2Y54A

Fragment growing induces conformational changes in acetylcholine- binding protein: a structural and thermodynamic analysis - (fragment 1)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Fragment Growing Induces Conformational Changes in Acetylcholine-Binding Protein: A Structural and Thermodynamic Analysis.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 43
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2y54A00
5SYOA 3IGQA 2W8FA 2YMEA 5AFLA 5BW2A 5J5HA 3ZKRA 4HFCA 4IL4A 4NPPA 1I9BA 2X00A 3EHZA 4HFEA 3UQ7A 3WTHA 4ZR6A 3RQUA 3U8NA 4HFIA 2XNUA 4ZJSA 4Z91A 2XQ8A 4HFHA 5AFJA 3WIPA 5AFNA 4LMLA 2WN9A 2C9TA 5HEHA 4BFQA 4HFDA 4D01A 5J5GA 2YKSA 4ILBA 3U8LA 2BYRA 3UU4A 5J5FA 4HFBA 2XQ3A 2XYSA 4UM3P 3ZDGA 5BP0A 2XQ6A 4UY2A 4Z90A 3TLSA 4AFGA 4AFHA 2BG9C 5AFHA 3JAEA 5J0ZA 4ZZCA 2Y57A 4UM3S 2XNTA 4ZZBA 1UW6A 2Y7YA 2BYSA 2XQ4A 4ZK4A 2BYQA 3UU6A 3C79A 3RQWA 3WTJA 4EZ1A 3SQ6A 5CFBA 5L4HA 4ZRUA 5HEGA 3UU8A 2YMDA 3UQ4A 3EAMA 3C84A 3UUBA 2WNCA 2ZJUA 4A98A 2BYPA 4QH4A 4FRRA 3WTOA 2XNVA 4WV9A 3U8JA 5HEJA 2YN6A 4B5DA 3PMZA 4HQPA 4TWHA 2BR8A 2WNLA 5L47A 4LMJA 3SQ9A 3RHWA 2X00D 5HEUA 4ILAA 2YOEA 4X5TA 4AFTA 5LG3A 5AFKA 5FJVA 5BRXA 2WZYA 3WTIA 5LXBA 4ZK1A 4A97A 3SH1A 1UV6A 5TVCA 5CO5A 4COFA 2XZ5A 3WTLA 4QAAA 2BYNA 5L4EA 2XZ6A 4UXUA 3U8KA 5HEOA 2BJ0A 2XQAA 2BG9E 3SIOA 2PGZA 3P50A 4UM3A 5HCJA 3UU3A 3U8MA 2VL0A 4TWFA 3GUAA 4QH1A 4UM1A 4BQTA 4QH5A 3TLWA 2XQ5A 5J5IA 3EI0A 4ZJTA 4XK9A 2BR7A 3UU5A 2QC1B 3RIAA 3ZDHA 3JADA 2WNJA 2ZJVA 3PEOA 2BG9A 3WTKA 4F8HA 5HCMA 3TLTA 3WTNA 4ILCA 3LSVA 4TWDA 4NZBA 3JAFA 4XHEA 5JMEA 2W8GA 4IL9A 3RIFA 2BG9B 2Y56A 5KZUA 3P4WA 3RI5A 3TLUA 2XQ7A 4PIRA 3T4MA 2PH9A 3WTMA 5KE4A 5AFMA 2Y58A 4IREA 2XQ9A 4QACA 4TNVA 2Y54A 1UX2A 4ALXA 4DBMA 2UZ6A 5AINA 5IUXA 4LMKA 5AFMB 2XYTA 4TNWA 4QABA 3TLVA
chains in the Genus database with same CATH superfamily
