJFA 1LKOA 3PVTA 3QD8A 5CZUA 2FZFA 5ERKA 5GN8B 3PVYA 4XKUA 1JKVA 4DYZA 5K53A 2Z5RA 1TJOA 3FSEA 3FVBA 2XGWA 1UVHA 1MFRA 2JD60 2HTNA 2JD70 4TOAA 1TKPA 2XKQA 2YW6A 3PW1A 4II4B 3UOIA 2PYBA 2FL0A 4OYNA 4TOFA 1Z4AA 4ITWA 4U3GA 4KVRA 3SE1A 3R2HA 2V2OA 1SQ3A 2CN7A 3F33A 4LQNA 4ETRA 4CVRA 2CF7A 3WVUA 2IY4A 3KA8A 4ZTTA 1VLGA 3OGHA 4TO9A 2GYDA 2C6RA 3RBCA 4AM4A 3RGDA 1XZ3A 4EVCA 4RC5A 5CMQA 5FEJA 5HJHA 1L8IA 4TW3A 2JD80 4EVDA 2BK6A 2OH3A 4ZKHA 1VEIA 4ZKWA 3PW8C 4ZLWA 2X170 3EZ0A 2RBDA 4DZ0A 5LBHA 1FHAA 4RC6A 2FKZA 2FHAA 2Z5PA 1YUXA 3E2CA 4TOBA 4ML5A 2WLUA 1NNQA 2HR5A 3QHCA 4M33A 1MOJA 4TOCA 3ERZA 4MY7A 4CMYV 4RC7A 3R2RA 2GYQA 5GU2X 3BVKA 1JI4A 1KRQA 3KXUA 1JKUA 2V2JA 1RCEA 1IESA 1JIGA 3AF7X 3KA3A 5C6FA 3F36A 1ZS3A 3MPSA 3E1QA 2XJOA 1F33A 4DYUA 3R2LA 3SHXA 5E2DA 3Q4QA 3E1OA 3ISFA 1NFVA 1RYTA 2IU2A 2CN6A 5AXSA 4RC5B 1BG7A 3EZUA 1GWGA 4ZMCA 2C2FA 2ZG9X 1DATA 4CY9A 3IQ1A 3BVFA 5JKMG 5CMRA 2Z6MA 4ERUA 3KA9A 4CMYA 3WVVA 3FI6A 2Y3QA 2D5KA 1RCIA 5D8OA 1R03A 1RCCA 3AF9X 1JGCA 4ZL5A 3O7RA 1O9IA 1EUMA 3F34A 1AEWA 3BKNA 5GU1X 5D8QA 4LYUA 2CLUA 1Z6OM 2YW7A 4M32A 2YJJA 1UMNA 3KA4A 4AM5A 3IS7A 1QYBA 2C41A 2QQYA 5JKMA 3AK9A 1VELA 4EVBA 4R42A 3BVEA 3AJQA 2C2JA 1LKPA 2V2RA 4LQJA 1DVBA 4TOHA 2VXIA 3QZ3A 3PW8A 2ZURX 2IB0A 3RD0A 3SH6A 1TK6A 2VZBA 3NOZX 5D8RA 4PGIA 2OC5A 3NP0X 3RE7A 4A25A 5FFBA 3PVTB 5IX6A 1NF4A 3AJPA 3PVYB 3PWQA 3AJOA 1S3QA 4LPJA 4P18A 3Q4RA 4DYYA 3TA8A 3KX9A 2Z90A 4XGSA 1IERA 5JKLG 5J93A 3HIUA 1JI5A 4PG0A 5JACA 4II4A 4MUDA 3PW1B 2CHIA 1JYBA 3UOFA 4REUA 3F38A 5FFAA 3PVRA 5FFCA 1H96A 2ZA6A 4DE6A 4ZL6A 3OJ5A 3NP2X 4E6KA 4ISPA 2BKCA 2CHPA 3WVWA 5LS9A 3PZAA 1O9RA 4Y08A 4PGKA 3EGMA 4MN9A 3GVYA 2ZG8X 3GHQA 3F37A 4QUWA 5LG2A 5JKLA 2V2SA 4IWJA 3AK8A 1L8HA 1S2ZA 5D8XA 2XJNA 1XZ1A 5D8YA 2V15A 4CVSA 3T9JA 4LQHA 2ITBA 4IXKA 4M34A 2FG4A 4DI0A 2YJKA 1VEQA 1LB3A 5LG8A 5J8WA 3VNXA 4DASA 3QVDA 2BJYA 5GU0X 1QGHA 3U90A 3Q4OA 4RC6B 2W0OA 2V2MA 1HRSA 4LPNA 4LYXA 4MKUA 3BT5A 5FFDA 3E1NA 2QF9A 4MJYA 2G4HA 3QB9A 2FFXJ 2Z5QA 2GS4A 2ZA8A 3Q4NA 2CLBA 3E1LA 2VXXA 3AF8X 3E1JA 4RC7B 3SIDA 3PVRB 2UX1A 4XKSA 3F39A 2V2PA 1BFRA 3QHBA 1Z6OA 1YV1A 3BVLA 4PG1A
chains in the Genus database with same CATH superfamily
3R2OA 1DPSA 2CIHA 3WNWA 2G38B 1S30A 1SOFA 4M35A 3F32A 3ES3A 2OKCA 2F7NA 3E6SA 2WTLA 4CVPA 3H7GA 5GN8A 5D8PA 1JREA 1F30A 1N1QA 1RCGA 4KVQA 3A68A 3UNOA 3E6RA 3E1MA 2XJMA 4Z5SA 2ZA7A 1B71A 1TKOA 2V2IA 3D19A 1OTKA 2BW1A 3A9QA 5JDOB 5HQOA 1RCDA 3GE4A 5E1UA 5D8SA 4CYBA 4LPMA 4YVZA 1NF6A 3R2MA 5J8SA 5J9VA 5I4JA 1YUZA 3RAVA 2CEIA 1JTSA 4YKHA 5K52A 3KWOA 2C2UA 4TOGA 2V2LA 4ZKXA 3R2SA 4LQVA 4Z3BA 3E1PA 3ISEA 3PWQC 4XKTA 5GU3X 1BCFA 3W54A 4TOEA 3F35A 4ITTA 2FJCA 2CWLA 5FFEA 1ZUJA 2AR0A 3GGZA 3PWFA 4IWKA 4WJG4 2WLAA 