2Y5CA

Structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
SDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADRENODOXIN-LIKE PROTEIN, MITOCHONDRIAL
publication title Structure and Functional Studies on Human Mitochondrial Ferredoxins
rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 29
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2y5cA00
3AB5A 3AEGB 2MJ3A 3AEFB 1L5PA 1FM0D 1YQ3B 3DWMA 2MH7A 3CIRB 4JWSC 4ZOHC 1N62A 2KMMA 3AE8B 1TKEA 5G5HA 4HRSA 1QOFA 2MJEA 2PIAA 4US9A 1OQRA 1J7CA 1QOAA 3NVWA 4HROA 3VRBB 4YTMB 5C3JB 1CJEA 2L83A 4YXDB 2W3RA 1SF0A 2B76B 3ZYYX 1NVID 1GAQB 2Y5CA 1FMAD 1TKGA 1FRDA 3VRAB 1FIQA 1SIJA 2L52A 2FBWB 1E7PB 3AE2B 1TYGB 3HRDD 1AWDA 1N61A 1UWMA 3AE7B 1PUTA 1XLPA 2K9XA 4IDIA 1WXQA 1JQ4A 1L0VB 2H88B 3LXFA 1E0ZA 1I7HA 3AMZA 2KAJA 3EUB2 4C7ZA 4C7YA 4P6VF 1QF6A 1A70A 2CJNA 4JWUC 4US8A 1QOBA 2HTME 2H89B 1QT9A 2W55A 2DBYA 1DOXA 3NVZA 4YT0B 5EE3A 5C2TB 1XLQA 1JW9D 2MJDA 1QLBB 4LTUA 3W9CB 1T3QA 3AE9B 1ZOYB 2BT6A 1WYGA 2WS3B 2N0SB 1VJKA 2K5PA 3KWLA 1DOYA 1ZUD2 4YTPB 3AEAB 5EE0A 2AX5A 3CWIA 5AUIA 4WQMA 2JX5A 1AYFA 3AE3B 3ETRA 3P4SB 4YSXB 1DGJA 2PKOA 1NI3A 2WP9B 3AH7A 2ACZB 4C80A 1FFVA 1ZP0B 1JRPA 1F0ZA 3AE6B 3NS1A 1RFKA 1L6UA 1FRRA 1YQ4B 1KFYB 3AE1B 3NRZA 1TKYA 1JWAD 1FFUA 1RYJA 3AEBB 3P4QB 3P63A 5GXGB 1J7AA 3SFDB 2Q5WD 1B9RA 1DOIA 5G5GA 1OQQA 1OFFA 1WRIA 3AEDB 2WU5B 3P1MA 3BIID 2K22A 5EE1A 3VR9B 2LEKA 1YJIA 3WCQA 1RWSA 1L6VA 2BS3B 1ZXIA 2CJOA 1N60A 4KX6B 4YSYB 1IUEA 1JALA 1FXAA 3FAHA 3SFEB 1E6EB 1V8CA 1XLNA 3AV8A 3AM9A 5MPOA 1YJJA 4FXCA 3NVVA 1CZPA 1NENB 1N63A 2G1EA 2JQRB 1V97A 1FO4A 4YSZB 2OHFA 1N5WA 1PFDA 1J7BA 2WQYB 4JX1C 4WWMA 4USAA 3HUIA 3RPFC 4ITKA 2WLBA 1VLBA 2WU2B 3AN1A 3VR8B 2WDVB 2WDQB 3B9JA 3HVZA 4N59A 1E10A 2CU3A 2EKIA 3LB8C 1NYQA 5EE9A 4ZHOA 1WGKA 1TJEA 2WDRB 3P4RB 2QIEB 3AE4B 1EWYC 3ABVB 3W5UB 1XLOA 2PVGC 3B2GA 3NVYA 2PVOD 3P4PB 2W3SA 3AEEB 3DWGC 3PO0A 1QOGA 5H92C 1KRHA 2E3TA 3W5VB 1NEKB 2QJLA 4YTNB 1GPXA 1PDXA 1JWBD 2BS2B 3SR6A 1NYRA 1XO3A 4ZHPA 3FC4A 1SB3C 4N58A 1KF6B 4N6EB 2W54A 2M19A 1RM6C 1FXIA 1E9MA 3B2FA 5H8YE 2BS4B 1R7SA 1N5XA 2M56B 1VDVA 3L4PA 2DWQA 1JROA 1WWTA 4A9AA 3AE5B 3AECB 1ROEA 5AUKA
chains in the Genus database with same CATH superfamily
3VXWA 1OEYJ 4ASWC 1N62A 2XK5B 2WNMA 1V1OA 1ZW7A 3RNGC 2FCMA 1QOAA 4HROA 3L13A 1I35A 4C4VA 2L83A 2LJIA 1WXAA 2B76B 2WGSA 1V1PB 3V60A 2YEPF 3PHWB 4MEMA 1UF0A 4HEA1 2XBBC 1AWDA 2O2VA 3VHTC 2L0TA 1J0GA 2N1VA 3A9KA 4CYEA 2IPKD 1SXTA 3MHZA 2JSVX 3JSVA 2ZCBA 3ZNZB 1FCLA 5HI1A 4YT0B 2KJRA 3VQIA 3WANA 4II3B 1UZXB 2LGIA 3RNAC 1VJKA 5D6JB 3TEWA 2MP2A 1U4AA 5AEKB 4WQMA 4DBGA 3AE3B 5IO9A 2RPVA 4YSXB 1WJUA 3X23A 2EKEC 3GZNI 2REXA 3UI3A 2FIFA 4KDIC 4GGQA 2VH1A 4MM3A 1JWUD 5D3IB 1P9DU 4LCDE 4HKQA 2N7EA 1GNUA 1UGJA 2CJOA 2JWUA 4L2YA 3Q8BA 4HK2A 1K52A 2G1EA 2D10A 2KOXA 2BYTA 2N9PC 5DCNA 4ZDVA 2K0PA 1XD3B 3DBSA 2INNE 5IA7A 3Q3JA 4BKSA 1WSPA 1K8RB 2BS4B 1N5XA 2L8JA 4RGOS 4E74A 2K25A 2MBOA 3K9OB 2WXRA 3RT3B 4MGKE 5CHWA 4US9A 4D2KA 4C4VB 2KDEB 2PMVA 4HCNB 3NHEB 4AQ7A 3MFGA 4L1BA 4F7ZA 1NVID 1XQQA 2KQSA 5G55A 1FRDA 3TEZA 1E8ZA 4JE3B 4CO7A 2O2VB 3ZRFA 3TUOA 3A9KB 3L10B 1F2RC 2MHJA 3UGBB 1E0ZA 3UQAA 1QF6A 2KWUB 1TGZB 1WM2A 3I9V1 4JPSA 4A6QA 2KWDA 2PW9A 1BUIC 3QJZA 1XLQA 2CKHB 1FNWA 3W9CB 1T3QA 1ZOYB 2MP2B 4GDKA 3V62A 1DOYA 2WXNA 1HZ6A 5TR5A 1C77A 3ETRA 2V0GA 2ZW1A 4M00A 2RDBC 2GB1A 1JRPA 3VUWA 2LRUA 3S2AA 4K7UA 4KZ0A 2Q5WD 1UUPA 2RGFA 5KHOA 4GU2A 1YJ1A 5IOIA 1V2YA 2WU5B 4BBNF 2HDEA 4ZRPA 3ZJUA 1YJIA 2HE7A 3ML8A 1IUEA 2AQ3B 3U2SC 2J4XA 2K8BA 2JQRB 5G2NA 3RULA 2NMQA 3HUIA 4ZYNA 1SBBB 4N59A 1ET9A 4OHJA 1TJEA 3OJ3A 2QHOA 4M02A 3U52E 2QCZA 2I1JA 4YTNB 1PDXA 3RI7C 4N58A 1IPGA 3NG0A 4RCOA 4BZAA 2JYTA 3L4PA 2GLSA 4WWPA 3AB5A 4LNKA 2KYWA 3Q2AC 1L5PA 5HHDG 3A1QA 3AE8B 4FJVB 1MFWA 2JRIB 2ZEQA 2WXLA 4NJ6A 3RYTA 4DK5A 2GMIC 4NQKE 3QQ8B 3VRAB 3Q8FA 1YN3A 3ECIA 4TQ1A 1PUTA 2O6VD 4GDLB 2EELA 2Z59B 4MELA 4WQOB 2BB6A 2DBYA 3O65B 2BF8B 3UQBA 4LTUA 3WAMA 2PE6B 4MJSA 4AJYB 3L17A 1ZUD2 3EC8A 3CWIA 2KANA 4W9FA 1FFVA 4LDTD 1EUVB 1QILA 4H2AA 1HTOA 4CHKA 4DDGD 2JT4B 2D3CA 4WJOA 1Y8RC 2LHDA 2WWZA 1S3SG 2MRPA 1H4RA 1IGCA 3SDLC 3BINA 3PRMB 3Q3MC 3V6EB 1TIFA 1A5RA 2M1MA 4BVUC 3P42A 2R2OA 1V9JA 3DVGX 4CQNA 3RUIB 3FILA 4XZ4A 3VH4B 2K8HA 3I63C 3H6NA 3QARA 3ABVB 2KDFB 2ON8A 2MSED 2PVGC 1P7EA 1QQRA 1AW7A 1QOGA 2E3TA 3VTVA 2QJLA 1XO3A 1STEA 5DPTA 3TSSA 1SIFA 3MC8A 1K51A 3WA0A 4HKZE 3ZO5B 5J17A 3A1QB 2L76A 1EO6A 4EZLA 4MDKE 4MSQB 4DXGA 2WXMA 4GN1A 5E6JA 2IGGA 2DYBA 3EHVA 4RFBA 3R66C 3U7ZA 3VUXA 4W9DA 2H88B 3N1XC 3CF6E 1YIWA 3R2IA 4XWTA 4P6VF 2Y5BB 2M0AA 3TIXA 3Q8CA 4EOYA 3TEXA 1QLBB 4MJSB 3E9SA 1VZ6A 1WRDB 3AU4A 4ZRIA 3AEAB 1KJTA 5D94A 1ENFA 1WE6A 2ACZB 2N7JA 1K50A 3KQ4A 4C80A 2C5LC 2HD5B 4IC7B 2AL6A 2N9EB 2LASA 2NBUA 1WXVA 3V05A 2VZKB 3P1MA 4ACFA 4P1BC 2JU6X 2A4ZA 1ZXIA 3R3MA 3FILB 1L0XB 2I2YA 2LGSA 4I6LB 3R7QA 3DBHB 1V5TA 2KQ7A 2ZVOA 1WGKA 2KWVB 2OEDA 3PZDA 5L95C 2QMTA 1GC7A 4M8NA 3H7SA 1FEHA 1GUAB 3FC4A 3IVFA 1RM6C 3EGRA 4TUUA 4GOCA 1IYFA 1ZGUB 4ICUA 2KJ6A 1XEEA 2QC8A 1WGRA 3KUZA 4HPLB 1QOFA 2MJEA 1YOVB 1WGYA 2K8CA 2JZZA 4KGRA 2LD9A 1TKGA 1R4MB 2G4SA 1MVKA 2J0JA 2OJWA 3E56A 2KT7A 1WR1A 3GOEA 1I4PA 4I6NB 4REZA 5CHFA 3U7DA 3ZNHB 4C00A 1TBEA 1KTKA 3QX1A 1MPEA 4YWGG 1WI0A 1OGWA 4K3CA 3NZ3A 2FAZA 1MG8A 2CHXA 2D11A 1WYGA 1WX9A 3B08A 2AX5A 2FCSA 2LGYA 1M4VA 3AH7A 4RMAA 4BKSD 2JXTA 3NS1A 1RFKA 3I3TB 5JHAA 4NNJB 1LM8B 3ENEA 4W9HA 2C7HA 4HCPB 3NJTA 1HXYD 1T0SC 3EECA 1WIAA 3CSFA 4EZKA 1NENB 4ZRKA 2CU1A 2GI9A 3V61A 4K3BA 2WU2B 3HVZA 2DZIA 5JXVA 2GBMA 1NYQA 1WMHA 2DAFA 