2Y5CA

Structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
SDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Functional Studies on Human Mitochondrial Ferredoxins
rcsb
source organism Homo sapiens
molecule tags Electron transport
molecule keywords ADRENODOXIN-LIKE PROTEIN, MITOCHONDRIAL
total genus 29
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2y5cA00
3SR6A 1JWAD 1WGKA 4N6EB 1T3QA 4JX1C 3VRBB 1JRPA 1NEKB 3AH7A 1OQQA 1E7PB 3HRDD 1J7BA 1DOIA 2E3TA 4YTNB 4ITKA 2OHFA 1FRRA 1L6VA 2JQRB 2WDVB 1E10A 2LEKA 3NVVA 3AM9A 5C2TB 1DGJA 2JX5A 3CWIA 1SF0A 1YJIA 2W54A 4WWMA 3P4PB 3AEEB 3RPFC 4US8A 2ACZB 1FRDA 3AE3B 4WQMA 1PDXA 2FBWB 3NVWA 4KX6B 1VDVA 1N5XA 3NS1A 2M56B 1N63A 4US9A 3KWLA 1YQ4B 1VJKA 1TJEA 3AE6B 3AEAB 1CJEA 3VR8B 4N59A 2WDQB 3PO0A 4C7ZA 1JALA 2WLBA 1ZUD2 3P63A 2MH7A 4YXDB 3HUIA 3P1MA 1NI3A 2WQYB 1A70A 1E9MA 1KFYB 2PVOD 3AE4B 5H8YE 2M19A 4YTPB 1E0ZA 1SB3C 1L6UA 5G5HA 3AE9B 4JWSC 3B9JA 1TKGA 2K22A 1J7CA 1NVID 5G5GA 5C3JB 3FAHA 4USAA 1JW9D 2W3SA 1L0VB 3L4PA 4YSXB 4ZHPA 4C80A 1GPXA 1XO3A 4P6VF 3AEBB 3FC4A 3LXFA 2KAJA 1AWDA 1ZP0B 1PFDA 1N60A 3AEGB 3LB8C 4LTUA 5EE9A 2EKIA 1JWBD 1OFFA 2K5PA 2QIEB 2WU2B 3AE2B 1B9RA 1XLNA 1WXQA 3AEFB 5EE3A 1QF6A 1EWYC 1FXIA 3AE8B 1R7SA 1YQ3B 1GAQB 1JROA 1RYJA 4A9AA 2G1EA 1QOGA 3SFEB 1FIQA 2BT6A 3AV8A 3ZYYX 1VLBA 1WWTA 2KMMA 3BIID 2W3RA 3AEDB 1XLOA 1ROEA 4ZOHC 4YSYB 1QOBA 4HRSA 1KRHA 2AX5A 3VRAB 1DOXA 2BS3B 1WYGA 4JWUC 2N0SB 1AYFA 3WCQA 2MJ3A 1YJJA 4N58A 1NENB 1RM6C 1RFKA 5H92C 3EUB2 3AE1B 1FFVA 2BS4B 1SIJA 3AE5B 3NVYA 1TKEA 2W55A 2DBYA 3P4QB 5AUIA 2L83A 1DOYA 2QJLA 3W5UB 2WP9B 4YTMB 1QOAA 1OQRA 1RWSA 1I7HA 1WRIA 1ZOYB 3HVZA 3B2GA 2PKOA 1FFUA 2B76B 1QOFA 1F0ZA 2H88B 3CIRB 4FXCA 2PVGC 1FXAA 2K9XA 3P4SB 1V97A 3DWMA 3VR9B 5MPOA 1TYGB 1XLPA 4HROA 1FO4A 1TKYA 3AB5A 2MJEA 1CZPA 2CJNA 1N61A 4IDIA 4YSZB 1N5WA 1L5PA 1KF6B 2CU3A 3AECB 3AMZA 5EE1A 3DWGC 1XLQA 1E6EB 3B2FA 3ETRA 1QLBB 1ZXIA 3P4RB 1QT9A 2HTME 2CJOA 3W9CB 1V8CA 5EE0A 1FM0D 1NYQA 3W5VB 2WDRB 2MJDA 2Y5CA 2PIAA 2BS2B 2DWQA 1PUTA 1J7AA 2L52A 4C7YA 2H89B 1N62A 2Q5WD 2WS3B 1FMAD 1IUEA 3SFDB 3AE7B 1UWMA 3NVZA 3ABVB 5AUKA 1JQ4A 3NRZA 4ZHOA 5GXGB 2WU5B 1NYRA 3AN1A 4YT0B
chains in the Genus database with same CATH superfamily
3AU4A 3RNBC 3PREA 1Y8RC 4KDIC 1WGHA 5JHBA 1UF0A 2K8HA 3M95A 1V86A 4OW0A 3NVWA 4W9DA 5IN7A 4LNIA 4QAYA 5L95C 2EMSA 2V9HA 2K8CA 3AEAB 2FUHB 4OZCA 1ZUD2 1SSNA 1IP9A 1BXTA 5G5HA 4ICVA 3P42A 3VDZA 1J0GA 3PS6A 4USAA 2FUG1 3UQAA 1V49A 1UGJA 4L23A 5D2MB 2KDIA 3IBEA 2DHZA 2NS5A 2PTLA 2J0KA 3KW5B 4EZJA 3BVZA 2IO2B 3IHPC 1HE8A 1ZDXA 2M17A 3QIJA 1PFDA 2KN4A 2K0PA 3BY4B 1XLNA 2GMIC 5LNK1 4KKJA 4B9KA 1VLBA 1V5OA 2KWVB 3RULA 1WWTA 3ZIMA 4DHZB 3AEDB 1TS3A 1LM8B 1SE4A 1GC6A 1WYGA 2IO1B 5AZFA 2N0SB 1WGYA 4EE2A 1RM6C 2BTEA 1YOVB 4I6PA 2JRIB 3U4EG 3NVYA 4CQNA 3VUWA 2G4DB 3W5UB 2WP9B 3KYDD 5T8IA 1I7HA 3B2GA 2B76B 2KYWA 1QOFA 2LGXA 2AQ3B 2LI5A 3RD2A 4FLHA 1KLUD 4JQWC 4GMVA 4PK1A 2W9NA 4W9KA 3ZRFA 2A5UA 4IWQA 3P4RB 1VRAB 2Y3AA 4LCDE 1TZ1A 3EC8A 5AZGA 1YN4A 2WXLA 3P2BA 1EF5A 3ZKJC 3ZTCA 4M0WA 3AN1A 5D6JB 2C7NB 3SDLC 1OQQA 3ALBA 3QAQA 3A4RA 4A20A 2INCC 4WWMA 1KLGD 3T3NA 1VD2A 2WWZA 3RNFC 3UF8A 4NAMA 4WH4A 1Z2MA 4LNOA 1L6UA 1NVID 1F1HA 2KVRA 3TEWA 1WRDB 4TQ0A 2DAJA 1GPXA 4CO7A 4DXGA 2EKIA 2BQQA 5D94A 1BMLC 2UYZB 3IAM1 4GSWA 4BZAA 1R7SA 3SD5A 2O6VA 1UZXB 1OTRB 2WXHA 3T3OA 3BIID 2W3RA 2MW5A 4K81A 4J6IA 4C56C 3RFZB 2KJHB 1WI0A 3CSTA 3KQ4A 4YTMB 1SBBB 5HG2A 1RWSA 4GB9A 2Z8LA 4KKIA 3H7PB 1F0ZA 2PVGC 5JHAA 1QQRA 3VFKA 2MJEA 1CZPA 5L83A 2FCMA 4J3OD 2KTFA 4ZYNA 1MJDA 2KLGA 3APDA 3Q8CA 1QT9A 1STEA 1ET9A 1SE2A 2WXMA 4E74A 4FN2A 2D07B 2WS3B 3SFDB 3VUXA 2KK8A 4YT0B 3U2SC 1WGKA 4N6EB 3TEYA 2VZKD 1MHHE 3NZ3A 2L0FA 2IY0B 3ZTDA 1Q0WB 2E3TA 4ITKA 2IGGA 2WDVB 3WALA 3CWIA 1SF0A 2W54A 3FILA 2ACZB 4KDLB 4REZA 3KVFB 2KWCA 3Q69A 3PZDA 4US9A 2INDC 3TUOA 3P1MA 4R3DA 1A70A 1KFYB 5D7GA 1FPYA 5LXHA 1E0ZA 3TBLD 1XD3B 4DHJD 3WA0A 1HA5A 1WXSA 2V0GA 1TY2A 4ANUA 4NAWA 3T9LA 4KGTA 3LB8C 3N3KB 2ZVOA 2WXKA 2JYTA 3AE2B 3AEFB 1GAQB 3ZO5B 4FADA 2KQ7A 3I57A 2QMTA 3Q3NC 1FEHA 2GBRA 2V3PA 4GDKB 2I1JA 5IO9A 2ICIA 4BKTA 3EUB2 4FJZA 2D10A 4A3PA 2CS4A 2DYMA 2QJLA 4A90A 1TIFA 3NS8A 3AU5A 4MDKE 1E7UA 1U4AA 3J9CA 2MHJA 3VR9B 4E3CA 3DWMA 5MPOA 2W82A 2JVCA 2LGYA 3KH0A 1LGRA 3KUZA 1QZEA 1JRUA 3H7PA 1C1YB 4P1BC 3SHQA 4XWWA 1PGBA 2M4NA 4ANWA 1TGZB 4II2B 4C7YA 1JWMD 4MEMA 2AQ2B 1XEEA 2N1WA 5FK9C 3NVZA 1WJ4A 3NRZA 2WGSA 2I1KA 4PS8A 3EFUA 2LUEA 4NJ7A 4MH8A 4XC2A 3Q14C 2CR5A 1SGHA 2KVZA 2HJ8A 4ZRPA 2NTTA 2FBWB 2JXTA 4IWOA 2PJHA 3X0WA 3V3XA 2D3BA 3SU8X 1UBIA 1GOZA 3AE6B 3IVFA 3WAOA 2WDQB 3PO0A 2IYDB 4C7ZA 2WLBA 2K1FA 4AJYB 5BO4B 4KV2A 4ACFA 2M19A 2IGDA 2RPVA 3KUCB 3TSSA 3IT4B 2BB5A 2KDMA 4HJGE 1GJZA 1EF1A 1D5XC 2D3CA 2ZJDA 2BWFA 3QC8B 5HHDG 2DAFA 2RDBC 1EWYC 3M3JA 2LGIA 3NG0A 3E9SA 4PYZA 3VTVA 2IZVB 1RFAA 1UH6A 3Q8AA 2DZKA 3NZUA 1XLOA 3BYTB 2IJ0A 4JWUC 2E6XA 4GGQA 1UD7A 4A55A 4OVUA 1C79A 1ENFA 2NBVB 3UINB 3M62B 2KNBA 5G2NA 1EU4A 2GBKA 2LMCA 4BOZB 3KWVA 3P4SB 1XLPA 2Y5PA 4LJOB 4IDIA 1EWCA 2CJNA 1WE7A 1D6EC 4B6WA 3DBRI 3ETRA 1R4NI 4JLCA 3UI3A 2D3AA 4AUQC 1PUTA 3U52E 1N62A 2Q5WD 3MHZA 1YNTE 3ZJUA 1ET6A 1WFYA 1EU3A 2CU1A 2N9LA 3PZ7A 2AL6A 3VTUA 3W1SA 1JRPA 4B95A 2ASQA 5EDSA 4GU2A 3QHTA 2LEKA 4XE0A 5C2TB 3R7QA 1V6EA 1FCCC 1YJIA 4HKQA 3Q6BA 3KYCD 1VDVA 2I2YA 4HLEA 2N1VA 3KLSX 4DK5A 3Q8BA 1JALA 3P63A 2KMAA 2MQJA 1UELA 1M4VA 3AE9B 1WIAA 1J7CA 4O1NA 2D3GA 3B0AA 1L0VB 4ZRQA 3LXFA 4D2KA 4E71A 1ZP0B 4AJWA 1JCKB 5CHFA 5EE9A 3V62A 3VUYA 2ZVNA 1JROA 4P7IA 1E8ZA 2MP2B 2NPTA 2JZZA 2BT6A 