3IS8A 5ERJA 2FG8A 2V2NA 1J30A 1VJXA 4AM2A 4TODA 4RC8A 3HL1A 2ZG7X 4ISMA 3O7SA 5GOUA 3BVIA 3VV9A 3KA6A 1LKMA 4CVTA 4KVSA 4ZJKA 2V8TA 4DYXA 4YXJA 4EVEA 4CYAA 3R2KA 5HJFA 1LKOA 3PVTA 3QD8A 5CZUA 2FZFA 5ERKA 5GN8B 3PVYA 3N6OA 4XKUA 1JKVA 4DYZA 5K53A 2Z5RA 3FRRA 1TJOA 3FSEA 3FVBA 2XGWA 1UVHA 4W4LB 1MFRA 2JD60 2HTNA 2JD70 4TOAA 1TKPA 2XKQA 2YW6A 3PW1A 4II4B 3UOIA 2PYBA 2FL0A 4OYNA 4TOFA 1Z4AA 3C23A 4ITWA 4W4KB 4U3GA 4KVRA 3SE1A 3R2HA 2V2OA 1SQ3A 2CN7A 3F33A 4LQNA 4ETRA 4CVRA 2CF7A 3WVUA 2IY4A 3KA8A 4ZTTA 1VLGA 3OGHA 4TO9A 2GYDA 2C6RA 3RBCA 4X0JA 4AM4A 3RGDA 3KDQA 1XZ3A 4EVCA 4RC5A 5CMQA 5FEJA 3FRSA 5HJHA 1L8IA 4TW3A 2JD80 4EVDA 2BK6A 2OH3A 3DBYA 4ZKHA 1VEIA 4ZKWA 3PW8C 4ZLWA 2X170 3EZ0A 3UFBA 2RBDA 4DZ0A 5LBHA 1FHAA 4RC6A 2FKZA 2FHAA 2Z5PA 1YUXA 2WWXB 3E2CA 4TOBA 2WLUA 4ML5A 1NNQA 3GGYA 2HR5A 3QHCA 4M33A 1MOJA 4TOCA 3ERZA 4MY7A 4MXPA 3C1ZA 4CMYV 4RC7A 3R2RA 3C21A 2GYQA 5GU2X 2MGYA 3BVKA 1JI4A 1KRQA 3KXUA 1JKUA 2V2JA 4E40A 1RCEA 1IESA 1JIGA 3AF7X 3KA3A 5C6FA 3F36A 1ZS3A 3MPSA 3E1QA 2XJOA 1F33A 4DYUA 3R2LA 2V8UA 3SHXA 5E2DA 3Q4QA 3E1OA 3ISFA 1NFVA 1RYTA 2IU2A 2CN6A 5AXSA 4RC5B 1BG7A 3EZUA 1GWGA 4ZMCA 2C2FA 2ZG9X 1DATA 4CY9A 3IQ1A 3BVFA 5JKMG 5JDOA 5CMRA 2Z6MA 4ERUA 3KA9A 4CMYA 3WVVA 3FI6A 2Y3QA 2D5KA 1RCIA 5D8OA 1R03A 1RCCA 3AF9X 1JGCA 4ZL5A 3O7RA 1O9IA 1EUMA 3F34A 1AEWA 3BKNA 5GU1X 5D8QA 4LYUA 2CLUA 1Z6OM 2YW7A 4M32A 2YJJA 1UMNA 3KA4A 4AM5A 3IS7A 1QYBA 2C41A 2QQYA 3KHKA 5JKMA 3AK9A 1VELA 4EVBA 4KXRB 4R42A 3BVEA 3AJQA 2C2JA 1LKPA 2V2RA 4LQJA 1DVBA 4TOHA 2VXIA 3QZ3A 3PW8A 2ZURX 2IB0A 3RD0A 3SH6A 1TK6A 2VZBA 3NOZX 3C1YA 5D8RA 4PGIA 2OC5A 3NP0X 3RE7A 4A25A 5FFBA 2N02A 3PVTB 5IX6A 1NF4A 3L0MA 3AJPA 3PVYB 3PWQA 3AJOA 2Y44A 1S3QA 4LPJA 4P18A 3Q4RA 4DYYA 3TA8A 3KX9A 2Z90A 4XGSA 1IERA 3VVAA 5JKLG 3V3KB 5J93A 3HIUA 4YXMA 1JI5A 4PG0A 5JACA 4II4A 4MUDA 3PW1B 3LKDA 2CHIA 1JYBA 3UOFA 4REUA 3F38A 3JZ9A 5FFAA 3PVRA 5FFCA 1H96A 2ZA6A 4DE6A 4ZL6A 3M6JA 3NP2X 3JZAB 3OJ5A 4E6KA 4ISPA 2BKCA 2CHPA 3WVWA 5LS9A 3PZAA 1O9RA 4Y08A 4PGKA 5HU6D 3EGMA 4MN9A 3GVYA 2ZG8X 3GHQA 3F37A 4QUWA 5LG2A 5JKLA 2V2SA 4IWJA 3AK8A 1L8HA 1S2ZA 5D8XA 2XJNA 1XZ1A 5D8YA 2V15A 4CVSA 3T9JA 4LQHA 2ITBA 4IXKA 4M34A 2FG4A 4DI0A 2YJKA 1VEQA 1LB3A 5LG8A 5J8WA 3VNXA 4DASA 3QVDA 2BJYA 5GU0X 1QGHA 3U90A 3Q4OA 4RC6B 2W0OA 2V2MA 1HRSA 4LPNA 4LYXA 4MKUA 3BT5A 5FFDA 3E1NA 2QF9A 4MJYA 2G4HA 3QB9A 2FFXJ 2Z5QA 2GS4A 2ZA8A 3Q4NA 2CLBA 3E1LA 2VXXA 3AF8X 3E1JA 4RC7B 3SIDA 3PVRB 2UX1A 4XKSA 3F39A 2V2PA 1BFRA 3QHBA 1Z6OA 1YV1A 3BVLA 4PG1A
chains in the Genus database with same CATH topology