5SYOA 3IGQA 2W8FA 2YMEA 5AFLA 5BW2A 5J5HA 3ZKRA 4HFCA 4IL4A 4NPPA 1I9BA 2X00A 3EHZA 4HFEA 3UQ7A 3WTHA 4ZR6A 3RQUA 3U8NA 4HFIA 2XNUA 4ZJSA 4Z91A 2XQ8A 4HFHA 5AFJA 3WIPA 5AFNA 4LMLA 2WN9A 2C9TA 5HEHA 4BFQA 4HFDA 4D01A 5J5GA 2YKSA 4ILBA 3U8LA 2BYRA 3UU4A 5J5FA 4HFBA 2XQ3A 2XYSA 4UM3P 3ZDGA 5BP0A 2XQ6A 4UY2A 4Z90A 3TLSA 4AFGA 4AFHA 2BG9C 5AFHA 3JAEA 5J0ZA 4ZZCA 2Y57A 4UM3S 2XNTA 4ZZBA 1UW6A 2Y7YA 2BYSA 2XQ4A 4ZK4A 2BYQA 3UU6A 3C79A 3RQWA 3WTJA 4EZ1A 3SQ6A 5CFBA 5L4HA 4ZRUA 5HEGA 3UU8A 2YMDA 3UQ4A 3EAMA 3C84A 3UUBA 2WNCA 2ZJUA 4A98A 2BYPA 4QH4A 4FRRA 3WTOA 2XNVA 4WV9A 3U8JA 5HEJA 2YN6A 4B5DA 3PMZA 4HQPA 4TWHA 2BR8A 2WNLA 5L47A 4LMJA 3SQ9A 3RHWA 2X00D 5HEUA 4ILAA 2YOEA 4X5TA 4AFTA 5LG3A 5AFKA 5FJVA 5BRXA 2WZYA 3WTIA 5LXBA 4ZK1A 4A97A 3SH1A 1UV6A 5TVCA 5CO5A 4COFA 2XZ5A 3WTLA 4QAAA 2BYNA 5L4EA 2XZ6A 4UXUA 3U8KA 5HEOA 2BJ0A 2XQAA 2BG9E 3SIOA 2PGZA 3P50A 4UM3A 5HCJA 3UU3A 3U8MA 2VL0A 4TWFA 3GUAA 4QH1A 4UM1A 4BQTA 4QH5A 3TLWA 2XQ5A 5J5IA 3EI0A 4ZJTA 4XK9A 2BR7A 3UU5A 2QC1B 3RIAA 3ZDHA 3JADA 2WNJA 2ZJVA 3PEOA 2BG9A 3WTKA 4F8HA 5HCMA 3TLTA 3WTNA 4ILCA 3LSVA 4TWDA 4NZBA 3JAFA 4XHEA 5JMEA 2W8GA 4IL9A 3RIFA 2BG9B 2Y56A 5KZUA 3P4WA 3RI5A 3TLUA 2XQ7A 4PIRA 3T4MA 2PH9A 3WTMA 5KE4A 5AFMA 2Y58A 4IREA 2XQ9A 4QACA 4TNVA 2Y54A 1UX2A 4ALXA 4DBMA 2UZ6A 5AINA 5IUXA 4LMKA 5AFMB 2XYTA 4TNWA 4QABA 3TLVA
chains in the Genus database with same CATH topology
5SYOA 3IGQA 2W8FA 2YMEA 5AFLA 5BW2A 5J5HA 3ZKRA 4HFCA 4IL4A 4NPPA 1I9BA 2X00A 3EHZA 4HFEA 3UQ7A 3WTHA 4ZR6A 3RQUA 3U8NA 4HFIA 2XNUA 4ZJSA 4Z91A 2XQ8A 4HFHA 5AFJA 3WIPA 5AFNA 4LMLA 2WN9A 2C9TA 5HEHA 4BFQA 4HFDA 4D01A 5J5GA 2YKSA 4ILBA 3U8LA 2BYRA 3UU4A 5J5FA 4HFBA 2XQ3A 2XYSA 4UM3P 3ZDGA 5BP0A 2XQ6A 4UY2A 4Z90A 3TLSA 4AFGA 4AFHA 2BG9C 5AFHA 3JAEA 5J0ZA 4ZZCA 2Y57A 4UM3S 2XNTA 4ZZBA 1UW6A 2Y7YA 2BYSA 2XQ4A 4ZK4A 2BYQA 3UU6A 3C79A 3RQWA 3WTJA 4EZ1A 3SQ6A 5CFBA 5L4HA 4ZRUA 5HEGA 3UU8A 2YMDA 3UQ4A 3EAMA 3C84A 3UUBA 2WNCA 2ZJUA 4A98A 2BYPA 4QH4A 4FRRA 3WTOA 2XNVA 4WV9A 3U8JA 5HEJA 2YN6A 4B5DA 3PMZA 4HQPA 4TWHA 2BR8A 2WNLA 5L47A 4LMJA 3SQ9A 3RHWA 2X00D 5HEUA 4ILAA 2YOEA 4X5TA 4AFTA 5LG3A 5AFKA 5FJVA 5BRXA 2WZYA 3WTIA 5LXBA 4ZK1A 4A97A 3SH1A 1UV6A 5TVCA 5CO5A 4COFA 2XZ5A 3WTLA 4QAAA 2BYNA 5L4EA 2XZ6A 4UXUA 3U8KA 5HEOA 2BJ0A 2XQAA 2BG9E 3SIOA 2PGZA 3P50A 4UM3A 5HCJA 3UU3A 3U8MA 2VL0A 4TWFA 3GUAA 4QH1A 4UM1A 4BQTA 4QH5A 3TLWA 2XQ5A 5J5IA 3EI0A 4ZJTA 4XK9A 2BR7A 3UU5A 2QC1B 3RIAA 3ZDHA 3JADA 2WNJA 2ZJVA 3PEOA 2BG9A 3WTKA 4F8HA 5HCMA 3TLTA 3WTNA 