2Y4GA

Structure of the tirandamycin-bound fad-dependent tirandamycin oxidase taml in p212121 space group
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
500
structure length
500
Chain Sequence
MKHIDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEADVPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNPAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAML
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
total genus 159
structure length 500
sequence length 500
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y4gA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y4gA02
2Y3SA 5K8EA 1ZR6A 3FWAA 4PVJA 5D79A 2BVGA 5I1WA 3RJ8A 3D2DA 2BVHA 3W8XA 2IPIA 5L6GA 4PZFA 3FW9A 3FW8A 3PQBA 3D2HA 5AWVA 2Y4GA 3HSUA 3W8ZA 4PWCA 4PVHA 4UD8A 2UUUA 3TSHA 3VTEA 4PVEA 3FW7A 3TSJA 2AXRA 3POPA 4DNSA 2UUVA 5L6FA 2Y08A 3GSYA 2Y3RA 4EC3A 2WDWA 5I1VA 3RJAA 4PVKA 3W8WA 2BVFA 3D2JA 4PWBA 4XLOA
chains in the Genus database with same CATH superfamily
5HQXA 5HHZA 3B9JB 1ZR6A 2P3HA 3BW7A 1UXYA 2MBRA 2BVGA 3DQ0A 3RJ8A 1JRPA 3W8XA 2IPIA 2NQWA 3S1FA 4PZFA 3ETRB 3PQBA 3W8ZA 4PWCA 4BBYA 2PLSA 1E8HA 3TSHA 1W1QA 2YVSA 4PVEA 3HRDC 1E0YA 2UUVA 1F0XA 3GSYA 2BVFA 2W55A 5AE3A 1N62C 1N63C 1N61C 3D2JA 3TX1A 4ZOHB 3DEDA 2P13A 3NVZB 1N5XA 3KJMA 2VFUA 3FWAA 3NVWB 4PVJA 2P4PA 3D2DA 4ML8A 3NRZB 1E8GA 1AHZA 1AHUA 1VAOA 1AHVA 1WVFA 4PVHA 4UD8A 2UUUA 3AMZA 3I99A 4O95A 2QPMA 3TSJA 2GQTA 1RM6B 1JROA 1MBBA 1FO4A 2WDWA 3PM9A 3RJAA 3S1DA 1FIQB 1MBTA 3LAEA 1V97A 2W3SA 5K8EA 2Q85A 2I0KA 4OALA 1QLTA 5D79A 1DIQA 2VFTA 3S1CA 2O3GA 4HG0A 5I1WA 1DIIA 4JAYA 5ADZA 2BVHA 2VFVA 1SB3B 3FW9A 3FW8A 2Q4WA 3D2HA 2Y4GA 1W1OA 5G5HB 3AM9A 3POPA 2VFSA 5HMRA 4DNSA 2QKNA 1QLUA 2Y08A 5L6FA 3AN1A 4EC3A 2R2ZA 5FXDA 5I1VA 5FXPA 2VAOA 3W8WA 4PVKA 1WYGA 4BC7A 1ZXIC 5AE2A 1HSKA 1DZNA 1N5WC 2EXRA 4PWBA 4XLOA 5G5GB 3S1EA 2Y3SA 1W1MA 1W1RA 2PLIA 3NVYB 5AE1A 5L6GA 3C0PA 4PYTA 2RK5A 5FXFA 1W1JA 1W1KA 2GQUA 4MLAA 4BC9A 4JB1A 5AWVA 1I19A 3HSUA 2W3RA 2E3TA 2VFRA 1FFUC 1VDVA 1W1SA 3VTEA 3FW7A 1E8FA 2AXRA 1W1LA 1FFVC 3JS8A 3EUB3 3NS1B 2Y3RA 2OAIA 5FXEA 3NVVB 3LLBA 1T3QC 4BCAA 3SR6B 1WVEA 1N60C 2W54A 2R8DA
chains in the Genus database with same CATH topology