4FJZA 3VAWA 3AE4B 1UBQA 4WWOA 3B2GA 3DVNV 3C19A 2O6VB 2PJHA 1R4NI 1HEZE 1P98A 2NPTA 4ZHPA 3J9CA 4EE2A 4XC2A 2L7RA 2JF5A 3OWEB 3JW0X 3DBLI 1L4ZB 3ZLZA 1JROA 4OW0A 1TZOA 1ROEA 4HLEA 3M95A 1VZ8A 4B0MA 1YX6B 4PS7A 3WIMA 3K9PB 4J6IA 1C1YB 2BPSA 3T3OA 1M94A 3UF8A 2OOBB 3W1YA 4XWWA 1ZKHA 3H7PA 2NBVB 2L32A 3CSTA 2N1WA 2LZ6A 2V3SA 3SU8X 4TQ0A 3KUCB 4C7YA 1WJ4A 5E6NA 3PHXB 3ZDTA 1C78A 2BB5A 2PPHA 2PEAA 2GBNA 1KM7A 4GLSC 4HJKA 4JGHB 2JXXA 4G11A 2KO3A 5FR6A 1K53A 1P7FA 4ANVA 3L08A 3ZJVA 1VZ7A 4WH4A 1YN5A 4EZJA 3NZUA 2V4IB 1OFFA 4KZCA 5FR3A 3AEDB 4KGTA 3T9LA 3QA8A 3DHHC 4N9F4 4IOIE 1IP9A 2IZVB 2KLCA 1X1MA 3AM9A 3RNEC 3NUHB 1CK1A 3M63B 4WAFA 4W9CA 1J7BA 3ZDMC 3N1YC 2JRHA 1WMHB 4TKNA 1E10A 3MHSD 1ZE3D 1UNSA 1UGMA 2WDRB 5AZFA 2M0XA 4ARCA 5D3DA 2PVOD 3DWGC 1VCBA 2LRWA 2IO3B 1JWBD 4TMAB 2LGDA 3U4EG 4ZRQA 1UBIA 1D4BA 1T6BX 2MCNB 2KZRA 2VRRB 2JYEA 4GB9A 3C0RB 3KYDD 3DHGC 1HTQA 4A3OA 2IDYA 3QHTA 2G4DB 2L05A 1T0YA 3PS6A 3PLUA 3PZ8A 2NTTA 2BGFA 2ZCCA 1I42A 5D7GA 3QWZB 4HPPA 1J19A 2DX5B 3GB1A 2VZKD 1WXQA 1SEBD 3B0AA 2KLGA 3KUDB 2MLBA 1A70A 4US8A 1AN8A 3Q8AA 3LJ3A 2FCQA 1GB4A 3NVZA 2ZZPB 3AU5A 4BBNC 4HXDA 3AE9B 2MWSB 4KGSA 4A20A 1ISNA 5E6OA 3KW5B 1GOZA 1JMLA 1WYWB 2KC2A 1L6UA 4WJNA 3JSVB 2M4NA 1FFUA 1RYJA 4S0RA 5GXGB 2N9KA 1WX7A 4MH0E 5FKAC 3APFA 2K6QA 3JYUA 4M0WA 2JWZA 3VR9B 1TY0A 1N60A 4KX6B 1FXAA 3UIOB 3AULA 4MACA 2IGDA 4FADA 4B6WA 1R4NB 2XEWA 1IBXA 4A8XC 2RDGA 2DHZA 4MM3B 1ACCA 2CU3A 3DBLB 3IAS1 3PSEB 3NVYA 2KDIA 2IGHA 4MH8A 1C9FA 3PT2B 1SB3C 4FHJA 4N6EB 2GBKA 4RNAA 1N6ZA 4ARIA 2J52A 2FCNA 2SAKA 1E8YA 4ANUA 2DYMA 4LJOB 1V81A 2D3AA 4X57B 1WXSA 3O13A 4RM9A 1OQRA 2KDBA 2INCC 4XDCA 2W3RA 5FK9C 3BYTB 2IO1B 3H1UA 1SIJA 4P7IA 1V80A 3RFZB 4IW0A 1WE7A 2CR5A 4S17A 1TYGB 5CTRC 2KK8A 3DBHI 1CQVA 2YLMA 4M01A 1LXDA 3IFWB 1DYQA 4FULA 1XT9B 3BZDB 3RCZA 1DOXA 2UWQA 1D5XC 4AWJA 1WX8A 1JW9D 2D3BA 1XXGA 2WXKA 1HA5A 3KVFB 5GMVA 3JVZX 1PGAA 2ZNVB 1D6EC 1Q10A 2KJHB 4DHZB 4WJQA 1XCQL 3AE6B 1YNTE 3DVNU 2NS5A 1TKYA 1JWAD 3P63A 3A33B 2G9HD 3ZVVA 4M0WB 2KTRA 1R4MI 4DHJB 4MGYE 3W2DA 1SJHD 4OZAA 2WXOA 4GDKB 5DPSA 2LEKA 3RNCC 4B0EA 1IBXB 4WIPA 1PFDA 1ESFA 4W9KA 3RPFC 2ZJDA 3ZW3A 2INDC 1GC6A 3ZTCA 1FNVA 1Z5SB 3ZKJC 2RDHA 4FN2A 2FNJB 2KDMA 2MBHA 3H8HA 2ZPYA 1GG3A 4K7SA 1JWSD 2CHWA 5H8YE 1R7SA 1VRAB 2BKFA 4GIVA 1I4XA 2KXJA 2Z0DB 4EFOA 2KMMA 5G5HA 1RLFA 2PIAA 2BYFA 3HK0A 5CX3A 2I38A 1SF0A 2Y5CA 4NJCA 1LQBA 2FBWB 2ZNVC 4UDUC 2MBEA 1L0VB 3EUB2 2FUG1 1UD7A 1QT9A 2PTLA 3BVGA 4FBJB 3R8BA 4XGAB 2A5UA 5LXIB 4XYCA 5LLIA 1MJDA 1WJNA 2EMSA 4E3CA 3P4SB 4LJPB 2QEJC 2WX1A 4KDLB 4JQWC 4G3XB 3W5UB 3P4QB 1T0QC 2DLBA 2KTRB 1WRIA 2B3AA 4IWPA 1NDDA 3HHMA 4MT5A 3DVGY 1E7VA 2K6DB 1F1HA 1YQBA 3MP9A 4K7WA 4BOSC 1YJJA 1YMHE 2KNBA 4G0NB 2G3QB 4YSZB 1N5WA 1VLBA 4LNOA 2WDQB 2EKIA 4LK0M 2MEKA 2WXGA 3ONSA 3BY4B 3OLMD 5JZEB 1KLGD 2C9WB 1RAXA 4M8MA 4W9IA 3DCGA 1P3QU 2M19A 2W54A 3QIJA 1WY8A 2DWQA 4JL9A 1V6EA 1Z2MA 1T5XD 2MJ3A 1YQ3B 4ZOHC 3U8ZA 1B1ZA 1TS4A 4YXDB 2JY6A 3ZYYX 1HE8A 1FMAD 2V3NA 4W9LA 1RFAA 3N30A 2ZVNA 4KV2A 1Q1OA 2WXJA 4WAAA 4XX5A 5BO4B 1UWMA 2CS4A 3GP7A 2LI5A 3IG3A 1E7UA 3N32A 3IT6B 2WXPA 2KMAA 2NTSA 2XN9C 1TS3A 1UWXA 1RRBA 3L16A 3DPDA 2KACA 3KWLA 2LVPA 2PKOA 1NI3A 4PS3A 2KVRA 5HKHA 4OVZA 4LNIA 4C56C 1OEYA 1G6JA 2WXFA 3N3KB 4IWOA 1PQSA 1EWCA 2V4LA 2IO0B 2NBWB 4RM8A 2J0MA 1RWSA 3BYYB 5KHQA 4IWQA 1F52A 3URYA 1YD8U 2W82A 4USAA 2WQYB 4L23A 4AP4C 4NY0A 5IKCM 3QAQA 2UYZB 5E6PA 4RF1A 1EM7A 2QIEB 3BVMA 1E8XA 1I4QA 2BKRB 4KKIA 2KN5A 1T0RC 2KMCA 1F9JA 2DZJA 3EA6A 3U30A 4DXAB 1V1PA 1SE4A 2J7QB 1WGGA 4LNNA 3QK0A 4A55A 3BK2A 3DWMA 3GS2A 3N1ZC 3WAOA 2WYQA 5BMGA 2LVQA 4JLCA 1MHHE 1FIQA 4BKGA 1QKZA 3Q14C 2L0FA 1E8WA 1XCTL 3CMMB 4DHJD 2Y3AA 1LO5D 4OZCA 1I7HA 3RMKC 2KAJA 5JHBA 2L1AA 2RSUA 4DDID 1JRUA 2BVCA 3P2BA 2IY0B 1WGDA 2MJDA 2WS3B 3ZTDA 5C23A 3R7RA 3TMPB 1S1QB 3PTFC 1FD6A 3VDZA 2AQ2B 1WZ3A 4JIOU 2BW2A 1BMLC 1VD2A 4IG7B 1KLVA 3QC8B 1OQYA 2IY1B 1OQQA 5BMHA 3NZSA 2D5GA 1J8CA 1WM3A 2GOWA 3WCQA 1F77A 4ZYSA 2QSDA 3Q3OC 4YL8A 2PLPA 3SFEB 1XLNA 1KOTA 5DPRA 4WWNA 5MPOA 2INPE 5J18A 2DZKA 1V97A 4KSKC 5HG2A 4ITKA 4TSSA 3VR8B 1I4RA 3NS8A 4PYZA 2AL3A 4AS1A 2KKCA 4FJYA 4OVUA 3PO0A 1EU3A 2BS2B 3VTWA 5EDSA 2JUOA 4Q2JA 3OJ4B 1HQRD 3PREA 4J3OD 4MGZE 3AEGB 3BK1A 4JWSC 3CIRB 2R2QA 4HRSA 4NPNA 3TJPA 3PPAA 2NPTB 4IM3A 3RNBC 2KX0A 2TSSA 1TZ1A 2V9HA 3AE2B 2LJ5A 2BWFA 3LXFA 1LFDA 3ZQ4A 2LMCA 2CJNA 2J0KA 5J2RA 2HTME 1FPYA 4A3PA 2BTEA 1KLUD 2LUEA 1C79A 5T8IA 4AJWA 1XF5L 1C76A 1YX5B 3H7PB 3ZXRA 1L0YB 2K5PA 3DBRB 2JX5A 1GJZA 2C7MB 1AYFA 1VR9A 3I5JC 2GRIA 2AEHA 3LYYA 2GBJA 3L0WB 1FRRA 1KFYB 3L54A 2G45B 2WHIA 3RZWC 3TBLD 3BIID 2WXIA 4NAWA 4W9GA 4OVVA 5L83A 3ML9A 2LXAA 2NCNA 3DQVA 2FE8A 1V8CA 3W1SA 3PGEA 1WF9A 3MTNB 4XDDA 2OHFA 5BYQA 1PGXA 3TCAA 3HM6X 2J42A 2AWTA 2WDVB 3ZGZA 1V86A 1C4CA 1SJED 2LGXA 5HFYA 4ANWA 3WALA 1OTRB 4K1RB 3PRZA 3P4PB 4KIKA 4HDQA 1EF1A 2FUHB 3W5VB 5IN7A 2MX2A 3APCA 1ZXHA 3PV1A 1ZDVA 4P1CC 2MW5A 3BVZA 4DXFA 4IKGA 1D5MC 3APDA 2V1YA 3HIZA 3AE5B 4RGTA 4BOZB 2DAJA 2XNAC 4GDLA 4EUTA 3GE3C 2N9XA 4FA6A 1V49A 3LDZE 3TEYA 4YTMB 3A4RA 5IAAC 3N9YC 3ZXVA 3SEBA 2Y5PA 4B9KA 1MHXA 1QZEA 3HRDD 1V5OA 3M62B 1XLPA 3VVWB 2K9XA 2KWCA 1IGDA 1WXMA 3R2TA 5EE3A 5C2TB 4ZRJA 1TS5A 3M3JA 2JZPA 3DHIC 4NJ7A 2RMMA 2MBBB 3NY5A 2R61A 3IXSA 4G50A 4W9JA 2K39A 3QCAA 3BWUD 4RF0A 2WP9B 2ZPNA 3Q3FA 1F0ZA 4EKUA 1NI2A 4PYUA 1J7AA 5TSSA 2I1KA 4NAWB 4ICVA 4W9EA 2D3GA 4RGNA 5CHVC 2K22A 2BYEA 3VH3B 3FAHA 2WX0A 2N9LA 4FXCA 3NVVA 1L7YA 1NBFC 3EFUA 1E5WA 2IO2B 2WLBA 2M17A 1I4HA 3VTUA 2SEBD 4KIKB 2MBQA 3P4RB 2ZW0A 2YVCA 3HM3A 4OZBA 2KVZA 