3R2OA 1DPSA 2CIHA 3WNWA 2G38B 1S30A 1SOFA 4M35A 3F32A 3ES3A 2OKCA 2F7NA 3E6SA 2WTLA 4CVPA 3H7GA 5GN8A 5D8PA 1JREA 1F30A 1N1QA 1RCGA 4KVQA 3A68A 3UNOA 3E6RA 3E1MA 2XJMA 4Z5SA 2ZA7A 1B71A 1TKOA 2V2IA 3D19A 1OTKA 2BW1A 3A9QA 5JDOB 5HQOA 1RCDA 3GE4A 5E1UA 5D8SA 4CYBA 4LPMA 4YVZA 1NF6A 3R2MA 5J8SA 5J9VA 5I4JA 1YUZA 3RAVA 2CEIA 1JTSA 4YKHA 5K52A 3KWOA 2C2UA 4TOGA 2V2LA 4ZKXA 3R2SA 4LQVA 4Z3BA 3E1PA 3ISEA 3PWQC 4XKTA 5GU3X 1BCFA 3W54A 4TOEA 3F35A 4ITTA 2FJCA 2CWLA 5FFEA 1ZUJA 2AR0A 3GGZA 3PWFA 4IWKA 4WJG4 2WLAA 3IS8A 5ERJA 2FG8A 2V2NA 1J30A 1VJXA 4AM2A 4TODA 4RC8A 3HL1A 2ZG7X 4ISMA 3O7SA 5GOUA 3BVIA 3VV9A 3KA6A 1LKMA 4CVTA 4KVSA 4ZJKA 2V8TA 4DYXA 4YXJA 4EVEA 4CYAA 3R2KA 5HJFA 1LKOA 3PVTA 3QD8A 5CZUA 2FZFA 5ERKA 5GN8B 3PVYA 3N6OA 4XKUA 1JKVA 4DYZA 5K53A 2Z5RA 3FRRA 1TJOA 3FSEA 3FVBA 2XGWA 1UVHA 4W4LB 1MFRA 2JD60 2HTNA 2JD70 4TOAA 1TKPA 2XKQA 2YW6A 3PW1A 4II4B 3UOIA 2PYBA 2FL0A 4OYNA 4TOFA 1Z4AA 3C23A 4ITWA 4W4KB 4U3GA 4KVRA 3SE1A 3R2HA 2V2OA 1SQ3A 2CN7A 3F33A 4LQNA 4ETRA 4CVRA 2CF7A 3WVUA 2IY4A 3KA8A 4ZTTA 1VLGA 3OGHA 4TO9A 2GYDA 2C6RA 3RBCA 4X0JA 4AM4A 3RGDA 3KDQA 1XZ3A 4EVCA 4RC5A 5CMQA 5FEJA 3FRSA 5HJHA 1L8IA 4TW3A 2JD80 4EVDA 2BK6A 2OH3A 3DBYA 4ZKHA 1VEIA 4ZKWA 3PW8C 4ZLWA 2X170 3EZ0A 3UFBA 2RBDA 4DZ0A 5LBHA 1FHAA 4RC6A 2FKZA 2FHAA 2Z5PA 1YUXA 2WWXB 3E2CA 4TOBA 2WLUA 4ML5A 1NNQA 3GGYA 2HR5A 3QHCA 4M33A 1MOJA 4TOCA 3ERZA 4MY7A 4MXPA 3C1ZA 4CMYV 4RC7A 3R2RA 3C21A 2GYQA 5GU2X 2MGYA 3BVKA 1JI4A 1KRQA 3KXUA 1JKUA 2V2JA 4E40A 1RCEA 1IESA 1JIGA 3AF7X 3KA3A 5C6FA 3F36A 1ZS3A 3MPSA 3E1QA 2XJOA 1F33A 4DYUA 3R2LA 2V8UA 3SHXA 5E2DA 3Q4QA 3E1OA 3ISFA 1NFVA 1RYTA 2IU2A 2CN6A 5AXSA 4RC5B 1BG7A 3EZUA 1GWGA 4ZMCA 2C2FA 2ZG9X 1DATA 4CY9A 3IQ1A 3BVFA 5JKMG 5JDOA 5CMRA 2Z6MA 4ERUA 3KA9A 4CMYA 3WVVA 3FI6A 2Y3QA 2D5KA 1RCIA 5D8OA 1R03A 1RCCA 3AF9X 1JGCA 4ZL5A 3O7RA 1O9IA 1EUMA 3F34A 1AEWA 3BKNA 5GU1X 5D8QA 4LYUA 2CLUA 1Z6OM 2YW7A 4M32A 2YJJA 1UMNA 3KA4A 4AM5A 3IS7A 1QYBA 2C41A 2QQYA 3KHKA 5JKMA 3AK9A 1VELA 4EVBA 4KXRB 4R42A 3BVEA 3AJQA 2C2JA 1LKPA 2V2RA 4LQJA 1DVBA 4TOHA 2VXIA 3QZ3A 3PW8A 2ZURX 2IB0A 3RD0A 3SH6A 1TK6A 2VZBA 3NOZX 3C1YA 5D8RA 4PGIA 2OC5A 3NP0X 3RE7A 4A25A 5FFBA 2N02A 3PVTB 5IX6A 1NF4A 3L0MA 3AJPA 3PVYB 3PWQA 3AJOA 2Y44A 1S3QA 4LPJA 4P18A 3Q4RA 4DYYA 3TA8A 3KX9A 2Z90A 4XGSA 1IERA 3VVAA 5JKLG 3V3KB 5J93A 3HIUA 4YXMA 1JI5A 4PG0A 5JACA 4II4A 4MUDA 3PW1B 3LKDA 2CHIA 1JYBA 3UOFA 4REUA 3F38A 3JZ9A 5FFAA 3PVRA 5FFCA 1H96A 2ZA6A 4DE6A 4ZL6A 3M6JA 3NP2X 3JZAB 3OJ5A 4E6KA 4ISPA 2BKCA 2CHPA 3WVWA 5LS9A 3PZAA 1O9RA 4Y08A 4PGKA 5HU6D 3EGMA 4MN9A 3GVYA 2ZG8X 3GHQA 3F37A 4QUWA 5LG2A 5JKLA 2V2SA 4IWJA 3AK8A 1L8HA 1S2ZA 5D8XA 2XJNA 1XZ1A 5D8YA 2V15A 4CVSA 3T9JA 4LQHA 2ITBA 4IXKA 4M34A 2FG4A 4DI0A 2YJKA 1VEQA 1LB3A 5LG8A 5J8WA 3VNXA 4DASA 3QVDA 2BJYA 5GU0X 1QGHA 3U90A 3Q4OA 4RC6B 2W0OA 2V2MA 1HRSA 4LPNA 4LYXA 4MKUA 3BT5A 5FFDA 3E1NA 2QF9A 4MJYA 