2Y4GA

Structure of the tirandamycin-bound fad-dependent tirandamycin oxidase taml in p212121 space group
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
500
structure length
500
Chain Sequence
MKHIDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEADVPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNPAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
molecule keywords TAML
total genus 159
structure length 500
sequence length 500
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y4gA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y4gA02
4PVEA 4PWCA 2AXRA 2WDWA 5L6FA 4PVJA 3W8XA 3POPA 3FWAA 2Y08A 4PZFA 4XLOA 3W8WA 4UD8A 3FW8A 5I1VA 4PWBA 3D2HA 2BVFA 5I1WA 5L6GA 1ZR6A 2Y3RA 3D2DA 3RJ8A 3FW7A 3D2JA 4PVKA 5D79A 4DNSA 2UUVA 3TSHA 3W8ZA 3PQBA 2BVGA 5AWVA 3GSYA 4PVHA 3TSJA 2Y3SA 3HSUA 3RJAA 2UUUA 5K8EA 3VTEA 3FW9A 2BVHA 4EC3A 2Y4GA 2IPIA
chains in the Genus database with same CATH superfamily
3W8XA 5AE1A 3EUB3 4PVJA 3NVWB 3FWAA 1HSKA 2W3RA 4UD8A 1E8HA 1MBBA 1AHUA 1T3QC 2PLIA 3JS8A 2R2ZA 3LAEA 2VFTA 2P4PA 1DIQA 1DZNA 2BVFA 1QLUA 5I1WA 1W1SA 1ZR6A 3D2DA 3C0PA 3RJ8A 4ML8A 5ADZA 1N5WC 3D2JA 2GQUA 1VAOA 2UUVA 4DNSA 2EXRA 3W8ZA 2QPMA 3PM9A 3NRZB 4PYTA 1E8GA 3RJAA 5K8EA 1RM6B 5FXPA 1W1LA 4PWCA 2AXRA 4PZFA 1QLTA 1FO4A 3FW8A 2VFVA 2YVSA 1AHVA 3TX1A 1VDVA 4BBYA 2E3TA 1F0XA 2P3HA 4PVKA 1WVEA 3AMZA 1FIQB 2BVGA 1W1KA 4HG0A 3HSUA 1N60C 2W3SA 2I0KA 2UUUA 1JRPA 1WYGA 2BVHA 3DQ0A 1WVFA 3FW9A 1E8FA 2Y4GA 2IPIA 3BW7A 5HQXA 1N62C 4PVEA 5G5HB 2WDWA 3POPA 4XLOA 2Y08A 5FXFA 3W8WA 4BC9A 3AM9A 1SB3B 3ETRB 3S1EA 3S1FA 3KJMA 1W1OA 5AE2A 2Y3RA 2Q85A 3NVZB 3S1CA 1UXYA 3I99A 1E0YA 4JAYA 4OALA 5D79A 2W54A 1W1RA 2RK5A 1AHZA 2QKNA 3LLBA 3TSHA 5HMRA 3PQBA 5AWVA 2NQWA 3GSYA 4PVHA 1FFUC 4JB1A 2Y3SA 2VFUA 3S1DA 1N61C 2R8DA 4BCAA 3HRDC 3VTEA 2OAIA 1MBTA 1JROA 2MBRA 2PLSA 5FXEA 5L6FA 3NVVB 5I1VA 3B9JB 4PWBA 2GQTA 2O3GA 3D2HA 5FXDA 1ZXIC 5G5GB 2VFSA 2VAOA 5L6GA 1W1MA 2VFRA 3SR6B 5HHZA 1N63C 2W55A 3FW7A 3NVYB 2P13A 4O95A 5AE3A 3DEDA 4MLAA 3AN1A 1FFVC 1I19A 1V97A 3TSJA 3NS1B 1W1JA 4ZOHB 1W1QA 4EC3A 2Q4WA 1DIIA 1N5XA 4BC7A
chains in the Genus database with same CATH topology