1Q1OA 3RNAC 4EUTA 1I35A 2K8BA 3OLMD 1I4QA 3UIPB 4YSYB 3IG3A 3DVNV 2WXRA 4PS3A 3VRAB 5CHVC 1HQRD 3WAPA 4ZRKA 1Q5WB 2J0MA 2MJ3A 2N7EA 3W1YA 5IP4D 4DXFA 2ZZPB 3ZW3A 2W55A 2DBYA 4S0RA 5AUIA 3L10B 2JWZA 3M63B 3AULA 1ZOYB 2FCQA 3PLVA 4RNAA 4MSMB 2EKEC 3I5JC 2LZ6A 1C76A 3VQIA 1C78A 3TJPA 3ZNHB 2K6DB 1KF6B 2NTSA 1XLQA 3N9YC 3ZVVA 3DDCB 3W5VB 1UUPA 2PIAA 3PRMB 1ISNA 4WWNA 4OZAA 5KHOA 2BVCA 3U8ZA 1KM7A 3CMMB 4W9LA 4NZLB 2EELA 4EZKA 2KZRA 1J7BA 2BF8B 3DHIC 1L6VA 1E10A 4N9F4 2KDFB 1WXAA 4KX6B 3EECA 3GZNI 3ECIA 4TV3A 4N59A 1VZ6A 2O6VD 3HVDA 1VCBA 2WQYB 3VTWA 1WJUA 1EM7A 4IW0A 3Q3FA 1UNSA 2CHWA 4AOFA 1ZXHA 2N9PC 2BGFA 5C23A 2R2OA 1QF6A 1RYJA 4K7WA 4M02A 5DPTA 1TS2A 1ZE3D 4GXBA 2DLBA 4JGHB 3R8BA 1CK1A 3VVWB 1KTKA 5J2RA 1UBQA 2XK5A 2KWDA 2JPHA 1YJJA 2NPTB 3N32A 2Z59B 4B0MA 2JYEA 2QHOA 5IOIA 3BINA 2KFJA 4WJQA 1K51A 1FFUA 4FXCA 3JW0X 1PGXA 1WMHA 3BZDB 1TYGB 4IC7B 1WE6A 3AECB 3ZJTA 3PTFC 1SJHD 2QC8A 5CX3A 4MGYE 2KT7A 2GBNA 3TIXA 4PT5A 3RNCC 1I4GA 4M01A 2FE8A 4NQLB 4OZBA 4RCOA 4K3BA 5GXGB 2NMQA 2LJIA 3SR6A 2V3NA 4KGSA 4G50A 5GMVA 4WWPA 3RZWC 3BYYB 1E7PB 3UIOB 4BFRA 3X23A 3DBHI 3NVVA 2O2VB 4ANXA 1SJED 4NAWB 1FRDA 2PE6B 3EA6A 4ASWC 1X1MA 4HWIB 4KZ0A 4FA6A 2M56B 1PGAA 1R4NB 2VH2A 2JZ3B 5E6OA 2K39A 4XWTA 3EFCA 1OEYJ 4ZHPA 3A4SC 3VHTC 1TTNA 1XO3A 1H4RA 4P6VF 3JSVA 4K3CA 1OFFA 2QIEB 2M8SA 5JZEB 3U7ZA 1MPEA 1L4DB 3JYUA 1I4XA 4ZYSA 3AV8A 2LGDA 1GUAB 4BBNC 2RD0A 1VR9A 3VAWA 3N30A 1HTQA 1WZ3A 3PHWB 3W1SC 3R66C 4DHZE 3H6NA 4NQKE 2DYBA 2V4LA 3DCGA 2AEHA 3L16A 2KFKB 5HFYA 1WRIA 4XZ4A 1SE9A 2XNAC 2IPKD 3APCA 1BUIC 3AXCA 2JT4B 5CHWA 2KD0A 4DHJB 2QSDA 2C7MB 1EO6A 3AMZA 4TUUA 4HPPA 4A6QA 3B2FA 4XDCA 3ML9A 4JIOU 5EE0A 2LRWA 3SEBA 2KQSA 2L52A 4MGKE 2QILA 1FMAD 3GOEA 1UWMA 4KSLC 2GRIA 4LJPB 2V4IB 2LASA 4ZRJA 1NEKB 3AH7A 3HRDD 4IOIE 1C4AA 1FRRA 3WIMA 1WGDA 3NOBA 3BK2A 3RUIB 2L05A 2LRUA 1WYWB 2CHZA 4TMAB 3NZSA 4C4VB 1YQ4B 3VR8B 4F7ZA 3HUIA 1XXGA 1NI3A 2DZJA 2ZNVB 1SB3C 3RPFC 3CSFA 3B9JA 4RMAA 3V6CB 4IM2A 4P16A 4MM3B 2MBEA 3FC4A 1L7YA 2C5LC 5FKAC 3DPDA 1JWBD 2YEPF 1L2NA 4M8MA 5LXIB 4FJYA 4NNJB 3L17A 2G1EA 2WX0A 3HHMA 2BKRB 2AYOB 4RGTA 2L76A 2KWUB 2KX3A 3B1LX 1Q10A 3WCQA 2BWES 4HDOA 2BYEA 1HTOA 4UDUC 2HDEA 1D5MC 1TKEA 2AL3A 4TSSA 1KOTA 4KIKB 1QOAA 2Z0DB 2KLCA 4M8NA 2OOBB 2C60A 4G3XB 2CU3A 1B1ZA 4ICUA 1V1OA 2KTRB 2MJDA 2Y5CA 3FKYA 3GE3C 1NI2A 2MP2A 1CQVA 2BW2A 1JWUD 3UGBB 2WNMA 3PT2B 1JWAD 5BYSA 4HDQA 5C1ZA 2YEPB 2V1YA 3N1XC 1P9DU 1VZ8A 1MHXA 1DGJA 3AM9A 4JPSA 2BBCA 2WXIA 1AW7A 1HXYD 3A9KB 2TSSA 2C7HA 2MX2A 3ONSA 2NR2A 1IGDA 2FNJB 5JH5C 1C3TA 1LQBA 4FHKA 3ZRCA 2JUOA 3L4PA 2KO3A 2ON8A 1ACCA 4WAAA 5DCNA 1WXQA 3L0WB 4MJSB 4A9AA 1QOGA 3H9DA 3LYYA 4FBJB 5HKHA 5FR6A 1ROEA 4ZOHC 2PPHA 1DOXA 4W9FA 2I38A 1F52A 2SEBD 1C4PA 3NUHB 2JU6X 4P1CC 1FXTB 3AE1B 1SIJA 1YJ1A 2LXAA 4W9CA 3ZUNA 1C4CA 2KACA 2LWPA 3I9V1 4L1BA 4HCPB 3MJWA 5AEKB 3ZNZB 4RGMA 3R7RA 1IYFA 1LXDA 1F9JA 1L5PA 3PRPB 4KIKA 4MGIE 1E8XA 2KQ4X 2MWSB 3MFGA 2MCNB 5D3IB 3A1QB 5DPSA 1LFDA 1L0XB 2DWQA 1J7AA 2HTHA 3Q3JA 2H89B 2VRRB 5AUKA 3ABVB 2IDYA 2GBJA 4ZDVA 1T3QA 3VRBB 4HPLB 1RAXA 2VZKB 1DOIA 1T6BX 2OHFA 2O6VB 1WGRA 4GN1A 1K50A 4DQOC 1BT0A 3QA8A 3RN9C 2ZCCA 4LDTD 2BPSA 4DDID 1M94A 4YTPB 1V5TA 3Q8FA 1TKGA 2PE9A 4WAFA 3A9KA 2XK5B 2V3SA 4X57B 1N60A 5E6PA 2KX0A 4IM3A 3BK1A 4HVBA 3OJ3A 1WJNA 3B08A 4S17A 1WMHB 1QOBA 1P0RA 2L00B 1YX6B 3ZGZA 1YX5B 4DWFA 4RH6A 1NENB 3URYA 2DZMA 1RFKA 5J18A 3W2DA 4EZLA 3Q8EA 3MJ5A 1TZOA 4JL9A 2RMMA 4W9HA 3RI7C 4FJVB 2PKOA 3C0RB 2CHXA 3FILB 1FNVA 2KC2A 2FAZA 3DBHB 3QK0A 1PQSA 3ZXRA 5TR5A 2J4XA 2A4ZA 2JWUA 3DWGC 2KMCA 1C9FA 1WXVA 3HIZA 2O2VA 2CJOA 2MBOA 2N7JA 1GB4A 1YIWA 2BKFA 1RLFA 2YVCA 1IUEA 2LVQA 2IO0B 2RGFA 3L13A 1P3QU 3PZ8A 3U30A 2WXPA 1P98A 5G55A 3OAWA 4YTNB 2JQRB 2KANA 2J53A 2KN5A 1E90A 3DVGX 2JX5A 1TT5B 2LUMA 3ZNGC 3AE3B 2KFKA 2JSVX 3V61A 3EGRA 4IM0A 2L7RA 4YXDB 2MH7A 1WH3A 1YQBA 2WXFA 2PVOD 1IBXB 2MSED 2C9WB 3ZLZA 2N7DA 4MGZE 2BB6A 4GDLA 3OJ4B 2WXNA 3PSEB 2L32A 3DBLB 4HCNB 2OJWA 4W9GA 1FIQA 5BMIA 3DBRB 2KMMA 2HJ1A 2MRPA 3R2TA 3CF6E 5DPRA 2BS4B 3AE5B 2ZPNA 1AARA 2DYOA 3VXWA 2D11A 4K7UA 4I6LB 2H88B 1D5ZC 1FNUA 4BOSC 3DHGC 3ML8A 4MM3A 5D3DA 5AZHA 5I4DA 4W9IA 4CHKA 1QKZA 2L3ZA 1KJTA 2HTME 3W9CB 1V8CA 4IUMB 1FM0D 2N4FA 4LLGM 4II3B 4WWOA 1E7VA 2N9XA 1IGCA 1SEBD 1WY8A 1JQ4A 4MACA 3TEXA 3LJ3A 5IA7A 4GLSC 4A8XC 3APFA 3ZXVA 1CMXB 4FHJA 4GOCA 2X8XX 4US8A 2NCNA 3QX1A 4W9EA 4JE3B 1RRBA 1Z5SB 2WXGA 4OVVA 2LJ5A 4CYEA 3V6EB 1VJKA 1TY0A 4NJCA 3BWUD 2G45B 5H8YE 3AE4B 3PV1A 2LHEA 3DVNU 1D3ZA 1JW9D 4MELA 4YSXB 1G6JA 3QARA 2ONQA 2ZW1A 1T0SC 2Z0EB 3AEGB 3MC0B 4HXDA 3MHSD 4DBGA 1IBXA 1ZKHA 1KLVA 2JXXA 1FXIA 2RPQA 5BMHA 4IWPA 1WXMA 2GOWA 3Q3OC 4L2YA 4TKNA 4AQ7A 4GDLB 2MEKA 2BS3B 3TMPB 1J8CA 1AYFA 3DBSA 5H92C 1MG8A 2KTRA 2DNFA 2L1AA 2PEAA 1FCLA 3P4QB 4RM9A 4BAXA 3HM6X 4PYUA 2DZIA 2EMTA 4LNFA 5FR3A 1WM2A 2KJRA 3RCZA 4C00A 1JWSD 1TKYA 4YSZB 4F8CB 4OVZA 5EE1A 3MP9A 1D4BA 4KZCA 1S3SG 2LXCA 4AS1A 1JMLA 2AQ1B 4KSKC 4DDGD 2B3AA 4MJSA 3PRZA 1P7EA 4K7SA 3I63C 2IBIB 4ZHOA 4LDTB 2RDGA 4NPNA 2LVPA 2L8JA 3NHEB 1UWXA 2D5GA 2J52A 1K8RB 2DX5B 3IT6B 3GE8C 2REXA 2MLBA 3QQ8B 2G3QB 3MTNB 1S1QB 2MBHA 3GS2A 2XEWA 4KGRA 1E9MA 1P7FA 2JY6A 3ZDTA 4BBNF 4XX5A 2K22A 1R4MB 4IKGA 4WJNA 3QCAA 5IKCM 1WZ0A 4LNNA 3ENEA 2L0TA 2J7QB 2G9HD 2KAJA 3D32A 1R4MI 2MBBB 3GB1A 2WU2B 4W9JA 4ARIA 3GZNB 3QWZB 3VH3B 3JVZX 2AX5A 4GIVA 3C8YA 3BVMA 2M1MA 1KH0A 4URKA 3RZFA 2BYVE 4KVGB 3K9OB 2XBBC 2OJRA 3A1QA 1H8CA 1E5WA 2L83A 3T8MA 1WX7A 2AWTA 4WURA 3UQBA 2KHWB 1WSPA 1XCQL 2RDHA 1V2YA 2K9XA 4ZRIA 3TCAA 3VH4B 4HROA 5E6JA 3NY5A 2UWQA 3TL5A 2CKHB 