2Y5CA

Structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
b'SDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADRENODOXIN-LIKE PROTEIN, MITOCHONDRIAL
publication title Structure and Functional Studies on Human Mitochondrial Ferredoxins
rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 29
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2y5cA00
1QOBA 2K9XA 2OHFA 3AE7B 3W5VB 4P6VF 4C80A 2CJOA 1VLBA 1YJJA 4A9AA 3NVZA 2H88B 2KAJA 2MJEA 3AE4B 1FFUA 1NI3A 1ROEA 1RWSA 3B2GA 1TKEA 4N59A 1E9MA 1NVID 1WXQA 1T3QA 1E7PB 2K5PA 2N0SB 3DWGC 5H92C 2M56B 3FAHA 1KFYB 4YTMB 2W55A 1TJEA 3L4PA 4JWSC 2EKIA 3AEEB 3AE3B 2DBYA 4YSXB 3ETRA 3W9CB 1NENB 3AE6B 4ZOHC 3B2FA 1ZXIA 1KRHA 3AECB 1FXIA 1RFKA 1XLNA 4ZHOA 1CZPA 3NVWA 3AEBB 2MJ3A 2WDQB 2G1EA 1QOGA 1JWAD 2JQRB 2WDVB 1WYGA 5C2TB 1CJEA 2K22A 1TKGA 1QF6A 5G5HA 2QJLA 2M19A 2W3SA 2WU2B 3AH7A 4HROA 1J7AA 1XLPA 3NVYA 3RPFC 1OQRA 1SB3C 1B9RA 1GAQB 1JW9D 1V97A 2Y5CA 2B76B 1V8CA 2WU5B 2MJDA 1A70A 4ITKA 1GPXA 3VRAB 1TYGB 5EE3A 1E10A 2PIAA 1PFDA 1N5WA 2W54A 2PVOD 3AEFB 1FXAA 2WP9B 4KX6B 1E0ZA 2WDRB 3SFEB 1VJKA 2MH7A 1JALA 3B9JA 3KWLA 1KF6B 3LB8C 5AUIA 2CU3A 3P4RB 4ZHPA 1RM6C 1XO3A 2LEKA 3P4SB 1ZP0B 1SF0A 3AE5B 3PO0A 1N61A 4YSZB 1JROA 2WLBA 4LTUA 2E3TA 3AM9A 1IUEA 3NVVA 1SIJA 3CWIA 4US8A 3AEAB 4JX1C 1JRPA 1AYFA 4N6EB 1FRRA 1WRIA 3NRZA 1WGKA 4WQMA 1YQ4B 1EWYC 4IDIA 1JQ4A 3AE9B 1J7CA 3LXFA 2W3RA 1FRDA 4N58A 3SR6A 4YTNB 3ZYYX 1N62A 1FIQA 2BS3B 3P63A 4USAA 1PDXA 2PKOA 3AE2B 1JWBD 3W5UB 1L6UA 1AWDA 5EE9A 1NYQA 3P4PB 2CJNA 2AX5A 3CIRB 1NEKB 3AE8B 5H8YE 4C7ZA 1TKYA 3FC4A 2KMMA 1DGJA 3WCQA 1DOXA 2ACZB 2H89B 3AMZA 3HUIA 3SFDB 1QOFA 2JX5A 1PUTA 2WS3B 5EE0A 1NYRA 1OQQA 1VDVA 3VR8B 4YXDB 1YQ3B 1QLBB 1YJIA 4YT0B 4HRSA 3BIID 3AEGB 1N5XA 5EE1A 4C7YA 1J7BA 2BS4B 4YTPB 1F0ZA 3AE1B 1XLQA 1L5PA 3AEDB 3NS1A 3VR9B 5AUKA 1UWMA 1FO4A 2BT6A 2DWQA 2BS2B 3P1MA 2PVGC 1FM0D 1DOIA 2WQYB 3DWMA 5C3JB 1RYJA 1N63A 3ABVB 1WWTA 3HVZA 1FFVA 1N60A 3HRDD 1QOAA 3AB5A 4WWMA 5G5GA 4YSYB 3VRBB 5GXGB 2HTME 5MPOA 2FBWB 1I7HA 1FMAD 1ZUD2 2Q5WD 1E6EB 3AV8A 3P4QB 4JWUC 1ZOYB 1OFFA 3AN1A 1DOYA 1XLOA 1R7SA 2L52A 2L83A 2QIEB 4FXCA 1QT9A 1L0VB 1L6VA 3EUB2 4US9A
chains in the Genus database with same CATH superfamily
2DENB 2RPVA 3I3TB 4P6VF 2OEDA 2LD9A 2WGSA 3R2IA 4OZAA 4FHJA 2PPHA 1L2NA 2LHDA 4WWPA 2LFIA 3QHTA 5IKCM 4MSMB 2QILA 4P7IA 4WJNA 2RSUA 4AJWA 2KJRA 1WI0A 2TSSA 2W3SA 3L54A 2RD0A 3NZUA 3T3OA 4IM0A 1JW9D 2L7RA 2K39A 2L32A 5CHVC 3V62A 1WR1A 3VRAB 4BFRA 3ZJTA 2L3ZA 1V5OA 4EE2A 2CU3A 3EA6A 2M0AA 1GB1A 3KYCD 2KWCA 3ZDTA 2KFJA 4MDKE 1XQQA 4KVGB 1TIFA 1MVKA 5AZHA 2WNMA 4HK2A 2NPTB 2QCZA 1OEYA 1E7UA 2QSDA 4IM2A 3ZTDA 4CO7A 1QKZA 3SFDB 2WS3B 3QIJA 3M3JA 1YJIA 1WZ3A 2KLGA 2ASQA 1P1AA 1KLGD 2LVPA 1UELA 3WIMA 2BT6A 3BK2A 2BS2B 2PVGC 3QA8A 2J52A 3SU8X 1DOIA 3R2TA 3NZ3A 5LNK1 3ABVB 1TTNA 3TL5A 4LNNA 4XX5A 1EU3A 4XDDA 3VRBB 5GXGB 1YQBA 2L52A 4AJYB 4C80A 3IG3A 3CMMB 4MGYE 5C1ZA 4K7SA 1BT0A 1RWSA 4N59A 2FIDA 1UD7A 1UNSA 4YTMB 1KFYB 2CS4A 2IDYA 4M8MA 2DZIA 3N1ZC 2XNAC 5D7GA 3PZ7A 3B2FA 3EGRA 3ECIA 4HPPA 4BKTA 4IWPA 2KJ6A 5CHWA 4KSKC 1E8XA 4CQNA 2ZCBA 1C4AA 4JGHB 4NJ6A 4TV3A 3PHWB 1J8CA 1ET6A 1GB4A 2MHJA 1GPXA 2N9XA 1GJZA 2XBBC 5EE3A 4PT5A 1P3QU 3SFEB 4GU2A 1XO3A 4HDOA 1YNTE 2NMQA 2ZNVC 3BZDB 5KHQA 2ZW1A 4FJVB 5DPSA 5BO4B 1K50A 1R4NI 2LGXA 1IGDA 4DXAB 1WFYA 1C76A 2DLBA 2I1KA 2LVQA 4GSWA 3VQIA 2GLSA 5EE9A 2KWVB 2KDMA 4DWFA 5KHOA 3VTVA 1C3TA 3SD5A 1K8RB 5LLIA 5IAAC 4W9DA 4QAYA 5AZGA 4RFBA 2OOBB 1FXTB 3IXSA 3H7PB 1G6JA 1ZW7A 4FLHA 4YT0B 1Y56A 1D6EC 2JYTA 3H7PA 1XLQA 1L5PA 3M95A 4FBJB 4RH6A 3HM6X 2IGHA 1SSNA 1UWMA 1F9JA 2QMTA 2V4LA 2IPKD 1WJ6A 2LJIA 3KUCB 3ZVVA 4L2YA 3PRMB 2BYVE 2V3PA 2WXRA 1GUAB 4UDUC 2WHIA 3X0WA 4I6PA 2LWPA 1JMLA 4YWGG 2CHXA 2L83A 2FCNA 3GS2A 4M00A 2N1WA 3BVGA 2V1YA 5IP4D 3ZNID 2FCMA 2PTLA 1E7PB 1P98A 4IC7B 4FHKA 5DPWA 1QZEA 2LGIA 1EF1A 4CYEA 2NVUI 1CQVA 2KTRB 3AECB 1RFKA 3BY4B 4W9GA 2J0JA 2GMIC 3PLUA 2N9KA 3N9YC 3VXWA 3VFKA 3ZLZA 2KTRA 1WGRA 1SB3C 2Y5CA 3PGEA 1OTRB 3AULA 3A4RA 1IP9A 2GB1A 2B3AA 2M8SA 5HFYA 2RR9A 3HIZA 3P42A 3WAOA 1EO6A 4K3CA 3AE5B 4XYCA 2E3TA 1WR6E 2MCNB 4HLEA 3R8BA 2JF5A 5J18A 2W82A 3AE9B 2PEAA 2RDGA 4F1SA 2D3BA 1FRDA 3SR6A 3AU4A 1N62A 3W5UB 2IGDA 4C4VB 4NAWB 4W9HA 1FPYA 2XEWA 1D5XC 2BTEA 3AE8B 5JZEB 5H8YE 3TIXA 2WWZA 4BAXA 4NAWA 3B08A 1IYFA 3I57A 3CSTA 3VR8B 4AS1A 2ICIA 3GB1A 2LGYA 4YTPB 3DHHC 4MACA 3MC0B 2KWDA 2IZVB 2NTTA 2DWQA 2VH2A 4ARIA 2FUG1 2KX0A 2IY1B 2ZW0A 2IJ0A 1E6EB 4PS8A 2KQ7A 1HZ6A 1L6VA 1UGMA 3QJZA 1MG4A 3AE4B 1FCLA 1TKEA 1T3QA 2D3CA 5TR5A 1SJHD 1C4PA 1TJEA 3ZDMC 2EMSA 1V1PB 4DXFA 4C00A 2Z0EB 3KYDD 2KC1A 2KVZA 4GXBA 3AEBB 2G1EA 3ML8A 3V3XA 3ZTCA 2EMTA 2GBJA 3DHIC 2K22A 2K1FA 3UIPB 1GG3A 3AH7A 2MP2A 1V97A 3AU5A 3ZIMA 2JWZA 4KX6B 3KWLA 2LEKA 3MFGA 4XWTA 1TT5B 1WM2A 4BKSD 1IUEA 5FK9C 1R4MI 1YN4A 