2W3SA 2LUMA 1KF6B 4GMVA 3H9DA 2OJRA 5D2MB 3B2FA 1H8CA 2ASQA 3ALBA 2DZMA 3IBEA 4KVGB 3GZNB 3A9JA 4FHKA 2Z8LA 1TKEA 1I4GA 1WR6E 3ZRCA 4GXBA 1EF5A 4DQOC 4HJGE 3RN9C 1GAQB 1TT5B 2AQ1B 4DHZE 2PE9A 1D3ZA 2LXCA 4NQLB 3Q3NC 2WXHA 2E6XA 2Z0EB 1HZ5A 2CHZA 4O1NA 4R3DA 3V6CB 4I6PA 4II2B 2J53A 1QOBA 2BYVE 2H89B 2KQ4X 4MSMB 2DYOA 1ZPSA 2BT6A 1SE9A 3W1SC 2DENB 1CMXB 1UELA 3SHQA 1SE2A 3ZNID 3OG5A 2QDFA 3T3NA 1ZDXA 4RH6A 1FXTB 4AUQC 5IP4D 3AE1B 1P1AA 2BWES 5G5GA 2C60A 4F8CB 4PT5A 2UU7A 2HJ1A 5EE1A 1L6VA 4YSYB 2K3UA 1C4PA 5I4DA 2KFKA 1CZPA 2KHWB 1SGHA 1FO4A 4JX1C 4WWMA 3B9JA 1MG4A 1SE3A 4E71A 1E90A 1AARA 3LB8C 3KWVA 2JZ3B 1ET6A 3AEEB 4FLHA 2IYDB 5LXHA 1YN4A 1P0RA 1SSNA 3B1LX 3RNFC 4MGIE 1E9MA 1KH0A 3MC9A 4HPMB 4AOFA 2M56B 4NAMA 4BFRA 3GE8C 4IM0A 1TTNA 2N4FA 4XE0A 3A9JB 3AEFB 1FM0D 4BKTA 2L3ZA 3Q8EA 1J7CA 3VRBB 3WAPA 4HVBA 5C3JB 1CJEA 3TL5A 3UINB 3RD2A 3A4SC 2KX3A 2NVUI 2D07B 4IDIA 1JQ4A 2LHEA 3AMZA 3ZUNA 2BQQA 3I57A 4QAYA 2LFIA 1GB1A 2GBRA 2KN4A 1TY2A 2DNFA 3VUYA 3Q69A 2N0SB 3DDCB 5DPWA 5BMIA 2M8SA 2N7DA 5AZGA 1PYWD 3KLSX 3PVLA 2MA9B 3HVDA 1YQ4B 3NRZA 3NOBA 3SFDB 2KD0A 1B9RA 3ZJTA 2W9NA 2FIDA 2RD0A 2X38A 3PLVA 3EFCA 2O6VA 1C3TA 2KFJA 2KFKB 1F2RI 2VH2A 4IM2A 1UH6A 3AV8A 4IUMB 1N63A 3KYCD 5JH5C 3PZ7A 1EU4A 1LGRA 4DWFA 3IT4B 2WDTB 1WGHA 4PK1A 4ZHOA 2BBCA 2HJ8A 3T8MA 2MQJA 4EEWA 3DBRI 1WFYA 2KC1A 1BT0A 2YEPB 1NEKB 3SR6A 2V3PA 4F1SA 2ICIA 1Q5WB 4RGMA 1BXTA 1WZ0A 3X0WA 1L2NA 4WJPA 1C4AA 2D2QA 3AECB 3AI5A 4TV3A 3C8YA 2K1FA 4PS8A 3VFKA 2MH7A 3RZFA 1Q0WB 4HWIB 1JWMD 3UIPB 2XK5A 3NVWA 5LNK1 1TS2A 4WURA 2ONQA 2L00B 3ZNGC 3MJWA 2L52A 1FNUA 1E7PB 3KH0A 1N61A 1L4DB 3AE7B 3Q6BA 3MJ5A 4C7ZA 4JWUC 3SD5A 2W55A 2LVOA 3DOWA 2LWPA 4KSLC 2RR9A 3D32A 4YTPB 5EE0A 2AYOB 5AUIA 4URKA 2KTFA 1DGJA 3IHPC 3IAM1 1ZP0B 1PGBA 3AXCA 2EMTA 4NZLB 3AEBB 2C7NB 2HTHA 1DOIA 4A90A 2WXQA 2JVCA 2RPQA 1D5ZC 3MC0B 2BS3B 5AZHA 4BAXA 1JALA 4LNFA 1E6EB 2X8XX 2NR2A 2IBIB 3FKYA 2IJ0A 5C1ZA 3AN1A 4ANXA 5EE9A 4P16A 1FCCC 1MI0A 2QILA 1EWYC 5BYRA 1XLOA 4LDTB 5H92C 1KRHA 1GPXA 1NYRA 1WH3A 3PRPB 3N20C 1Y56A 2JPHA 5BYSA 4LLGM 1WJ6A 1FXIA 1JCKB 4K81A 3OAWA 4B95A 1VDVA 3ZIMA 1WWTA 3V3XA 4A9AA 4GSWA 4KKJA 5AUKA 4HDOA
chains in the Genus database with same CATH topology
1XEEA 2XNAC 1I4XA 1N62A 2KMMA 5G5HA 2WNMA 1QOFA 1V1OA 2MJEA 2PIAA 3TEYA 1QOAA 4HROA 4YTMB 2I38A 4KGRA 2L83A 2LJIA 1SF0A 2B76B 2Y5CA 3N9YC 1V1PB 1TKGA 4NJCA 2YEPF 1MVKA 3SEBA 2Y5PA 4HEA1 3E56A 2FBWB 1MHXA 4UDUC 1I4PA 3HRDD 1AWDA 4REZA 1XLPA 2K9XA 1L0VB 1KTKA 2IPKD 3EUB2 2FUG1 1SXTA 1MPEA 4YWGG 3MHZA 1IGDA 2JSVX 1QT9A 2PTLA 3BVGA 3NZ3A 1FCLA 5HI1A 3R2TA 4YT0B 5EE3A 5C2TB 3R8BA 3VQIA 1TS5A 2JZPA 1WYGA 2LGIA 2RMMA 1VJKA 2R61A 3TEWA 3IXSA 2AX5A 4WQMA 3AE3B 3P4SB 2RPVA 3BWUD 4RF0A 4YSXB 1M4VA 2WP9B 3AH7A 2QEJC 3UI3A 1F0ZA 2JXTA 3NS1A 1RFKA 3W5UB 3P4QB 1JWUD 5D3IB 2DLBA 1J7AA 5TSSA 4NAWB 1WRIA 4HKQA 4RGNA 2K22A 4MT5A 1UGJA 2CJOA 2JWUA 4L2YA 3FAHA 3Q8BA 1HXYD 2N9LA 3MP9A 1YJJA 4FXCA 1YMHE 1K52A 3NVVA 1NENB 2G1EA 2GI9A 4YSZB 1N5WA 2WLBA 1VLBA 2WU2B 1I4HA 2WDQB 2BYTA 3HVZA 5JXVA 2EKIA 1NYQA 2SEBD 4LK0M 3P4RB 2MEKA 2ZW0A 3AE4B 2WXGA 3B2GA 4OZBA 2W3SA 1KLGD 2K0PA 2INNE 1HEZE 2LUMA 4ZHPA 3J9CA 1KF6B 1WSPA 4EE2A 2W54A 2M19A 3OWEB 3B2FA 2BS4B 1N5XA 1L4ZB 2DWQA 1JROA 4RGOS 4OW0A 1TZOA 1ROEA 1T5XD 2MJ3A 1VZ8A 4B0MA 1YQ3B 4ZOHC 2Z8LA 1TKEA 1I4GA 2WXRA 1B1ZA 4US9A 4D2KA 4DQOC 2PMVA 4HJGE 4AQ7A 1TS4A 3MFGA 4YXDB 3T3OA 3ZYYX 4L1BA 1NVID 1GAQB 4XWWA 1FMAD 2V3NA 1FRDA 3TEZA 2AQ1B 4JE3B 2L32A 3TUOA 2WXJA 1UWMA 2WXHA 2E6XA 3GP7A 4TQ0A 1F2RC 1HZ5A 1E0ZA 4C7YA 4O1NA 4R3DA 1QF6A 3IT6B 2J53A 1QOBA 3I9V1 2H89B 2WXPA 2KWDA 2PW9A 4JPSA 1BUIC 2KQ4X 4A6QA 2NTSA 2DYOA 2XN9C 1XLQA 1C78A 2BB5A 1TS3A 1UWXA 1FNWA 3W9CB 1T3QA 1ZPSA 1ZOYB 2BT6A 4GLSC 2KACA 3KWLA 1DOYA 1SE2A 2WXNA 1HZ6A 1C77A 1K53A 3ETRA 1P7FA 2PKOA 1NI3A 3T3NA 2V0GA 2ZW1A 1ZDXA 4RH6A 2GB1A 3ZJVA 1VZ7A 1JRPA 4WH4A 4OVZA 1YN5A 3AE1B 4C56C 2Q5WD 1UUPA 2WXFA 5G5GA 2V4IB 1OFFA 5FR3A 3AEDB 1EWCA 2WU5B 4PT5A 4KGTA 5EE1A 2HDEA 4ZRPA 3ZJUA 1YJIA 4IOIE 1RWSA 1L6VA 3BYYB 4YSYB 1IUEA 2K3UA 1C4PA 3AM9A 3URYA 5I4DA 2AQ3B 3U2SC 2J4XA 3NUHB 1CK1A 1CZPA 2JQRB 2W82A 1FO4A 4WAFA 4USAA 1J7BA 2WQYB 4JX1C 4WWMA 4L23A 2NMQA 3HUIA 1SBBB 3B9JA 4N59A 4RF1A 1E10A 1SE3A 1ET9A 1UNSA 1ZE3D 3KWVA 3LB8C 4OHJA 1TJEA 2WDRB 1EM7A 2QIEB 3BVMA 1I4QA 4ARCA 5D3DA 2PVOD 3U52E 1ET6A 4KKIA 3AEEB 3DWGC 1YN4A 4YTNB 1PDXA 1JWBD 4TMAB 1SSNA 3EA6A 4N58A 3U4EG 1V1PA 4ZRQA 1D4BA 1SE4A 4RCOA 1T6BX 1E9MA 1KH0A 2JYTA 2M56B 3L4PA 4NAMA 2JYEA 4A55A 3BK2A 3AB5A 4XE0A 3AEFB 1L5PA 1FM0D 5HHDG 3DWMA 3GS2A 3AE8B 3Q8EA 2IDYA 2WXLA 1J7CA 5BMGA 3VRBB 5C3JB 1CJEA 3PZ8A 2NTTA 3VRAB 1MHHE 1FIQA 3Q8FA 5D7GA 1QKZA 1YN3A 1XCTL 4TQ1A 1PUTA 3GB1A 2VZKD 1WXQA 2Y3AA 4IDIA 1SEBD 2LHEA 1JQ4A 1LO5D 4OZCA 1I7HA 3AMZA 2EELA 2KAJA 4GDLB 2L1AA 3I57A 1A70A 4US8A 1AN8A 3Q8AA 2LFIA 2BB6A 2DBYA 1GB4A 1GB1A 3NVZA 2KN4A 2MJDA 4LTUA 4KGSA 3AE9B 1TY2A 2WS3B 2N0SB 3Q69A 5BMIA 1ZUD2 1GOZA 3CWIA 1JMLA 1FD6A 1PYWD 2AQ2B 1FFVA 3KLSX 2BW2A 1QILA 1BMLC 1L6UA 1YQ4B 3HVDA 3NRZA 4H2AA 1FFUA 1RYJA 5GXGB 3SFDB 2N9KA 1B9RA 3ZJTA 2LHDA 1OQQA 5FKAC 5BMHA 2X38A 2D5GA 1IGCA 4M0WA 3VR9B 1TY0A 3WCQA 1F77A 4ZYSA 1N60A 4KX6B 1F2RI 1FXAA 2QSDA 3SFEB 2PLPA 3P42A 1XLNA 3AV8A 4MACA 2IGDA 5MPOA 2INPE 4CQNA 1N63A 1V97A 1IBXA 3FILA 3PZ7A 5HG2A 4A8XC 1EU4A 2RDGA 4ITKA 4MM3B 4TSSA 3VR8B 1I4RA 3IT4B 1ACCA 2CU3A 4ZHOA 3IAS1 2BBCA 4AS1A 3ABVB 2ON8A 2PVGC 3NVYA 1P7EA 1QQRA 3PO0A 2IGHA 1AW7A 1EU3A 1QOGA 4MH8A 2E3TA 2YEPB 1NEKB 2QJLA 1C9FA 3SR6A 2BS2B 1XO3A 2V3PA 1SB3C 1STEA 2ICIA 4N6EB 3TSSA 4RGMA 1BXTA 