2G4HA 3QB9A 2FFXJ 2Z5QA 2GS4A 2ZA8A 3Q4NA 2CLBA 3E1LA 2VXXA 3AF8X 3E1JA 4RC7B 3SIDA 3PVRB 2UX1A 4XKSA 3F39A 2V2PA 1BFRA 3QHBA 1Z6OA 1YV1A 3BVLA 4PG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2O A;  1DPS A;  2CIH A;  3WNW A;  1S30 A;  1SOF A;  4M35 A;  3F32 A;  3ES3 A;  2F7N A;  3E6S A;  2WTL A;  4CVP A;  3H7G A;  5GN8 A;  5D8P A;  1JRE A;  1F30 A;  1N1Q A;  1RCG A;  4KVQ A;  3A68 A;  3UNO A;  3E6R A;  3E1M A;  2XJM A;  4Z5S A;  2ZA7 A;  1B71 A;  1TKO A;  2V2I A;  1OTK A;  2BW1 A;  3A9Q A;  5HQO A;  1RCD A;  3GE4 A;  5E1U A;  5D8S A;  4CYB A;  4LPM A;  1NF6 A;  3R2M A;  5J8S A;  5J9V A;  5I4J A;  1YUZ A;  3RAV A;  2CEI A;  1JTS A;  4YKH A;  5K52 A;  3KWO A;  2C2U A;  4TOG A;  2V2L A;  4ZKX A;  3R2S A;  4LQV A;  4Z3B A;  3E1P A;  3ISE A;  3PWQ C;  4XKT A;  5GU3 X;  1BCF A;  4TOE A;  3F35 A;  4ITT A;  2FJC A;  5FFE A;  1ZUJ A;  3PWF A;  4IWK A;  2WLA A;  3IS8 A;  5ERJ A;  2FG8 A;  2V2N A;  1J30 A;  1VJX A;  4AM2 A;  4TOD A;  4RC8 A;  3HL1 A;  2ZG7 X;  4ISM A;  3O7S A;  5GOU A;  3BVI A;  3KA6 A;  1LKM A;  4CVT A;  4KVS A;  4ZJK A;  4DYX A;  4EVE A;  4CYA A;  3R2K A;  5HJF A;  1LKO A;  3PVT A;  3QD8 A;  5CZU A;  2FZF A;  5ERK A;  5GN8 B;  3PVY A;  4XKU A;  1JKV A;  4DYZ A;  5K53 A;  2Z5R A;  1TJO A;  3FSE A;  3FVB A;  2XGW A;  1UVH A;  1MFR A;  2JD6 0;  2HTN A;  2JD7 0;  4TOA A;  1TKP A;  2XKQ A;  2YW6 A;  3PW1 A;  4II4 B;  3UOI A;  2PYB A;  2FL0 A;  4OYN A;  4TOF A;  1Z4A A;  4ITW A;  4U3G A;  4KVR A;  3SE1 A;  3R2H A;  2V2O A;  1SQ3 A;  2CN7 A;  3F33 A;  4LQN A;  4ETR A;  4CVR A;  2CF7 A;  3WVU A;  2IY4 A;  3KA8 A;  4ZTT A;  1VLG A;  3OGH A;  4TO9 A;  2GYD A;  2C6R A;  3RBC A;  4AM4 A;  3RGD A;  1XZ3 A;  4EVC A;  4RC5 A;  5CMQ A;  5FEJ A;  5HJH A;  1L8I A;  4TW3 A;  2JD8 0;  4EVD A;  2BK6 A;  2OH3 A;  4ZKH A;  1VEI A;  4ZKW A;  3PW8 C;  4ZLW A;  2X17 0;  3EZ0 A;  2RBD A;  4DZ0 A;  5LBH A;  1FHA A;  4RC6 A;  2FKZ A;  2FHA A;  2Z5P A;  1YUX A;  3E2C A;  4TOB A;  4ML5 A;  2WLU A;  1NNQ A;  2HR5 A;  3QHC A;  4M33 A;  1MOJ A;  4TOC A;  3ERZ A;  4MY7 A;  4CMY V;  4RC7 A;  3R2R A;  2GYQ A;  5GU2 X;  3BVK A;  1JI4 A;  1KRQ A;  3KXU A;  1JKU A;  2V2J A;  1RCE A;  1IES A;  1JIG A;  3AF7 X;  3KA3 A;  5C6F A;  3F36 A;  1ZS3 A;  3MPS A;  3E1Q A;  2XJO A;  1F33 A;  4DYU A;  3R2L A;  3SHX A;  5E2D A;  3Q4Q A;  3E1O A;  3ISF A;  1NFV A;  1RYT A;  2IU2 A;  2CN6 A;  5AXS A;  4RC5 B;  1BG7 A;  3EZU A;  1GWG A;  4ZMC A;  2C2F A;  2ZG9 X;  1DAT A;  4CY9 A;  3IQ1 A;  3BVF A;  5JKM G;  5CMR A;  2Z6M A;  4ERU A;  3KA9 A;  4CMY A;  3WVV A;  3FI6 A;  2Y3Q A;  2D5K A;  1RCI A;  5D8O A;  1R03 A;  1RCC A;  3AF9 X;  1JGC A;  4ZL5 A;  3O7R A;  1O9I A;  1EUM A;  3F34 A;  1AEW A;  3BKN A;  5GU1 