3V05A 4URKA 1YQ4B 2OJWA 4OHJA 3R7QA 2PE6B 3FILB 5HG2A 3E9SA 3M62B 4WJQA 4M01A 4NAMA 4KZ0A 1WF9A 3FILA 3IVFA 3GE3C 2N9EB 4M0WA 4IUMB 2IBIB 1YN5A 1TKYA 2C7HA 2DYMA 4BZAA 2HD5B 3GOEA 2WX0A 3PSEB 2WXFA 5JHAA 2KT7A 4GMVA 2Z59B 2AEHA 4KGRA 1TS3A 2KTFA 5D94A 3VUXA 1F77A 4YSYB 2HTME 2GOWA 3M63B 4MGKE 4J6IA 2BBCA 2ZCCA 1QT9A 3N3KB 1EWCA 2WYQA 3ZKJC 2WXLA 5L95C 2PE9A 2LVOA 2WXNA 3PV1A 5TSSA 1NVID 3SEBA 1LGRA 4JWSC 3I9V1 2JRIB 2MBOA 3IHPC 3ETRA 1UBQA 2YEPF 5AEKB 3NVWA 3TEWA 5JHBA 5BYSA 4MJSB 4RMAA 2N9PC 3RULA 4WJPA 4MJSA 1XLPA 1WXSA 3A9JA 4ICVA 3RZWC 1BMLC 1WXAA 2WU5B 2MJDA 4XGAB 1P7EA 3J9CA 2MEKA 4ZRJA 3EHVA 4FADA 1D3ZA 1ZE3D 1VJKA 4ZRKA 4FA6A 2N7EA 2OJRA 1X1MA 1HQRD 3DBHB 3Q6BA 1T0YA 4B95A 4WJOA 2ZPYA 2W9NA 3A33B 3CWIA 1VD2A 3DBSA 3W1SC 3MC9A 1JQ4A 4IW0A 3LXFA 4N58A 4PYZA 4YTNB 1FIQA 2R61A 4USAA 2PKOA 1L6UA 2G3QB 3RNGC 2A5UA 2FNJB 4BVUC 2AX5A 1WJ4A 3Q3FA 2MA9B 4I6NB 2FAZA 4BKSA 3FC4A 2LI5A 4H2AA 4TQ0A 4JL9A 2FUHB 1QOFA 3N1XC 2BKFA 4HCNB 1YQ3B 1QLBB 3IAM1 4W9EA 2HJ1A 4A3PA 1VRAB 1I4RA 5IN7A 4RGTA 2E6XA 2KFKB 4DDID 2KN5A 1JWSD 3KUDB 4A3OA 2DAFA 2I1JA 2M1MA 2KK8A 3AV8A 1ZOYB 3VTUA 2J7QB 2K6DB 2KKCA 4US9A 1I35A 3ENEA 1C1YB 4NQLB 5BYQA 1WXQA 5H92C 4M02A 2ZPNA 4WQOB 3UQBA 3TJPA 3AE3B 3ZJUA 3AE6B 2ZVOA 5IA7A 3RD2A 3QCAA 4BBNF 3JSVB 4N9F4 1QQRA 2AYOB 1V81A 2K0PA 2WXHA 2JQRB 3V60A 2JWUA 3JSVA 1QF6A 5G5HA 3IFWB 1I4XA 1V8CA 2G45B 1HXYD 4EEWA 4LNFA 3Q8AA 1H8CA 3NOBA 2FE8A 4ANUA 2MLBA 2D11A 3DDCB 1Q1OA 3KQ4A 1VZ6A 4K81A 2KACA 2KD0A 4KIKB 3L13A 3GP7A 1L0YB 3APCA 2BB6A 3Q14C 2DNFA 1E8ZA 3B1LX 2UYZB 1JWBD 4IKGA 4RF1A 1RAXA 1EU4A 3NG0A 2YEPB 4HCPB 2I38A 2ON8A 4K1RB 3WCQA 1DOXA 3UI3A 2CR5A 4C56C 1OQQA 3T3NA 4LJPB 4ZRIA 3BIID 1N5XA 1I4GA 1SIFA 3PVLA 2ZZPB 3VR9B 1FO4A 1WYWB 3P1MA 4A20A 1TY2A 3VUWA 4RF0A 3VVWB 3WA0A 1N60A 4IG7B 3AB5A 3C19A 2NPTA 1SXTA 3QK0A 1SE9A 4JQWC 4GDKB 1DOYA 1I42A 1EM7A 1VR9A 2BPSA 2DX5B 4LK0M 1WM3A 3LDZE 4OVUA 3RI7C 1YN3A 5LXHA 3B2GA 1Z2MA 2C5LC 3DBLI 3SDLC 3C8YA 1XD3B 4KV2A 3IT6B 3BVZA 3S2AA 3P2BA 4LDTD 1MJDA 5G2NA 3AI5A 3ZNZB 1V9JA 3Q8CA 3QAQA 1V86A 4TKNA 4TUUA 3BINA 3RMKC 3A9KB 4PS7A 1LM8B 4II2B 1A70A 1STEA 4ITKA 3AEFB 4AQ7A 4RGOS 3KH0A 4YSZB 5CX3A 4HWIB 1OEYJ 1UH6A 3AEAB 1TZOA 1WRIA 1J0GA 4LLGM 2JSVX 3X23A 4MSQB 1AWDA 2CJNA 2G4SA 3ZO5B 2JVCA 4RGMA 4C7ZA 1HTQA 2KDIA 4P1CC 2CHWA 2WXJA 5EE0A 4YXDB 4F7ZA 4IWOA 5EE1A 3DBRB 3RNBC 1C79A 1ACCA 3ZXRA 2G4DB 3QX1A 1FFVA 4JLCA 3DCGA 1Z5SB 2PLPA 5MPOA 4WH4A 1ZUD2 2I2YA 1WIAA 4WWNA 1L7YA 5L83A 4W9JA 5CTRC 1VLBA 1YJ1A 2N0SB 2BVCA 4LNIA 3QARA 4YL8A 2WDVB 1P0RA 1TKGA 3W2DA 3NVYA 1GAQB 4LDTB 4HJGE 3R66C 3D32A 3HK0A 3RCZA 2ZNVB 1UBIA 4P16A 1JALA 3LB8C 2V9HA 1RM6C 1FD6A 1FNWA 4GIVA 2D3AA 1NBFC 5D6JB 1SIJA 2JZ3B 1FRRA 1J7CA 1SBBB 1T0SC 1L4ZB 3OJ3A 2NR2A 4RCOA 1QILA 5C23A 2YVCA 2MX2A 3VH4B 2BKRB 2RPQA 3P4PB 4GN1A 4DK5A 2DAJA 2G9HD 4KZCA 2REXA 1YIWA 4WIPA 3AMZA 4PYUA 1JRUA 1PGAA 3U52E 4B0MA 4DHZB 3AEGB 3KUZA 1J7BA 1P9DU 3U8ZA 4XC2A 3NHEB 3ZRFA 1BXTA 4HKZE 4MM3B 4NQKE 3ZJVA 2WQYB 2LJ5A 2ZVNA 5C3JB 1KJTA 1WGHA 2DYBA 3GE8C 4MM3A 3GZNI 4II3B 3NS8A 4C4VA 3DBHI 2K8HA 3ZQ4A 3MJWA 3ZNGC 1B1ZA 1R7SA 2K9XA 4REZA 2H88B 1NI3A 1ROEA 1D5MC 1T6BX 2JU6X 2K5PA 2M56B 3FAHA 3C0RB 1A5RA 2LMCA 1XLNA 1WX9A 3KW5B 1KM7A 4KGTA 2MJ3A 4AUQC 4ANVA 1WSPA 1QOGA 2INCC 2GBKA 4HKQA 1LFDA 3ZXVA 3RPFC 2CU1A 2O6VD 2PJHA 1JWMD 1E10A 2Y3AA 1PFDA 2L05A 1LXDA 3OWEB 3QC8B 3DPDA 5AUIA 5HI1A 3K9PB 4M8NA 2N4FA 1S3SG 1V1PA 1ZDXA 1XT9B 3Q3MC 4X57B 4G3XB 2D5GA 4MGIE 1EWYC 3MC8A 3ZRCA 4HDQA 1V5TA 2N1VA 3PZ8A 2DZJA 2LRUA 1NYQA 4AWJA 3CIRB 4WWOA 1NEKB 1E8WA 1TZ1A 2NTSA 3N32A 3DHGC 1R4NB 2HE7A 2DZMA 3DVNU 4DDGD 3HVDA 1CK1A 3PRZA 1E90A 3ZW3A 1H4RA 1FM0D 2GRIA 4P1BC 2L00B 1QOAA 1GC6A 2IY0B 2KDEB 2MRPA 3EFUA 2AL6A 1UF0A 2LZ6A 2MQJA 2WXMA 2OHFA 2KN4A 3ZNHB 2J0MA 4NZLB 3RNAC 1WZ0A 2WXOA 2D3GA 1V6EA 1HTOA 4NPNA 5CHFA 3W9CB 3RNFC 1ZXIA 1VZ7A 4AOFA 2M17A 2C7NB 2KX3A 1K52A 3W1YA 4A55A 3BYYB 4DXGA 4E3CA 2WU2B 2K8BA 4DBGA 4LCDE 2KMCA 1KOTA 2EELA 2PIAA 1N5WA 2X38A 2PVOD 2MH7A 4KGSA 2BB5A 4TMAB 2KMAA 1LQBA 2O6VB 4TSSA 2WX1A 1JRPA 4GB9A 5IOIA 2KDFB 4JE3B 4MELA 2UWQA 1TS4A 2O6VA 2RDHA 5FKAC 2QC8A 4W9CA 4HEA1 1WXMA 1U4AA 2KXJA 3RT3B 4ZRPA 1XEEA 1LO5D 2H89B 1SE3A 1XF5L 2KJHB 3DVNV 1MHHE 3AEDB 3NS1A 2RDBC 2Y5BB 2RGFA 4HPMB 4EFOA 3RFZB 1AARA 2V0GA 2IO2B 1OGWA 2LRWA 4K3BA 4ARCA 4KDIC 1I4PA 1ZPSA 1T0QC 1EUVB 2LXCA 4NJCA 4BOSC 3HM3A 1WJNA 3L0WB 4MT5A 5AUKA 2MBBB 3RNEC 3PT2B 2INDC 4CHKA 2NBVB 2C9WB 3TSSA 2XN9C 3WAMA 2WXIA 2EKIA 1IBXB 4LNOA 1NENB 4ZOHC 3RZFA 3Q69A 1IBXA 2KFKA 2LXAA 3VDZA 3KVFB 3DVGX 4ASWC 4EZLA 1C77A 4Q2JA 1JCKB 4IM3A 3T9LA 4W9FA 1L0XB 1E7VA 3VAWA 3P4SB 3DOWA 3HHMA 4WAAA 1N61A 1PQSA 4OVVA 2WLBA 3H7SA 2J0KA 5AZFA 1F2RI 2R2OA 2HDEA 2J53A 4MGZE 4MH8A 3W1SA 4OW0A 4ZDVA 2BWFA 1KH0A 4ANXA 2J42A 5FR6A 2PMVA 1RLFA 1JWUD 2NBUA 1M94A 1SEBD 1NDDA 2JX5A 3NJTA 