2Y4GA

Structure of the tirandamycin-bound fad-dependent tirandamycin oxidase taml in p212121 space group
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
500
structure length
500
Chain Sequence
b'MKHIDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEADVPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNPAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAML
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
total genus 159
structure length 500
sequence length 500
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y4gA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y4gA02
4PVKA 3D2DA 4PWBA 3D2JA 3RJAA 5K8EA 4EC3A 2BVGA 2BVHA 4PWCA 3TSHA 1ZR6A 3W8XA 3D2HA 4PZFA 2UUVA 2IPIA 3W8WA 5I1VA 2WDWA 5L6GA 2BVFA 4XLOA 4PVHA 3TSJA 3RJ8A 5AWVA 3FW9A 3GSYA 4UD8A 2Y08A 2UUUA 3PQBA 2Y3SA 4PVJA 3VTEA 3W8ZA 5D79A 5I1WA 3POPA 4DNSA 3FW8A 2Y3RA 3FWAA 5L6FA 3FW7A 4PVEA 2Y4GA 2AXRA 3HSUA
chains in the Genus database with same CATH superfamily
2VFRA 2YVSA 1N5WC 1E8GA 1N60C 3RJAA 1JROA 1WYGA 2PLIA 4PWCA 3S1FA 3W8XA 1E8FA 3S1CA 4BC7A 3S1EA 5I1VA 2WDWA 4XLOA 2W3RA 4UD8A 5AWVA 3TX1A 2VAOA 1W1KA 1WVFA 1MBTA 1E8HA 4BC9A 3ETRB 3LAEA 1W1JA 4PYTA 2GQUA 2OAIA 3NVWB 1N5XA 3POPA 1E0YA 1T3QC 3FWAA 2VFUA 4PVEA 5AE3A 3NVZB 4HG0A 5HMRA 5ADZA 3D2DA 4PWBA 3KJMA 1QLUA 3S1DA 5FXDA 2BVGA 1N61C 2NQWA 3EUB3 4MLAA 1HSKA 3B9JB 2W3SA 2IPIA 3NS1B 5L6GA 1W1OA 2PLSA 3RJ8A 4ML8A 4ZOHB 1AHUA 2Y08A 2UUUA 1DIIA 3PQBA 5G5HB 2Y3SA 3LLBA 3VTEA 1QLTA 5HHZA 3DEDA 2Q85A 5AE2A 2Y4GA 3C0PA 1W1SA 1DZNA 3HSUA 1F0XA 3PM9A 4JB1A 1DIQA 4PVKA 4EC3A 3D2JA 5HQXA 5K8EA 1ZXIC 3TSHA 5G5GB 4PZFA 2UUVA 5AE1A 3I99A 1W1MA 3W8WA 2P13A 2R2ZA 4BBYA 1UXYA 2I0KA 3NVYB 4PVHA 3TSJA 2W55A 3FW9A 3GSYA 5FXFA 2Q4WA 1WVEA 2P3HA 4BCAA 3AN1A 3NRZB 1MBBA 1W1LA 3AMZA 1SB3B 1VAOA 1AHVA 2QKNA 2R8DA 2W54A 4OALA 5FXEA 3FW8A 2O3GA 2Y3RA 3FW7A 2P4PA 1FFUC 3BW7A 2AXRA 1V97A 2E3TA 3JS8A 2MBRA 2BVHA 3DQ0A 1ZR6A 3D2HA 4JAYA 1FIQB 1VDVA 3AM9A 2BVFA 1W1RA 1JRPA 2VFTA 1N62C 2RK5A 3NVVB 2GQTA 2EXRA 2VFSA 4PVJA 1FFVC 2QPMA 3W8ZA 5D79A 1I19A 2VFVA 4O95A 3SR6B 5I1WA 3HRDC 1FO4A 1W1QA 4DNSA 1N63C 5L6FA 1RM6B 1AHZA 5FXPA
chains in the Genus database with same CATH topology