4RNAA 1C4AA 4ARIA 4Q2JA 2J52A 1HQRD 2SAKA 3AECB 4J3OD 1K51A 4HKZE 3C8YA 3AEGB 2DYMA 3BK1A 2MH7A 3CIRB 4JWSC 1JWMD 4HRSA 3O13A 1OQRA 3NVWA 5LNK1 4XDCA 1TS2A 4WURA 4DXGA 2WXMA 2W3RA 2ONQA 5FK9C 3BYTB 1SIJA 5E6JA 2IGGA 2TSSA 3RFZB 2L52A 1FNUA 1E7PB 3AE2B 1TYGB 4RFBA 1CQVA 1N61A 1L4DB 3AE7B 3MJ5A 3U7ZA 2H88B 3LXFA 3R2IA 1DYQA 3ZQ4A 4XWTA 2LMCA 4C7ZA 4P6VF 2CJNA 3BZDB 4JWUC 2HTME 2W55A 2BTEA 1DOXA 1KLUD 1C79A 1D5XC 2M0AA 5T8IA 3Q8CA 1XF5L 1JW9D 3TEXA 1QLBB 1C76A 3E9SA 1VZ6A 1XXGA 2WXKA 1HA5A 1L0YB 2K5PA 4YTPB 3AEAB 5EE0A 5AUIA 2JX5A 1AYFA 1PGAA 1D6EC 1DGJA 1VR9A 1ENFA 1Q10A 3IAM1 2ACZB 2N7JA 1K50A 2GRIA 3KQ4A 4C80A 1ZP0B 1PGBA 1XCQL 3LYYA 3AE6B 1FRRA 4NZLB 1KFYB 1YNTE 3P63A 1TKYA 1JWAD 3AEBB 1DOIA 2G9HD 4A90A 2WXQA 3V05A 1D5ZC 2VZKB 3MC0B 1SJHD 3BIID 2WXIA 3P1MA 4OZAA 3W2DA 2JU6X 2WXOA 4GDKB 2LEKA 2BS3B 1ZXIA 2FE8A 1JALA 1E6EB 1V8CA 3W1SA 4B0EA 1IBXB 3FILB 4XDDA 4WIPA 2OHFA 5BYQA 1PFDA 1PGXA 1ESFA 1L0XB 2IJ0A 2I2YA 3RPFC 2J42A 3AN1A 2WDVB 3ZGZA 1C4CA 1FNVA 1SJED 5EE9A 4P16A 1WGKA 2OEDA 5HFYA 1FCCC 1MI0A 2QILA 1EWYC 2RDHA 5BYRA 1XLOA 3P4PB 2KDMA 3H8HA 2QMTA 5H92C 1KRHA 3W5VB 1JWSD 1GPXA 1FEHA 1ZXHA 1NYRA 1ZDVA 3FC4A 1Y56A 5BYSA 4LLGM 3BVZA 1RM6C 1FXIA 1JCKB 3EGRA 4IKGA 5H8YE 4DXFA 1D5MC 1R7SA 1VRAB 1VDVA 1WWTA 3V3XA 3AE5B 4A9AA 4KKJA 4RGTA 5AUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB5 A;  3AEG B;  2MJ3 A;  3AEF B;  1L5P A;  1FM0 D;  1YQ3 B;  3DWM A;  2MH7 A;  3CIR B;  4JWS C;  4ZOH C;  1N62 A;  2KMM A;  3AE8 B;  1TKE A;  5G5H A;  4HRS A;  1QOF A;  2MJE A;  2PIA A;  4US9 A;  1OQR A;  1J7C A;  1QOA A;  3NVW A;  4HRO A;  3VRB B;  4YTM B;  5C3J B;  1CJE A;  2L83 A;  4YXD B;  2W3R A;  1SF0 A;  2B76 B;  3ZYY X;  1NVI D;  1GAQ B;  2Y5C A;  1FMA D;  1TKG A;  1FRD A;  3VRA B;  1FIQ A;  1SIJ A;  2L52 A;  2FBW B;  1E7P B;  3AE2 B;  1TYG B;  3HRD D;  1AWD A;  1N61 A;  1UWM A;  3AE7 B;  1PUT A;  1XLP A;  2K9X A;  4IDI A;  1WXQ A;  1JQ4 A;  1L0V B;  2H88 B;  3LXF A;  1E0Z A;  1I7H A;  3AMZ A;  2KAJ A;  3EUB 2;  4C7Z A;  4C7Y A;  4P6V F;  1QF6 A;  1A70 A;  2CJN A;  4JWU C;  4US8 A;  1QOB A;  2HTM E;  2H89 B;  1QT9 A;  2W55 A;  2DBY A;  1DOX A;  3NVZ A;  4YT0 B;  5EE3 A;  5C2T B;  1XLQ A;  1JW9 D;  2MJD A;  1QLB B;  4LTU A;  3W9C B;  1T3Q A;  3AE9 B;  1ZOY B;  2BT6 A;  1WYG A;  2WS3 B;  2N0S B;  1VJK A;  2K5P A;  3KWL A;  1DOY A;  1ZUD 2;  4YTP B;  3AEA B;  5EE0 A;  2AX5 A;  3CWI A;  5AUI A;  4WQM A;  2JX5 A;  1AYF A;  3AE3 B;  3ETR A;  3P4S B;  4YSX B;  1DGJ A;  2PKO A;  1NI3 A;  2WP9 B;  3AH7 A;  2ACZ B;  4C80 A;  1FFV A;  1ZP0 B;  1JRP A;  1F0Z A;  3AE6 B;  3NS1 A;  1RFK A;  1L6U A;  1FRR A;  1YQ4 B;  1KFY B;  3AE1 B;  3NRZ A;  1TKY A;  1JWA D;  1FFU A;  1RYJ A;  3AEB B;  3P4Q B;  3P63 A;  5GXG B;  1J7A A;  3SFD B;  2Q5W D;  1B9R A;  1DOI A;  5G5G A;  1OQQ A;  1OFF A;  1WRI A;  3AED B;  2WU5 B;  3P1M A;  3BII D;  2K22 A;  5EE1 A;  3VR9 B;  2LEK A;  1YJI A;  3WCQ A;  1RWS A;  1L6V A;  2BS3 B;  1ZXI A;  2CJO A;  1N60 A;  4KX6 B;  4YSY B;  1IUE A;  1JAL A;  1FXA A;  3FAH A;  3SFE B;  1E6E B;  1V8C A;  1XLN A;  3AV8 A;  3AM9 A;  5MPO A;  1YJJ A;  4FXC A;  3NVV A;  1CZP A;  1NEN B;  1N63 A;  2G1E A;  2JQR B;  1V97 A;  1FO4 A;  4YSZ B;  2OHF A;  1N5W A;  1PFD A;  1J7B A;  2WQY B;  4JX1 C;  4WWM A;  4USA A;  3HUI A;  3RPF C;  4ITK A;  2WLB A;  1VLB A;  2WU2 B;  3AN1 A;  3VR8 B;  2WDV B;  2WDQ B;  3B9J A;  3HVZ A;  4N59 A;  1E10 A;  2CU3 A;  2EKI A;  3LB8 C;  1NYQ A;  5EE9 A;  4ZHO A;  1WGK A;  1TJE A;  2WDR B;  3P4R B;  2QIE B;  3AE4 B;  1EWY C;  3ABV B;  3W5U B;  1XLO A;  2PVG C;  3B2G A;  3NVY A;  2PVO D;  3P4P B;  2W3S A;  3AEE B;  3DWG C;  3PO0 A;  1QOG A;  5H92 C;  1KRH A;  2E3T A;  3W5V B;  1NEK B;  2QJL A;  4YTN B;  1GPX A;  1PDX A;  1JWB D;  2BS2 B;  3SR6 A;  1NYR A;  1XO3 A;  4ZHP A;  3FC4 A;  1SB3 C;  4N58 A;  1KF6 B;  4N6E B;  2W54 A;  2M19 A;  1RM6 C;  1FXI A;  1E9M A;  3B2F A;  5H8Y E;  2BS4 B;  1R7S A;  1N5X A;  2M56 B;  1VDV A;  3L4P A;  2DWQ A;  1JRO A;  1WWT A;  4A9A A;  3AE5 B;  3AEC B;  1ROE A;  5AUK A; 
#chains in the Genus database with same CATH topology
 3VXW A;  1OEY J;  4ASW C;  1N62 A;  2XK5 B;  2WNM A;  1V1O A;  1ZW7 A;  3RNG C;  2FCM A;  1QOA A;  4HRO A;  3L13 A;  1I35 A;  4C4V A;  2L83 A;  2LJI A;  1WXA A;  2B76 B;  2WGS A;  1V1P B;  3V60 A;  2YEP F;  3PHW B;  4MEM A;  1UF0 A;  4HEA 1;  2XBB C;  1AWD A;  2O2V A;  3VHT C;  2L0T A;  1J0G A;  2N1V A;  3A9K A;  4CYE A;  2IPK D;  1SXT A;  3MHZ A;  2JSV X;  3JSV A;  2ZCB A;  3ZNZ B;  1FCL A;  5HI1 A;  4YT0 B;  2KJR A;  3VQI A;  3WAN A;  4II3 B;  1UZX B;  2LGI A;  3RNA C;  1VJK A;  5D6J B;  3TEW A;  2MP2 A;  1U4A A;  5AEK B;  4WQM A;  4DBG A;  3AE3 B;  5IO9 A;  2RPV A;  4YSX B;  1WJU A;  3X23 A;  2EKE C;  3GZN I;  2REX A;  3UI3 A;  2FIF A;  4KDI C;  4GGQ A;  2VH1 A;  4MM3 A;  1JWU D;  5D3I B;  1P9D U;  4LCD E;  4HKQ A;  2N7E A;  1GNU A;  1UGJ A;  2CJO A;  2JWU A;  4L2Y A;  3Q8B A;  4HK2 A;  1K52 A;  2G1E A;  2D10 A;  2KOX A;  2BYT A;  2N9P C;  5DCN A;  4ZDV A;  2K0P A;  1XD3 B;  3DBS A;  2INN E;  5IA7 A;  3Q3J A;  4BKS A;  1WSP A;  1K8R B;  2BS4 B;  1N5X A;  2L8J A;  4RGO S;  4E74 A;  2K25 A;  2MBO A;  3K9O B;  2WXR A;  3RT3 B;  4MGK E;  5CHW A;  4US9 A;  4D2K A;  4C4V B;  2KDE B;  2PMV A;  4HCN B;  3NHE B;  4AQ7 A;  3MFG A;  4L1B A;  4F7Z A;  1NVI D;  1XQQ A;  2KQS A;  5G55 A;  1FRD A;  3TEZ A;  1E8Z A;  4JE3 B;  4CO7 A;  2O2V B;  3ZRF A;  3TUO A;  3A9K B;  3L10 B;  1F2R C;  2MHJ A;  3UGB B;  1E0Z A;  3UQA A;  1QF6 A;  2KWU B;  1TGZ B;  1WM2 A;  3I9V 1;  4JPS A;  4A6Q A;  2KWD A;  2PW9 A;  1BUI C;  3QJZ A;  1XLQ A;  2CKH B;  1FNW A;  3W9C B;  1T3Q A;  1ZOY B;  2MP2 B;  4GDK A;  3V62 A;  1DOY A;  2WXN A;  1HZ6 A;  5TR5 A;  1C77 A;  3ETR A;  2V0G A;  2ZW1 A;  4M00 A;  2RDB C;  2GB1 A;  1JRP A;  3VUW A;  2LRU A;  3S2A A;  4K7U A;  4KZ0 A;  2Q5W D;  1UUP A;  2RGF A;  5KHO A;  4GU2 A;  1YJ1 A;  5IOI A;  1V2Y A;  2WU5 B;  4BBN F;  2HDE A;  4ZRP A;  3ZJU A;  1YJI A;  2HE7 A;  3ML8 A;  1IUE A;  2AQ3 B;  3U2S C;  2J4X A;  2K8B A;  2JQR B;  5G2N A;  3RUL A;  2NMQ A;  3HUI A;  4ZYN A;  1SBB B;  4N59 A;  1ET9 A;  4OHJ A;  1TJE A;  3OJ3 A;  2QHO A;  4M02 A;  3U52 E;  2QCZ A;  2I1J A;  4YTN B;  1PDX A;  3RI7 C;  4N58 A;  1IPG A;  3NG0 A;  4RCO A;  4BZA A;  2JYT A;  3L4P A;  2GLS A;  4WWP A;  3AB5 A;  4LNK A;  2KYW A;  3Q2A C;  1L5P A;  5HHD G;  3A1Q A;  3AE8 B;  4FJV B;  1MFW A;  2JRI B;  2ZEQ A;  2WXL A;  4NJ6 A;  3RYT A;  4DK5 A;  2GMI C;  4NQK E;  3QQ8 B;  3VRA B;  3Q8F A;  1YN3 A;  3ECI A;  4TQ1 A;  1PUT A;  2O6V D;  4GDL B;  2EEL A;  2Z59 B;  4MEL A;  4WQO B;  2BB6 A;  2DBY A;  3O65 B;  2BF8 B;  3UQB A;  4LTU A;  3WAM A;  2PE6 B;  4MJS A;  4AJY B;  3L17 A;  1ZUD 2;  3EC8 A;  3CWI A;  2KAN A;  4W9F A;  1FFV A;  4LDT D;  1EUV B;  1QIL A;  4H2A A;  1HTO A;  4CHK A;  4DDG D;  2JT4 B;  2D3C A;  4WJO A;  1Y8R C;  2LHD A;  2WWZ A;  1S3S G;  2MRP A;  1H4R A;  1IGC A;  3SDL C;  3BIN A;  3PRM B;  3Q3M C;  3V6E B;  1TIF A;  1A5R A;  2M1M A;  4BVU C;  3P42 A;  2R2O A;  1V9J A;  3DVG X;  4CQN A;  3RUI B;  3FIL A;  4XZ4 A;  3VH4 B;  2K8H A;  3I63 C;  3H6N A;  3QAR A;  3ABV B;  2KDF B;  2ON8 A;  2MSE D;  2PVG C;  1P7E A;  1QQR A;  1AW7 A;  1QOG A;  2E3T A;  3VTV A;  2QJL A;  1XO3 A;  1STE A;  5DPT A;  3TSS A;  1SIF A;  3MC8 A;  1K51 A;  3WA0 A;  4HKZ E;  3ZO5 B;  5J17 A;  3A1Q B;  2L76 A;  1EO6 A;  4EZL A;  4MDK E;  4MSQ B;  4DXG A;  2WXM A;  4GN1 A;  5E6J A;  2IGG A;  2DYB A;  3EHV A;  4RFB A;  3R66 C;  3U7Z A;  3VUX A;  4W9D A;  2H88 B;  3N1X C;  3CF6 E;  1YIW A;  3R2I A;  4XWT A;  4P6V F;  2Y5B B;  2M0A A;  3TIX A;  3Q8C A;  4EOY A;  3TEX A;  1QLB B;  4MJS B;  3E9S A;  1VZ6 A;  1WRD B;  3AU4 A;  4ZRI A;  3AEA B;  1KJT A;  5D94 A;  1ENF A;  1WE6 A;  2ACZ B;  2N7J A;  1K50 A;  3KQ4 A;  4C80 A;  2C5L C;  2HD5 B;  4IC7 B;  2AL6 A;  2N9E B;  2LAS A;  2NBU A;  1WXV A;  3V05 A;  2VZK B;  3P1M A;  4ACF A;  4P1B C;  2JU6 X;  2A4Z A;  1ZXI A;  3R3M A;  3FIL B;  1L0X B;  2I2Y A;  2LGS A;  4I6L B;  3R7Q A;  3DBH B;  1V5T A;  2KQ7 A;  2ZVO A;  1WGK A;  2KWV B;  2OED A;  3PZD A;  5L95 C;  2QMT A;  1GC7 A;  4M8N A;  3H7S A;  1FEH A;  1GUA B;  3FC4 A;  3IVF A;  1RM6 C;  3EGR A;  4TUU A;  4GOC A;  1IYF A;  1ZGU B;  4ICU A;  2KJ6 A;  1XEE A;  2QC8 A;  1WGR A;  3KUZ A;  4HPL B;  1QOF A;  2MJE A;  1YOV B;  1WGY A;  2K8C A;  2JZZ A;  4KGR A;  2LD9 A;  1TKG A;  1R4M B;  2G4S A;  1MVK A;  2J0J A;  2OJW A;  3E56 A;  2KT7 A;  1WR1 A;  3GOE A;  1I4P A;  4I6N B;  4REZ A;  5CHF A;  3U7D A;  3ZNH B;  4C00 A;  1TBE A;  1KTK A;  3QX1 A;  1MPE A;  4YWG G;  1WI0 A;  1OGW A;  4K3C A;  3NZ3 A;  2FAZ A;  1MG8 A;  2CHX A;  2D11 A;  1WYG A;  1WX9 A;  3B08 A;  2AX5 A;  2FCS A;  2LGY A;  1M4V A;  3AH7 A;  4RMA A;  4BKS D;  2JXT A;  3NS1 A;  1RFK A;  3I3T B;  5JHA A;  4NNJ B;  1LM8 B;  3ENE A;  4W9H A;  2C7H A;  4HCP B;  3NJT A;  1HXY D;  1T0S C;  3EEC A;  1WIA A;  3CSF A;  4EZK A;  1NEN B;  4ZRK A;  2CU1 A;  2GI9 A;  3V61 A;  4K3B A;  2WU2 B;  3HVZ A;  2DZI A;  5JXV A;  2GBM A;  1NYQ A;  1WMH A;  2DAF A;  4FJZ A;  3VAW A;  3AE4 B;  1UBQ A;  4WWO A;  3B2G A;  3DVN V;  3C19 A;  2O6V B;  2PJH A;  1R4N I;  1HEZ E;  1P98 A;  2NPT A;  4ZHP A;  3J9C A;  4EE2 A;  4XC2 A;  2L7R A;  2JF5 A;  3OWE B;  3JW0 X;  3DBL I;  1L4Z B;  3ZLZ A;  1JRO A;  4OW0 A;  1TZO A;  1ROE A;  4HLE A;  3M95 A;  1VZ8 A;  4B0M A;  1YX6 B;  4PS7 A;  3WIM A;  3K9P B;  4J6I A;  1C1Y B;  2BPS A;  3T3O A;  1M94 A;  3UF8 A;  2OOB B;  3W1Y A;  4XWW A;  1ZKH A;  3H7P A;  2NBV B;  2L32 A;  3CST A;  2N1W A;  2LZ6 A;  2V3S A;  3SU8 X;  4TQ0 A;  3KUC B;  4C7Y A;  1WJ4 A;  5E6N A;  3PHX B;  3ZDT A;  1C78 A;  2BB5 A;  2PPH A;  2PEA A;  2GBN A;  1KM7 A;  4GLS C;  4HJK A;  4JGH B;  2JXX A;  4G11 A;  2KO3 A;  5FR6 A;  1K53 A;  1P7F A;  4ANV A;  3L08 A;  3ZJV A;  1VZ7 A;  4WH4 A;  1YN5 A;  4EZJ A;  3NZU A;  2V4I B;  1OFF A;  4KZC A;  5FR3 A;  3AED B;  4KGT A;  3T9L A;  3QA8 A;  3DHH C;  4N9F 4;  4IOI E;  1IP9 A;  2IZV B;  2KLC A;  1X1M A;  3AM9 A;  3RNE C;  3NUH B;  1CK1 A;  3M63 B;  4WAF A;  4W9C A;  1J7B A;  3ZDM C;  3N1Y C;  2JRH A;  1WMH B;  4TKN A;  1E10 A;  3MHS D;  1ZE3 D;  1UNS A;  1UGM A;  2WDR B;  5AZF A;  2M0X A;  4ARC A;  5D3D A;  2PVO D;  3DWG C;  1VCB A;  2LRW A;  2IO3 B;  1JWB D;  4TMA B;  2LGD A;  3U4E G;  4ZRQ A;  1UBI A;  1D4B A;  1T6B X;  2MCN B;  2KZR A;  2VRR B;  2JYE A;  4GB9 A;  3C0R B;  3KYD D;  3DHG C;  1HTQ A;  4A3O A;  2IDY A;  3QHT A;  2G4D B;  2L05 A;  1T0Y A;  3PS6 A;  3PLU A;  3PZ8 A;  2NTT A;  2BGF A;  2ZCC A;  1I42 A;  5D7G A;  3QWZ B;  4HPP A;  1J19 A;  2DX5 B;  3GB1 A;  2VZK D;  1WXQ A;  1SEB D;  3B0A A;  2KLG A;  3KUD B;  2MLB A;  1A70 A;  4US8 A;  1AN8 A;  3Q8A A;  3LJ3 A;  2FCQ A;  1GB4 A;  3NVZ A;  2ZZP B;  3AU5 A;  4BBN C;  4HXD A;  3AE9 B;  2MWS B;  4KGS A;  4A20 A;  1ISN A;  5E6O A;  3KW5 B;  1GOZ A;  1JML A;  1WYW B;  2KC2 A;  1L6U A;  4WJN A;  3JSV B;  2M4N A;  1FFU A;  1RYJ A;  4S0R A;  5GXG B;  2N9K A;  1WX7 A;  4MH0 E;  5FKA C;  3APF A;  2K6Q A;  3JYU A;  4M0W A;  2JWZ A;  3VR9 B;  1TY0 A;  