3W8XA 5AE1A 3EUB3 4PVJA 3NVWB 3FWAA 1HSKA 2W3RA 4UD8A 1E8HA 1MBBA 1AHUA 1T3QC 2PLIA 3JS8A 2R2ZA 3LAEA 2VFTA 2P4PA 1DIQA 1DZNA 2BVFA 1QLUA 5I1WA 1W1SA 1ZR6A 3D2DA 3C0PA 3RJ8A 4ML8A 5ADZA 1N5WC 3D2JA 2GQUA 1VAOA 2UUVA 4DNSA 2EXRA 3W8ZA 2QPMA 3PM9A 3NRZB 4PYTA 1E8GA 3RJAA 5K8EA 1RM6B 5FXPA 1W1LA 4PWCA 2AXRA 4PZFA 1QLTA 1FO4A 3FW8A 2VFVA 2YVSA 1AHVA 3TX1A 1VDVA 4BBYA 2E3TA 1F0XA 2P3HA 4PVKA 1WVEA 3AMZA 1FIQB 2BVGA 1W1KA 4HG0A 3HSUA 1N60C 2W3SA 2I0KA 2UUUA 1JRPA 1WYGA 2BVHA 3DQ0A 1WVFA 3FW9A 1E8FA 2Y4GA 2IPIA 3BW7A 5HQXA 1N62C 4PVEA 5G5HB 2WDWA 3POPA 4XLOA 2Y08A 5FXFA 3W8WA 4BC9A 3AM9A 1SB3B 3ETRB 3S1EA 3S1FA 3KJMA 1W1OA 5AE2A 2Y3RA 2Q85A 3NVZB 3S1CA 1UXYA 3I99A 1E0YA 4JAYA 4OALA 5D79A 2W54A 1W1RA 2RK5A 1AHZA 2QKNA 3LLBA 3TSHA 5HMRA 3PQBA 5AWVA 2NQWA 3GSYA 4PVHA 1FFUC 4JB1A 2Y3SA 2VFUA 3S1DA 1N61C 2R8DA 4BCAA 3HRDC 3VTEA 2OAIA 1MBTA 1JROA 2MBRA 2PLSA 5FXEA 5L6FA 3NVVB 5I1VA 3B9JB 4PWBA 2GQTA 2O3GA 3D2HA 5FXDA 1ZXIC 5G5GB 2VFSA 2VAOA 5L6GA 1W1MA 2VFRA 3SR6B 5HHZA 1N63C 2W55A 3FW7A 3NVYB 2P13A 4O95A 5AE3A 3DEDA 4MLAA 3AN1A 1FFVC 1I19A 1V97A 3TSJA 3NS1B 1W1JA 4ZOHB 1W1QA 4EC3A 2Q4WA 1DIIA 1N5XA 4BC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PVE A;  4PWC A;  2AXR A;  2WDW A;  5L6F A;  4PVJ A;  3W8X A;  3POP A;  3FWA A;  2Y08 A;  4PZF A;  4XLO A;  3W8W A;  4UD8 A;  3FW8 A;  5I1V A;  4PWB A;  3D2H A;  2BVF A;  5I1W A;  5L6G A;  1ZR6 A;  2Y3R A;  3D2D A;  3RJ8 A;  3FW7 A;  3D2J A;  4PVK A;  5D79 A;  4DNS A;  2UUV A;  3TSH A;  3W8Z A;  3PQB A;  2BVG A;  5AWV A;  3GSY A;  4PVH A;  3TSJ A;  2Y3S A;  3HSU A;  3RJA A;  2UUU A;  5K8E A;  3VTE A;  3FW9 A;  2BVH A;  4EC3 A;  2Y4G A;  2IPI A; 
#chains in the Genus database with same CATH topology
 3W8X A;  5AE1 A;  3EUB 3;  4PVJ A;  3NVW B;  3FWA A;  1HSK A;  2W3R A;  4UD8 A;  1E8H A;  1MBB A;  1AHU A;  1T3Q C;  2PLI A;  3JS8 A;  2R2Z A;  3LAE A;  2VFT A;  2P4P A;  1DIQ A;  1DZN A;  2BVF A;  1QLU A;  5I1W A;  1W1S A;  1ZR6 A;  3D2D A;  3C0P A;  3RJ8 A;  4ML8 A;  5ADZ A;  1N5W C;  3D2J A;  2GQU A;  1VAO A;  2UUV A;  4DNS A;  2EXR A;  3W8Z A;  2QPM A;  3PM9 A;  3NRZ B;  4PYT A;  1E8G A;  3RJA A;  5K8E A;  1RM6 B;  5FXP A;  1W1L A;  4PWC A;  2AXR A;  4PZF A;  1QLT A;  1FO4 A;  3FW8 A;  2VFV A;  2YVS A;  1AHV A;  3TX1 A;  1VDV A;  4BBY A;  2E3T A;  1F0X A;  2P3H A;  4PVK A;  1WVE A;  3AMZ A;  1FIQ B;  2BVG A;  1W1K A;  4HG0 A;  3HSU A;  1N60 C;  2W3S A;  2I0K A;  2UUU A;  1JRP A;  1WYG A;  2BVH A;  3DQ0 A;  1WVF A;  3FW9 A;  1E8F A;  2Y4G A;  2IPI A;  3BW7 A;  5HQX A;  1N62 C;  4PVE A;  5G5H B;  2WDW A;  3POP A;  4XLO A;  2Y08 A;  5FXF A;  3W8W A;  4BC9 A;  3AM9 A;  1SB3 B;  3ETR B;  3S1E A;  3S1F A;  3KJM A;  1W1O A;  5AE2 A;  2Y3R A;  2Q85 A;  3NVZ B;  3S1C A;  1UXY A;  3I99 A;  1E0Y A;  4JAY A;  4OAL A;  5D79 A;  2W54 