2KWUB 3NUHB 5D3DA 2N9LA 2J4XA 1Q10A 4DHJD 1CMXB 5JH5C 4PS3A 1TY0A 3U2SC 2IGGA 4JPSA 4KIKA 4R3DA 1RYJA 4A90A 5EDSA 4NJ7A 2M0XA 5E6PA 3UGBB 3ZUNA 4G50A 1TS5A 3UINB 1OFFA 1XXGA 1TBEA 4ANWA 3KLSX 2SEBD 1C4CA 3L08A 2KDBA 3NVZA 4HVBA 1V49A 1TS2A 4RGNA 5G55A 4G0NB 1WMHB 1ZXHA 3AEEB 4YSXB 1GNUA 1J19A 3NY5A 2KO3A 2IYDB 4EKUA 2WXPA 1WMHA 3RUIB 1V1OA 2LUEA 2RMMA 1ISNA 3JW0X 1CJEA 1WXVA 2V4IB 5GMVA 4HXDA 2KZRA 4HROA 4GDKA 1OQRA 2FCSA 2B76B 1Q0WB 2MWSB 2JZPA 2AQ2B 1D4BA 2WDRB 2C7MB 4EOYA 3BK1A 3URYA 1SF0A 1OQYA 4BBNC 1JROA 2KYWA 2NS5A 4LTUA 2LUMA 2CKHB 3NRZA 4WQMA 3LJ3A 1ZGUB 2AQ1B 1EF5A 2KQSA 1UGJA 1RFAA 3BVMA 1Q5WB 2MBEA 2FCQA 3A9KA 1WGDA 3MHSD 1TGZB 3UF8A 5BMIA 1DGJA 2GI9A 3ONSA 3A1QB 2ACZB 3Q3JA 2C60A 1F2RC 4ICUA 2VRRB 3A1QA 1VCBA 3MJ5A 4RM8A 3TEXA 2BS4B 2KLCA 1F0ZA 2INPE 1T5XD 3DWMA 1ZKHA 4DHJB 4KDLB 3Q3OC 3ALBA 2Q5WD 2IO3B 5I4DA 3U4EG 2QIEB 3BYTB 4B6WA 2MW5A 1XCQL 1V2YA 4A9AA 2M4NA 2AWTA 4WAFA 3H8HA 3ML9A 1AW7A 1NI2A 3L4PA 4S17A 2DBYA 1SJED 3KWVA 4XDCA 1KRHA 1RRBA 3RYTA 3Q8FA 1JWAD 1WYGA 3UIOB 2BGFA 4FJZA 1K53A 5E6OA 5T8IA 1PGBA 3R7RA 4WURA 1DYQA 5DPTA 3IT4B 1UWXA 2W54A 1E0ZA 4E74A 3B9JA 3TMPB 1KLUD 3VHTC 1MHXA 3Q2AC 4J3OD 4MH0E 4S0RA 4EZJA 2GBNA 2BW2A 4N6EB 4ZRQA 2DHZA 3ZYYX 1I4HA 2BS3B 2WXQA 3P63A 3WAPA 3AE2B 1MPEA 1C9FA 2N7DA 3MP9A 2INNE 1YD8U 2MSED 1NYRA 3PS6A 1UUPA 2L76A 2MBHA 1I4QA 4KKIA 3AE1B 1FEHA 2VZKD 4RM9A 3EC8A 2QHOA 2JXXA 4ZYSA 2PW9A 4HPLB 3N30A 1N63A 2V3NA 2JUOA 4G11A 2KHWB 2L0TA 4MEMA 1I7HA 1WGGA 4BKGA 4OZBA 2QDFA 3A4SC 4FXCA 4JIOU 1L0VB 1MFWA 4NNJB 3TBLD 5J2RA 3TEZA 3MHZA 3VUYA 2CJOA 2KVRA 2KAJA 2MBQA 1Y8RC 3DWGC 2JXTA 4ZYNA 1ET9A 1PGXA 1CZPA 2D10A 2WDQB 3MTNB 5BYRA 2WDTB 2GBMA 2K8CA 4GDLB 3WANA 3H9DA 5C2TB 2D2QA 3EFCA 2QJLA 2M19A 3NZSA 1J7AA 3DBLB 3R3MA 4GDLA 1WX7A 3UQAA 4W9LA 1TYGB 3OLMD 1MG8A 2ONQA 1FXAA 2WP9B 5D2MB 1KF6B 1T0RC 3P4RB 2NCNA 4K7WA 5JXVA 2SAKA 3L17A 4RNAA 2XK5B 4US8A 2K3UA 2DYOA 5IO9A 4K7UA 2AL3A 4DQOC 3AXCA 3IBEA 1YMHE 3L16A 4O1NA 2XK5A 2WXKA 1V80A 5DPRA 1FNUA 3QWZB 3RNCC 4NY0A 2FIFA 2KMMA 1FNVA 2QEJC 3HUIA 3N1YC 4KSLC 1PUTA 1WRDB 1VDVA 1HZ5A 4FULA 4L1BA 3CSFA 1MI0A 2LHEA 5D3IB 3PZDA 4ACFA 1WX8A 2N7JA 3K9OB 1WWTA 2KC2A 4D2KA 3I5JC 3PRPB 4WWMA 2VZKB 1WE7A 1N6ZA 1FMAD 3T8MA 2Y5PA 3PPAA 2MP2B 3TUOA 4EUTA 3AN1A 1SGHA 3W5VB 1YJJA 3DVGY 2MJEA 2HTHA 1FFUA 1KLVA 1E9MA 1YOVB 3U30A 4XZ4A 2JYEA 1KTKA 2JPHA 1FXIA 2L1AA 3N20C 4ZHOA 1SE4A 1WJUA 2CHZA 4XWWA 1ESFA 1F52A 4HJKA 4FN2A 4AP4C 1K51A 3IAS1 1B9RA 4M0WB 2GBRA 2KNBA 3B0AA 5HKHA 3H6NA 3V61A 3JYUA 3CF6E 4ZHPA 2D07B 1E8YA 3PO0A 3NVVA 1GC7A 1SE2A 4JX1C 2Z0DB 4LJOB 4IDIA 1YX5B 3APDA 2O2VB 2W3RA 5HHDG 1FCCC 3OG5A 4FJYA 1PDXA 1XCTL 3V6EB 3TEYA 3U7DA 2O2VA 4LNKA 1UZXB 2KOXA 1HE8A 4B0EA 2KQ4X 5J17A 2ZEQA 2HJ8A 4HRSA 4C7YA 2LGDA 4KKJA 2BYEA 1C78A 2LASA 2YLMA 3QQ8B 4I6LB 2K6QA 4IWQA 2L0FA 3PTFC 1IGCA 5G5GA 2LGSA 2FBWB 4JWUC 1WGYA 3PREA 4GLSC 4OZCA 5E6JA 2WXGA 3A9JB 3PLVA 3OJ4B 1XLOA 4GOCA 3LYYA 4A6QA 3EUB2 3ZGZA 1WE6A 1QOBA 2BWES 3AE7B 2K25A 1HA5A 3VTWA 1BUIC 1VZ8A 1S1QB 2R2QA 2W55A 3GZNB 2UU7A 5BMGA 2Z8LA 2V3SA 4IOIE 2JZZA 3E56A 1IPGA 3U7ZA 1HEZE 4BOZB 2EKEC 5DCNA 2JT4B 3JVZX 5LXIB 3L10B 3VH3B 3DQVA 1AN8A 1YX6B 4B9KA 2JRHA 1F1HA 2ZJDA 4XE0A 2BYTA 4DHZE 4W9KA 5E6NA 2AQ3B 2JY6A 3APFA 3RN9C 1ZP0B 3TCAA 3V6CB 3OAWA 3AM9A 4GGQA 3Q8BA 2BF8B 1D5ZC 1AYFA 1WGKA 4L23A 1WY8A 3DBRI 1GOZA 2A4ZA 3WALA 2VH1A 2DZKA 3PHXB 4EZKA 3EECA 4F8CB 2BYFA 2IO0B 4TQ1A 2KANA 4A8XC 5BMHA 3BWUD 1P7FA 2L8JA 1PYWD 1WH3A 2IO1B 3Q8EA 4PK1A 3O13A 4W9IA 2X8XX 1ENFA 1ZDVA 3FKYA 1L4DB 1E5WA 2BQQA 1M4VA 3Q3NC 3HVZA 3HRDD 3I63C 4E71A 5FR3A 3P4QB 3H1UA 1R4MB 2NBWB 3SHQA 3O65B 4OVZA
chains in the Genus database with same CATH topology
1EWCA 2K9XA 2RPVA 2WXLA 4REZA 4P6VF 1XCQL 2OEDA 4A9AA 2H88B 1NI3A 1ROEA 1D5MC 1T6BX 2WXNA 2JU6X 1NVID 5TSSA 4WAFA 3SEBA 2K5PA 3H8HA 3R2IA 2M56B 3FAHA 4OZAA 1AW7A 4JWSC 3I9V1 3L4PA 2DBYA 2LHDA 3ETRA 1SJED 2YEPF 2LFIA 3KWVA 4XDCA 2LMCA 1KRHA 1XLNA 3NVWA 3TEWA 4KGTA 2QILA 2MJ3A 5BYSA 3Q8FA 1WSPA 1QOGA 1JWAD 1WYGA 4HKQA 1K53A 2TSSA 2W3SA 3RPFC 1XLPA 3T3OA 5T8IA 1JW9D 1BMLC 1PGBA 2WU5B 4WURA 2L32A 2MJDA 1DYQA 1P7EA 3VRAB 1JWMD 3ZJTA 3IT4B 1UWXA 3J9CA 2MEKA 2Y3AA 2W54A 1PFDA 1E10A 1E0ZA 1ZE3D 1VJKA 3OWEB 3B9JA 5AUIA 5HI1A 1HQRD 2CU3A 4EE2A 3EA6A 1KLUD 1MHXA 2M0AA 4J3OD 1GB1A 1ZDXA 1V1PA 3CWIA 2BW2A 4N6EB 4ZRQA 2D5GA 1EWYC 1JQ4A 3LXFA 4N58A 4YTNB 1MVKA 1I4HA 1FIQA 2BS3B 2R61A 2WNMA 2WXQA 2PKOA 3AE2B 3P63A 3PZ8A 1L6UA 1MPEA 1NYQA 1C9FA 2AX5A 2QSDA 3CIRB 3MP9A 1NEKB 2INNE 3FC4A 2NTSA 4H2AA 4TQ0A 1QKZA 3SFDB 1QOFA 2WS3B 1NYRA 1YQ3B 1UUPA 1QLBB 1YJIA 3HVDA 1CK1A 1I4QA 4KKIA 3AE1B 1KLGD 3IAM1 1FEHA 2VZKD 2BT6A 3BK2A 2BS2B 2PVGC 1FM0D 2J52A 1VRAB 4ZYSA 1DOIA 2GRIA 2PW9A 1I4RA 3R2TA 3NZ3A 1N63A 5LNK1 2V3NA 3ABVB 4RGTA 2E6XA 1EU3A 1QOAA 1JWSD 4XDDA 3VRBB 5GXGB 1I7HA 3AV8A 4OZBA 1ZOYB 