3H1UA 2QDFA 2KOXA 1OGWA 3R2IA 1E6EB 1F2RI 3O65B 1NYQA 2WDRB 3RT3B 1L4ZB 3KUDB 1HEZE 3WAMA 1WJ6A 1DYQA 2IGHA 1ZPSA 2KDEB 2MA9B 3HK0A 1ZDVA 1HZ6A 4EEWA 2WDTB 4RGOS 2FIDA 4WQMA 1ESFA 4AP4C 1MI0A 2SAKA 5BMGA 4H2AA 1N63A 2R61A 4I6NB 4PS7A 2NBUA 1TJEA 1Y56A 3IAS1 2GLSA 2W3SA 3EHVA 2N9EB 2INNE 2R2QA 4EFOA 2LHDA 2HE7A 2K5PA 5EE3A 3LDZE 3AE8B 1XT9B 5E6NA 1WX8A 2M0XA 3ZYYX 4M0WB 4XGAB 2INPE 3A9JB 2KC1A 3DOWA 5TSSA 3AI5A 3H8HA 3PLUA 2JZPA 4K1RB 4G11A 4N58A 1VZ7A 1OQYA 4BVUC 4RF0A 4F1SA 4OHJA 1WX9A 1GNUA 3DHHC 2OEDA 3C19A 4Q2JA 3L08A 4B0EA 3HVZA 1T0QC 3PVLA 1E8YA 1GC7A 2WXOA 1UGMA 1J19A 1FO4A 5DPWA 2K25A 1N61A 4G0NB 1F77A 4AWJA 1QLBB 1ZXIA 2PMVA 2ZCBA 2LFIA 5BYQA 2UU7A 4RF1A 2IY1B 1TBEA 3HM3A 3U7DA 2WU5B 1B9RA 3L54A 3RNEC 3QJZA 4HJKA 1V81A 4YWGG 3N20C 3AEEB 2Y5BB 2M0AA 2FCSA 2FIFA 3N1ZC 3DBLI 2GBMA 3NS1A 2ZPYA 3ZJVA 3KWLA 2RR9A 1NBFC 2K6QA 1WM3A 3V05A 3ZNID 2ZNVC 4A3OA 2XN9C 2X38A 2LVOA 4JWSC 5G5GA 2QEJC 2J42A 1V1PA 3OWEB 1EUVB 4RM8A 4LTUA 2HD5B 4TQ1A 2KDBA 3MC9A 1I42A 1XCTL 2WXJA 2FCNA 4BKSD 3O13A 2K3UA 3WANA 3N1YC 4WIPA 5KHQA 1MFWA 4HRSA 2GB1A 1LO5D 4NJ6A 4WJPA 3Q2AC 3ZDMC 2RSUA 1F2RC 1YMHE 1V80A 1C77A 3PPAA 1FFVA 1N6ZA 4MT5A 3A9JA 1YN3A 4LK0M 2LGSA 3IXSA 1TS4A 3BVGA 1K53A 4LNKA 5J17A 3JSVB 1FXAA 2NVUI 4C4VA 4GDKA 3PHXB 3DQVA 4BKGA 1WR1A 2JF5A 1XQQA 5BYRA 2BS2B 4HPMB 3AE7B 2MBQA 4HKZE 1SE3A 1T5XD 1GG3A 4JX1C 3K9PB 2ZW0A 2QCZA 5HI1A 4WJOA 2DENB 1I4HA 3Q3MC 2KJ6A 1MVKA 2KKCA 3R3MA 3H7SA 3P4PB 3GP7A 4HEA1 1OEYA 1FNWA 3RYTA 1QILA 1PDXA 2WXQA 4FULA 1YD8U 1N5XA 1HZ5A 4RFBA 1K52A 2G4SA 3ZQ4A 1CJEA 4DXAB 1FD6A 3PGEA 3RNGC 4EKUA 4EOYA 2ZEQA 1WF9A 5C3JB 4WQOB 4IG7B 2GI9A 3FAHA 4ANVA 2JRHA 3OG5A 3E56A 3TEZA 1IPGA 4C80A 3MC8A 3AEBB 1AWDA 1SIFA 4BKSA 2VH1A 3NJTA 1L0YB 1I4PA 2PLPA 3DVGY 1YQ3B 5LLIA 2YLMA 4MSQB 1V1PB 2NBWB 2LD9A 4HK2A 3RMKC 1PYWD 3S2AA 2WHIA 2IO3B 1ZGUB 4XYCA 1T0RC 4RGNA 1KRHA 1SXTA 2BYTA 5JXVA 1P1AA 2WYQA 1TS5A 4ARCA 3I3TB 1XF5L 2WX1A 1MG4A 1I4RA 1V9JA 4M00A 2PW9A 1ZW7A 1DOYA 3IFWB 1T0YA 2N9KA 1OQRA 5IAAC 2BYFA 3V60A 1E8WA 3CIRB 1WR6E 2KXJA 3A33B 1V97A 3AB5A 4MH0E 1A5RA 1N5WA 5CTRC 4YL8A 1AN8A 2J0JA 4NY0A 4XDDA 1YN5A 2D2QA 1GB1A 1WGGA 1NDDA 1NYRA 3SFEB
chains in the Genus database with same CATH topology
2WNMA 3PZ7A 1JWAD 5BYSA 3W1SA 1JRPA 1UWXA 2D5GA 2YEPB 2J52A 2LEKA 1VZ8A 3AM9A 1MHXA 1DGJA 4XE0A 5C2TB 1FCCC 1YJIA 3IT6B 4HKQA 4JPSA 2BBCA 2WXIA 4OW0A 1AW7A 3NVWA 1HXYD 1VDVA 2I2YA 2TSSA 3KLSX 3GS2A 3AEAB 4OZCA 3Q8BA 1JALA 1ZUD2 3P63A 1SSNA 1IGDA 4KGRA 1BXTA 1E9MA 1P7FA 5G5HA 1M4VA 3AE9B 2K22A 3P42A 1J7CA 4O1NA 4USAA 2FUG1 4IKGA 1UGJA 4L23A 1L0VB 3L4PA 2PTLA 2ON8A 3BVZA 4ZRQA 3LXFA 4D2KA 2G9HD 2KAJA 1ZDXA 1ZP0B 1JCKB 1PFDA 5EE9A 2KN4A 3GB1A 2WU2B 1ACCA 2K0PA 1XLNA 1WXQA 4ARIA 1JROA 5LNK1 4A9AA 1QOGA 3LYYA 4KKJA 2BT6A 1VLBA 1WWTA 3AEDB 1I4QA 1ROEA 4ZOHC 4YSYB 1TS3A 2WXRA 1SE4A 2AX5A 3VRAB 1DOXA 3C8YA 2I38A 1HQRD 1WYGA 3BVMA 2N0SB 1C4PA 2SEBD 3NUHB 1KH0A 2JU6X 2MJ3A 4EE2A 1RM6C 2BTEA 3AE1B 4DXFA 1SIJA 3U4EG 3NVYA 4CQNA 2W55A 2DBYA 5AUIA 2L83A 3W5UB 2WP9B 5T8IA 1I7HA 1C4CA 1ZOYB 3B2GA 4WURA 2B76B 4RNAA 2KACA 3I9V1 1QOFA 4L1BA 1WSPA 1XCQL 1C76A 2AQ3B 2RDHA 2K9XA 4RGMA 4HROA 5E6JA 3VQIA 1C78A 1KLUD 1L5PA 1KF6B 2NTSA 3R2IA 1XLQA 1E6EB 3N9YC 1F2RI 2KQ4X 3MFGA 3P4RB 5D3IB 1VRAB 2Y3AA 1L0XB 1NYQA 1UUPA 2WDRB 3W5VB 2PIAA 2DWQA 1L4ZB 1J7AA 1HEZE 2H89B 1YN4A 2WXLA 4OZAA 5AUKA 3ABVB 2IDYA 4M0WA 3AN1A 1T3QA 3VRBB 1DYQA 2IGHA 1ZPSA 4NZLB 2EELA 1OQQA 1J7BA 2VZKB 1DOIA 1T6BX 1ZDVA 1L6VA 2OHFA 1HZ6A 1E10A 1K50A 4DQOC 4WWMA 1KLGD 4RGOS 4WQMA 3T3NA 1ESFA 4KX6B 1MI0A 2SAKA 5BMGA 4H2AA 1N63A 2R61A 1TJEA 4N59A 1VZ6A 4NAMA 3HVDA 1Y56A 4WH4A 2WQYB 4YTPB 1L6UA 1EM7A 3Q8FA 1TKGA 3IAS1 1NVID 1UNSA 4WAFA 3TEWA 2W3SA 4TQ0A 1GPXA 1ZXHA 2INNE 2LHDA 1N60A 4DXGA 2EKIA 1BMLC 2K5PA 5EE3A 1QF6A 3IAM1 3AE8B 1R7SA 3BK1A 1RYJA 1TS2A 1ZE3D 2WXHA 2DLBA 3R8BA 3ZYYX 1CK1A 2INPE 3T3OA 3BIID 2W3RA 1KTKA 5TSSA 1QOBA 3H8HA 2JZPA 3ZGZA 4RH6A 2KWDA 1YJJA 4N58A 1NENB 4C56C 3RFZB 1VZ7A 3URYA 1RFKA 3W2DA 4RF0A 4OHJA 3Q8EA 4B0MA 2JYEA 3MJ5A 1TZOA 3KQ4A 2RMMA 2OEDA 4Q2JA 4YTMB 1SBBB 5HG2A 1RWSA 1K51A 2Z8LA 4B0EA 3HVZA 2PKOA 1FFUA 4KKIA 2WXOA 3FILB 1FNVA 1F0ZA 4FXCA 2PVGC 1PGXA 1QQRA 3BZDB 1TYGB 1FO4A 2MJEA 1CZPA 1N61A 2J4XA 3AECB 3ZJTA 2JWUA 3DWGC 4J3OD 1SJHD 1F77A 1C9FA 1QLBB 1ZXIA 3Q8CA 1QT9A 2CJOA 2N7JA 2PMVA 1STEA 1ET9A 1GB4A 2LFIA 4PT5A 5BYQA 1I4GA 2FE8A 1SE2A 2WXMA 4OZBA 4RCOA 4RF1A 2WS3B 1IUEA 3SFDB 5GXGB 2NMQA 2WU5B 2LJIA 4YT0B 3U2SC 1B9RA 3SR6A 1WGKA 2V3NA 3PZ8A 4N6EB 4KGSA 3TEYA 2VZKD 1MHHE 2WXPA 3NZ3A 3BYYB 1E7PB 4YWGG 4YTNB 2E3TA 4ITKA 2IGGA 2WDVB 2JQRB 2J53A 3NVVA 2JX5A 3CWIA 1SF0A 2W54A 3AEEB 1SJED 3FILA 2ACZB 2LUMA 4NAWB 1FRDA 2M0AA 3AE3B 3EA6A 4REZA 3Q69A 3NS1A 2JSVX 2M56B 4US9A 3ZJVA 1PGAA 3EGRA 3KWLA 3TUOA 3V05A 4YXDB 2MH7A 3P1MA 4R3DA 2XN9C 1A70A 1KFYB 2WXFA 2PVOD 2X38A 5D7GA 1IBXB 1E0ZA 4JWSC 5G5GA 2QEJC 4XWTA 1HA5A 2J42A 2V0GA 1TY2A 4ZHPA 1V1PA 1XO3A 4P6VF 3OWEB 4KGTA 2BB6A 3LB8C 4LTUA 2WXKA 1OFFA 2JYTA 2QIEB 2WXNA 3AE2B 2L32A 3AEFB 3U7ZA 1MPEA 1L4DB 1GAQB 4TQ1A 1XCTL 2WXJA 1I4XA 1FIQA 3I57A 4ZYSA 3AV8A 2QMTA 5BMIA 3O13A 2K3UA 1VR9A 2KMMA 1FEHA 4WIPA 2V3PA 4HRSA 2GB1A 1LO5D 4GDKB 1F2RC 3R2TA 2ICIA 1YMHE 1C77A 3EUB2 1FFVA 2BS4B 4MT5A 3AE5B 2DYOA 1YN3A 4LK0M 5HFYA 2DYMA 2QJLA 4A90A 3IXSA 1WRIA 1TS4A 3BVGA 2XNAC 2IPKD 1K53A 3J9CA 1BUIC 2H88B 1D5ZC 1FXAA 3VR9B 1FNUA 3DWMA 5MPOA 2W82A 2QSDA 5D3DA 3AMZA 5I4DA 1QKZA 4A6QA 3B2FA 4XDCA 2HTME 3W9CB 1V8CA 4XWWA 5EE0A 1PGBA 1FM0D 3SEBA 5BYRA 4LLGM 2BS2B 2L52A 4C7YA 1JWMD 2QILA 2AQ2B 1XEEA 1FMAD 1IGCA 