2VFRA 2YVSA 1N5WC 1E8GA 1N60C 3RJAA 1JROA 1WYGA 2PLIA 4PWCA 3S1FA 3W8XA 1E8FA 3S1CA 4BC7A 3S1EA 5I1VA 2WDWA 4XLOA 2W3RA 4UD8A 5AWVA 3TX1A 2VAOA 1W1KA 1WVFA 1MBTA 1E8HA 4BC9A 3ETRB 3LAEA 1W1JA 4PYTA 2GQUA 2OAIA 3NVWB 1N5XA 3POPA 1E0YA 1T3QC 3FWAA 2VFUA 4PVEA 5AE3A 3NVZB 4HG0A 5HMRA 5ADZA 3D2DA 4PWBA 3KJMA 1QLUA 3S1DA 5FXDA 2BVGA 1N61C 2NQWA 3EUB3 4MLAA 1HSKA 3B9JB 2W3SA 2IPIA 3NS1B 5L6GA 1W1OA 2PLSA 3RJ8A 4ML8A 4ZOHB 1AHUA 2Y08A 2UUUA 1DIIA 3PQBA 5G5HB 2Y3SA 3LLBA 3VTEA 1QLTA 5HHZA 3DEDA 2Q85A 5AE2A 2Y4GA 3C0PA 1W1SA 1DZNA 3HSUA 1F0XA 3PM9A 4JB1A 1DIQA 4PVKA 4EC3A 3D2JA 5HQXA 5K8EA 1ZXIC 3TSHA 5G5GB 4PZFA 2UUVA 5AE1A 3I99A 1W1MA 3W8WA 2P13A 2R2ZA 4BBYA 1UXYA 2I0KA 3NVYB 4PVHA 3TSJA 2W55A 3FW9A 3GSYA 5FXFA 2Q4WA 1WVEA 2P3HA 4BCAA 3AN1A 3NRZB 1MBBA 1W1LA 3AMZA 1SB3B 1VAOA 1AHVA 2QKNA 2R8DA 2W54A 4OALA 5FXEA 3FW8A 2O3GA 2Y3RA 3FW7A 2P4PA 1FFUC 3BW7A 2AXRA 1V97A 2E3TA 3JS8A 2MBRA 2BVHA 3DQ0A 1ZR6A 3D2HA 4JAYA 1FIQB 1VDVA 3AM9A 2BVFA 1W1RA 1JRPA 2VFTA 1N62C 2RK5A 3NVVB 2GQTA 2EXRA 2VFSA 4PVJA 1FFVC 2QPMA 3W8ZA 5D79A 1I19A 2VFVA 4O95A 3SR6B 5I1WA 3HRDC 1FO4A 1W1QA 4DNSA 1N63C 5L6FA 1RM6B 1AHZA 5FXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PVK A;  3D2D A;  4PWB A;  3D2J A;  3RJA A;  5K8E A;  4EC3 A;  2BVG A;  2BVH A;  4PWC A;  3TSH A;  1ZR6 A;  3W8X A;  3D2H A;  4PZF A;  2UUV A;  2IPI A;  3W8W A;  5I1V A;  2WDW A;  5L6G A;  2BVF A;  4XLO A;  4PVH A;  3TSJ A;  3RJ8 A;  5AWV A;  3FW9 A;  3GSY A;  4UD8 A;  2Y08 A;  2UUU A;  3PQB A;  2Y3S A;  4PVJ A;  3VTE A;  3W8Z A;  5D79 A;  5I1W A;  3POP A;  4DNS A;  3FW8 A;  2Y3R A;  3FWA A;  5L6F A;  3FW7 A;  4PVE A;  2Y4G A;  2AXR A;  3HSU A; 
#chains in the Genus database with same CATH topology
 2VFR A;  2YVS A;  1N5W C;  1E8G A;  1N60 C;  3RJA A;  1JRO A;  1WYG A;  2PLI A;  4PWC A;  3S1F A;  3W8X A;  1E8F A;  3S1C A;  4BC7 A;  3S1E A;  5I1V A;  2WDW A;  4XLO A;  2W3R A;  4UD8 A;  5AWV A;  3TX1 A;  2VAO A;  1W1K A;  1WVF A;  1MBT A;  1E8H A;  4BC9 A;  3ETR B;  3LAE A;  1W1J A;  4PYT A;  2GQU A;  2OAI A;  3NVW B;  1N5X A;  3POP A;  1E0Y A;  1T3Q C;  3FWA A;  2VFU A;  4PVE A;  5AE3 A;  3NVZ B;  4HG0 A;  5HMR A;  5ADZ A;  3D2D A;  4PWB A;  3KJM A;  1QLU A;  3S1D A;  5FXD A;  2BVG A;  1N61 C;  2NQW A;  3EUB 3;  4MLA A;  1HSK A;  3B9J B;  2W3S A;  2IPI A;  3NS1 B;  5L6G A;  1W1O A;  2PLS A;  3RJ8 A;  4ML8 A;  4ZOH B;  1AHU A;  2Y08 A;  2UUU A;  1DII A;  3PQB A;  5G5H B;  2Y3S A;  3LLB A;  3VTE A;  1QLT A;  5HHZ A;  3DED A;  2Q85 A;  5AE2 A;  2Y4G A;  3C0P A;  1W1S A;  1DZN A;  3HSU A;  1F0X A;  3PM9 A;  4JB1 A;  1DIQ A;  4PVK A;  4EC3 A;  3D2J A;  5HQX A;  5K8E A;  1ZXI C;  3TSH A;  5G5G B;  4PZF A;  2UUV A;  5AE1 A;  3I99 A;  1W1M A;  3W8W A;  2P13 A;  2R2Z A;  4BBY A;  1UXY A;  2I0K A;  3NVY B;  4PVH A;  