2L52A 4FXCA 1L0VB 4US9A 2WXMA 2OHFA 2KN4A 3TEZA 3MHZA 4NZLB 4C80A 2CJOA 2KAJA 1RWSA 4N59A 2WXOA 5BYQA 1WXQA 1UNSA 3DWGC 5H92C 4YTMB 1KFYB 2JXTA 2IDYA 3AE3B 3ZJUA 2XNAC 5D7GA 3W9CB 3AE6B 3PZ7A 3B2FA 1ZXIA 3EGRA 1ET9A 1VZ7A 1PGXA 1CZPA 2WDQB 5BYRA 1QQRA 2K0PA 1K52A 2JQRB 2WXHA 4GDLB 5C2TB 2JWUA 4A55A 3BYYB 4CQNA 1QF6A 4DXGA 5G5HA 1C4AA 2QJLA 2M19A 2WU2B 1J7AA 1I4XA 1V8CA 1ET6A 1GB4A 1GPXA 1TYGB 5EE3A 1HXYD 2EELA 2PIAA 4PT5A 1N5WA 2X38A 2ONQA 2PVOD 1FXAA 2WP9B 3Q8AA 4USAA 3SFEB 2MH7A 4KGSA 1KF6B 3P4RB 1XO3A 2FE8A 1YNTE 2BB5A 2NMQA 3BZDB 4TMAB 5JXVA 2SAKA 2ZW1A 4RNAA 1K50A 1VZ6A 2K3UA 3KQ4A 2KACA 2DYOA 4TSSA 4US8A 1JRPA 1IGDA 4DQOC 4JE3B 1C76A 2DLBA 3GP7A 1YMHE 1TS4A 1L0YB 4O1NA 2RDHA 2BB6A 2WXKA 3VQIA 5FKAC 1JWBD 4HEA1 4IKGA 5EE9A 4RF1A 2KDMA 1EU4A 3ZYYX 1FNUA 2YEPB 2I38A 2ON8A 4ZRPA 2KMMA 1FNVA 4RFBA 2QEJC 1XEEA 3WCQA 1LO5D 1DOXA 2H89B 3HUIA 3IXSA 3UI3A 1PUTA 4C56C 1VDVA 1OQQA 1HZ5A 3T3NA 1SE3A 1XF5L 4YT0B 1Y56A 1D6EC 3BIID 1N5XA 4L1BA 1I4GA 2JYTA 1XLQA 1L5PA 1MHHE 3AEDB 4RH6A 3NS1A 2IGHA 3VR9B 1SSNA 1MI0A 1UWMA 2LHEA 2QMTA 2IPKD 5D3IB 1FO4A 3P1MA 1TY2A 2LJIA 4L2YA 2N7JA 4RF0A 2V3PA 1WWTA 3RFZB 1N60A 2WXRA 2V0GA 4D2KA 3AB5A 4WWMA 2VZKB 4UDUC 4ARCA 1FMAD 1SXTA 2Y5PA 3TUOA 4GDKB 3AN1A 1DOYA 1I4PA 1JMLA 4YWGG 1EM7A 1ZPSA 1VR9A 2L83A 4NJCA 4LK0M 4MT5A 5AUKA 3W5VB 3GS2A 3BVGA 1YJJA 2MJEA 1YN3A 1FFUA 3B2GA 1E9MA 2PTLA 1E7PB 3TSSA 2XN9C 2WXIA 2EKIA 2LGIA 3C8YA 1IBXB 2JYEA 1NENB 1KTKA 4ZOHC 1CQVA 3AECB 3IT6B 1FXIA 1RFKA 2L1AA 3BVZA 3Q69A 4ZHOA 1SE4A 1IBXA 2N9KA 3N9YC 4XWWA 3Q8CA 1ESFA 1K51A 1C77A 4Q2JA 3IAS1 1B9RA 1JCKB 1SB3C 2Y5CA 1A70A 1STEA 4ITKA 1L0XB 2GB1A 3AEFB 5HFYA 3P42A 4AQ7A 4RGOS 4ZHPA 3P4SB 3AE5B 3PO0A 1N61A 4YSZB 2WLBA 2E3TA 3NVVA 3R8BA 3AEAB 1SE2A 4JX1C 1F2RI 1TZOA 1WRIA 2W82A 2HDEA 2J53A 4IDIA 3AE9B 4MH8A 3W1SA 4LLGM 2RDGA 2W3RA 5HHDG 1FRDA 1FCCC 3SR6A 1N62A 2JSVX 4OW0A 1PDXA 1XCTL 3W5UB 2IGDA 1AWDA 1KH0A 3TEYA 2CJNA 2J42A 4NAWB 1D5XC 2PMVA 2BTEA 3AE8B 4RGMA 5H8YE 4C7ZA 1JWUD 4B0EA 2KQ4X 1SEBD 2WXJA 2JX5A 5EE0A 3I57A 3VR8B 3NUHB 4YXDB 5D3DA 2N9LA 2J4XA 4AS1A 2ICIA 3GB1A 1Q10A 4HRSA 5EE1A 4C7YA 4KKJA 4YTPB 4MACA 3MC0B 1C78A 2KWDA 2NTTA 2DWQA 1C79A 1ACCA 1TY0A 3U2SC 2IGGA 4JPSA 4ARIA 4R3DA 1RYJA 2FUG1 2ZW0A 1FFVA 4A90A 2IJ0A 1IGCA 2PLPA 5G5GA 5MPOA 2FBWB 4WH4A 1ZUD2 1TS5A 1E6EB 4JWUC 2I2YA 4GLSC 4OZCA 5E6JA 1OFFA 1XXGA 2WXGA 1XLOA 1HZ6A 3LYYA 1L6VA 3KLSX 4A6QA 3EUB2 3ZGZA 2SEBD 1QOBA 3AE7B 1HA5A 1C4CA 1VLBA 1BUIC 1VZ8A 3NVZA 3AE4B 1FCLA 1TS2A 1TKEA 4RGNA 1T3QA 2N0SB 2W55A 1SJHD 1C4PA 1TJEA 5BMGA 1ZXHA 3AEEB 4YSXB 2Z8LA 1V1PB 4IOIE 4DXFA 3E56A 3U7ZA 1HEZE 3AEBB 2WXPA 1V1OA 2RMMA 2G1EA 3V3XA 2WDVB 1CJEA 2K22A 1TKGA 2V4IB 3W2DA 1AN8A 3AH7A 4HROA 3NVYA 1OQRA 1GAQB 1V97A 2B76B 2JZPA 4HJGE 4XE0A 2AQ2B 2BYTA 4KX6B 4P16A 1D4BA 2WDRB 1JALA 3BK1A 3KWLA 3LB8C 3URYA 1RM6C 2AQ3B 2LEKA 1FNWA 3MFGA 1FD6A 1ZP0B 4XWTA 1SF0A 1JROA 4LTUA 3AM9A 1IUEA 1SIJA 3Q8BA 5FK9C 2LUMA 1D5ZC 1AYFA 1YN4A 3V05A 1FRRA 3NRZA 1WGKA 4WQMA 1YQ4B 4L23A 4OHJA 1J7CA 1SBBB 3FILB 5HG2A 1L4ZB 2AQ1B 4RCOA 3E9SA 1QILA 4NAMA 1UGJA 3BVMA 1GOZA 3P4PB 3FILA 4M0WA 2G9HD 1YN5A 1TKYA 5BMIA 1DGJA 2GI9A 4TQ1A 4WIPA 4A8XC 3BWUD 1P7FA 2ACZB 2DYMA 3AMZA 5BMHA 1PGAA 3U52E 1PYWD 2WXFA 3Q8EA 4B0MA 1F2RC 3O13A 3AEGB 3MJ5A 3TEXA 1J7BA 2BS4B 1F0ZA 2INPE 1ENFA 1BXTA 4KGRA 1ZDVA 4HKZE 4MM3B 1L4DB 1TS3A 1T5XD 3ZJVA 2WQYB 3DWMA 5C3JB 1M4VA 3HVZA 3HRDD 1F77A 4YSYB 2HTME 5FR3A 3ZQ4A 2Q5WD 3P4QB 5I4DA 3U4EG 1B1ZA 1R7SA 2BBCA 2QIEB 1QT9A 3BYTB 4OVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QOB A;  2K9X A;  2OHF A;  3AE7 B;  3W5V B;  4P6V F;  4C80 A;  2CJO A;  1VLB A;  1YJJ A;  4A9A A;  3NVZ A;  2H88 B;  2KAJ A;  2MJE A;  3AE4 B;  1FFU A;  1NI3 A;  1ROE A;  1RWS A;  3B2G A;  1TKE A;  4N59 A;  1E9M A;  1NVI D;  1WXQ A;  1T3Q A;  1E7P B;  2K5P A;  2N0S B;  3DWG C;  5H92 C;  2M56 B;  3FAH A;  1KFY B;  4YTM B;  2W55 A;  1TJE A;  3L4P A;  4JWS C;  2EKI A;  3AEE B;  3AE3 B;  2DBY A;  4YSX B;  3ETR A;  3W9C B;  1NEN B;  3AE6 B;  4ZOH C;  3B2F A;  1ZXI A;  1KRH A;  3AEC B;  1FXI A;  1RFK A;  1XLN A;  4ZHO A;  1CZP A;  3NVW A;  3AEB B;  2MJ3 A;  2WDQ B;  2G1E A;  1QOG A;  1JWA D;  2JQR B;  2WDV B;  1WYG A;  5C2T B;  1CJE A;  2K22 A;  1TKG A;  1QF6 A;  5G5H A;  2QJL A;  2M19 A;  2W3S A;  2WU2 B;  3AH7 A;  4HRO A;  1J7A A;  1XLP A;  3NVY A;  3RPF C;  1OQR A;  1SB3 C;  1B9R A;  1GAQ B;  1JW9 D;  1V97 A;  2Y5C A;  2B76 B;  1V8C A;  2WU5 B;  2MJD A;  1A70 A;  4ITK A;  1GPX A;  3VRA B;  1TYG B;  5EE3 A;  1E10 A;  2PIA A;  1PFD A;  1N5W A;  2W54 A;  2PVO D;  3AEF B;  1FXA A;  2WP9 B;  4KX6 B;  1E0Z A;  2WDR B;  3SFE B;  1VJK A;  2MH7 A;  1JAL A;  3B9J A;  3KWL A;  1KF6 B;  3LB8 C;  5AUI A;  2CU3 A;  3P4R B;  4ZHP A;  1RM6 C;  1XO3 A;  2LEK A;  3P4S B;  1ZP0 B;  1SF0 A;  3AE5 B;  3PO0 A;  