1SEBD 3AE7B 1UWMA 3NVZA 4MACA 5FK9C 1JQ4A 3NRZA 3TEXA 2GRIA 2V4IB 4HKZE 1SE3A 1T5XD 4JX1C 4GLSC 1NEKB 2ZW0A 3AH7A 4MH8A 5HI1A 4A8XC 3HRDD 1I4HA 4IOIE 1C4AA 1FRRA 1MVKA 3BK2A 3GP7A 3P4PB 4HEA1 1FNWA 4US8A 4TMAB 1QILA 4ZRPA 1PDXA 2NTTA 2FBWB 2JXTA 2WXQA 4JE3B 2WXGA 1N5XA 1HZ5A 4RFBA 3V3XA 1K52A 3ZQ4A 1YQ4B 1GOZA 1VJKA 3AE6B 3VR8B 1CJEA 1TY0A 1FD6A 2WDQB 3PO0A 4C7ZA 2WLBA 4NJCA 3BWUD 3HUIA 1XXGA 1NI3A 5H8YE 3AE4B 2M19A 1SB3C 2IGDA 3RPFC 5C3JB 3B9JA 2RPVA 2LHEA 3TSSA 2GI9A 3FAHA 3IT4B 2BB5A 1JW9D 2KDMA 3E56A 3TEZA 4YSXB 4P16A 4MM3B 4C80A 3AEBB 3FC4A 2ONQA 2ZW1A 4HJGE 1AWDA 5FKAC 1D5XC 3AEGB 3MC0B 1IBXA 1JWBD 5HHDG 1L0YB 2YEPF 1I4PA 2PLPA 1EWYC 1FXIA 1YQ3B 2LGIA 2G1EA 1V1PB 3E9SA 5BMHA 3Q8AA 1PYWD 4RGTA 4L2YA 1XLOA 4AQ7A 4GDLB 4RGNA 1KRHA 3BYTB 2MEKA 2IJ0A 2BS3B 4JWUC 1SXTA 1AYFA 1Q10A 2BYTA 3WCQA 2E6XA 5JXVA 1TS5A 4ARCA 5H92C 1XF5L 2L1AA 4UDUC 1FCLA 2HDEA 4A55A 1I4RA 2PW9A 1D5MC 1TKEA 3P4QB 1C79A 1ENFA 1DOYA 4TSSA 1QOAA 1OQRA 2N9KA 5FR3A 1EU4A 2LMCA 3KWVA 3CIRB 3P4SB 1V97A 1JWSD 1XLPA 2Y5PA 1TKYA 3AB5A 4IDIA 1EWCA 2CJNA 4YSZB 1D6EC 1N5WA 4OVZA 2CU3A 5EE1A 1B1ZA 3MP9A 1AN8A 4XDDA 1V1OA 1YN5A 1D4BA 3ETRA 1GB1A 3UI3A 4AS1A 1JMLA 2AQ1B 2MJDA 2Y5CA 1PUTA 3U52E 1N62A 1CQVA 2Q5WD 3MHZA 1P7EA 1YNTE 3ZJUA 1ET6A 1EU3A 4ZHOA 2BW2A 1JWUD 1NYRA 2RDGA 3SFEB 2N9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SR6 A;  1JWA D;  1WGK A;  4N6E B;  1T3Q A;  4JX1 C;  3VRB B;  1JRP A;  1NEK B;  3AH7 A;  1OQQ A;  1E7P B;  3HRD D;  1J7B A;  1DOI A;  2E3T A;  4YTN B;  4ITK A;  2OHF A;  1FRR A;  1L6V A;  2JQR B;  2WDV B;  1E10 A;  2LEK A;  3NVV A;  3AM9 A;  5C2T B;  1DGJ A;  2JX5 A;  3CWI A;  1SF0 A;  1YJI A;  2W54 A;  4WWM A;  3P4P B;  3AEE B;  3RPF C;  4US8 A;  2ACZ B;  1FRD A;  3AE3 B;  4WQM A;  1PDX A;  2FBW B;  3NVW A;  4KX6 B;  1VDV A;  1N5X A;  3NS1 A;  2M56 B;  1N63 A;  4US9 A;  3KWL A;  1YQ4 B;  1VJK A;  1TJE A;  3AE6 B;  3AEA B;  1CJE A;  3VR8 B;  4N59 A;  2WDQ B;  3PO0 A;  4C7Z A;  1JAL A;  2WLB A;  1ZUD 2;  3P63 A;  2MH7 A;  4YXD B;  3HUI A;  3P1M A;  1NI3 A;  2WQY B;  1A70 A;  1E9M A;  1KFY B;  2PVO D;  3AE4 B;  5H8Y E;  2M19 A;  4YTP B;  1E0Z A;  1SB3 C;  1L6U A;  5G5H A;  3AE9 B;  4JWS C;  3B9J A;  1TKG A;  2K22 A;  1J7C A;  1NVI D;  5G5G A;  5C3J B;  3FAH A;  4USA A;  1JW9 D;  2W3S A;  1L0V B;  3L4P A;  4YSX B;  4ZHP A;  4C80 A;  1GPX A;  1XO3 A;  4P6V F;  3AEB B;  3FC4 A;  3LXF A;  2KAJ A;  1AWD A;  1ZP0 B;  1PFD A;  1N60 A;  3AEG B;  3LB8 C;  4LTU A;  5EE9 A;  2EKI A;  1JWB D;  1OFF A;  2K5P A;  2QIE B;  2WU2 B;  3AE2 B;  1B9R A;  1XLN A;  1WXQ A;  3AEF B;  5EE3 A;  1QF6 A;  1EWY C;  1FXI A;  3AE8 B;  1R7S A;  1YQ3 B;  1GAQ B;  1JRO A;  1RYJ A;  4A9A A;  2G1E A;  1QOG A;  3SFE B;  1FIQ A;  2BT6 A;  3AV8 A;  3ZYY X;  1VLB A;  1WWT A;  2KMM A;  3BII D;  2W3R A;  3AED B;  1XLO A;  1ROE A;  4ZOH C;  4YSY B;  1QOB A;  4HRS A;  1KRH A;  2AX5 A;  3VRA B;  1DOX A;  2BS3 B;  1WYG A;  4JWU C;  2N0S B;  1AYF A;  3WCQ A;  2MJ3 A;  1YJJ A;  4N58 A;  1NEN B;  1RM6 C;  1RFK A;  5H92 C;  3EUB 2;  3AE1 B;  1FFV A;  2BS4 B;  1SIJ A;  3AE5 B;  3NVY A;  1TKE A;  2W55 A;  2DBY A;  3P4Q B;  5AUI A;  2L83 A;  1DOY A;  2QJL A;  3W5U B;  2WP9 B;  4YTM B;  1QOA A;  1OQR A;  1RWS A;  1I7H A;  1WRI A;  1ZOY B;  3HVZ A;  3B2G A;  2PKO A;  1FFU A;  2B76 B;  1QOF A;  1F0Z A;  2H88 B;  3CIR B;  4FXC A;  2PVG C;  1FXA A;  2K9X A;  3P4S B;  1V97 A;  3DWM A;  3VR9 B;  5MPO A;  1TYG B;  1XLP A;  4HRO A;  1FO4 A;  1TKY A;  3AB5 A;  2MJE A;  1CZP A;  2CJN A;  1N61 A;  4IDI A;  4YSZ B;  1N5W A;  1L5P A;  1KF6 B;  2CU3 A;  3AEC B;  3AMZ A;  5EE1 A;  3DWG C;  1XLQ A;  1E6E B;  3B2F A;  3ETR A;  1QLB B;  1ZXI A;  3P4R B;  1QT9 A;  2HTM E;  2CJO A;  3W9C B;  1V8C A;  5EE0 A;  1FM0 D;  1NYQ A;  3W5V B;  2WDR B;  2MJD A;  2Y5C A;  2PIA A;  2BS2 B;  2DWQ A;  1PUT A;  1J7A A;  2L52 A;  4C7Y A;  2H89 B;  1N62 A;  2Q5W D;  2WS3 B;  1FMA D;  1IUE A;  3SFD B;  3AE7 B;  1UWM A;  3NVZ A;  3ABV B;  5AUK A;  1JQ4 A;  3NRZ A;  4ZHO A;  5GXG B;  2WU5 B;  1NYR A;  3AN1 A;  4YT0 B; 
#chains in the Genus database with same CATH topology
 3AU4 A;  3RNB C;  3PRE A;  1Y8R C;  4KDI C;  1WGH A;  5JHB A;  1UF0 A;  2K8H A;  3M95 A;  1V86 A;  4OW0 A;  3NVW A;  4W9D A;  5IN7 A;  4LNI A;  4QAY A;  5L95 C;  2EMS A;  2V9H A;  2K8C A;  3AEA B;  2FUH B;  4OZC A;  1ZUD 2;  1SSN A;  1IP9 A;  1BXT A;  5G5H A;  4ICV A;  3P42 A;  3VDZ A;  1J0G A;  3PS6 A;  4USA A;  2FUG 1;  3UQA A;  1V49 A;  1UGJ A;  4L23 A;  5D2M B;  2KDI A;  3IBE A;  2DHZ A;  2NS5 A;  2PTL A;  2J0K A;  3KW5 B;  4EZJ A;  3BVZ A;  2IO2 B;  3IHP C;  1HE8 A;  1ZDX A;  2M17 A;  3QIJ A;  1PFD A;  2KN4 A;  2K0P A;  3BY4 B;  1XLN A;  2GMI C;  5LNK 1;  4KKJ A;  4B9K A;  1VLB A;  1V5O A;  2KWV B;  3RUL A;  1WWT A;  3ZIM A;  4DHZ B;  3AED B;  1TS3 A;  1LM8 B;  1SE4 A;  1GC6 A;  1WYG A;  2IO1 B;  5AZF A;  2N0S B;  1WGY A;  4EE2 A;  1RM6 C;  2BTE A;  1YOV B;  4I6P A;  2JRI B;  3U4E G;  3NVY A;  4CQN A;  3VUW A;  2G4D B;  3W5U B;  2WP9 B;  3KYD D;  5T8I A;  1I7H A;  3B2G A;  2B76 B;  2KYW A;  1QOF A;  2LGX A;  2AQ3 B;  2LI5 A;  3RD2 A;  4FLH A;  1KLU D;  4JQW C;  4GMV A;  4PK1 A;  2W9N A;  4W9K A;  3ZRF A;  2A5U A;  4IWQ A;  3P4R B;  1VRA B;  2Y3A A;  4LCD E;  1TZ1 A;  3EC8 A;  5AZG A;  1YN4 A;  2WXL A;  3P2B A;  1EF5 A;  3ZKJ C;  3ZTC A;  4M0W A;  3AN1 A;  5D6J B;  2C7N B;  3SDL C;  1OQQ A;  3ALB A;  3QAQ A;  3A4R A;  4A20 A;  2INC C;  4WWM A;  1KLG D;  3T3N A;  1VD2 A;  2WWZ A;  3RNF C;  3UF8 A;  4NAM A;  4WH4 A;  1Z2M A;  