1N60 A;  4KX6 B;  1FXA A;  3UIO B;  3AUL A;  4MAC A;  2IGD A;  4FAD A;  4B6W A;  1R4N B;  2XEW A;  1IBX A;  4A8X C;  2RDG A;  2DHZ A;  4MM3 B;  1ACC A;  2CU3 A;  3DBL B;  3IAS 1;  3PSE B;  3NVY A;  2KDI A;  2IGH A;  4MH8 A;  1C9F A;  3PT2 B;  1SB3 C;  4FHJ A;  4N6E B;  2GBK A;  4RNA A;  1N6Z A;  4ARI A;  2J52 A;  2FCN A;  2SAK A;  1E8Y A;  4ANU A;  2DYM A;  4LJO B;  1V81 A;  2D3A A;  4X57 B;  1WXS A;  3O13 A;  4RM9 A;  1OQR A;  2KDB A;  2INC C;  4XDC A;  2W3R A;  5FK9 C;  3BYT B;  2IO1 B;  3H1U A;  1SIJ A;  4P7I A;  1V80 A;  3RFZ B;  4IW0 A;  1WE7 A;  2CR5 A;  4S17 A;  1TYG B;  5CTR C;  2KK8 A;  3DBH I;  1CQV A;  2YLM A;  4M01 A;  1LXD A;  3IFW B;  1DYQ A;  4FUL A;  1XT9 B;  3BZD B;  3RCZ A;  1DOX A;  2UWQ A;  1D5X C;  4AWJ A;  1WX8 A;  1JW9 D;  2D3B A;  1XXG A;  2WXK A;  1HA5 A;  3KVF B;  5GMV A;  3JVZ X;  1PGA A;  2ZNV B;  1D6E C;  1Q10 A;  2KJH B;  4DHZ B;  4WJQ A;  1XCQ L;  3AE6 B;  1YNT E;  3DVN U;  2NS5 A;  1TKY A;  1JWA D;  3P63 A;  3A33 B;  2G9H D;  3ZVV A;  4M0W B;  2KTR A;  1R4M I;  4DHJ B;  4MGY E;  3W2D A;  1SJH D;  4OZA A;  2WXO A;  4GDK B;  5DPS A;  2LEK A;  3RNC C;  4B0E A;  1IBX B;  4WIP A;  1PFD A;  1ESF A;  4W9K A;  3RPF C;  2ZJD A;  3ZW3 A;  2IND C;  1GC6 A;  3ZTC A;  1FNV A;  1Z5S B;  3ZKJ C;  2RDH A;  4FN2 A;  2FNJ B;  2KDM A;  2MBH A;  3H8H A;  2ZPY A;  1GG3 A;  4K7S A;  1JWS D;  2CHW A;  5H8Y E;  1R7S A;  1VRA B;  2BKF A;  4GIV A;  1I4X A;  2KXJ A;  2Z0D B;  4EFO A;  2KMM A;  5G5H A;  1RLF A;  2PIA A;  2BYF A;  3HK0 A;  5CX3 A;  2I38 A;  1SF0 A;  2Y5C A;  4NJC A;  1LQB A;  2FBW B;  2ZNV C;  4UDU C;  2MBE A;  1L0V B;  3EUB 2;  2FUG 1;  1UD7 A;  1QT9 A;  2PTL A;  3BVG A;  4FBJ B;  3R8B A;  4XGA B;  2A5U A;  5LXI B;  4XYC A;  5LLI A;  1MJD A;  1WJN A;  2EMS A;  4E3C A;  3P4S B;  4LJP B;  2QEJ C;  2WX1 A;  4KDL B;  4JQW C;  4G3X B;  3W5U B;  3P4Q B;  1T0Q C;  2DLB A;  2KTR B;  1WRI A;  2B3A A;  4IWP A;  1NDD A;  3HHM A;  4MT5 A;  3DVG Y;  1E7V A;  2K6D B;  1F1H A;  1YQB A;  3MP9 A;  4K7W A;  4BOS C;  1YJJ A;  1YMH E;  2KNB A;  4G0N B;  2G3Q B;  4YSZ B;  1N5W A;  1VLB A;  4LNO A;  2WDQ B;  2EKI A;  4LK0 M;  2MEK A;  2WXG A;  3ONS A;  3BY4 B;  3OLM D;  5JZE B;  1KLG D;  2C9W B;  1RAX A;  4M8M A;  4W9I A;  3DCG A;  1P3Q U;  2M19 A;  2W54 A;  3QIJ A;  1WY8 A;  2DWQ A;  4JL9 A;  1V6E A;  1Z2M A;  1T5X D;  2MJ3 A;  1YQ3 B;  4ZOH C;  3U8Z A;  1B1Z A;  1TS4 A;  4YXD B;  2JY6 A;  3ZYY X;  1HE8 A;  1FMA D;  2V3N A;  4W9L A;  1RFA A;  3N30 A;  2ZVN A;  4KV2 A;  1Q1O A;  2WXJ A;  4WAA A;  4XX5 A;  5BO4 B;  1UWM A;  2CS4 A;  3GP7 A;  2LI5 A;  3IG3 A;  1E7U A;  3N32 A;  3IT6 B;  2WXP A;  2KMA A;  2NTS A;  2XN9 C;  1TS3 A;  1UWX A;  1RRB A;  3L16 A;  3DPD A;  2KAC A;  3KWL A;  2LVP A;  2PKO A;  1NI3 A;  4PS3 A;  2KVR A;  5HKH A;  4OVZ A;  4LNI A;  4C56 C;  1OEY A;  1G6J A;  2WXF A;  3N3K B;  4IWO A;  1PQS A;  1EWC A;  2V4L A;  2IO0 B;  2NBW B;  4RM8 A;  2J0M A;  1RWS A;  3BYY B;  5KHQ A;  4IWQ A;  1F52 A;  3URY A;  1YD8 U;  2W82 A;  4USA A;  2WQY B;  4L23 A;  4AP4 C;  4NY0 A;  5IKC M;  3QAQ A;  2UYZ B;  5E6P A;  4RF1 A;  1EM7 A;  2QIE B;  3BVM A;  1E8X A;  1I4Q A;  2BKR B;  4KKI A;  2KN5 A;  1T0R C;  2KMC A;  1F9J A;  2DZJ A;  3EA6 A;  3U30 A;  4DXA B;  1V1P A;  1SE4 A;  2J7Q B;  1WGG A;  4LNN A;  3QK0 A;  4A55 A;  3BK2 A;  3DWM A;  3GS2 A;  3N1Z C;  3WAO A;  2WYQ A;  5BMG A;  2LVQ A;  4JLC A;  1MHH E;  1FIQ A;  4BKG A;  1QKZ A;  3Q14 C;  2L0F A;  1E8W A;  1XCT L;  3CMM B;  4DHJ D;  2Y3A A;  1LO5 D;  4OZC A;  1I7H A;  3RMK C;  2KAJ A;  5JHB A;  2L1A A;  2RSU A;  4DDI D;  1JRU A;  2BVC A;  3P2B A;  2IY0 B;  1WGD A;  2MJD A;  2WS3 B;  3ZTD A;  5C23 A;  3R7R A;  3TMP B;  1S1Q B;  3PTF C;  1FD6 A;  3VDZ A;  2AQ2 B;  1WZ3 A;  4JIO U;  2BW2 A;  1BML C;  1VD2 A;  4IG7 B;  1KLV A;  3QC8 B;  1OQY A;  2IY1 B;  1OQQ A;  5BMH A;  3NZS A;  2D5G A;  1J8C A;  1WM3 A;  2GOW A;  3WCQ A;  1F77 A;  4ZYS A;  2QSD A;  3Q3O C;  4YL8 A;  2PLP A;  3SFE B;  1XLN A;  1KOT A;  5DPR A;  4WWN A;  5MPO A;  2INP E;  5J18 A;  2DZK A;  1V97 A;  4KSK C;  5HG2 A;  4ITK A;  4TSS A;  3VR8 B;  1I4R A;  3NS8 A;  4PYZ A;  2AL3 A;  4AS1 A;  2KKC A;  4FJY A;  4OVU A;  3PO0 A;  1EU3 A;  2BS2 B;  3VTW A;  5EDS A;  2JUO A;  4Q2J A;  3OJ4 B;  1HQR D;  3PRE A;  4J3O D;  4MGZ E;  3AEG B;  3BK1 A;  4JWS C;  3CIR B;  2R2Q A;  4HRS A;  4NPN A;  3TJP A;  3PPA A;  2NPT B;  4IM3 A;  3RNB C;  2KX0 A;  2TSS A;  1TZ1 A;  2V9H A;  3AE2 B;  2LJ5 A;  2BWF A;  3LXF A;  1LFD A;  3ZQ4 A;  2LMC A;  2CJN A;  2J0K A;  5J2R A;  2HTM E;  1FPY A;  4A3P A;  2BTE A;  1KLU D;  2LUE A;  1C79 A;  5T8I A;  4AJW A;  1XF5 L;  1C76 A;  1YX5 B;  3H7P B;  3ZXR A;  1L0Y B;  2K5P A;  3DBR B;  2JX5 A;  1GJZ A;  2C7M B;  1AYF A;  1VR9 A;  3I5J C;  2GRI A;  2AEH A;  3LYY A;  2GBJ A;  3L0W B;  1FRR A;  1KFY B;  3L54 A;  2G45 B;  2WHI A;  3RZW C;  3TBL D;  3BII D;  2WXI A;  4NAW A;  4W9G A;  4OVV A;  5L83 A;  3ML9 A;  2LXA A;  2NCN A;  3DQV A;  2FE8 A;  1V8C A;  3W1S A;  3PGE A;  1WF9 A;  3MTN B;  4XDD A;  2OHF A;  5BYQ A;  1PGX A;  3TCA A;  3HM6 X;  2J42 A;  2AWT A;  2WDV B;  3ZGZ A;  1V86 A;  1C4C A;  1SJE D;  2LGX A;  5HFY A;  4ANW A;  3WAL A;  1OTR B;  4K1R B;  3PRZ A;  3P4P B;  4KIK A;  4HDQ A;  1EF1 A;  2FUH B;  3W5V B;  5IN7 A;  2MX2 A;  3APC A;  1ZXH A;  3PV1 A;  1ZDV A;  4P1C C;  2MW5 A;  3BVZ A;  4DXF A;  4IKG A;  1D5M C;  3APD A;  2V1Y A;  3HIZ A;  3AE5 B;  4RGT A;  4BOZ B;  2DAJ A;  2XNA C;  4GDL A;  4EUT A;  3GE3 C;  2N9X A;  4FA6 A;  1V49 A;  3LDZ E;  3TEY A;  