1N61 A;  4YSZ B;  1JRO A;  2WLB A;  4LTU A;  2E3T A;  3AM9 A;  1IUE A;  3NVV A;  1SIJ A;  3CWI A;  4US8 A;  3AEA B;  4JX1 C;  1JRP A;  1AYF A;  4N6E B;  1FRR A;  1WRI A;  3NRZ A;  1WGK A;  4WQM A;  1YQ4 B;  1EWY C;  4IDI A;  1JQ4 A;  3AE9 B;  1J7C A;  3LXF A;  2W3R A;  1FRD A;  4N58 A;  3SR6 A;  4YTN B;  3ZYY X;  1N62 A;  1FIQ A;  2BS3 B;  3P63 A;  4USA A;  1PDX A;  2PKO A;  3AE2 B;  1JWB D;  3W5U B;  1L6U A;  1AWD A;  5EE9 A;  1NYQ A;  3P4P B;  2CJN A;  2AX5 A;  3CIR B;  1NEK B;  3AE8 B;  5H8Y E;  4C7Z A;  1TKY A;  3FC4 A;  2KMM A;  1DGJ A;  3WCQ A;  1DOX A;  2ACZ B;  2H89 B;  3AMZ A;  3HUI A;  3SFD B;  1QOF A;  2JX5 A;  1PUT A;  2WS3 B;  5EE0 A;  1NYR A;  1OQQ A;  1VDV A;  3VR8 B;  4YXD B;  1YQ3 B;  1QLB B;  1YJI A;  4YT0 B;  4HRS A;  3BII D;  3AEG B;  1N5X A;  5EE1 A;  4C7Y A;  1J7B A;  2BS4 B;  4YTP B;  1F0Z A;  3AE1 B;  1XLQ A;  1L5P A;  3AED B;  3NS1 A;  3VR9 B;  5AUK A;  1UWM A;  1FO4 A;  2BT6 A;  2DWQ A;  2BS2 B;  3P1M A;  2PVG C;  1FM0 D;  1DOI A;  2WQY B;  3DWM A;  5C3J B;  1RYJ A;  1N63 A;  3ABV B;  1WWT A;  3HVZ A;  1FFV A;  1N60 A;  3HRD D;  1QOA A;  3AB5 A;  4WWM A;  5G5G A;  4YSY B;  3VRB B;  5GXG B;  2HTM E;  5MPO A;  2FBW B;  1I7H A;  1FMA D;  1ZUD 2;  2Q5W D;  1E6E B;  3AV8 A;  3P4Q B;  4JWU C;  1ZOY B;  1OFF A;  3AN1 A;  1DOY A;  1XLO A;  1R7S A;  2L52 A;  2L83 A;  2QIE B;  4FXC A;  1QT9 A;  1L0V B;  1L6V A;  3EUB 2;  4US9 A; 
#chains in the Genus database with same CATH topology
 2DEN B;  2RPV A;  3I3T B;  4P6V F;  2OED A;  2LD9 A;  2WGS A;  3R2I A;  4OZA A;  4FHJ A;  2PPH A;  1L2N A;  2LHD A;  4WWP A;  2LFI A;  3QHT A;  5IKC M;  4MSM B;  2QIL A;  4P7I A;  4WJN A;  2RSU A;  4AJW A;  2KJR A;  1WI0 A;  2TSS A;  2W3S A;  3L54 A;  2RD0 A;  3NZU A;  3T3O A;  4IM0 A;  1JW9 D;  2L7R A;  2K39 A;  2L32 A;  5CHV C;  3V62 A;  1WR1 A;  3VRA B;  4BFR A;  3ZJT A;  2L3Z A;  1V5O A;  4EE2 A;  2CU3 A;  3EA6 A;  2M0A A;  1GB1 A;  3KYC D;  2KWC A;  3ZDT A;  2KFJ A;  4MDK E;  1XQQ A;  4KVG B;  1TIF A;  1MVK A;  5AZH A;  2WNM A;  4HK2 A;  2NPT B;  2QCZ A;  1OEY A;  1E7U A;  2QSD A;  4IM2 A;  3ZTD A;  4CO7 A;  1QKZ A;  3SFD B;  2WS3 B;  3QIJ A;  3M3J A;  1YJI A;  1WZ3 A;  2KLG A;  2ASQ A;  1P1A A;  1KLG D;  2LVP A;  1UEL A;  3WIM A;  2BT6 A;  3BK2 A;  2BS2 B;  2PVG C;  3QA8 A;  2J52 A;  3SU8 X;  1DOI A;  3R2T A;  3NZ3 A;  5LNK 1;  3ABV B;  1TTN A;  3TL5 A;  4LNN A;  4XX5 A;  1EU3 A;  4XDD A;  3VRB B;  5GXG B;  1YQB A;  2L52 A;  4AJY B;  4C80 A;  3IG3 A;  3CMM B;  4MGY E;  5C1Z A;  4K7S A;  1BT0 A;  1RWS A;  4N59 A;  2FID A;  1UD7 A;  1UNS A;  4YTM B;  1KFY B;  2CS4 A;  2IDY A;  4M8M A;  2DZI A;  3N1Z C;  2XNA C;  5D7G A;  3PZ7 A;  3B2F A;  3EGR A;  3ECI A;  4HPP A;  4BKT A;  4IWP A;  2KJ6 A;  5CHW A;  4KSK C;  1E8X A;  4CQN A;  2ZCB A;  1C4A A;  4JGH B;  4NJ6 A;  4TV3 A;  3PHW B;  1J8C A;  1ET6 A;  1GB4 A;  2MHJ A;  1GPX A;  2N9X A;  1GJZ A;  2XBB C;  5EE3 A;  4PT5 A;  1P3Q U;  3SFE B;  4GU2 A;  1XO3 A;  4HDO A;  1YNT E;  2NMQ A;  2ZNV C;  3BZD B;  5KHQ A;  2ZW1 A;  4FJV B;  5DPS A;  5BO4 B;  1K50 A;  1R4N I;  2LGX A;  1IGD A;  4DXA B;  1WFY A;  1C76 A;  2DLB A;  2I1K A;  2LVQ A;  4GSW A;  3VQI A;  2GLS A;  5EE9 A;  2KWV B;  2KDM A;  4DWF A;  5KHO A;  3VTV A;  1C3T A;  3SD5 A;  1K8R B;  5LLI A;  5IAA C;  4W9D A;  4QAY A;  5AZG A;  4RFB A;  2OOB B;  1FXT B;  3IXS A;  3H7P B;  1G6J A;  1ZW7 A;  4FLH A;  4YT0 B;  1Y56 A;  1D6E C;  2JYT A;  3H7P A;  1XLQ A;  1L5P A;  3M95 A;  4FBJ B;  4RH6 A;  3HM6 X;  2IGH A;  1SSN A;  1UWM A;  1F9J A;  2QMT A;  2V4L A;  2IPK D;  1WJ6 A;  2LJI A;  3KUC B;  3ZVV A;  4L2Y A;  3PRM B;  2BYV E;  2V3P A;  2WXR A;  1GUA B;  4UDU C;  2WHI A;  3X0W A;  4I6P A;  2LWP A;  1JML A;  4YWG G;  2CHX A;  2L83 A;  2FCN A;  3GS2 A;  4M00 A;  2N1W A;  3BVG A;  2V1Y A;  5IP4 D;  3ZNI D;  2FCM A;  2PTL A;  1E7P B;  1P98 A;  4IC7 B;  4FHK A;  5DPW A;  1QZE A;  2LGI A;  1EF1 A;  4CYE A;  2NVU I;  1CQV A;  2KTR B;  3AEC B;  1RFK A;  3BY4 B;  4W9G A;  2J0J A;  2GMI C;  3PLU A;  2N9K A;  3N9Y C;  3VXW A;  3VFK A;  3ZLZ A;  2KTR A;  1WGR A;  1SB3 C;  2Y5C A;  3PGE A;  1OTR B;  3AUL A;  3A4R A;  1IP9 A;  2GB1 A;  2B3A A;  2M8S A;  5HFY A;  2RR9 A;  3HIZ A;  3P42 A;  3WAO A;  1EO6 A;  4K3C A;  3AE5 B;  4XYC A;  2E3T A;  1WR6 E;  2MCN B;  4HLE A;  3R8B A;  2JF5 A;  5J18 A;  2W82 A;  3AE9 B;  2PEA A;  2RDG A;  4F1S A;  2D3B A;  1FRD A;  3SR6 A;  3AU4 A;  1N62 A;  3W5U B;  2IGD A;  4C4V B;  4NAW B;  4W9H A;  1FPY A;  2XEW A;  1D5X C;  2BTE A;  3AE8 B;  5JZE B;  5H8Y E;  3TIX A;  2WWZ A;  4BAX A;  4NAW A;  3B08 A;  1IYF A;  3I57 A;  3CST A;  3VR8 B;  4AS1 A;  2ICI A;  3GB1 A;  2LGY A;  4YTP B;  3DHH C;  4MAC A;  3MC0 B;  2KWD A;  2IZV B;  2NTT A;  2DWQ A;  2VH2 A;  4ARI A;  2FUG 1;  2KX0 A;  2IY1 B;  2ZW0 A;  2IJ0 A;  