4LNO A;  1L6U A;  1NVI D;  1F1H A;  2KVR A;  3TEW A;  1WRD B;  4TQ0 A;  2DAJ A;  1GPX A;  4CO7 A;  4DXG A;  2EKI A;  2BQQ A;  5D94 A;  1BML C;  2UYZ B;  3IAM 1;  4GSW A;  4BZA A;  1R7S A;  3SD5 A;  2O6V A;  1UZX B;  1OTR B;  2WXH A;  3T3O A;  3BII D;  2W3R A;  2MW5 A;  4K81 A;  4J6I A;  4C56 C;  3RFZ B;  2KJH B;  1WI0 A;  3CST A;  3KQ4 A;  4YTM B;  1SBB B;  5HG2 A;  1RWS A;  4GB9 A;  2Z8L A;  4KKI A;  3H7P B;  1F0Z A;  2PVG C;  5JHA A;  1QQR A;  3VFK A;  2MJE A;  1CZP A;  5L83 A;  2FCM A;  4J3O D;  2KTF A;  4ZYN A;  1MJD A;  2KLG A;  3APD A;  3Q8C A;  1QT9 A;  1STE A;  1ET9 A;  1SE2 A;  2WXM A;  4E74 A;  4FN2 A;  2D07 B;  2WS3 B;  3SFD B;  3VUX A;  2KK8 A;  4YT0 B;  3U2S C;  1WGK A;  4N6E B;  3TEY A;  2VZK D;  1MHH E;  3NZ3 A;  2L0F A;  2IY0 B;  3ZTD A;  1Q0W B;  2E3T A;  4ITK A;  2IGG A;  2WDV B;  3WAL A;  3CWI A;  1SF0 A;  2W54 A;  3FIL A;  2ACZ B;  4KDL B;  4REZ A;  3KVF B;  2KWC A;  3Q69 A;  3PZD A;  4US9 A;  2IND C;  3TUO A;  3P1M A;  4R3D A;  1A70 A;  1KFY B;  5D7G A;  1FPY A;  5LXH A;  1E0Z A;  3TBL D;  1XD3 B;  4DHJ D;  3WA0 A;  1HA5 A;  1WXS A;  2V0G A;  1TY2 A;  4ANU A;  4NAW A;  3T9L A;  4KGT A;  3LB8 C;  3N3K B;  2ZVO A;  2WXK A;  2JYT A;  3AE2 B;  3AEF B;  1GAQ B;  3ZO5 B;  4FAD A;  2KQ7 A;  3I57 A;  2QMT A;  3Q3N C;  1FEH A;  2GBR A;  2V3P A;  4GDK B;  2I1J A;  5IO9 A;  2ICI A;  4BKT A;  3EUB 2;  4FJZ A;  2D10 A;  4A3P A;  2CS4 A;  2DYM A;  2QJL A;  4A90 A;  1TIF A;  3NS8 A;  3AU5 A;  4MDK E;  1E7U A;  1U4A A;  3J9C A;  2MHJ A;  3VR9 B;  4E3C A;  3DWM A;  5MPO A;  2W82 A;  2JVC A;  2LGY A;  3KH0 A;  1LGR A;  3KUZ A;  1QZE A;  1JRU A;  3H7P A;  1C1Y B;  4P1B C;  3SHQ A;  4XWW A;  1PGB A;  2M4N A;  4ANW A;  1TGZ B;  4II2 B;  4C7Y A;  1JWM D;  4MEM A;  2AQ2 B;  1XEE A;  2N1W A;  5FK9 C;  3NVZ A;  1WJ4 A;  3NRZ A;  2WGS A;  2I1K A;  4PS8 A;  3EFU A;  2LUE A;  4NJ7 A;  4MH8 A;  4XC2 A;  3Q14 C;  2CR5 A;  1SGH A;  2KVZ A;  2HJ8 A;  4ZRP A;  2NTT A;  2FBW B;  2JXT A;  4IWO A;  2PJH A;  3X0W A;  3V3X A;  2D3B A;  3SU8 X;  1UBI A;  1GOZ A;  3AE6 B;  3IVF A;  3WAO A;  2WDQ B;  3PO0 A;  2IYD B;  4C7Z A;  2WLB A;  2K1F A;  4AJY B;  5BO4 B;  4KV2 A;  4ACF A;  2M19 A;  2IGD A;  2RPV A;  3KUC B;  3TSS A;  3IT4 B;  2BB5 A;  2KDM A;  4HJG E;  1GJZ A;  1EF1 A;  1D5X C;  2D3C A;  2ZJD A;  2BWF A;  3QC8 B;  5HHD G;  2DAF A;  2RDB C;  1EWY C;  3M3J A;  2LGI A;  3NG0 A;  3E9S A;  4PYZ A;  3VTV A;  2IZV B;  1RFA A;  1UH6 A;  3Q8A A;  2DZK A;  3NZU A;  1XLO A;  3BYT B;  2IJ0 A;  4JWU C;  2E6X A;  4GGQ A;  1UD7 A;  4A55 A;  4OVU A;  1C79 A;  1ENF A;  2NBV B;  3UIN B;  3M62 B;  2KNB A;  5G2N A;  1EU4 A;  2GBK A;  2LMC A;  4BOZ B;  3KWV A;  3P4S B;  1XLP A;  2Y5P A;  4LJO B;  4IDI A;  1EWC A;  2CJN A;  1WE7 A;  1D6E C;  4B6W A;  3DBR I;  3ETR A;  1R4N I;  4JLC A;  3UI3 A;  2D3A A;  4AUQ C;  1PUT A;  3U52 E;  1N62 A;  2Q5W D;  3MHZ A;  1YNT E;  3ZJU A;  1ET6 A;  1WFY A;  1EU3 A;  2CU1 A;  2N9L A;  3PZ7 A;  2AL6 A;  3VTU A;  3W1S A;  1JRP A;  4B95 A;  2ASQ A;  5EDS A;  4GU2 A;  3QHT A;  2LEK A;  4XE0 A;  5C2T B;  3R7Q A;  1V6E A;  1FCC C;  1YJI A;  4HKQ A;  3Q6B A;  3KYC D;  1VDV A;  2I2Y A;  4HLE A;  2N1V A;  3KLS X;  4DK5 A;  3Q8B A;  1JAL A;  3P63 A;  2KMA A;  2MQJ A;  1UEL A;  1M4V A;  3AE9 B;  1WIA A;  1J7C A;  4O1N A;  2D3G A;  3B0A A;  1L0V B;  4ZRQ A;  3LXF A;  4D2K A;  4E71 A;  1ZP0 B;  4AJW A;  1JCK B;  5CHF A;  5EE9 A;  3V62 A;  3VUY A;  2ZVN A;  1JRO A;  4P7I A;  1E8Z A;  2MP2 B;  2NPT A;  2JZZ A;  2BT6 A;  1Q1O A;  3RNA C;  4EUT A;  1I35 A;  2K8B A;  3OLM D;  1I4Q A;  3UIP B;  4YSY B;  3IG3 A;  3DVN V;  2WXR A;  4PS3 A;  3VRA B;  5CHV C;  1HQR D;  3WAP A;  4ZRK A;  1Q5W B;  2J0M A;  2MJ3 A;  2N7E A;  3W1Y A;  5IP4 D;  4DXF A;  2ZZP B;  3ZW3 A;  2W55 A;  2DBY A;  4S0R A;  5AUI A;  3L10 B;  2JWZ A;  3M63 B;  3AUL A;  1ZOY B;  2FCQ A;  3PLV A;  4RNA A;  4MSM B;  2EKE C;  3I5J C;  2LZ6 A;  1C76 A;  3VQI A;  1C78 A;  3TJP A;  3ZNH B;  2K6D B;  1KF6 B;  2NTS A;  1XLQ A;  3N9Y C;  3ZVV A;  3DDC B;  3W5V B;  1UUP A;  2PIA A;  3PRM B;  1ISN A;  4WWN A;  4OZA A;  5KHO A;  2BVC A;  3U8Z A;  1KM7 A;  3CMM B;  4W9L A;  4NZL B;  2EEL A;  4EZK A;  2KZR A;  1J7B A;  2BF8 B;  3DHI C;  1L6V A;  1E10 A;  4N9F 4;  2KDF B;  1WXA A;  4KX6 B;  3EEC A;  3GZN I;  3ECI A;  4TV3 A;  4N59 A;  1VZ6 A;  2O6V D;  3HVD A;  1VCB A;  2WQY B;  3VTW A;  1WJU A;  1EM7 A;  4IW0 A;  3Q3F A;  1UNS A;  2CHW A;  4AOF A;  1ZXH A;  2N9P C;  2BGF A;  5C23 A;  2R2O A;  1QF6 A;  1RYJ A;  4K7W A;  4M02 A;  5DPT A;  1TS2 A;  1ZE3 D;  4GXB A;  2DLB A;  4JGH B;  3R8B A;  1CK1 A;  3VVW B;  1KTK A;  5J2R A;  1UBQ A;  2XK5 A;  2KWD A;  2JPH A;  1YJJ A;  2NPT B;  3N32 A;  2Z59 B;  4B0M A;  2JYE A;  2QHO A;  5IOI A;  3BIN A;  2KFJ A;  4WJQ A;  1K51 A;  1FFU A;  4FXC A;  3JW0 X;  1PGX A;  1WMH A;  3BZD B;  1TYG B;  4IC7 B;  1WE6 A;  3AEC B;  3ZJT A;  3PTF C;  1SJH D;  2QC8 A;  5CX3 A;  4MGY E;  2KT7 A;  2GBN A;  3TIX A;  4PT5 A;  3RNC C;  1I4G A;  4M01 A;  2FE8 A;  4NQL B;  4OZB A;  4RCO A;  4K3B A;  5GXG B;  2NMQ A;  2LJI A;  3SR6 A;  2V3N A;  4KGS A;  4G50 A;  5GMV A;  4WWP A;  3RZW C;  3BYY B;  1E7P B;  3UIO B;  4BFR A;  3X23 A;  3DBH I;  3NVV A;  2O2V B;  4ANX A;  1SJE D;  4NAW B;  1FRD A;  2PE6 B;  3EA6 A;  4ASW C;  1X1M A;  4HWI B;  4KZ0 A;  4FA6 A;  2M56 B;  1PGA A;  1R4N B;  2VH2 A;  2JZ3 B;  5E6O A;  2K39 A;  4XWT A;  3EFC A;  1OEY J;  4ZHP A;  3A4S C;  3VHT C;  1TTN A;  1XO3 A;  1H4R A;  4P6V F;  3JSV A;  4K3C A;  1OFF A;  2QIE B;  2M8S A;  5JZE