4YTM B;  3A4R A;  5IAA C;  3N9Y C;  3ZXV A;  3SEB A;  2Y5P A;  4B9K A;  1MHX A;  1QZE A;  3HRD D;  1V5O A;  3M62 B;  1XLP A;  3VVW B;  2K9X A;  2KWC A;  1IGD A;  1WXM A;  3R2T A;  5EE3 A;  5C2T B;  4ZRJ A;  1TS5 A;  3M3J A;  2JZP A;  3DHI C;  4NJ7 A;  2RMM A;  2MBB B;  3NY5 A;  2R61 A;  3IXS A;  4G50 A;  4W9J A;  2K39 A;  3QCA A;  3BWU D;  4RF0 A;  2WP9 B;  2ZPN A;  3Q3F A;  1F0Z A;  4EKU A;  1NI2 A;  4PYU A;  1J7A A;  5TSS A;  2I1K A;  4NAW B;  4ICV A;  4W9E A;  2D3G A;  4RGN A;  5CHV C;  2K22 A;  2BYE A;  3VH3 B;  3FAH A;  2WX0 A;  2N9L A;  4FXC A;  3NVV A;  1L7Y A;  1NBF C;  3EFU A;  1E5W A;  2IO2 B;  2WLB A;  2M17 A;  1I4H A;  3VTU A;  2SEB D;  4KIK B;  2MBQ A;  3P4R B;  2ZW0 A;  2YVC A;  3HM3 A;  4OZB A;  2KVZ A;  2W3S A;  2LUM A;  1KF6 B;  4GMV A;  3H9D A;  2OJR A;  5D2M B;  3B2F A;  1H8C A;  2ASQ A;  3ALB A;  2DZM A;  3IBE A;  4KVG B;  3GZN B;  3A9J A;  4FHK A;  2Z8L A;  1TKE A;  1I4G A;  1WR6 E;  3ZRC A;  4GXB A;  1EF5 A;  4DQO C;  4HJG E;  3RN9 C;  1GAQ B;  1TT5 B;  2AQ1 B;  4DHZ E;  2PE9 A;  1D3Z A;  2LXC A;  4NQL B;  3Q3N C;  2WXH A;  2E6X A;  2Z0E B;  1HZ5 A;  2CHZ A;  4O1N A;  4R3D A;  3V6C B;  4I6P A;  4II2 B;  2J53 A;  1QOB A;  2BYV E;  2H89 B;  2KQ4 X;  4MSM B;  2DYO A;  1ZPS A;  2BT6 A;  1SE9 A;  3W1S C;  2DEN B;  1CMX B;  1UEL A;  3SHQ A;  1SE2 A;  3ZNI D;  3OG5 A;  2QDF A;  3T3N A;  1ZDX A;  4RH6 A;  1FXT B;  4AUQ C;  5IP4 D;  3AE1 B;  1P1A A;  2BWE S;  5G5G A;  2C60 A;  4F8C B;  4PT5 A;  2UU7 A;  2HJ1 A;  5EE1 A;  1L6V A;  4YSY B;  2K3U A;  1C4P A;  5I4D A;  2KFK A;  1CZP A;  2KHW B;  1SGH A;  1FO4 A;  4JX1 C;  4WWM A;  3B9J A;  1MG4 A;  1SE3 A;  4E71 A;  1E90 A;  1AAR A;  3LB8 C;  3KWV A;  2JZ3 B;  1ET6 A;  3AEE B;  4FLH A;  2IYD B;  5LXH A;  1YN4 A;  1P0R A;  1SSN A;  3B1L X;  3RNF C;  4MGI E;  1E9M A;  1KH0 A;  3MC9 A;  4HPM B;  4AOF A;  2M56 B;  4NAM A;  4BFR A;  3GE8 C;  4IM0 A;  1TTN A;  2N4F A;  4XE0 A;  3A9J B;  3AEF B;  1FM0 D;  4BKT A;  2L3Z A;  3Q8E A;  1J7C A;  3VRB B;  3WAP A;  4HVB A;  5C3J B;  1CJE A;  3TL5 A;  3UIN B;  3RD2 A;  3A4S C;  2KX3 A;  2NVU I;  2D07 B;  4IDI A;  1JQ4 A;  2LHE A;  3AMZ A;  3ZUN A;  2BQQ A;  3I57 A;  4QAY A;  2LFI A;  1GB1 A;  2GBR A;  2KN4 A;  1TY2 A;  2DNF A;  3VUY A;  3Q69 A;  2N0S B;  3DDC B;  5DPW A;  5BMI A;  2M8S A;  2N7D A;  5AZG A;  1PYW D;  3KLS X;  3PVL A;  2MA9 B;  3HVD A;  1YQ4 B;  3NRZ A;  3NOB A;  3SFD B;  2KD0 A;  1B9R A;  3ZJT A;  2W9N A;  2FID A;  2RD0 A;  2X38 A;  3PLV A;  3EFC A;  2O6V A;  1C3T A;  2KFJ A;  2KFK B;  1F2R I;  2VH2 A;  4IM2 A;  1UH6 A;  3AV8 A;  4IUM B;  1N63 A;  3KYC D;  5JH5 C;  3PZ7 A;  1EU4 A;  1LGR A;  4DWF A;  3IT4 B;  2WDT B;  1WGH A;  4PK1 A;  4ZHO A;  2BBC A;  2HJ8 A;  3T8M A;  2MQJ A;  4EEW A;  3DBR I;  1WFY A;  2KC1 A;  1BT0 A;  2YEP B;  1NEK B;  3SR6 A;  2V3P A;  4F1S A;  2ICI A;  1Q5W B;  4RGM A;  1BXT A;  1WZ0 A;  3X0W A;  1L2N A;  4WJP A;  1C4A A;  2D2Q A;  3AEC B;  3AI5 A;  4TV3 A;  3C8Y A;  2K1F A;  4PS8 A;  3VFK A;  2MH7 A;  3RZF A;  1Q0W B;  4HWI B;  1JWM D;  3UIP B;  2XK5 A;  3NVW A;  5LNK 1;  1TS2 A;  4WUR A;  2ONQ A;  2L00 B;  3ZNG C;  3MJW A;  2L52 A;  1FNU A;  1E7P B;  3KH0 A;  1N61 A;  1L4D B;  3AE7 B;  3Q6B A;  3MJ5 A;  4C7Z A;  4JWU C;  3SD5 A;  2W55 A;  2LVO A;  3DOW A;  2LWP A;  4KSL C;  2RR9 A;  3D32 A;  4YTP B;  5EE0 A;  2AYO B;  5AUI A;  4URK A;  2KTF A;  1DGJ A;  3IHP C;  3IAM 1;  1ZP0 B;  1PGB A;  3AXC A;  2EMT A;  4NZL B;  3AEB B;  2C7N B;  2HTH A;  1DOI A;  4A90 A;  2WXQ A;  2JVC A;  2RPQ A;  1D5Z C;  3MC0 B;  2BS3 B;  5AZH A;  4BAX A;  1JAL A;  4LNF A;  1E6E B;  2X8X X;  2NR2 A;  2IBI B;  3FKY A;  2IJ0 A;  5C1Z A;  3AN1 A;  4ANX A;  5EE9 A;  4P16 A;  1FCC C;  1MI0 A;  2QIL A;  1EWY C;  5BYR A;  1XLO A;  4LDT B;  5H92 C;  1KRH A;  1GPX A;  1NYR A;  1WH3 A;  3PRP B;  3N20 C;  1Y56 A;  2JPH A;  5BYS A;  4LLG M;  1WJ6 A;  1FXI A;  1JCK B;  4K81 A;  3OAW A;  4B95 A;  1VDV A;  3ZIM A;  1WWT A;  3V3X A;  4A9A A;  4GSW A;  4KKJ A;  5AUK A;  4HDO A; 
#chains in the Genus database with same CATH homology
 1XEE A;  2XNA C;  1I4X A;  1N62 A;  2KMM A;  5G5H A;  2WNM A;  1QOF A;  1V1O A;  2MJE A;  2PIA A;  3TEY A;  1QOA A;  4HRO A;  4YTM B;  2I38 A;  4KGR A;  2L83 A;  2LJI A;  1SF0 A;  2B76 B;  2Y5C A;  3N9Y C;  1V1P B;  1TKG A;  4NJC A;  2YEP F;  1MVK A;  3SEB A;  2Y5P A;  4HEA 1;  3E56 A;  2FBW B;  1MHX A;  4UDU C;  1I4P A;  3HRD D;  1AWD A;  4REZ A;  1XLP A;  2K9X A;  1L0V B;  1KTK A;  2IPK D;  3EUB 2;  2FUG 1;  1SXT A;  1MPE A;  4YWG G;  3MHZ A;  1IGD A;  2JSV X;  1QT9 A;  2PTL A;  3BVG A;  3NZ3 A;  1FCL A;  5HI1 A;  3R2T A;  4YT0 B;  5EE3 A;  5C2T B;  3R8B A;  3VQI A;  1TS5 A;  2JZP A;  1WYG A;  2LGI A;  2RMM A;  1VJK A;  2R61 A;  3TEW A;  3IXS A;  2AX5 A;  4WQM A;  3AE3 B;  3P4S B;  2RPV A;  3BWU D;  4RF0 A;  4YSX B;  1M4V A;  2WP9 B;  3AH7 A;  2QEJ C;  3UI3 A;  1F0Z A;  2JXT A;  3NS1 A;  1RFK A;  3W5U B;  3P4Q B;  1JWU D;  5D3I B;  2DLB A;  1J7A A;  5TSS A;  4NAW B;  1WRI A;  4HKQ A;  4RGN A;  2K22 A;  4MT5 A;  1UGJ A;  2CJO A;  2JWU A;  4L2Y A;  3FAH A;  3Q8B A;  1HXY D;  2N9L A;  3MP9 A;  1YJJ A;  4FXC A;  1YMH E;  1K52 A;  3NVV A;  1NEN B;  2G1E A;  2GI9 A;  4YSZ B;  1N5W A;  2WLB A;  1VLB A;  2WU2 B;  1I4H A;  2WDQ B;  2BYT A;  3HVZ A;  5JXV A;  2EKI A;  1NYQ A;  2SEB D;  4LK0 M;  3P4R B;  2MEK A;  2ZW0 A;  3AE4 B;  2WXG A;  3B2G A;  4OZB A;  2W3S A;  1KLG D;  2K0P A;  2INN E;  1HEZ E;  2LUM A;  4ZHP A;  3J9C A;  1KF6 B;  1WSP A;  4EE2 A;  2W54 A;  2M19 A;  3OWE B;  3B2F