1E6E B;  4PS8 A;  2KQ7 A;  1HZ6 A;  1L6V A;  1UGM A;  3QJZ A;  1MG4 A;  3AE4 B;  1FCL A;  1TKE A;  1T3Q A;  2D3C A;  5TR5 A;  1SJH D;  1C4P A;  1TJE A;  3ZDM C;  2EMS A;  1V1P B;  4DXF A;  4C00 A;  2Z0E B;  3KYD D;  2KC1 A;  2KVZ A;  4GXB A;  3AEB B;  2G1E A;  3ML8 A;  3V3X A;  3ZTC A;  2EMT A;  2GBJ A;  3DHI C;  2K22 A;  2K1F A;  3UIP B;  1GG3 A;  3AH7 A;  2MP2 A;  1V97 A;  3AU5 A;  3ZIM A;  2JWZ A;  4KX6 B;  3KWL A;  2LEK A;  3MFG A;  4XWT A;  1TT5 B;  1WM2 A;  4BKS D;  1IUE A;  5FK9 C;  1R4M I;  1YN4 A;  3V05 A;  4URK A;  1YQ4 B;  2OJW A;  4OHJ A;  3R7Q A;  2PE6 B;  3FIL B;  5HG2 A;  3E9S A;  3M62 B;  4WJQ A;  4M01 A;  4NAM A;  4KZ0 A;  1WF9 A;  3FIL A;  3IVF A;  3GE3 C;  2N9E B;  4M0W A;  4IUM B;  2IBI B;  1YN5 A;  1TKY A;  2C7H A;  2DYM A;  4BZA A;  2HD5 B;  3GOE A;  2WX0 A;  3PSE B;  2WXF A;  5JHA A;  2KT7 A;  4GMV A;  2Z59 B;  2AEH A;  4KGR A;  1TS3 A;  2KTF A;  5D94 A;  3VUX A;  1F77 A;  4YSY B;  2HTM E;  2GOW A;  3M63 B;  4MGK E;  4J6I A;  2BBC A;  2ZCC A;  1QT9 A;  3N3K B;  1EWC A;  2WYQ A;  3ZKJ C;  2WXL A;  5L95 C;  2PE9 A;  2LVO A;  2WXN A;  3PV1 A;  5TSS A;  1NVI D;  3SEB A;  1LGR A;  4JWS C;  3I9V 1;  2JRI B;  2MBO A;  3IHP C;  3ETR A;  1UBQ A;  2YEP F;  5AEK B;  3NVW A;  3TEW A;  5JHB A;  5BYS A;  4MJS B;  4RMA A;  2N9P C;  3RUL A;  4WJP A;  4MJS A;  1XLP A;  1WXS A;  3A9J A;  4ICV A;  3RZW C;  1BML C;  1WXA A;  2WU5 B;  2MJD A;  4XGA B;  1P7E A;  3J9C A;  2MEK A;  4ZRJ A;  3EHV A;  4FAD A;  1D3Z A;  1ZE3 D;  1VJK A;  4ZRK A;  4FA6 A;  2N7E A;  2OJR A;  1X1M A;  1HQR D;  3DBH B;  3Q6B A;  1T0Y A;  4B95 A;  4WJO A;  2ZPY A;  2W9N A;  3A33 B;  3CWI A;  1VD2 A;  3DBS A;  3W1S C;  3MC9 A;  1JQ4 A;  4IW0 A;  3LXF A;  4N58 A;  4PYZ A;  4YTN B;  1FIQ A;  2R61 A;  4USA A;  2PKO A;  1L6U A;  2G3Q B;  3RNG C;  2A5U A;  2FNJ B;  4BVU C;  2AX5 A;  1WJ4 A;  3Q3F A;  2MA9 B;  4I6N B;  2FAZ A;  4BKS A;  3FC4 A;  2LI5 A;  4H2A A;  4TQ0 A;  4JL9 A;  2FUH B;  1QOF A;  3N1X C;  2BKF A;  4HCN B;  1YQ3 B;  1QLB B;  3IAM 1;  4W9E A;  2HJ1 A;  4A3P A;  1VRA B;  1I4R A;  5IN7 A;  4RGT A;  2E6X A;  2KFK B;  4DDI D;  2KN5 A;  1JWS D;  3KUD B;  4A3O A;  2DAF A;  2I1J A;  2M1M A;  2KK8 A;  3AV8 A;  1ZOY B;  3VTU A;  2J7Q B;  2K6D B;  2KKC A;  4US9 A;  1I35 A;  3ENE A;  1C1Y B;  4NQL B;  5BYQ A;  1WXQ A;  5H92 C;  4M02 A;  2ZPN A;  4WQO B;  3UQB A;  3TJP A;  3AE3 B;  3ZJU A;  3AE6 B;  2ZVO A;  5IA7 A;  3RD2 A;  3QCA A;  4BBN F;  3JSV B;  4N9F 4;  1QQR A;  2AYO B;  1V81 A;  2K0P A;  2WXH A;  2JQR B;  3V60 A;  2JWU A;  3JSV A;  1QF6 A;  5G5H A;  3IFW B;  1I4X A;  1V8C A;  2G45 B;  1HXY D;  4EEW A;  4LNF A;  3Q8A A;  1H8C A;  3NOB A;  2FE8 A;  4ANU A;  2MLB A;  2D11 A;  3DDC B;  1Q1O A;  3KQ4 A;  1VZ6 A;  4K81 A;  2KAC A;  2KD0 A;  4KIK B;  3L13 A;  3GP7 A;  1L0Y B;  3APC A;  2BB6 A;  3Q14 C;  2DNF A;  1E8Z A;  3B1L X;  2UYZ B;  1JWB D;  4IKG A;  4RF1 A;  1RAX A;  1EU4 A;  3NG0 A;  2YEP B;  4HCP B;  2I38 A;  2ON8 A;  4K1R B;  3WCQ A;  1DOX A;  3UI3 A;  2CR5 A;  4C56 C;  1OQQ A;  3T3N A;  4LJP B;  4ZRI A;  3BII D;  1N5X A;  1I4G A;  1SIF A;  3PVL A;  2ZZP B;  3VR9 B;  1FO4 A;  1WYW B;  3P1M A;  4A20 A;  1TY2 A;  3VUW A;  4RF0 A;  3VVW B;  3WA0 A;  1N60 A;  4IG7 B;  3AB5 A;  3C19 A;  2NPT A;  1SXT A;  3QK0 A;  1SE9 A;  4JQW C;  4GDK B;  1DOY A;  1I42 A;  1EM7 A;  1VR9 A;  2BPS A;  2DX5 B;  4LK0 M;  1WM3 A;  3LDZ E;  4OVU A;  3RI7 C;  1YN3 A;  5LXH A;  3B2G A;  1Z2M A;  2C5L C;  3DBL I;  3SDL C;  3C8Y A;  1XD3 B;  4KV2 A;  3IT6 B;  3BVZ A;  3S2A A;  3P2B A;  4LDT D;  1MJD A;  5G2N A;  3AI5 A;  3ZNZ B;  1V9J A;  3Q8C A;  3QAQ A;  1V86 A;  4TKN A;  4TUU A;  3BIN A;  3RMK C;  3A9K B;  4PS7 A;  1LM8 B;  4II2 B;  1A70 A;  1STE A;  4ITK A;  3AEF B;  4AQ7 A;  4RGO S;  3KH0 A;  4YSZ B;  5CX3 A;  4HWI B;  1OEY J;  1UH6 A;  3AEA B;  1TZO A;  1WRI A;  1J0G A;  4LLG M;  2JSV X;  3X23 A;  4MSQ B;  1AWD A;  2CJN A;  2G4S A;  3ZO5 B;  2JVC A;  4RGM A;  4C7Z A;  1HTQ A;  2KDI A;  4P1C C;  2CHW A;  2WXJ A;  5EE0 A;  4YXD B;  4F7Z A;  4IWO A;  5EE1 A;  3DBR B;  3RNB C;  1C79 A;  1ACC A;  3ZXR A;  2G4D B;  3QX1 A;  1FFV A;  4JLC A;  3DCG A;  1Z5S B;  2PLP A;  5MPO A;  4WH4 A;  1ZUD 2;  2I2Y A;  1WIA A;  4WWN A;  1L7Y A;  5L83 A;  4W9J A;  5CTR C;  1VLB A;  1YJ1 A;  2N0S B;  2BVC A;  4LNI A;  3QAR A;  4YL8 A;  2WDV B;  1P0R A;  1TKG A;  3W2D A;  3NVY A;  1GAQ B;  4LDT B;  4HJG E;  3R66 C;  3D32 A;  3HK0 A;  3RCZ A;  2ZNV B;  1UBI A;  4P16 A;  1JAL A;  3LB8 C;  2V9H A;  1RM6 C;  1FD6 A;  1FNW A;  4GIV A;  2D3A A;  1NBF C;  5D6J B;  1SIJ A;  2JZ3 B;  1FRR A;  1J7C A;  1SBB B;  1T0S C;  1L4Z B;  3OJ3 A;  2NR2 A;  4RCO A;  1QIL A;  5C23 A;  2YVC A;  2MX2 A;  3VH4 B;  2BKR B;  2RPQ A;  3P4P B;  4GN1 A;  4DK5 A;  2DAJ A;  2G9H D;  4KZC A;  2REX A;  1YIW A;  4WIP