X;  5D8Q A;  4LYU A;  2CLU A;  1Z6O M;  2YW7 A;  4M32 A;  2YJJ A;  1UMN A;  3KA4 A;  4AM5 A;  3IS7 A;  1QYB A;  2C41 A;  2QQY A;  5JKM A;  3AK9 A;  1VEL A;  4EVB A;  4R42 A;  3BVE A;  3AJQ A;  2C2J A;  1LKP A;  2V2R A;  4LQJ A;  1DVB A;  4TOH A;  2VXI A;  3QZ3 A;  3PW8 A;  2ZUR X;  2IB0 A;  3RD0 A;  3SH6 A;  1TK6 A;  2VZB A;  3NOZ X;  5D8R A;  4PGI A;  2OC5 A;  3NP0 X;  3RE7 A;  4A25 A;  5FFB A;  3PVT B;  5IX6 A;  1NF4 A;  3AJP A;  3PVY B;  3PWQ A;  3AJO A;  1S3Q A;  4LPJ A;  4P18 A;  3Q4R A;  4DYY A;  3TA8 A;  3KX9 A;  2Z90 A;  4XGS A;  1IER A;  5JKL G;  5J93 A;  3HIU A;  1JI5 A;  4PG0 A;  5JAC A;  4II4 A;  4MUD A;  3PW1 B;  2CHI A;  1JYB A;  3UOF A;  4REU A;  3F38 A;  5FFA A;  3PVR A;  5FFC A;  1H96 A;  2ZA6 A;  4DE6 A;  4ZL6 A;  3OJ5 A;  3NP2 X;  4E6K A;  4ISP A;  2BKC A;  2CHP A;  3WVW A;  5LS9 A;  3PZA A;  1O9R A;  4Y08 A;  4PGK A;  3EGM A;  4MN9 A;  3GVY A;  2ZG8 X;  3GHQ A;  3F37 A;  4QUW A;  5LG2 A;  5JKL A;  2V2S A;  4IWJ A;  3AK8 A;  1L8H A;  1S2Z A;  5D8X A;  2XJN A;  1XZ1 A;  5D8Y A;  2V15 A;  4CVS A;  3T9J A;  4LQH A;  2ITB A;  4IXK A;  4M34 A;  2FG4 A;  4DI0 A;  2YJK A;  1VEQ A;  1LB3 A;  5LG8 A;  5J8W A;  3VNX A;  4DAS A;  3QVD A;  2BJY A;  5GU0 X;  1QGH A;  3U90 A;  3Q4O A;  4RC6 B;  2W0O A;  2V2M A;  1HRS A;  4LPN A;  4LYX A;  4MKU A;  3BT5 A;  5FFD A;  3E1N A;  2QF9 A;  4MJY A;  2G4H A;  3QB9 A;  2FFX J;  2Z5Q A;  2GS4 A;  2ZA8 A;  3Q4N A;  2CLB A;  3E1L A;  2VXX A;  3AF8 X;  3E1J A;  4RC7 B;  3SID A;  3PVR B;  2UX1 A;  4XKS A;  3F39 A;  2V2P A;  1BFR A;  3QHB A;  1Z6O A;  1YV1 A;  3BVL A;  4PG1 A; 
#chains in the Genus database with same CATH topology
 3R2O A;  1DPS A;  2CIH A;  3WNW A;  2G38 B;  1S30 A;  1SOF A;  4M35 A;  3F32 A;  3ES3 A;  2OKC A;  2F7N A;  3E6S A;  2WTL A;  4CVP A;  3H7G A;  5GN8 A;  5D8P A;  1JRE A;  1F30 A;  1N1Q A;  1RCG A;  4KVQ A;  3A68 A;  3UNO A;  3E6R A;  3E1M A;  2XJM A;  4Z5S A;  2ZA7 A;  1B71 A;  1TKO A;  2V2I A;  3D19 A;  1OTK A;  2BW1 A;  3A9Q A;  5JDO B;  5HQO A;  1RCD A;  3GE4 A;  5E1U A;  5D8S A;  4CYB A;  4LPM A;  4YVZ A;  1NF6 A;  3R2M A;  5J8S A;  5J9V A;  5I4J A;  1YUZ A;  3RAV A;  2CEI A;  1JTS A;  4YKH A;  5K52 A;  3KWO A;  2C2U A;  4TOG A;  2V2L A;  4ZKX A;  3R2S A;  4LQV A;  4Z3B A;  3E1P A;  3ISE A;  3PWQ C;  4XKT A;  5GU3 X;  1BCF A;  3W54 A;  4TOE A;  3F35 A;  4ITT A;  2FJC A;  2CWL A;  5FFE A;  1ZUJ A;  2AR0 A;  3GGZ A;  3PWF A;  4IWK A;  4WJG 4;  2WLA A;  3IS8 A;  5ERJ A;  2FG8 A;  2V2N A;  1J30 A;  1VJX A;  4AM2 A;  4TOD A;  4RC8 A;  3HL1 A;  2ZG7 X;  4ISM A;  3O7S A;  5GOU A;  3BVI A;  3VV9 A;  3KA6 A;  1LKM A;  4CVT A;  4KVS A;  4ZJK A;  2V8T A;  4DYX A;  4YXJ A;  4EVE A;  4CYA A;  3R2K A;  5HJF A;  