B;  3U7Z A;  1MPE A;  1L4D B;  3JYU A;  1I4X A;  4ZYS A;  3AV8 A;  2LGD A;  1GUA B;  4BBN C;  2RD0 A;  1VR9 A;  3VAW A;  3N30 A;  1HTQ A;  1WZ3 A;  3PHW B;  3W1S C;  3R66 C;  4DHZ E;  3H6N A;  4NQK E;  2DYB A;  2V4L A;  3DCG A;  2AEH A;  3L16 A;  2KFK B;  5HFY A;  1WRI A;  4XZ4 A;  1SE9 A;  2XNA C;  2IPK D;  3APC A;  1BUI C;  3AXC A;  2JT4 B;  5CHW A;  2KD0 A;  4DHJ B;  2QSD A;  2C7M B;  1EO6 A;  3AMZ A;  4TUU A;  4HPP A;  4A6Q A;  3B2F A;  4XDC A;  3ML9 A;  4JIO U;  5EE0 A;  2LRW A;  3SEB A;  2KQS A;  2L52 A;  4MGK E;  2QIL A;  1FMA D;  3GOE A;  1UWM A;  4KSL C;  2GRI A;  4LJP B;  2V4I B;  2LAS A;  4ZRJ A;  1NEK B;  3AH7 A;  3HRD D;  4IOI E;  1C4A A;  1FRR A;  3WIM A;  1WGD A;  3NOB A;  3BK2 A;  3RUI B;  2L05 A;  2LRU A;  1WYW B;  2CHZ A;  4TMA B;  3NZS A;  4C4V B;  1YQ4 B;  3VR8 B;  4F7Z A;  3HUI A;  1XXG A;  1NI3 A;  2DZJ A;  2ZNV B;  1SB3 C;  3RPF C;  3CSF A;  3B9J A;  4RMA A;  3V6C B;  4IM2 A;  4P16 A;  4MM3 B;  2MBE A;  3FC4 A;  1L7Y A;  2C5L C;  5FKA C;  3DPD A;  1JWB D;  2YEP F;  1L2N A;  4M8M A;  5LXI B;  4FJY A;  4NNJ B;  3L17 A;  2G1E A;  2WX0 A;  3HHM A;  2BKR B;  2AYO B;  4RGT A;  2L76 A;  2KWU B;  2KX3 A;  3B1L X;  1Q10 A;  3WCQ A;  2BWE S;  4HDO A;  2BYE A;  1HTO A;  4UDU C;  2HDE A;  1D5M C;  1TKE A;  2AL3 A;  4TSS A;  1KOT A;  4KIK B;  1QOA A;  2Z0D B;  2KLC A;  4M8N A;  2OOB B;  2C60 A;  4G3X B;  2CU3 A;  1B1Z A;  4ICU A;  1V1O A;  2KTR B;  2MJD A;  2Y5C A;  3FKY A;  3GE3 C;  1NI2 A;  2MP2 A;  1CQV A;  2BW2 A;  1JWU D;  3UGB B;  2WNM A;  3PT2 B;  1JWA D;  5BYS A;  4HDQ A;  5C1Z A;  2YEP B;  2V1Y A;  3N1X C;  1P9D U;  1VZ8 A;  1MHX A;  1DGJ A;  3AM9 A;  4JPS A;  2BBC A;  2WXI A;  1AW7 A;  1HXY D;  3A9K B;  2TSS A;  2C7H A;  2MX2 A;  3ONS A;  2NR2 A;  1IGD A;  2FNJ B;  5JH5 C;  1C3T A;  1LQB A;  4FHK A;  3ZRC A;  2JUO A;  3L4P A;  2KO3 A;  2ON8 A;  1ACC A;  4WAA A;  5DCN A;  1WXQ A;  3L0W B;  4MJS B;  4A9A A;  1QOG A;  3H9D A;  3LYY A;  4FBJ B;  5HKH A;  5FR6 A;  1ROE A;  4ZOH C;  2PPH A;  1DOX A;  4W9F A;  2I38 A;  1F52 A;  2SEB D;  1C4P A;  3NUH B;  2JU6 X;  4P1C C;  1FXT B;  3AE1 B;  1SIJ A;  1YJ1 A;  2LXA A;  4W9C A;  3ZUN A;  1C4C A;  2KAC A;  2LWP A;  3I9V 1;  4L1B A;  4HCP B;  3MJW A;  5AEK B;  3ZNZ B;  4RGM A;  3R7R A;  1IYF A;  1LXD A;  1F9J A;  1L5P A;  3PRP B;  4KIK A;  4MGI E;  1E8X A;  2KQ4 X;  2MWS B;  3MFG A;  2MCN B;  5D3I B;  3A1Q B;  5DPS A;  1LFD A;  1L0X B;  2DWQ A;  1J7A A;  2HTH A;  3Q3J A;  2H89 B;  2VRR B;  5AUK A;  3ABV B;  2IDY A;  2GBJ A;  4ZDV A;  1T3Q A;  3VRB B;  4HPL B;  1RAX A;  2VZK B;  1DOI A;  1T6B X;  2OHF A;  2O6V B;  1WGR A;  4GN1 A;  1K50 A;  4DQO C;  1BT0 A;  3QA8 A;  3RN9 C;  2ZCC A;  4LDT D;  2BPS A;  4DDI D;  1M94 A;  4YTP B;  1V5T A;  3Q8F A;  1TKG A;  2PE9 A;  4WAF A;  3A9K A;  2XK5 B;  2V3S A;  4X57 B;  1N60 A;  5E6P A;  2KX0 A;  4IM3 A;  3BK1 A;  4HVB A;  3OJ3 A;  1WJN A;  3B08 A;  4S17 A;  1WMH B;  1QOB A;  1P0R A;  2L00 B;  1YX6 B;  3ZGZ A;  1YX5 B;  4DWF A;  4RH6 A;  1NEN B;  3URY A;  2DZM A;  1RFK A;  5J18 A;  3W2D A;  4EZL A;  3Q8E A;  3MJ5 A;  1TZO A;  4JL9 A;  2RMM A;  4W9H A;  3RI7 C;  4FJV B;  2PKO A;  3C0R B;  2CHX A;  3FIL B;  1FNV A;  2KC2 A;  2FAZ A;  3DBH B;  3QK0 A;  1PQS A;  3ZXR A;  5TR5 A;  2J4X A;  2A4Z A;  2JWU A;  3DWG C;  2KMC A;  1C9F A;  1WXV A;  3HIZ A;  2O2V A;  2CJO A;  2MBO A;  2N7J A;  1GB4 A;  1YIW A;  2BKF A;  1RLF A;  2YVC A;  1IUE A;  2LVQ A;  2IO0 B;  2RGF A;  3L13 A;  1P3Q U;  3PZ8 A;  3U30 A;  2WXP A;  1P98 A;  5G55 A;  3OAW A;  4YTN B;  2JQR B;  2KAN A;  2J53 A;  2KN5 A;  1E90 A;  3DVG X;  2JX5 A;  1TT5 B;  2LUM A;  3ZNG C;  3AE3 B;  2KFK A;  2JSV X;  3V61 A;  3EGR A;  4IM0 A;  2L7R A;  4YXD B;  2MH7 A;  1WH3 A;  1YQB A;  2WXF A;  2PVO D;  1IBX B;  2MSE D;  2C9W B;  3ZLZ A;  2N7D A;  4MGZ E;  2BB6 A;  4GDL A;  3OJ4 B;  2WXN A;  3PSE B;  2L32 A;  3DBL B;  4HCN B;  2OJW A;  4W9G A;  1FIQ A;  5BMI A;  3DBR B;  2KMM A;  2HJ1 A;  2MRP A;  3R2T A;  3CF6 E;  5DPR A;  2BS4 B;  3AE5 B;  2ZPN A;  1AAR A;  2DYO A;  3VXW A;  2D11 A;  4K7U A;  4I6L B;  2H88 B;  1D5Z C;  1FNU A;  4BOS C;  3DHG C;  3ML8 A;  4MM3 A;  5D3D A;  5AZH A;  5I4D A;  4W9I A;  4CHK A;  1QKZ A;  2L3Z A;  1KJT A;  2HTM E;  3W9C B;  1V8C A;  4IUM B;  1FM0 D;  2N4F A;  4LLG M;  4II3 B;  4WWO A;  1E7V A;  2N9X A;  1IGC A;  1SEB D;  1WY8 A;  1JQ4 A;  4MAC A;  3TEX A;  3LJ3 A;  5IA7 A;  4GLS C;  4A8X C;  3APF A;  3ZXV A;  1CMX B;  4FHJ A;  4GOC A;  2X8X X;  4US8 A;  2NCN A;  3QX1 A;  4W9E A;  4JE3 B;  1RRB A;  1Z5S B;  2WXG A;  4OVV A;  2LJ5 A;  4CYE A;  3V6E B;  1VJK A;  1TY0 A;  4NJC A;  3BWU D;  2G45 B;  5H8Y E;  3AE4 B;  3PV1 A;  2LHE A;  3DVN U;  1D3Z A;  1JW9 D;  4MEL A;  4YSX B;  1G6J A;  3QAR A;  2ONQ A;  2ZW1 A;  1T0S C;  2Z0E B;  3AEG B;  3MC0 B;  4HXD A;  3MHS D;  4DBG A;  1IBX A;  1ZKH A;  1KLV A;  2JXX A;  1FXI A;  2RPQ A;  5BMH A;  4IWP A;  1WXM A;  2GOW A;  3Q3O C;  4L2Y A;  4TKN A;  4AQ7 A;  4GDL B;  2MEK A;  2BS3 B;  3TMP B;  1J8C A;  1AYF A;  3DBS A;  5H92 C;  1MG8 A;  2KTR A;  2DNF A;  2L1A A;  2PEA A;  1FCL A;  3P4Q B;  4RM9 A;  4BAX A;  3HM6 X;  4PYU A;  2DZI A;  2EMT A;  4LNF A;  5FR3 A;  1WM2 A;  2KJR A;  3RCZ A;  4C00 A;  1JWS D;  1TKY A;  4YSZ B;  4F8C B;  4OVZ A;  5EE1 A;  3MP9 A;  1D4B A;  4KZC A;  1S3S G;  2LXC A;  4AS1 A;  1JML A;  2AQ1 B;  4KSK C;  4DDG D;  2B3A A;  4MJS A;  3PRZ A;  1P7E A;  4K7S A;  3I63 C;  2IBI B;  4ZHO A;  4LDT B;  2RDG A;  4NPN A;  2LVP A;  2L8J A;  3NHE B;  1UWX A;  2D5G A;  2J52 A;  1K8R B;  