4ILCA 3LSVA 4TWDA 4NZBA 3JAFA 4XHEA 5JMEA 2W8GA 4IL9A 3RIFA 2BG9B 2Y56A 5KZUA 3P4WA 3RI5A 3TLUA 2XQ7A 4PIRA 3T4MA 2PH9A 3WTMA 5KE4A 5AFMA 2Y58A 4IREA 2XQ9A 4QACA 4TNVA 2Y54A 1UX2A 4ALXA 4DBMA 2UZ6A 5AINA 5IUXA 4LMKA 5AFMB 2XYTA 4TNWA 4QABA 3TLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SYO A;  3IGQ A;  2W8F A;  2YME A;  5AFL A;  5BW2 A;  5J5H A;  3ZKR A;  4HFC A;  4IL4 A;  4NPP A;  1I9B A;  2X00 A;  3EHZ A;  4HFE A;  3UQ7 A;  3WTH A;  4ZR6 A;  3RQU A;  3U8N A;  4HFI A;  2XNU A;  4ZJS A;  4Z91 A;  2XQ8 A;  4HFH A;  5AFJ A;  3WIP A;  5AFN A;  4LML A;  2WN9 A;  2C9T A;  5HEH A;  4BFQ A;  4HFD A;  4D01 A;  5J5G A;  2YKS A;  4ILB A;  3U8L A;  2BYR A;  3UU4 A;  5J5F A;  4HFB A;  2XQ3 A;  2XYS A;  4UM3 P;  3ZDG A;  5BP0 A;  2XQ6 A;  4UY2 A;  4Z90 A;  3TLS A;  4AFG A;  4AFH A;  2BG9 C;  5AFH A;  3JAE A;  5J0Z A;  4ZZC A;  2Y57 A;  4UM3 S;  2XNT A;  4ZZB A;  1UW6 A;  2Y7Y A;  2BYS A;  2XQ4 A;  4ZK4 A;  2BYQ A;  3UU6 A;  3C79 A;  3RQW A;  3WTJ A;  4EZ1 A;  3SQ6 A;  5CFB A;  5L4H A;  4ZRU A;  5HEG A;  3UU8 A;  2YMD A;  3UQ4 A;  3EAM A;  3C84 A;  3UUB A;  2WNC A;  2ZJU A;  4A98 A;  2BYP A;  4QH4 A;  4FRR A;  3WTO A;  2XNV A;  4WV9 A;  3U8J A;  5HEJ A;  2YN6 A;  4B5D A;  3PMZ A;  4HQP A;  4TWH A;  2BR8 A;  2WNL A;  5L47 A;  4LMJ A;  3SQ9 A;  3RHW A;  2X00 D;  5HEU A;  4ILA A;  2YOE A;  4X5T A;  4AFT A;  5LG3 A;  5AFK A;  5FJV A;  5BRX A;  2WZY A;  3WTI A;  5LXB A;  4ZK1 A;  4A97 A;  3SH1 A;  1UV6 A;  5TVC A;  5CO5 A;  4COF A;  2XZ5 A;  3WTL A;  4QAA A;  2BYN A;  5L4E A;  2XZ6 A;  4UXU A;  3U8K A;  5HEO A;  2BJ0 A;  2XQA A;  2BG9 E;  3SIO A;  2PGZ A;  3P50 A;  4UM3 A;  5HCJ A;  3UU3 A;  3U8M A;  2VL0 A;  4TWF A;  3GUA A;  4QH1 A;  4UM1 A;  4BQT A;  4QH5 A;  3TLW A;  2XQ5 A;  5J5I A;  3EI0 A;  4ZJT A;  4XK9 A;  2BR7 A;  3UU5 A;  2QC1 B;  3RIA A;  3ZDH A;  3JAD A;  2WNJ A;  2ZJV A;  3PEO A;  2BG9 A;  3WTK A;  4F8H A;  5HCM A;  3TLT A;  3WTN A;  4ILC A;  3LSV A;  4TWD A;  4NZB A;  3JAF A;  4XHE A;  5JME A;  2W8G A;  4IL9 A;  3RIF A;  2BG9 B;  2Y56 A;  5KZU A;  3P4W A;  3RI5 A;  3TLU A;  2XQ7 A;  4PIR A;  3T4M A;  2PH9 A;  3WTM A;  5KE4 A;  5AFM A;  2Y58 A;  4IRE A;  2XQ9 A;  4QAC A;  4TNV A;  2Y54 A;  1UX2 A;  4ALX A;  4DBM A;  2UZ6 A;  5AIN A;  5IUX A;  4LMK A;  5AFM B;  2XYT A;  4TNW A;  4QAB A;  3TLV A; 