1LKO A;  3PVT A;  3QD8 A;  5CZU A;  2FZF A;  5ERK A;  5GN8 B;  3PVY A;  3N6O A;  4XKU A;  1JKV A;  4DYZ A;  5K53 A;  2Z5R A;  3FRR A;  1TJO A;  3FSE A;  3FVB A;  2XGW A;  1UVH A;  4W4L B;  1MFR A;  2JD6 0;  2HTN A;  2JD7 0;  4TOA A;  1TKP A;  2XKQ A;  2YW6 A;  3PW1 A;  4II4 B;  3UOI A;  2PYB A;  2FL0 A;  4OYN A;  4TOF A;  1Z4A A;  3C23 A;  4ITW A;  4W4K B;  4U3G A;  4KVR A;  3SE1 A;  3R2H A;  2V2O A;  1SQ3 A;  2CN7 A;  3F33 A;  4LQN A;  4ETR A;  4CVR A;  2CF7 A;  3WVU A;  2IY4 A;  3KA8 A;  4ZTT A;  1VLG A;  3OGH A;  4TO9 A;  2GYD A;  2C6R A;  3RBC A;  4X0J A;  4AM4 A;  3RGD A;  3KDQ A;  1XZ3 A;  4EVC A;  4RC5 A;  5CMQ A;  5FEJ A;  3FRS A;  5HJH A;  1L8I A;  4TW3 A;  2JD8 0;  4EVD A;  2BK6 A;  2OH3 A;  3DBY A;  4ZKH A;  1VEI A;  4ZKW A;  3PW8 C;  4ZLW A;  2X17 0;  3EZ0 A;  3UFB A;  2RBD A;  4DZ0 A;  5LBH A;  1FHA A;  4RC6 A;  2FKZ A;  2FHA A;  2Z5P A;  1YUX A;  2WWX B;  3E2C A;  4TOB A;  2WLU A;  4ML5 A;  1NNQ A;  3GGY A;  2HR5 A;  3QHC A;  4M33 A;  1MOJ A;  4TOC A;  3ERZ A;  4MY7 A;  4MXP A;  3C1Z A;  4CMY V;  4RC7 A;  3R2R A;  3C21 A;  2GYQ A;  5GU2 X;  2MGY A;  3BVK A;  1JI4 A;  1KRQ A;  3KXU A;  1JKU A;  2V2J A;  4E40 A;  1RCE A;  1IES A;  1JIG A;  3AF7 X;  3KA3 A;  5C6F A;  3F36 A;  1ZS3 A;  3MPS A;  3E1Q A;  2XJO A;  1F33 A;  4DYU A;  3R2L A;  2V8U A;  3SHX A;  5E2D A;  3Q4Q A;  3E1O A;  3ISF A;  1NFV A;  1RYT A;  2IU2 A;  2CN6 A;  5AXS A;  4RC5 B;  1BG7 A;  3EZU A;  1GWG A;  4ZMC A;  2C2F A;  2ZG9 X;  1DAT A;  4CY9 A;  3IQ1 A;  3BVF A;  5JKM G;  5JDO A;  5CMR A;  2Z6M A;  4ERU A;  3KA9 A;  4CMY A;  3WVV A;  3FI6 A;  2Y3Q A;  2D5K A;  1RCI A;  5D8O A;  1R03 A;  1RCC A;  3AF9 X;  1JGC A;  4ZL5 A;  3O7R A;  1O9I A;  1EUM A;  3F34 A;  1AEW A;  3BKN A;  5GU1 X;  5D8Q A;  4LYU A;  2CLU A;  1Z6O M;  2YW7 A;  4M32 A;  2YJJ A;  1UMN A;  3KA4 A;  4AM5 A;  3IS7 A;  1QYB A;  2C41 A;  2QQY A;  3KHK A;  5JKM A;  3AK9 A;  1VEL A;  4EVB A;  4KXR B;  4R42 A;  3BVE A;  3AJQ A;  2C2J A;  1LKP A;  2V2R A;  4LQJ A;  1DVB A;  4TOH A;  2VXI A;  3QZ3 A;  3PW8 A;  2ZUR X;  2IB0 A;  3RD0 A;  3SH6 A;  1TK6 A;  2VZB A;  3NOZ X;  3C1Y A;  5D8R A;  4PGI A;  2OC5 A;  3NP0 X;  3RE7 A;  4A25 A;  5FFB A;  2N02 A;  3PVT B;  5IX6 A;  1NF4 A;  3L0M A;  3AJP A;  3PVY B;  3PWQ A;  3AJO A;  2Y44 A;  1S3Q A;  4LPJ A;  4P18 A;  3Q4R A;  4DYY A;  3TA8 A;  3KX9 A;  2Z90 A;  4XGS A;  1IER A;  3VVA A;  5JKL G;  3V3K B;  5J93 A;  3HIU A;  4YXM A;  1JI5 A;  4PG0 A;  5JAC A;  4II4 A;  4MUD A;  3PW1 B;  3LKD A;  2CHI A;  1JYB A;  3UOF A;  4REU A;  3F38 A;  3JZ9 A;  5FFA A;  3PVR A;  5FFC A;  1H96 A;  2ZA6 A;  4DE6 A;  4ZL6 A;  3M6J A;  3NP2 X;  3JZA B;  3OJ5 A;  4E6K A;  4ISP A;  2BKC A;  2CHP A;  3WVW A;  