A;  3AMZ A;  4PYU A;  1JRU A;  1PGA A;  3U52 E;  4B0M A;  4DHZ B;  3AEG B;  3KUZ A;  1J7B A;  1P9D U;  3U8Z A;  4XC2 A;  3NHE B;  3ZRF A;  1BXT A;  4HKZ E;  4MM3 B;  4NQK E;  3ZJV A;  2WQY B;  2LJ5 A;  2ZVN A;  5C3J B;  1KJT A;  1WGH A;  2DYB A;  3GE8 C;  4MM3 A;  3GZN I;  4II3 B;  3NS8 A;  4C4V A;  3DBH I;  2K8H A;  3ZQ4 A;  3MJW A;  3ZNG C;  1B1Z A;  1R7S A;  2K9X A;  4REZ A;  2H88 B;  1NI3 A;  1ROE A;  1D5M C;  1T6B X;  2JU6 X;  2K5P A;  2M56 B;  3FAH A;  3C0R B;  1A5R A;  2LMC A;  1XLN A;  1WX9 A;  3KW5 B;  1KM7 A;  4KGT A;  2MJ3 A;  4AUQ C;  4ANV A;  1WSP A;  1QOG A;  2INC C;  2GBK A;  4HKQ A;  1LFD A;  3ZXV A;  3RPF C;  2CU1 A;  2O6V D;  2PJH A;  1JWM D;  1E10 A;  2Y3A A;  1PFD A;  2L05 A;  1LXD A;  3OWE B;  3QC8 B;  3DPD A;  5AUI A;  5HI1 A;  3K9P B;  4M8N A;  2N4F A;  1S3S G;  1V1P A;  1ZDX A;  1XT9 B;  3Q3M C;  4X57 B;  4G3X B;  2D5G A;  4MGI E;  1EWY C;  3MC8 A;  3ZRC A;  4HDQ A;  1V5T A;  2N1V A;  3PZ8 A;  2DZJ A;  2LRU A;  1NYQ A;  4AWJ A;  3CIR B;  4WWO A;  1NEK B;  1E8W A;  1TZ1 A;  2NTS A;  3N32 A;  3DHG C;  1R4N B;  2HE7 A;  2DZM A;  3DVN U;  4DDG D;  3HVD A;  1CK1 A;  3PRZ A;  1E90 A;  3ZW3 A;  1H4R A;  1FM0 D;  2GRI A;  4P1B C;  2L00 B;  1QOA A;  1GC6 A;  2IY0 B;  2KDE B;  2MRP A;  3EFU A;  2AL6 A;  1UF0 A;  2LZ6 A;  2MQJ A;  2WXM A;  2OHF A;  2KN4 A;  3ZNH B;  2J0M A;  4NZL B;  3RNA C;  1WZ0 A;  2WXO A;  2D3G A;  1V6E A;  1HTO A;  4NPN A;  5CHF A;  3W9C B;  3RNF C;  1ZXI A;  1VZ7 A;  4AOF A;  2M17 A;  2C7N B;  2KX3 A;  1K52 A;  3W1Y A;  4A55 A;  3BYY B;  4DXG A;  4E3C A;  2WU2 B;  2K8B A;  4DBG A;  4LCD E;  2KMC A;  1KOT A;  2EEL A;  2PIA A;  1N5W A;  2X38 A;  2PVO D;  2MH7 A;  4KGS A;  2BB5 A;  4TMA B;  2KMA A;  1LQB A;  2O6V B;  4TSS A;  2WX1 A;  1JRP A;  4GB9 A;  5IOI A;  2KDF B;  4JE3 B;  4MEL A;  2UWQ A;  1TS4 A;  2O6V A;  2RDH A;  5FKA C;  2QC8 A;  4W9C A;  4HEA 1;  1WXM A;  1U4A A;  2KXJ A;  3RT3 B;  4ZRP A;  1XEE A;  1LO5 D;  2H89 B;  1SE3 A;  1XF5 L;  2KJH B;  3DVN V;  1MHH E;  3AED B;  3NS1 A;  2RDB C;  2Y5B B;  2RGF A;  4HPM B;  4EFO A;  3RFZ B;  1AAR A;  2V0G A;  2IO2 B;  1OGW A;  2LRW A;  4K3B A;  4ARC A;  4KDI C;  1I4P A;  1ZPS A;  1T0Q C;  1EUV B;  2LXC A;  4NJC A;  4BOS C;  3HM3 A;  1WJN A;  3L0W B;  4MT5 A;  5AUK A;  2MBB B;  3RNE C;  3PT2 B;  2IND C;  4CHK A;  2NBV B;  2C9W B;  3TSS A;  2XN9 C;  3WAM A;  2WXI A;  2EKI A;  1IBX B;  4LNO A;  1NEN B;  4ZOH C;  3RZF A;  3Q69 A;  1IBX A;  2KFK A;  2LXA A;  3VDZ A;  3KVF B;  3DVG X;  4ASW C;  4EZL A;  1C77 A;  4Q2J A;  1JCK B;  4IM3 A;  3T9L A;  4W9F A;  1L0X B;  1E7V A;  3VAW A;  3P4S B;  3DOW A;  3HHM A;  4WAA A;  1N61 A;  1PQS A;  4OVV A;  2WLB A;  3H7S A;  2J0K A;  5AZF A;  1F2R I;  2R2O A;  2HDE A;  2J53 A;  4MGZ E;  4MH8 A;  3W1S A;  4OW0 A;  4ZDV A;  2BWF A;  1KH0 A;  4ANX A;  2J42 A;  5FR6 A;  2PMV A;  1RLF A;  1JWU D;  2NBU A;  1M94 A;  1SEB D;  1NDD A;  2JX5 A;  3NJT A;  2KWU B;  3NUH B;  5D3D A;  2N9L A;  2J4X A;  1Q10 A;  4DHJ D;  1CMX B;  5JH5 C;  4PS3 A;  1TY0 A;  3U2S C;  2IGG A;  4JPS A;  4KIK A;  4R3D A;  1RYJ A;  4A90 A;  5EDS A;  4NJ7 A;  2M0X A;  5E6P A;  3UGB B;  3ZUN A;  4G50 A;  1TS5 A;  3UIN B;  1OFF A;  1XXG A;  1TBE A;  4ANW A;  3KLS X;  2SEB D;  1C4C A;  3L08 A;  2KDB A;  3NVZ A;  4HVB A;  1V49 A;  1TS2 A;  4RGN A;  5G55 A;  4G0N B;  1WMH B;  1ZXH A;  3AEE B;  4YSX B;  1GNU A;  1J19 A;  3NY5 A;  2KO3 A;  2IYD B;  4EKU A;  2WXP A;  1WMH A;  3RUI B;  1V1O A;  2LUE A;  2RMM A;  1ISN A;  3JW0 X;  1CJE A;  1WXV A;  2V4I B;  5GMV A;  4HXD A;  2KZR A;  4HRO A;  4GDK A;  1OQR A;  2FCS A;  2B76 B;  1Q0W B;  2MWS B;  2JZP A;  2AQ2 B;  1D4B A;  2WDR B;  2C7M B;  4EOY A;  3BK1 A;  3URY A;  1SF0 A;  1OQY A;  4BBN C;  1JRO A;  2KYW A;  2NS5 A;  4LTU A;  2LUM A;  2CKH B;  3NRZ A;  4WQM A;  3LJ3 A;  1ZGU B;  2AQ1 B;  1EF5 A;  2KQS A;  1UGJ A;  1RFA A;  3BVM A;  1Q5W B;  2MBE A;  2FCQ A;  3A9K A;  1WGD A;  3MHS D;  1TGZ B;  3UF8 A;  5BMI A;  1DGJ A;  2GI9 A;  3ONS A;  3A1Q B;  2ACZ B;  3Q3J A;  2C60 A;  1F2R C;  4ICU A;  2VRR B;  3A1Q A;  1VCB A;  3MJ5 A;  4RM8 A;  3TEX A;  2BS4 B;  2KLC A;  1F0Z A;  2INP E;  1T5X D;  3DWM A;  1ZKH A;  4DHJ B;  4KDL B;  3Q3O C;  3ALB A;  2Q5W D;  2IO3 B;  5I4D A;  3U4E G;  2QIE B;  3BYT B;  4B6W A;  2MW5 A;  1XCQ L;  1V2Y A;  4A9A A;  2M4N A;  2AWT A;  4WAF A;  3H8H A;  3ML9 A;  1AW7 A;  1NI2 A;  3L4P A;  4S17 A;  2DBY A;  1SJE D;  3KWV A;  4XDC A;  1KRH A;  1RRB A;  3RYT A;  3Q8F A;  1JWA D;  1WYG A;  3UIO B;  2BGF A;  4FJZ A;  1K53 A;  5E6O A;  5T8I A;  1PGB A;  3R7R A;  4WUR A;  1DYQ A;  5DPT A;  3IT4 B;  1UWX A;  2W54 A;  1E0Z A;  4E74 A;  3B9J A;  3TMP B;  1KLU D;  3VHT C;  1MHX A;  3Q2A C;  4J3O D;  4MH0 E;  4S0R A;  4EZJ A;  2GBN A;  2BW2 A;  4N6E B;  4ZRQ A;  2DHZ A;  3ZYY X;  1I4H