#chains in the Genus database with same CATH topology
 5SYO A;  3IGQ A;  2W8F A;  2YME A;  5AFL A;  5BW2 A;  5J5H A;  3ZKR A;  4HFC A;  4IL4 A;  4NPP A;  1I9B A;  2X00 A;  3EHZ A;  4HFE A;  3UQ7 A;  3WTH A;  4ZR6 A;  3RQU A;  3U8N A;  4HFI A;  2XNU A;  4ZJS A;  4Z91 A;  2XQ8 A;  4HFH A;  5AFJ A;  3WIP A;  5AFN A;  4LML A;  2WN9 A;  2C9T A;  5HEH A;  4BFQ A;  4HFD A;  4D01 A;  5J5G A;  2YKS A;  4ILB A;  3U8L A;  2BYR A;  3UU4 A;  5J5F A;  4HFB A;  2XQ3 A;  2XYS A;  4UM3 P;  3ZDG A;  5BP0 A;  2XQ6 A;  4UY2 A;  4Z90 A;  3TLS A;  4AFG A;  4AFH A;  2BG9 C;  5AFH A;  3JAE A;  5J0Z A;  4ZZC A;  2Y57 A;  4UM3 S;  2XNT A;  4ZZB A;  1UW6 A;  2Y7Y A;  2BYS A;  2XQ4 A;  4ZK4 A;  2BYQ A;  3UU6 A;  3C79 A;  3RQW A;  3WTJ A;  4EZ1 A;  3SQ6 A;  5CFB A;  5L4H A;  4ZRU A;  5HEG A;  3UU8 A;  2YMD A;  3UQ4 A;  3EAM A;  3C84 A;  3UUB A;  2WNC A;  2ZJU A;  4A98 A;  2BYP A;  4QH4 A;  4FRR A;  3WTO A;  2XNV A;  4WV9 A;  3U8J A;  5HEJ A;  2YN6 A;  4B5D A;  3PMZ A;  4HQP A;  4TWH A;  2BR8 A;  2WNL A;  5L47 A;  4LMJ A;  3SQ9 A;  3RHW A;  2X00 D;  5HEU A;  4ILA A;  2YOE A;  4X5T A;  4AFT A;  5LG3 A;  5AFK A;  5FJV A;  5BRX A;  2WZY A;  3WTI A;  5LXB A;  4ZK1 A;  4A97 A;  3SH1 A;  1UV6 A;  5TVC A;  5CO5 A;  4COF A;  2XZ5 A;  3WTL A;  4QAA A;  2BYN A;  5L4E A;  2XZ6 A;  4UXU A;  3U8K A;  5HEO A;  2BJ0 A;  2XQA A;  2BG9 E;  3SIO A;  2PGZ A;  3P50 A;  4UM3 A;  5HCJ A;  3UU3 A;  3U8M A;  2VL0 A;  4TWF A;  3GUA A;  4QH1 A;  4UM1 A;  4BQT A;  4QH5 A;  3TLW A;  2XQ5 A;  5J5I A;  3EI0 A;  4ZJT A;  4XK9 A;  2BR7 A;  3UU5 A;  2QC1 B;  3RIA A;  3ZDH A;  3JAD A;  2WNJ A;  2ZJV A;  3PEO A;  2BG9 A;  3WTK A;  4F8H A;  5HCM A;  3TLT A;  3WTN A;  4ILC A;  3LSV A;  4TWD A;  4NZB A;  3JAF A;  4XHE A;  5JME A;  2W8G A;  4IL9 A;  3RIF A;  2BG9 B;  2Y56 A;  5KZU A;  3P4W A;  3RI5 A;  3TLU A;  2XQ7 A;  4PIR A;  3T4M A;  2PH9 A;  3WTM A;  5KE4 A;  5AFM A;  2Y58 A;  4IRE A;  2XQ9 A;  4QAC A;  4TNV A;  2Y54 A;  1UX2 A;  4ALX A;  4DBM A;  2UZ6 A;  5AIN A;  5IUX A;  4LMK A;  5AFM B;  2XYT A;  4TNW A;  4QAB A;  3TLV A; 