2DX5 B;  3IT6 B;  3GE8 C;  2REX A;  2MLB A;  3QQ8 B;  2G3Q B;  3MTN B;  1S1Q B;  2MBH A;  3GS2 A;  2XEW A;  4KGR A;  1E9M A;  1P7F A;  2JY6 A;  3ZDT A;  4BBN F;  4XX5 A;  2K22 A;  1R4M B;  4IKG A;  4WJN A;  3QCA A;  5IKC M;  1WZ0 A;  4LNN A;  3ENE A;  2L0T A;  2J7Q B;  2G9H D;  2KAJ A;  3D32 A;  1R4M I;  2MBB B;  3GB1 A;  2WU2 B;  4W9J A;  4ARI A;  3GZN B;  3QWZ B;  3VH3 B;  3JVZ X;  2AX5 A;  4GIV A;  3C8Y A;  3BVM A;  2M1M A;  1KH0 A;  4URK A;  3RZF A;  2BYV E;  4KVG B;  3K9O B;  2XBB C;  2OJR A;  3A1Q A;  1H8C A;  1E5W A;  2L83 A;  3T8M A;  1WX7 A;  2AWT A;  4WUR A;  3UQB A;  2KHW B;  1WSP A;  1XCQ L;  2RDH A;  1V2Y A;  2K9X A;  4ZRI A;  3TCA A;  3VH4 B;  4HRO A;  5E6J A;  3NY5 A;  2UWQ A;  3TL5 A;  2CKH B;  3H1U A;  2QDF A;  2KOX A;  1OGW A;  3R2I A;  1E6E B;  1F2R I;  3O65 B;  1NYQ A;  2WDR B;  3RT3 B;  1L4Z B;  3KUD B;  1HEZ E;  3WAM A;  1WJ6 A;  1DYQ A;  2IGH A;  1ZPS A;  2KDE B;  2MA9 B;  3HK0 A;  1ZDV A;  1HZ6 A;  4EEW A;  2WDT B;  4RGO S;  2FID A;  4WQM A;  1ESF A;  4AP4 C;  1MI0 A;  2SAK A;  5BMG A;  4H2A A;  1N63 A;  2R61 A;  4I6N B;  4PS7 A;  2NBU A;  1TJE A;  1Y56 A;  3IAS 1;  2GLS A;  2W3S A;  3EHV A;  2N9E B;  2INN E;  2R2Q A;  4EFO A;  2LHD A;  2HE7 A;  2K5P A;  5EE3 A;  3LDZ E;  3AE8 B;  1XT9 B;  5E6N A;  1WX8 A;  2M0X A;  3ZYY X;  4M0W B;  4XGA B;  2INP E;  3A9J B;  2KC1 A;  3DOW A;  5TSS A;  3AI5 A;  3H8H A;  3PLU A;  2JZP A;  4K1R B;  4G11 A;  4N58 A;  1VZ7 A;  1OQY A;  4BVU C;  4RF0 A;  4F1S A;  4OHJ A;  1WX9 A;  1GNU A;  3DHH C;  2OED A;  3C19 A;  4Q2J A;  3L08 A;  4B0E A;  3HVZ A;  1T0Q C;  3PVL A;  1E8Y A;  1GC7 A;  2WXO A;  1UGM A;  1J19 A;  1FO4 A;  5DPW A;  2K25 A;  1N61 A;  4G0N B;  1F77 A;  4AWJ A;  1QLB B;  1ZXI A;  2PMV A;  2ZCB A;  2LFI A;  5BYQ A;  2UU7 A;  4RF1 A;  2IY1 B;  1TBE A;  3HM3 A;  3U7D A;  2WU5 B;  1B9R A;  3L54 A;  3RNE C;  3QJZ A;  4HJK A;  1V81 A;  4YWG G;  3N20 C;  3AEE B;  2Y5B B;  2M0A A;  2FCS A;  2FIF A;  3N1Z C;  3DBL I;  2GBM A;  3NS1 A;  2ZPY A;  3ZJV A;  3KWL A;  2RR9 A;  1NBF C;  2K6Q A;  1WM3 A;  3V05 A;  3ZNI D;  2ZNV C;  4A3O A;  2XN9 C;  2X38 A;  2LVO A;  4JWS C;  5G5G A;  2QEJ C;  2J42 A;  1V1P A;  3OWE B;  1EUV B;  4RM8 A;  4LTU A;  2HD5 B;  4TQ1 A;  2KDB A;  3MC9 A;  1I42 A;  1XCT L;  2WXJ A;  2FCN A;  4BKS D;  3O13 A;  2K3U A;  3WAN A;  3N1Y C;  4WIP A;  5KHQ A;  1MFW A;  4HRS A;  2GB1 A;  1LO5 D;  4NJ6 A;  4WJP A;  3Q2A C;  3ZDM C;  2RSU A;  1F2R C;  1YMH E;  1V80 A;  1C77 A;  3PPA A;  1FFV A;  1N6Z A;  4MT5 A;  3A9J A;  1YN3 A;  4LK0 M;  2LGS A;  3IXS A;  1TS4 A;  3BVG A;  1K53 A;  4LNK A;  5J17 A;  3JSV B;  1FXA A;  2NVU I;  4C4V A;  4GDK A;  3PHX B;  3DQV A;  4BKG A;  1WR1 A;  2JF5 A;  1XQQ A;  5BYR A;  2BS2 B;  4HPM B;  3AE7 B;  2MBQ A;  4HKZ E;  1SE3 A;  1T5X D;  1GG3 A;  4JX1 C;  3K9P B;  2ZW0 A;  2QCZ A;  5HI1 A;  4WJO A;  2DEN B;  1I4H A;  3Q3M C;  2KJ6 A;  1MVK A;  2KKC A;  3R3M A;  3H7S A;  3P4P B;  3GP7 A;  4HEA 1;  1OEY A;  1FNW A;  3RYT A;  1QIL A;  1PDX A;  2WXQ A;  4FUL A;  1YD8 U;  1N5X A;  1HZ5 A;  4RFB A;  1K52 A;  2G4S A;  3ZQ4 A;  1CJE A;  4DXA B;  1FD6 A;  3PGE A;  3RNG C;  4EKU A;  4EOY A;  2ZEQ A;  1WF9 A;  5C3J B;  4WQO B;  4IG7 B;  2GI9 A;  3FAH A;  4ANV A;  2JRH A;  3OG5 A;  3E56 A;  3TEZ A;  1IPG A;  4C80 A;  3MC8 A;  3AEB B;  1AWD A;  1SIF A;  4BKS A;  2VH1 A;  3NJT A;  1L0Y B;  1I4P A;  2PLP A;  3DVG Y;  1YQ3 B;  5LLI A;  2YLM A;  4MSQ B;  1V1P B;  2NBW B;  2LD9 A;  4HK2 A;  3RMK C;  1PYW D;  3S2A A;  2WHI A;  2IO3 B;  1ZGU B;  4XYC A;  1T0R C;  4RGN A;  1KRH A;  1SXT A;  2BYT A;  5JXV A;  1P1A A;  2WYQ A;  1TS5 A;  4ARC A;  3I3T B;  1XF5 L;  2WX1 A;  1MG4 A;  1I4R A;  1V9J A;  4M00 A;  2PW9 A;  1ZW7 A;  1DOY A;  3IFW B;  1T0Y A;  2N9K A;  1OQR A;  5IAA C;  2BYF A;  3V60 A;  1E8W A;  3CIR B;  1WR6 E;  2KXJ A;  3A33 B;  1V97 A;  3AB5 A;  4MH0 E;  1A5R A;  1N5W A;  5CTR C;  4YL8 A;  1AN8 A;  2J0J A;  4NY0 A;  4XDD A;  1YN5 A;  2D2Q A;  1GB1 A;  1WGG A;  1NDD A;  1NYR A;  3SFE B; 
#chains in the Genus database with same CATH homology
 2WNM A;  3PZ7 A;  1JWA D;  5BYS A;  3W1S A;  1JRP A;  1UWX A;  2D5G A;  2YEP B;  2J52 A;  2LEK A;  1VZ8 A;  3AM9 A;  1MHX A;  1DGJ A;  4XE0 A;  5C2T B;  1FCC C;  1YJI A;  3IT6 B;  4HKQ A;  4JPS A;  2BBC A;  2WXI A;  4OW0 A;  1AW7 A;  3NVW A;  1HXY D;  1VDV A;  2I2Y A;  2TSS A;  3KLS X;  3GS2 A;  3AEA B;  4OZC A;  3Q8B A;  1JAL A;  1ZUD 2;  3P63 A;  1SSN A;  1IGD A;  4KGR A;  1BXT A;  1E9M A;  1P7F A;  5G5H A;  1M4V A;  3AE9 B;  2K22 A;  3P42 A;  1J7C A;  4O1N A;  4USA A;  2FUG 1;  4IKG A;  1UGJ A;  4L23 A;  1L0V B;  3L4P A;  2PTL A;  2ON8 A;  3BVZ A;  4ZRQ A;  3LXF A;  4D2K A;  2G9H D;  2KAJ A;  1ZDX A;  1ZP0 B;  1JCK B;  1PFD A;  5EE9 A;  2KN4 A;  3GB1 A;  2WU2 B;  1ACC A;  2K0P A;  1XLN A;  1WXQ A;  4ARI A;  1JRO A;  5LNK 1;  4A9A A;  1QOG A;  3LYY A;  4KKJ A;  2BT6 A;  1VLB A;  1WWT A;  3AED B;  1I4Q A;  1ROE A;  4ZOH C;  4YSY B;  1TS3 A;  2WXR A;  1SE4 A;  2AX5 A;  3VRA B;  1DOX A;  3C8Y A;  2I38 A;  1HQR D;  1WYG A;  3BVM A;  2N0S B;  1C4P A;  2SEB D;  3NUH B;  1KH0 A;  2JU6 X;  2MJ3 A;  4EE2 A;  1RM6 C;  2BTE A;  3AE1 B;  4DXF A;  1SIJ A;  3U4E G;  3NVY A;  4CQN A;  2W55 A;  2DBY A;  5AUI A;  2L83 A;  3W5U B;  2WP9 B;  5T8I A;  1I7H A;  1C4C A;  1ZOY B;  3B2G A;  4WUR A;  2B76 B;  4RNA A;  2KAC A;  3I9V 1;  1QOF A;  4L1B A;  1WSP A;  1XCQ L;  1C76 A;  2AQ3 B;  2RDH A;  2K9X A;  4RGM A;  4HRO A;  5E6J A;  3VQI A;  1C78 A;  1KLU D;  1L5P A;  1KF6 B;  2NTS A;  3R2I A;  