5HQXA 5HHZA 3B9JB 1ZR6A 2P3HA 3BW7A 1UXYA 2MBRA 2BVGA 3DQ0A 3RJ8A 1JRPA 3W8XA 2IPIA 2NQWA 3S1FA 4PZFA 3ETRB 3PQBA 3W8ZA 4PWCA 4BBYA 2PLSA 1E8HA 3TSHA 1W1QA 2YVSA 4PVEA 3HRDC 1E0YA 2UUVA 1F0XA 3GSYA 2BVFA 2W55A 5AE3A 1N62C 1N63C 1N61C 3D2JA 3TX1A 4ZOHB 3DEDA 2P13A 3NVZB 1N5XA 3KJMA 2VFUA 3FWAA 3NVWB 4PVJA 2P4PA 3D2DA 4ML8A 3NRZB 1E8GA 1AHZA 1AHUA 1VAOA 1AHVA 1WVFA 4PVHA 4UD8A 2UUUA 3AMZA 3I99A 4O95A 2QPMA 3TSJA 2GQTA 1RM6B 1JROA 1MBBA 1FO4A 2WDWA 3PM9A 3RJAA 3S1DA 1FIQB 1MBTA 3LAEA 1V97A 2W3SA 5K8EA 2Q85A 2I0KA 4OALA 1QLTA 5D79A 1DIQA 2VFTA 3S1CA 2O3GA 4HG0A 5I1WA 1DIIA 4JAYA 5ADZA 2BVHA 2VFVA 1SB3B 3FW9A 3FW8A 2Q4WA 3D2HA 2Y4GA 1W1OA 5G5HB 3AM9A 3POPA 2VFSA 5HMRA 4DNSA 2QKNA 1QLUA 2Y08A 5L6FA 3AN1A 4EC3A 2R2ZA 5FXDA 5I1VA 5FXPA 2VAOA 3W8WA 4PVKA 1WYGA 4BC7A 1ZXIC 5AE2A 1HSKA 1DZNA 1N5WC 2EXRA 4PWBA 4XLOA 5G5GB 3S1EA 2Y3SA 1W1MA 1W1RA 2PLIA 3NVYB 5AE1A 5L6GA 3C0PA 4PYTA 2RK5A 5FXFA 1W1JA 1W1KA 2GQUA 4MLAA 4BC9A 4JB1A 5AWVA 1I19A 3HSUA 2W3RA 2E3TA 2VFRA 1FFUC 1VDVA 1W1SA 3VTEA 3FW7A 1E8FA 2AXRA 1W1LA 1FFVC 3JS8A 3EUB3 3NS1B 2Y3RA 2OAIA 5FXEA 3NVVB 3LLBA 1T3QC 4BCAA 3SR6B 1WVEA 1N60C 2W54A 2R8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3S A;  5K8E A;  1ZR6 A;  3FWA A;  4PVJ A;  5D79 A;  2BVG A;  5I1W A;  3RJ8 A;  3D2D A;  2BVH A;  3W8X A;  2IPI A;  5L6G A;  4PZF A;  3FW9 A;  3FW8 A;  3PQB A;  3D2H A;  5AWV A;  2Y4G A;  3HSU A;  3W8Z A;  4PWC A;  4PVH A;  4UD8 A;  2UUU A;  3TSH A;  3VTE A;  4PVE A;  3FW7 A;  3TSJ A;  2AXR A;  3POP A;  4DNS A;  2UUV A;  5L6F A;  2Y08 A;  3GSY A;  2Y3R A;  4EC3 A;  2WDW A;  5I1V A;  3RJA A;  4PVK A;  3W8W A;  2BVF A;  3D2J A;  4PWB A;  4XLO A; 
#chains in the Genus database with same CATH topology
 5HQX A;  5HHZ A;  3B9J B;  1ZR6 A;  2P3H A;  3BW7 A;  1UXY A;  2MBR A;  2BVG A;  3DQ0 A;  3RJ8 A;  1JRP A;  3W8X A;  2IPI A;  2NQW A;  3S1F A;  4PZF A;  3ETR B;  3PQB A;  3W8Z A;  4PWC A;  4BBY A;  2PLS A;  1E8H A;  3TSH A;  1W1Q A;  2YVS A;  4PVE A;  3HRD C;  1E0Y A;  2UUV A;  1F0X A;  3GSY A;  2BVF A;  2W55 A;  5AE3 A;  1N62 C;  1N63 C;  1N61 C;  3D2J A;  3TX1 A;  4ZOH B;  3DED A;  2P13 A;  3NVZ B;  1N5X A;  3KJM A;  2VFU A;  3FWA A;  3NVW B;  4PVJ A;  2P4P A;  3D2D A;  4ML8 A;  3NRZ B;  1E8G A;  1AHZ A;  1AHU A;  1VAO A;  1AHV A;  1WVF A;  4PVH A;  4UD8 A;  2UUU A;  3AMZ A;  3I99 A;  4O95 A;  2QPM A;  3TSJ A;  2GQT A;  1RM6 B;  1JRO A;  1MBB A;  1FO4 A;  2WDW A;  3PM9 A;  3RJA A;  3S1D A;  1FIQ B;  1MBT A;  3LAE A;  1V97 A;  2W3S A;  5K8E A;  2Q85 A;  2I0K A;  4OAL A;  1QLT A;  5D79 A;  1DIQ A;  2VFT A;  3S1C A;  2O3G A;  4HG0 A;  5I1W A;  1DII A;  4JAY A;  5ADZ A;  2BVH A;  2VFV A;  1SB3 B;  3FW9 A;  3FW8 A;  2Q4W A;  3D2H A;  2Y4G A;  1W1O A;  5G5H B;  3AM9 A;  3POP A;  2VFS A;  5HMR A;  4DNS A;  2QKN A;  