5LS9 A;  3PZA A;  1O9R A;  4Y08 A;  4PGK A;  5HU6 D;  3EGM A;  4MN9 A;  3GVY A;  2ZG8 X;  3GHQ A;  3F37 A;  4QUW A;  5LG2 A;  5JKL A;  2V2S A;  4IWJ A;  3AK8 A;  1L8H A;  1S2Z A;  5D8X A;  2XJN A;  1XZ1 A;  5D8Y A;  2V15 A;  4CVS A;  3T9J A;  4LQH A;  2ITB A;  4IXK A;  4M34 A;  2FG4 A;  4DI0 A;  2YJK A;  1VEQ A;  1LB3 A;  5LG8 A;  5J8W A;  3VNX A;  4DAS A;  3QVD A;  2BJY A;  5GU0 X;  1QGH A;  3U90 A;  3Q4O A;  4RC6 B;  2W0O A;  2V2M A;  1HRS A;  4LPN A;  4LYX A;  4MKU A;  3BT5 A;  5FFD A;  3E1N A;  2QF9 A;  4MJY A;  2G4H A;  3QB9 A;  2FFX J;  2Z5Q A;  2GS4 A;  2ZA8 A;  3Q4N A;  2CLB A;  3E1L A;  2VXX A;  3AF8 X;  3E1J A;  4RC7 B;  3SID A;  3PVR B;  2UX1 A;  4XKS A;  3F39 A;  2V2P A;  1BFR A;  3QHB A;  1Z6O A;  1YV1 A;  3BVL A;  4PG1 A; 
#chains in the Genus database with same CATH homology
 3R2O A;  1DPS A;  2CIH A;  3WNW A;  2G38 B;  1S30 A;  1SOF A;  4M35 A;  3F32 A;  3ES3 A;  2OKC A;  2F7N A;  3E6S A;  2WTL A;  4CVP A;  3H7G A;  5GN8 A;  5D8P A;  1JRE A;  1F30 A;  1N1Q A;  1RCG A;  4KVQ A;  3A68 A;  3UNO A;  3E6R A;  3E1M A;  2XJM A;  4Z5S A;  2ZA7 A;  1B71 A;  1TKO A;  2V2I A;  3D19 A;  1OTK A;  2BW1 A;  3A9Q A;  5JDO B;  5HQO A;  1RCD A;  3GE4 A;  5E1U A;  5D8S A;  4CYB A;  4LPM A;  4YVZ A;  1NF6 A;  3R2M A;  5J8S A;  5J9V A;  5I4J A;  1YUZ A;  3RAV A;  2CEI A;  1JTS A;  4YKH A;  5K52 A;  3KWO A;  2C2U A;  4TOG A;  2V2L A;  4ZKX A;  3R2S A;  4LQV A;  4Z3B A;  3E1P A;  3ISE A;  3PWQ C;  4XKT A;  5GU3 X;  1BCF A;  3W54 A;  4TOE A;  3F35 A;  4ITT A;  2FJC A;  2CWL A;  5FFE A;  1ZUJ A;  2AR0 A;  3GGZ A;  3PWF A;  4IWK A;  4WJG 4;  2WLA A;  3IS8 A;  5ERJ A;  2FG8 A;  2V2N A;  1J30 A;  1VJX A;  4AM2 A;  4TOD A;  4RC8 A;  3HL1 A;  2ZG7 X;  4ISM A;  3O7S A;  5GOU A;  3BVI A;  3VV9 A;  3KA6 A;  1LKM A;  4CVT A;  4KVS A;  4ZJK A;  2V8T A;  4DYX A;  4YXJ A;  4EVE A;  4CYA A;  3R2K A;  5HJF A;  1LKO A;  3PVT A;  3QD8 A;  5CZU A;  2FZF A;  5ERK A;  5GN8 B;  3PVY A;  3N6O A;  4XKU A;  1JKV A;  4DYZ A;  5K53 A;  2Z5R A;  3FRR A;  1TJO A;  3FSE A;  3FVB A;  2XGW A;  1UVH A;  4W4L B;  1MFR A;  2JD6 0;  2HTN A;  2JD7 0;  4TOA A;  1TKP A;  2XKQ A;  2YW6 A;  3PW1 A;  4II4 B;  3UOI A;  2PYB A;  2FL0 A;  4OYN A;  4TOF A;  1Z4A A;  3C23 A;  4ITW A;  4W4K B;  4U3G A;  4KVR A;  3SE1 A;  3R2H A;  2V2O A;  1SQ3 A;  2CN7 A;  3F33 A;  4LQN A;  4ETR A;  4CVR A;  2CF7 A;  3WVU A;  2IY4 A;  3KA8 A;  4ZTT A;  1VLG A;  3OGH A;  4TO9 A;  2GYD A;  2C6R A;  3RBC A;  4X0J A;  4AM4 A;  3RGD A;  3KDQ A;  1XZ3 A;  4EVC A;  4RC5 A;  5CMQ A;  5FEJ A;  3FRS A;  5HJH A;  1L8I A;  4TW3 A;  2JD8 0;  4EVD A;  2BK6 A;  2OH3 A;  3DBY A;  4ZKH A;  1VEI A;  4ZKW A;  3PW8 C;  4ZLW A;  2X17 0;  3EZ0 A;  3UFB A;  