A;  2BS4 B;  1N5X A;  1L4Z B;  2DWQ A;  1JRO A;  4RGO S;  4OW0 A;  1TZO A;  1ROE A;  1T5X D;  2MJ3 A;  1VZ8 A;  4B0M A;  1YQ3 B;  4ZOH C;  2Z8L A;  1TKE A;  1I4G A;  2WXR A;  1B1Z A;  4US9 A;  4D2K A;  4DQO C;  2PMV A;  4HJG E;  4AQ7 A;  1TS4 A;  3MFG A;  4YXD B;  3T3O A;  3ZYY X;  4L1B A;  1NVI D;  1GAQ B;  4XWW A;  1FMA D;  2V3N A;  1FRD A;  3TEZ A;  2AQ1 B;  4JE3 B;  2L32 A;  3TUO A;  2WXJ A;  1UWM A;  2WXH A;  2E6X A;  3GP7 A;  4TQ0 A;  1F2R C;  1HZ5 A;  1E0Z A;  4C7Y A;  4O1N A;  4R3D A;  1QF6 A;  3IT6 B;  2J53 A;  1QOB A;  3I9V 1;  2H89 B;  2WXP A;  2KWD A;  2PW9 A;  4JPS A;  1BUI C;  2KQ4 X;  4A6Q A;  2NTS A;  2DYO A;  2XN9 C;  1XLQ A;  1C78 A;  2BB5 A;  1TS3 A;  1UWX A;  1FNW A;  3W9C B;  1T3Q A;  1ZPS A;  1ZOY B;  2BT6 A;  4GLS C;  2KAC A;  3KWL A;  1DOY A;  1SE2 A;  2WXN A;  1HZ6 A;  1C77 A;  1K53 A;  3ETR A;  1P7F A;  2PKO A;  1NI3 A;  3T3N A;  2V0G A;  2ZW1 A;  1ZDX A;  4RH6 A;  2GB1 A;  3ZJV A;  1VZ7 A;  1JRP A;  4WH4 A;  4OVZ A;  1YN5 A;  3AE1 B;  4C56 C;  2Q5W D;  1UUP A;  2WXF A;  5G5G A;  2V4I B;  1OFF A;  5FR3 A;  3AED B;  1EWC A;  2WU5 B;  4PT5 A;  4KGT A;  5EE1 A;  2HDE A;  4ZRP A;  3ZJU A;  1YJI A;  4IOI E;  1RWS A;  1L6V A;  3BYY B;  4YSY B;  1IUE A;  2K3U A;  1C4P A;  3AM9 A;  3URY A;  5I4D A;  2AQ3 B;  3U2S C;  2J4X A;  3NUH B;  1CK1 A;  1CZP A;  2JQR B;  2W82 A;  1FO4 A;  4WAF A;  4USA A;  1J7B A;  2WQY B;  4JX1 C;  4WWM A;  4L23 A;  2NMQ A;  3HUI A;  1SBB B;  3B9J A;  4N59 A;  4RF1 A;  1E10 A;  1SE3 A;  1ET9 A;  1UNS A;  1ZE3 D;  3KWV A;  3LB8 C;  4OHJ A;  1TJE A;  2WDR B;  1EM7 A;  2QIE B;  3BVM A;  1I4Q A;  4ARC A;  5D3D A;  2PVO D;  3U52 E;  1ET6 A;  4KKI A;  3AEE B;  3DWG C;  1YN4 A;  4YTN B;  1PDX A;  1JWB D;  4TMA B;  1SSN A;  3EA6 A;  4N58 A;  3U4E G;  1V1P A;  4ZRQ A;  1D4B A;  1SE4 A;  4RCO A;  1T6B X;  1E9M A;  1KH0 A;  2JYT A;  2M56 B;  3L4P A;  4NAM A;  2JYE A;  4A55 A;  3BK2 A;  3AB5 A;  4XE0 A;  3AEF B;  1L5P A;  1FM0 D;  5HHD G;  3DWM A;  3GS2 A;  3AE8 B;  3Q8E A;  2IDY A;  2WXL A;  1J7C A;  5BMG A;  3VRB B;  5C3J B;  1CJE A;  3PZ8 A;  2NTT A;  3VRA B;  1MHH E;  1FIQ A;  3Q8F A;  5D7G A;  1QKZ A;  1YN3 A;  1XCT L;  4TQ1 A;  1PUT A;  3GB1 A;  2VZK D;  1WXQ A;  2Y3A A;  4IDI A;  1SEB D;  2LHE A;  1JQ4 A;  1LO5 D;  4OZC A;  1I7H A;  3AMZ A;  2EEL A;  2KAJ A;  4GDL B;  2L1A A;  3I57 A;  1A70 A;  4US8 A;  1AN8 A;  3Q8A A;  2LFI A;  2BB6 A;  2DBY A;  1GB4 A;  1GB1 A;  3NVZ A;  2KN4 A;  2MJD A;  4LTU A;  4KGS A;  3AE9 B;  1TY2 A;  2WS3 B;  2N0S B;  3Q69 A;  5BMI A;  1ZUD 2;  1GOZ A;  3CWI A;  1JML A;  1FD6 A;  1PYW D;  2AQ2 B;  1FFV A;  3KLS X;  2BW2 A;  1QIL A;  1BML C;  1L6U A;  1YQ4 B;  3HVD A;  3NRZ A;  4H2A A;  1FFU A;  1RYJ A;  5GXG B;  3SFD B;  2N9K A;  1B9R A;  3ZJT A;  2LHD A;  1OQQ A;  5FKA C;  5BMH A;  2X38 A;  2D5G A;  1IGC A;  4M0W A;  3VR9 B;  1TY0 A;  3WCQ A;  1F77 A;  4ZYS A;  1N60 A;  4KX6 B;  1F2R I;  1FXA A;  2QSD A;  3SFE B;  2PLP A;  3P42 A;  1XLN A;  3AV8 A;  4MAC A;  2IGD A;  5MPO A;  2INP E;  4CQN A;  1N63 A;  1V97 A;  1IBX A;  3FIL A;  3PZ7 A;  5HG2 A;  4A8X C;  1EU4 A;  2RDG A;  4ITK A;  4MM3 B;  4TSS A;  3VR8 B;  1I4R A;  3IT4 B;  1ACC A;  2CU3 A;  4ZHO A;  3IAS 1;  2BBC A;  4AS1 A;  3ABV B;  2ON8 A;  2PVG C;  3NVY A;  1P7E A;  1QQR A;  3PO0 A;  2IGH A;  1AW7 A;  1EU3 A;  1QOG A;  4MH8 A;  2E3T A;  2YEP B;  1NEK B;  2QJL A;  1C9F A;  3SR6 A;  2BS2 B;  1XO3 A;  2V3P A;  1SB3 C;  1STE A;  2ICI A;  4N6E B;  3TSS A;  4RGM A;  1BXT A;  4RNA A;  1C4A A;  4ARI A;  4Q2J A;  2J52 A;  1HQR D;  2SAK A;  3AEC B;  4J3O D;  1K51 A;  4HKZ E;  3C8Y A;  3AEG B;  2DYM A;  3BK1 A;  2MH7 A;  3CIR B;  4JWS C;  1JWM D;  4HRS A;  3O13 A;  1OQR A;  3NVW A;  5LNK 1;  4XDC A;  1TS2 A;  4WUR A;  4DXG A;  2WXM A;  2W3R A;  2ONQ A;  5FK9 C;  3BYT B;  1SIJ A;  5E6J A;  2IGG A;  2TSS A;  3RFZ B;  2L52 A;  1FNU A;  1E7P B;  3AE2 B;  1TYG B;  4RFB A;  1CQV A;  1N61 A;  1L4D B;  3AE7 B;  3MJ5 A;  3U7Z A;  2H88 B;  3LXF A;  3R2I A;  1DYQ A;  3ZQ4 A;  4XWT A;  2LMC A;  4C7Z A;  4P6V F;  2CJN A;  3BZD B;  4JWU C;  2HTM E;  2W55 A;  2BTE A;  1DOX A;  1KLU D;  1C79 A;  1D5X C;  2M0A A;  5T8I A;  3Q8C A;  1XF5 L;  1JW9 D;  3TEX A;  1QLB B;  1C76 A;  3E9S A;  1VZ6 A;  1XXG A;  2WXK A;  1HA5 A;  1L0Y B;  2K5P A;  4YTP B;  3AEA B;  5EE0 A;  5AUI A;  2JX5 A;  1AYF A;  1PGA A;  1D6E C;  1DGJ A;  1VR9 A;  1ENF A;  1Q10 A;  3IAM 1;  2ACZ B;  2N7J A;  1K50 A;  2GRI A;  3KQ4 A;  4C80 A;  1ZP0 B;  1PGB A;  1XCQ L;  3LYY A;  3AE6 B;  1FRR A;  4NZL B;  1KFY B;  1YNT E;  3P63 A;  1TKY A;  1JWA D;  3AEB B;  1DOI A;  2G9H D;  4A90 A;  2WXQ A;  3V05 A;  1D5Z C;  2VZK B;  3MC0 B;  1SJH D;  3BII D;  2WXI A;  3P1M A;  4OZA A;  3W2D A;  2JU6 X;  2WXO A;  4GDK B;  2LEK A;  2BS3 B;  1ZXI A;  2FE8 A;  1JAL A;  1E6E B;  1V8C A;  3W1S A;  4B0E A;  1IBX B;  3FIL B;  4XDD A;  4WIP A;  2OHF A;  5BYQ A;  1PFD A;  1PGX A;  1ESF A;  1L0X B;  2IJ0 A;  2I2Y A;  3RPF C;  2J42 A;  3AN1 A;  2WDV B;  3ZGZ A;  1C4C A;  1FNV A;  1SJE D;  5EE9 A;  4P16 A;  1WGK A;  2OED A;  5HFY A;  1FCC C;  1MI0 A;  2QIL A;  1EWY C;  2RDH A;  5BYR A;  1XLO A;  3P4P B;  2KDM A;  3H8H A;  2QMT A;  5H92 C;  1KRH A;  3W5V B;  1JWS D;  1GPX A;  1FEH A;  1ZXH A;  1NYR A;  1ZDV A;  3FC4 A;  1Y56 A;  5BYS A;  4LLG M;  3BVZ A;  1RM6 C;  1FXI A;  1JCK B;  3EGR A;  4IKG A;  5H8Y E;  4DXF A;  1D5M C;  1R7S A;  1VRA B;  1VDV A;  1WWT A;  3V3X A;  3AE5 B;  4A9A A;  4KKJ A;  4RGT A;  5AUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...