A;  1W1R A;  2RK5 A;  1AHZ A;  2QKN A;  3LLB A;  3TSH A;  5HMR A;  3PQB A;  5AWV A;  2NQW A;  3GSY A;  4PVH A;  1FFU C;  4JB1 A;  2Y3S A;  2VFU A;  3S1D A;  1N61 C;  2R8D A;  4BCA A;  3HRD C;  3VTE A;  2OAI A;  1MBT A;  1JRO A;  2MBR A;  2PLS A;  5FXE A;  5L6F A;  3NVV B;  5I1V A;  3B9J B;  4PWB A;  2GQT A;  2O3G A;  3D2H A;  5FXD A;  1ZXI C;  5G5G B;  2VFS A;  2VAO A;  5L6G A;  1W1M A;  2VFR A;  3SR6 B;  5HHZ A;  1N63 C;  2W55 A;  3FW7 A;  3NVY B;  2P13 A;  4O95 A;  5AE3 A;  3DED A;  4MLA A;  3AN1 A;  1FFV C;  1I19 A;  1V97 A;  3TSJ A;  3NS1 B;  1W1J A;  4ZOH B;  1W1Q A;  4EC3 A;  2Q4W A;  1DII A;  1N5X A;  4BC7 A; 
#chains in the Genus database with same CATH homology
 3W8X A;  5AE1 A;  3EUB 3;  4PVJ A;  3NVW B;  3FWA A;  1HSK A;  2W3R A;  4UD8 A;  1E8H A;  1MBB A;  1AHU A;  1T3Q C;  2PLI A;  3JS8 A;  2R2Z A;  3LAE A;  2VFT A;  2P4P A;  1DIQ A;  1DZN A;  2BVF A;  1QLU A;  5I1W A;  1W1S A;  1ZR6 A;  3D2D A;  3C0P A;  3RJ8 A;  4ML8 A;  5ADZ A;  1N5W C;  3D2J A;  2GQU A;  1VAO A;  2UUV A;  4DNS A;  2EXR A;  3W8Z A;  2QPM A;  3PM9 A;  3NRZ B;  4PYT A;  1E8G A;  3RJA A;  5K8E A;  1RM6 B;  5FXP A;  1W1L A;  4PWC A;  2AXR A;  4PZF A;  1QLT A;  1FO4 A;  3FW8 A;  2VFV A;  2YVS A;  1AHV A;  3TX1 A;  1VDV A;  4BBY A;  2E3T A;  1F0X A;  2P3H A;  4PVK A;  1WVE A;  3AMZ A;  1FIQ B;  2BVG A;  1W1K A;  4HG0 A;  3HSU A;  1N60 C;  2W3S A;  2I0K A;  2UUU A;  1JRP A;  1WYG A;  2BVH A;  3DQ0 A;  1WVF A;  3FW9 A;  1E8F A;  2Y4G A;  2IPI A;  3BW7 A;  5HQX A;  1N62 C;  4PVE A;  5G5H B;  2WDW A;  3POP A;  4XLO A;  2Y08 A;  5FXF A;  3W8W A;  4BC9 A;  3AM9 A;  1SB3 B;  3ETR B;  3S1E A;  3S1F A;  3KJM A;  1W1O A;  5AE2 A;  2Y3R A;  2Q85 A;  3NVZ B;  3S1C A;  1UXY A;  3I99 A;  1E0Y A;  4JAY A;  4OAL A;  5D79 A;  2W54 A;  1W1R A;  2RK5 A;  1AHZ A;  2QKN A;  3LLB A;  3TSH A;  5HMR A;  3PQB A;  5AWV A;  2NQW A;  3GSY A;  4PVH A;  1FFU C;  4JB1 A;  2Y3S A;  2VFU A;  3S1D A;  1N61 C;  2R8D A;  4BCA A;  3HRD C;  3VTE A;  2OAI A;  1MBT A;  1JRO A;  2MBR A;  2PLS A;  5FXE A;  5L6F A;  3NVV B;  5I1V A;  3B9J B;  4PWB A;  2GQT A;  2O3G A;  3D2H A;  5FXD A;  1ZXI C;  5G5G B;  2VFS A;  2VAO A;  5L6G A;  1W1M A;  2VFR A;  3SR6 B;  5HHZ A;  1N63 C;  2W55 A;  3FW7 A;  3NVY B;  2P13 A;  4O95 A;  5AE3 A;  3DED A;  4MLA A;  3AN1 A;  1FFV C;  1I19 A;  1V97 A;  3TSJ A;  3NS1 B;  1W1J A;  4ZOH B;  1W1Q A;  4EC3 A;  2Q4W A;  1DII A;  1N5X A;  4BC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...