2RBD A;  4DZ0 A;  5LBH A;  1FHA A;  4RC6 A;  2FKZ A;  2FHA A;  2Z5P A;  1YUX A;  2WWX B;  3E2C A;  4TOB A;  2WLU A;  4ML5 A;  1NNQ A;  3GGY A;  2HR5 A;  3QHC A;  4M33 A;  1MOJ A;  4TOC A;  3ERZ A;  4MY7 A;  4MXP A;  3C1Z A;  4CMY V;  4RC7 A;  3R2R A;  3C21 A;  2GYQ A;  5GU2 X;  2MGY A;  3BVK A;  1JI4 A;  1KRQ A;  3KXU A;  1JKU A;  2V2J A;  4E40 A;  1RCE A;  1IES A;  1JIG A;  3AF7 X;  3KA3 A;  5C6F A;  3F36 A;  1ZS3 A;  3MPS A;  3E1Q A;  2XJO A;  1F33 A;  4DYU A;  3R2L A;  2V8U A;  3SHX A;  5E2D A;  3Q4Q A;  3E1O A;  3ISF A;  1NFV A;  1RYT A;  2IU2 A;  2CN6 A;  5AXS A;  4RC5 B;  1BG7 A;  3EZU A;  1GWG A;  4ZMC A;  2C2F A;  2ZG9 X;  1DAT A;  4CY9 A;  3IQ1 A;  3BVF A;  5JKM G;  5JDO A;  5CMR A;  2Z6M A;  4ERU A;  3KA9 A;  4CMY A;  3WVV A;  3FI6 A;  2Y3Q A;  2D5K A;  1RCI A;  5D8O A;  1R03 A;  1RCC A;  3AF9 X;  1JGC A;  4ZL5 A;  3O7R A;  1O9I A;  1EUM A;  3F34 A;  1AEW A;  3BKN A;  5GU1 X;  5D8Q A;  4LYU A;  2CLU A;  1Z6O M;  2YW7 A;  4M32 A;  2YJJ A;  1UMN A;  3KA4 A;  4AM5 A;  3IS7 A;  1QYB A;  2C41 A;  2QQY A;  3KHK A;  5JKM A;  3AK9 A;  1VEL A;  4EVB A;  4KXR B;  4R42 A;  3BVE A;  3AJQ A;  2C2J A;  1LKP A;  2V2R A;  4LQJ A;  1DVB A;  4TOH A;  2VXI A;  3QZ3 A;  3PW8 A;  2ZUR X;  2IB0 A;  3RD0 A;  3SH6 A;  1TK6 A;  2VZB A;  3NOZ X;  3C1Y A;  5D8R A;  4PGI A;  2OC5 A;  3NP0 X;  3RE7 A;  4A25 A;  5FFB A;  2N02 A;  3PVT B;  5IX6 A;  1NF4 A;  3L0M A;  3AJP A;  3PVY B;  3PWQ A;  3AJO A;  2Y44 A;  1S3Q A;  4LPJ A;  4P18 A;  3Q4R A;  4DYY A;  3TA8 A;  3KX9 A;  2Z90 A;  4XGS A;  1IER A;  3VVA A;  5JKL G;  3V3K B;  5J93 A;  3HIU A;  4YXM A;  1JI5 A;  4PG0 A;  5JAC A;  4II4 A;  4MUD A;  3PW1 B;  3LKD A;  2CHI A;  1JYB A;  3UOF A;  4REU A;  3F38 A;  3JZ9 A;  5FFA A;  3PVR A;  5FFC A;  1H96 A;  2ZA6 A;  4DE6 A;  4ZL6 A;  3M6J A;  3NP2 X;  3JZA B;  3OJ5 A;  4E6K A;  4ISP A;  2BKC A;  2CHP A;  3WVW A;  5LS9 A;  3PZA A;  1O9R A;  4Y08 A;  4PGK A;  5HU6 D;  3EGM A;  4MN9 A;  3GVY A;  2ZG8 X;  3GHQ A;  3F37 A;  4QUW A;  5LG2 A;  5JKL A;  2V2S A;  4IWJ A;  3AK8 A;  1L8H A;  1S2Z A;  5D8X A;  2XJN A;  1XZ1 A;  5D8Y A;  2V15 A;  4CVS A;  3T9J A;  4LQH A;  2ITB A;  4IXK A;  4M34 A;  2FG4 A;  4DI0 A;  2YJK A;  1VEQ A;  1LB3 A;  5LG8 A;  5J8W A;  3VNX A;  4DAS A;  3QVD A;  2BJY A;  5GU0 X;  1QGH A;  3U90 A;  3Q4O A;  4RC6 B;  2W0O A;  2V2M A;  1HRS A;  4LPN A;  4LYX A;  4MKU A;  3BT5 A;  5FFD A;  3E1N A;  2QF9 A;  4MJY A;  2G4H A;  3QB9 A;  2FFX J;  2Z5Q A;  2GS4 A;  2ZA8 A;  3Q4N A;  2CLB A;  3E1L A;  2VXX A;  3AF8 X;  3E1J A;  4RC7 B;  3SID A;  3PVR B;  2UX1 A;  4XKS A;  3F39 A;  2V2P A;  1BFR A;  3QHB A;  1Z6O A;  1YV1 A;  3BVL A;  4PG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...