1QLU A;  2Y08 A;  5L6F A;  3AN1 A;  4EC3 A;  2R2Z A;  5FXD A;  5I1V A;  5FXP A;  2VAO A;  3W8W A;  4PVK A;  1WYG A;  4BC7 A;  1ZXI C;  5AE2 A;  1HSK A;  1DZN A;  1N5W C;  2EXR A;  4PWB A;  4XLO A;  5G5G B;  3S1E A;  2Y3S A;  1W1M A;  1W1R A;  2PLI A;  3NVY B;  5AE1 A;  5L6G A;  3C0P A;  4PYT A;  2RK5 A;  5FXF A;  1W1J A;  1W1K A;  2GQU A;  4MLA A;  4BC9 A;  4JB1 A;  5AWV A;  1I19 A;  3HSU A;  2W3R A;  2E3T A;  2VFR A;  1FFU C;  1VDV A;  1W1S A;  3VTE A;  3FW7 A;  1E8F A;  2AXR A;  1W1L A;  1FFV C;  3JS8 A;  3EUB 3;  3NS1 B;  2Y3R A;  2OAI A;  5FXE A;  3NVV B;  3LLB A;  1T3Q C;  4BCA A;  3SR6 B;  1WVE A;  1N60 C;  2W54 A;  2R8D A; 
#chains in the Genus database with same CATH homology
 5HQX A;  5HHZ A;  3B9J B;  1ZR6 A;  2P3H A;  3BW7 A;  1UXY A;  2MBR A;  2BVG A;  3DQ0 A;  3RJ8 A;  1JRP A;  3W8X A;  2IPI A;  2NQW A;  3S1F A;  4PZF A;  3ETR B;  3PQB A;  3W8Z A;  4PWC A;  4BBY A;  2PLS A;  1E8H A;  3TSH A;  1W1Q A;  2YVS A;  4PVE A;  3HRD C;  1E0Y A;  2UUV A;  1F0X A;  3GSY A;  2BVF A;  2W55 A;  5AE3 A;  1N62 C;  1N63 C;  1N61 C;  3D2J A;  3TX1 A;  4ZOH B;  3DED A;  2P13 A;  3NVZ B;  1N5X A;  3KJM A;  2VFU A;  3FWA A;  3NVW B;  4PVJ A;  2P4P A;  3D2D A;  4ML8 A;  3NRZ B;  1E8G A;  1AHZ A;  1AHU A;  1VAO A;  1AHV A;  1WVF A;  4PVH A;  4UD8 A;  2UUU A;  3AMZ A;  3I99 A;  4O95 A;  2QPM A;  3TSJ A;  2GQT A;  1RM6 B;  1JRO A;  1MBB A;  1FO4 A;  2WDW A;  3PM9 A;  3RJA A;  3S1D A;  1FIQ B;  1MBT A;  3LAE A;  1V97 A;  2W3S A;  5K8E A;  2Q85 A;  2I0K A;  4OAL A;  1QLT A;  5D79 A;  1DIQ A;  2VFT A;  3S1C A;  2O3G A;  4HG0 A;  5I1W A;  1DII A;  4JAY A;  5ADZ A;  2BVH A;  2VFV A;  1SB3 B;  3FW9 A;  3FW8 A;  2Q4W A;  3D2H A;  2Y4G A;  1W1O A;  5G5H B;  3AM9 A;  3POP A;  2VFS A;  5HMR A;  4DNS A;  2QKN A;  1QLU A;  2Y08 A;  5L6F A;  3AN1 A;  4EC3 A;  2R2Z A;  5FXD A;  5I1V A;  5FXP A;  2VAO A;  3W8W A;  4PVK A;  1WYG A;  4BC7 A;  1ZXI C;  5AE2 A;  1HSK A;  1DZN A;  1N5W C;  2EXR A;  4PWB A;  4XLO A;  5G5G B;  3S1E A;  2Y3S A;  1W1M A;  1W1R A;  2PLI A;  3NVY B;  5AE1 A;  5L6G A;  3C0P A;  4PYT A;  2RK5 A;  5FXF A;  1W1J A;  1W1K A;  2GQU A;  4MLA A;  4BC9 A;  4JB1 A;  5AWV A;  1I19 A;  3HSU A;  2W3R A;  2E3T A;  2VFR A;  1FFU C;  1VDV A;  1W1S A;  3VTE A;  3FW7 A;  1E8F A;  2AXR A;  1W1L A;  1FFV C;  3JS8 A;  3EUB 3;  3NS1 B;  2Y3R A;  2OAI A;  5FXE A;  3NVV B;  3LLB A;  1T3Q C;  4BCA A;  3SR6 B;  1WVE A;  1N60 C;  2W54 A;  2R8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...