#chains in the Genus database with same CATH homology
 5SYO A;  3IGQ A;  2W8F A;  2YME A;  5AFL A;  5BW2 A;  5J5H A;  3ZKR A;  4HFC A;  4IL4 A;  4NPP A;  1I9B A;  2X00 A;  3EHZ A;  4HFE A;  3UQ7 A;  3WTH A;  4ZR6 A;  3RQU A;  3U8N A;  4HFI A;  2XNU A;  4ZJS A;  4Z91 A;  2XQ8 A;  4HFH A;  5AFJ A;  3WIP A;  5AFN A;  4LML A;  2WN9 A;  2C9T A;  5HEH A;  4BFQ A;  4HFD A;  4D01 A;  5J5G A;  2YKS A;  4ILB A;  3U8L A;  2BYR A;  3UU4 A;  5J5F A;  4HFB A;  2XQ3 A;  2XYS A;  4UM3 P;  3ZDG A;  5BP0 A;  2XQ6 A;  4UY2 A;  4Z90 A;  3TLS A;  4AFG A;  4AFH A;  2BG9 C;  5AFH A;  3JAE A;  5J0Z A;  4ZZC A;  2Y57 A;  4UM3 S;  2XNT A;  4ZZB A;  1UW6 A;  2Y7Y A;  2BYS A;  2XQ4 A;  4ZK4 A;  2BYQ A;  3UU6 A;  3C79 A;  3RQW A;  3WTJ A;  4EZ1 A;  3SQ6 A;  5CFB A;  5L4H A;  4ZRU A;  5HEG A;  3UU8 A;  2YMD A;  3UQ4 A;  3EAM A;  3C84 A;  3UUB A;  2WNC A;  2ZJU A;  4A98 A;  2BYP A;  4QH4 A;  4FRR A;  3WTO A;  2XNV A;  4WV9 A;  3U8J A;  5HEJ A;  2YN6 A;  4B5D A;  3PMZ A;  4HQP A;  4TWH A;  2BR8 A;  2WNL A;  5L47 A;  4LMJ A;  3SQ9 A;  3RHW A;  2X00 D;  5HEU A;  4ILA A;  2YOE A;  4X5T A;  4AFT A;  5LG3 A;  5AFK A;  5FJV A;  5BRX A;  2WZY A;  3WTI A;  5LXB A;  4ZK1 A;  4A97 A;  3SH1 A;  1UV6 A;  5TVC A;  5CO5 A;  4COF A;  2XZ5 A;  3WTL A;  4QAA A;  2BYN A;  5L4E A;  2XZ6 A;  4UXU A;  3U8K A;  5HEO A;  2BJ0 A;  2XQA A;  2BG9 E;  3SIO A;  2PGZ A;  3P50 A;  4UM3 A;  5HCJ A;  3UU3 A;  3U8M A;  2VL0 A;  4TWF A;  3GUA A;  4QH1 A;  4UM1 A;  4BQT A;  4QH5 A;  3TLW A;  2XQ5 A;  5J5I A;  3EI0 A;  4ZJT A;  4XK9 A;  2BR7 A;  3UU5 A;  2QC1 B;  3RIA A;  3ZDH A;  3JAD A;  2WNJ A;  2ZJV A;  3PEO A;  2BG9 A;  3WTK A;  4F8H A;  5HCM A;  3TLT A;  3WTN A;  4ILC A;  3LSV A;  4TWD A;  4NZB A;  3JAF A;  4XHE A;  5JME A;  2W8G A;  4IL9 A;  3RIF A;  2BG9 B;  2Y56 A;  5KZU A;  3P4W A;  3RI5 A;  3TLU A;  2XQ7 A;  4PIR A;  3T4M A;  2PH9 A;  3WTM A;  5KE4 A;  5AFM A;  2Y58 A;  4IRE A;  2XQ9 A;  4QAC A;  4TNV A;  2Y54 A;  1UX2 A;  4ALX A;  4DBM A;  2UZ6 A;  5AIN A;  5IUX A;  4LMK A;  5AFM B;  2XYT A;  4TNW A;  4QAB A;  3TLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...