1XLQ A;  1E6E B;  3N9Y C;  1F2R I;  2KQ4 X;  3MFG A;  3P4R B;  5D3I B;  1VRA B;  2Y3A A;  1L0X B;  1NYQ A;  1UUP A;  2WDR B;  3W5V B;  2PIA A;  2DWQ A;  1L4Z B;  1J7A A;  1HEZ E;  2H89 B;  1YN4 A;  2WXL A;  4OZA A;  5AUK A;  3ABV B;  2IDY A;  4M0W A;  3AN1 A;  1T3Q A;  3VRB B;  1DYQ A;  2IGH A;  1ZPS A;  4NZL B;  2EEL A;  1OQQ A;  1J7B A;  2VZK B;  1DOI A;  1T6B X;  1ZDV A;  1L6V A;  2OHF A;  1HZ6 A;  1E10 A;  1K50 A;  4DQO C;  4WWM A;  1KLG D;  4RGO S;  4WQM A;  3T3N A;  1ESF A;  4KX6 B;  1MI0 A;  2SAK A;  5BMG A;  4H2A A;  1N63 A;  2R61 A;  1TJE A;  4N59 A;  1VZ6 A;  4NAM A;  3HVD A;  1Y56 A;  4WH4 A;  2WQY B;  4YTP B;  1L6U A;  1EM7 A;  3Q8F A;  1TKG A;  3IAS 1;  1NVI D;  1UNS A;  4WAF A;  3TEW A;  2W3S A;  4TQ0 A;  1GPX A;  1ZXH A;  2INN E;  2LHD A;  1N60 A;  4DXG A;  2EKI A;  1BML C;  2K5P A;  5EE3 A;  1QF6 A;  3IAM 1;  3AE8 B;  1R7S A;  3BK1 A;  1RYJ A;  1TS2 A;  1ZE3 D;  2WXH A;  2DLB A;  3R8B A;  3ZYY X;  1CK1 A;  2INP E;  3T3O A;  3BII D;  2W3R A;  1KTK A;  5TSS A;  1QOB A;  3H8H A;  2JZP A;  3ZGZ A;  4RH6 A;  2KWD A;  1YJJ A;  4N58 A;  1NEN B;  4C56 C;  3RFZ B;  1VZ7 A;  3URY A;  1RFK A;  3W2D A;  4RF0 A;  4OHJ A;  3Q8E A;  4B0M A;  2JYE A;  3MJ5 A;  1TZO A;  3KQ4 A;  2RMM A;  2OED A;  4Q2J A;  4YTM B;  1SBB B;  5HG2 A;  1RWS A;  1K51 A;  2Z8L A;  4B0E A;  3HVZ A;  2PKO A;  1FFU A;  4KKI A;  2WXO A;  3FIL B;  1FNV A;  1F0Z A;  4FXC A;  2PVG C;  1PGX A;  1QQR A;  3BZD B;  1TYG B;  1FO4 A;  2MJE A;  1CZP A;  1N61 A;  2J4X A;  3AEC B;  3ZJT A;  2JWU A;  3DWG C;  4J3O D;  1SJH D;  1F77 A;  1C9F A;  1QLB B;  1ZXI A;  3Q8C A;  1QT9 A;  2CJO A;  2N7J A;  2PMV A;  1STE A;  1ET9 A;  1GB4 A;  2LFI A;  4PT5 A;  5BYQ A;  1I4G A;  2FE8 A;  1SE2 A;  2WXM A;  4OZB A;  4RCO A;  4RF1 A;  2WS3 B;  1IUE A;  3SFD B;  5GXG B;  2NMQ A;  2WU5 B;  2LJI A;  4YT0 B;  3U2S C;  1B9R A;  3SR6 A;  1WGK A;  2V3N A;  3PZ8 A;  4N6E B;  4KGS A;  3TEY A;  2VZK D;  1MHH E;  2WXP A;  3NZ3 A;  3BYY B;  1E7P B;  4YWG G;  4YTN B;  2E3T A;  4ITK A;  2IGG A;  2WDV B;  2JQR B;  2J53 A;  3NVV A;  2JX5 A;  3CWI A;  1SF0 A;  2W54 A;  3AEE B;  1SJE D;  3FIL A;  2ACZ B;  2LUM A;  4NAW B;  1FRD A;  2M0A A;  3AE3 B;  3EA6 A;  4REZ A;  3Q69 A;  3NS1 A;  2JSV X;  2M56 B;  4US9 A;  3ZJV A;  1PGA A;  3EGR A;  3KWL A;  3TUO A;  3V05 A;  4YXD B;  2MH7 A;  3P1M A;  4R3D A;  2XN9 C;  1A70 A;  1KFY B;  2WXF A;  2PVO D;  2X38 A;  5D7G A;  1IBX B;  1E0Z A;  4JWS C;  5G5G A;  2QEJ C;  4XWT A;  1HA5 A;  2J42 A;  2V0G A;  1TY2 A;  4ZHP A;  1V1P A;  1XO3 A;  4P6V F;  3OWE B;  4KGT A;  2BB6 A;  3LB8 C;  4LTU A;  2WXK A;  1OFF A;  2JYT A;  2QIE B;  2WXN A;  3AE2 B;  2L32 A;  3AEF B;  3U7Z A;  1MPE A;  1L4D B;  1GAQ B;  4TQ1 A;  1XCT L;  2WXJ A;  1I4X A;  1FIQ A;  3I57 A;  4ZYS A;  3AV8 A;  2QMT A;  5BMI A;  3O13 A;  2K3U A;  1VR9 A;  2KMM A;  1FEH A;  4WIP A;  2V3P A;  4HRS A;  2GB1 A;  1LO5 D;  4GDK B;  1F2R C;  3R2T A;  2ICI A;  1YMH E;  1C77 A;  3EUB 2;  1FFV A;  2BS4 B;  4MT5 A;  3AE5 B;  2DYO A;  1YN3 A;  4LK0 M;  5HFY A;  2DYM A;  2QJL A;  4A90 A;  3IXS A;  1WRI A;  1TS4 A;  3BVG A;  2XNA C;  2IPK D;  1K53 A;  3J9C A;  1BUI C;  2H88 B;  1D5Z C;  1FXA A;  3VR9 B;  1FNU A;  3DWM A;  5MPO A;  2W82 A;  2QSD A;  5D3D A;  3AMZ A;  5I4D A;  1QKZ A;  4A6Q A;  3B2F A;  4XDC A;  2HTM E;  3W9C B;  1V8C A;  4XWW A;  5EE0 A;  1PGB A;  1FM0 D;  3SEB A;  5BYR A;  4LLG M;  2BS2 B;  2L52 A;  4C7Y A;  1JWM D;  2QIL A;  2AQ2 B;  1XEE A;  1FMA D;  1IGC A;  1SEB D;  3AE7 B;  1UWM A;  3NVZ A;  4MAC A;  5FK9 C;  1JQ4 A;  3NRZ A;  3TEX A;  2GRI A;  2V4I B;  4HKZ E;  1SE3 A;  1T5X D;  4JX1 C;  4GLS C;  1NEK B;  2ZW0 A;  3AH7 A;  4MH8 A;  5HI1 A;  4A8X C;  3HRD D;  1I4H A;  4IOI E;  1C4A A;  1FRR A;  1MVK A;  3BK2 A;  3GP7 A;  3P4P B;  4HEA 1;  1FNW A;  4US8 A;  4TMA B;  1QIL A;  4ZRP A;  1PDX A;  2NTT A;  2FBW B;  2JXT A;  2WXQ A;  4JE3 B;  2WXG A;  1N5X A;  1HZ5 A;  4RFB A;  3V3X A;  1K52 A;  3ZQ4 A;  1YQ4 B;  1GOZ A;  1VJK A;  3AE6 B;  3VR8 B;  1CJE A;  1TY0 A;  1FD6 A;  2WDQ B;  3PO0 A;  4C7Z A;  2WLB A;  4NJC A;  3BWU D;  3HUI A;  1XXG A;  1NI3 A;  5H8Y E;  3AE4 B;  2M19 A;  1SB3 C;  2IGD A;  3RPF C;  5C3J B;  3B9J A;  2RPV A;  2LHE A;  3TSS A;  2GI9 A;  3FAH A;  3IT4 B;  2BB5 A;  1JW9 D;  2KDM A;  3E56 A;  3TEZ A;  4YSX B;  4P16 A;  4MM3 B;  4C80 A;  3AEB B;  3FC4 A;  2ONQ A;  2ZW1 A;  4HJG E;  1AWD A;  5FKA C;  1D5X C;  3AEG B;  3MC0 B;  1IBX A;  1JWB D;  5HHD G;  1L0Y B;  2YEP F;  1I4P A;  2PLP A;  1EWY C;  1FXI A;  1YQ3 B;  2LGI A;  2G1E A;  1V1P B;  3E9S A;  5BMH A;  3Q8A A;  1PYW D;  4RGT A;  4L2Y A;  1XLO A;  4AQ7 A;  4GDL B;  4RGN A;  1KRH A;  3BYT B;  2MEK A;  2IJ0 A;  2BS3 B;  4JWU C;  1SXT A;  1AYF A;  1Q10 A;  2BYT A;  3WCQ A;  2E6X A;  5JXV A;  1TS5 A;  4ARC A;  5H92 C;  1XF5 L;  2L1A A;  4UDU C;  1FCL A;  2HDE A;  4A55 A;  1I4R A;  2PW9 A;  1D5M C;  1TKE A;  3P4Q B;  1C79 A;  1ENF A;  1DOY A;  4TSS A;  1QOA A;  1OQR A;  2N9K A;  5FR3 A;  1EU4 A;  2LMC A;  3KWV A;  3CIR B;  3P4S B;  1V97 A;  1JWS D;  1XLP A;  2Y5P A;  1TKY A;  3AB5 A;  4IDI A;  1EWC A;  2CJN A;  4YSZ B;  1D6E C;  1N5W A;  4OVZ A;  2CU3 A;  5EE1 A;  1B1Z A;  3MP9 A;  1AN8 A;  4XDD A;  1V1O A;  1YN5 A;  1D4B A;  3ETR A;  1GB1 A;  3UI3 A;  4AS1 A;  1JML A;  2AQ1 B;  2MJD A;  2Y5C A;  1PUT A;  3U52 E;  1N62 A;  1CQV A;  2Q5W D;  3MHZ A;  1P7E A;  1YNT E;  3ZJU A;  1ET6 A;  1EU3 A;  4ZHO A;  2BW2 A;  1JWU D;  1NYR A;  2RDG A;  3SFE B;  2N9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...