3TSJ A;  2W55 A;  3FW9 A;  3GSY A;  5FXF A;  2Q4W A;  1WVE A;  2P3H A;  4BCA A;  3AN1 A;  3NRZ B;  1MBB A;  1W1L A;  3AMZ A;  1SB3 B;  1VAO A;  1AHV A;  2QKN A;  2R8D A;  2W54 A;  4OAL A;  5FXE A;  3FW8 A;  2O3G A;  2Y3R A;  3FW7 A;  2P4P A;  1FFU C;  3BW7 A;  2AXR A;  1V97 A;  2E3T A;  3JS8 A;  2MBR A;  2BVH A;  3DQ0 A;  1ZR6 A;  3D2H A;  4JAY A;  1FIQ B;  1VDV A;  3AM9 A;  2BVF A;  1W1R A;  1JRP A;  2VFT A;  1N62 C;  2RK5 A;  3NVV B;  2GQT A;  2EXR A;  2VFS A;  4PVJ A;  1FFV C;  2QPM A;  3W8Z A;  5D79 A;  1I19 A;  2VFV A;  4O95 A;  3SR6 B;  5I1W A;  3HRD C;  1FO4 A;  1W1Q A;  4DNS A;  1N63 C;  5L6F A;  1RM6 B;  1AHZ A;  5FXP A; 
#chains in the Genus database with same CATH homology
 2VFR A;  2YVS A;  1N5W C;  1E8G A;  1N60 C;  3RJA A;  1JRO A;  1WYG A;  2PLI A;  4PWC A;  3S1F A;  3W8X A;  1E8F A;  3S1C A;  4BC7 A;  3S1E A;  5I1V A;  2WDW A;  4XLO A;  2W3R A;  4UD8 A;  5AWV A;  3TX1 A;  2VAO A;  1W1K A;  1WVF A;  1MBT A;  1E8H A;  4BC9 A;  3ETR B;  3LAE A;  1W1J A;  4PYT A;  2GQU A;  2OAI A;  3NVW B;  1N5X A;  3POP A;  1E0Y A;  1T3Q C;  3FWA A;  2VFU A;  4PVE A;  5AE3 A;  3NVZ B;  4HG0 A;  5HMR A;  5ADZ A;  3D2D A;  4PWB A;  3KJM A;  1QLU A;  3S1D A;  5FXD A;  2BVG A;  1N61 C;  2NQW A;  3EUB 3;  4MLA A;  1HSK A;  3B9J B;  2W3S A;  2IPI A;  3NS1 B;  5L6G A;  1W1O A;  2PLS A;  3RJ8 A;  4ML8 A;  4ZOH B;  1AHU A;  2Y08 A;  2UUU A;  1DII A;  3PQB A;  5G5H B;  2Y3S A;  3LLB A;  3VTE A;  1QLT A;  5HHZ A;  3DED A;  2Q85 A;  5AE2 A;  2Y4G A;  3C0P A;  1W1S A;  1DZN A;  3HSU A;  1F0X A;  3PM9 A;  4JB1 A;  1DIQ A;  4PVK A;  4EC3 A;  3D2J A;  5HQX A;  5K8E A;  1ZXI C;  3TSH A;  5G5G B;  4PZF A;  2UUV A;  5AE1 A;  3I99 A;  1W1M A;  3W8W A;  2P13 A;  2R2Z A;  4BBY A;  1UXY A;  2I0K A;  3NVY B;  4PVH A;  3TSJ A;  2W55 A;  3FW9 A;  3GSY A;  5FXF A;  2Q4W A;  1WVE A;  2P3H A;  4BCA A;  3AN1 A;  3NRZ B;  1MBB A;  1W1L A;  3AMZ A;  1SB3 B;  1VAO A;  1AHV A;  2QKN A;  2R8D A;  2W54 A;  4OAL A;  5FXE A;  3FW8 A;  2O3G A;  2Y3R A;  3FW7 A;  2P4P A;  1FFU C;  3BW7 A;  2AXR A;  1V97 A;  2E3T A;  3JS8 A;  2MBR A;  2BVH A;  3DQ0 A;  1ZR6 A;  3D2H A;  4JAY A;  1FIQ B;  1VDV A;  3AM9 A;  2BVF A;  1W1R A;  1JRP A;  2VFT A;  1N62 C;  2RK5 A;  3NVV B;  2GQT A;  2EXR A;  2VFS A;  4PVJ A;  1FFV C;  2QPM A;  3W8Z A;  5D79 A;  1I19 A;  2VFV A;  4O95 A;  3SR6 B;  5I1W A;  3HRD C;  1FO4 A;  1W1Q A;  4DNS A;  1N63 C;  5L6F A;  1RM6 B;  1AHZ A;  5FXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...