A;  2BS3 B;  2WXQ A;  3P63 A;  3WAP A;  3AE2 B;  1MPE A;  1C9F A;  2N7D A;  3MP9 A;  2INN E;  1YD8 U;  2MSE D;  1NYR A;  3PS6 A;  1UUP A;  2L76 A;  2MBH A;  1I4Q A;  4KKI A;  3AE1 B;  1FEH A;  2VZK D;  4RM9 A;  3EC8 A;  2QHO A;  2JXX A;  4ZYS A;  2PW9 A;  4HPL B;  3N30 A;  1N63 A;  2V3N A;  2JUO A;  4G11 A;  2KHW B;  2L0T A;  4MEM A;  1I7H A;  1WGG A;  4BKG A;  4OZB A;  2QDF A;  3A4S C;  4FXC A;  4JIO U;  1L0V B;  1MFW A;  4NNJ B;  3TBL D;  5J2R A;  3TEZ A;  3MHZ A;  3VUY A;  2CJO A;  2KVR A;  2KAJ A;  2MBQ A;  1Y8R C;  3DWG C;  2JXT A;  4ZYN A;  1ET9 A;  1PGX A;  1CZP A;  2D10 A;  2WDQ B;  3MTN B;  5BYR A;  2WDT B;  2GBM A;  2K8C A;  4GDL B;  3WAN A;  3H9D A;  5C2T B;  2D2Q A;  3EFC A;  2QJL A;  2M19 A;  3NZS A;  1J7A A;  3DBL B;  3R3M A;  4GDL A;  1WX7 A;  3UQA A;  4W9L A;  1TYG B;  3OLM D;  1MG8 A;  2ONQ A;  1FXA A;  2WP9 B;  5D2M B;  1KF6 B;  1T0R C;  3P4R B;  2NCN A;  4K7W A;  5JXV A;  2SAK A;  3L17 A;  4RNA A;  2XK5 B;  4US8 A;  2K3U A;  2DYO A;  5IO9 A;  4K7U A;  2AL3 A;  4DQO C;  3AXC A;  3IBE A;  1YMH E;  3L16 A;  4O1N A;  2XK5 A;  2WXK A;  1V80 A;  5DPR A;  1FNU A;  3QWZ B;  3RNC C;  4NY0 A;  2FIF A;  2KMM A;  1FNV A;  2QEJ C;  3HUI A;  3N1Y C;  4KSL C;  1PUT A;  1WRD B;  1VDV A;  1HZ5 A;  4FUL A;  4L1B A;  3CSF A;  1MI0 A;  2LHE A;  5D3I B;  3PZD A;  4ACF A;  1WX8 A;  2N7J A;  3K9O B;  1WWT A;  2KC2 A;  4D2K A;  3I5J C;  3PRP B;  4WWM A;  2VZK B;  1WE7 A;  1N6Z A;  1FMA D;  3T8M A;  2Y5P A;  3PPA A;  2MP2 B;  3TUO A;  4EUT A;  3AN1 A;  1SGH A;  3W5V B;  1YJJ A;  3DVG Y;  2MJE A;  2HTH A;  1FFU A;  1KLV A;  1E9M A;  1YOV B;  3U30 A;  4XZ4 A;  2JYE A;  1KTK A;  2JPH A;  1FXI A;  2L1A A;  3N20 C;  4ZHO A;  1SE4 A;  1WJU A;  2CHZ A;  4XWW A;  1ESF A;  1F52 A;  4HJK A;  4FN2 A;  4AP4 C;  1K51 A;  3IAS 1;  1B9R A;  4M0W B;  2GBR A;  2KNB A;  3B0A A;  5HKH A;  3H6N A;  3V61 A;  3JYU A;  3CF6 E;  4ZHP A;  2D07 B;  1E8Y A;  3PO0 A;  3NVV A;  1GC7 A;  1SE2 A;  4JX1 C;  2Z0D B;  4LJO B;  4IDI A;  1YX5 B;  3APD A;  2O2V B;  2W3R A;  5HHD G;  1FCC C;  3OG5 A;  4FJY A;  1PDX A;  1XCT L;  3V6E B;  3TEY A;  3U7D A;  2O2V A;  4LNK A;  1UZX B;  2KOX A;  1HE8 A;  4B0E A;  2KQ4 X;  5J17 A;  2ZEQ A;  2HJ8 A;  4HRS A;  4C7Y A;  2LGD A;  4KKJ A;  2BYE A;  1C78 A;  2LAS A;  2YLM A;  3QQ8 B;  4I6L B;  2K6Q A;  4IWQ A;  2L0F A;  3PTF C;  1IGC A;  5G5G A;  2LGS A;  2FBW B;  4JWU C;  1WGY A;  3PRE A;  4GLS C;  4OZC A;  5E6J A;  2WXG A;  3A9J B;  3PLV A;  3OJ4 B;  1XLO A;  4GOC A;  3LYY A;  4A6Q A;  3EUB 2;  3ZGZ A;  1WE6 A;  1QOB A;  2BWE S;  3AE7 B;  2K25 A;  1HA5 A;  3VTW A;  1BUI C;  1VZ8 A;  1S1Q B;  2R2Q A;  2W55 A;  3GZN B;  2UU7 A;  5BMG A;  2Z8L A;  2V3S A;  4IOI E;  2JZZ A;  3E56 A;  1IPG A;  3U7Z A;  1HEZ E;  4BOZ B;  2EKE C;  5DCN A;  2JT4 B;  3JVZ X;  5LXI B;  3L10 B;  3VH3 B;  3DQV A;  1AN8 A;  1YX6 B;  4B9K A;  2JRH A;  1F1H A;  2ZJD A;  4XE0 A;  2BYT A;  4DHZ E;  4W9K A;  5E6N A;  2AQ3 B;  2JY6 A;  3APF A;  3RN9 C;  1ZP0 B;  3TCA A;  3V6C B;  3OAW A;  3AM9 A;  4GGQ A;  3Q8B A;  2BF8 B;  1D5Z C;  1AYF A;  1WGK A;  4L23 A;  1WY8 A;  3DBR I;  1GOZ A;  2A4Z A;  3WAL A;  2VH1 A;  2DZK A;  3PHX B;  4EZK A;  3EEC A;  4F8C B;  2BYF A;  2IO0 B;  4TQ1 A;  2KAN A;  4A8X C;  5BMH A;  3BWU D;  1P7F A;  2L8J A;  1PYW D;  1WH3 A;  2IO1 B;  3Q8E A;  4PK1 A;  3O13 A;  4W9I A;  2X8X X;  1ENF A;  1ZDV A;  3FKY A;  1L4D B;  1E5W A;  2BQQ A;  1M4V A;  3Q3N C;  3HVZ A;  3HRD D;  3I63 C;  4E71 A;  5FR3 A;  3P4Q B;  3H1U A;  1R4M B;  2NBW B;  3SHQ A;  3O65 B;  4OVZ A; 
#chains in the Genus database with same CATH homology
 1EWC A;  2K9X A;  2RPV A;  2WXL A;  4REZ A;  4P6V F;  1XCQ L;  2OED A;  4A9A A;  2H88 B;  1NI3 A;  1ROE A;  1D5M C;  1T6B X;  2WXN A;  2JU6 X;  1NVI D;  5TSS A;  4WAF A;  3SEB A;  2K5P A;  3H8H A;  3R2I A;  2M56 B;  3FAH A;  4OZA A;  1AW7 A;  4JWS C;  3I9V 1;  3L4P A;  2DBY A;  2LHD A;  3ETR A;  1SJE D;  2YEP F;  2LFI A;  3KWV A;  4XDC A;  2LMC A;  1KRH A;  1XLN A;  3NVW A;  3TEW A;  4KGT A;  2QIL A;  2MJ3 A;  5BYS A;  3Q8F A;  1WSP A;  1QOG A;  1JWA D;  1WYG A;  4HKQ A;  1K53 A;  2TSS A;  2W3S A;  3RPF C;  1XLP A;  3T3O A;  5T8I A;  1JW9 D;  1BML C;  1PGB A;  2WU5 B;  4WUR A;  2L32 A;  2MJD A;  1DYQ A;  1P7E A;  3VRA B;  1JWM D;  3ZJT A;  3IT4 B;  1UWX A;  3J9C A;  2MEK A;  2Y3A A;  2W54 A;  1PFD A;  1E10 A;  1E0Z A;  1ZE3 D;  1VJK A;  3OWE B;  3B9J A;  5AUI A;  5HI1 A;  1HQR D;  2CU3 A;  4EE2 A;  3EA6 A;  1KLU D;  1MHX A;  2M0A A;  4J3O D;  1GB1 A;  1ZDX A;  1V1P A;  3CWI A;  2BW2 A;  4N6E B;  4ZRQ A;  2D5G A;  1EWY C;  1JQ4 A;  3LXF A;  4N58 A;  4YTN B;  1MVK A;  1I4H A;  1FIQ A;  2BS3 B;  2R61 A;  2WNM A;  2WXQ A;  2PKO A;  3AE2 B;  3P63 A;  3PZ8 A;  1L6U A;  1MPE A;  1NYQ A;  1C9F A;  2AX5 A;  2QSD A;  3CIR B;  3MP9 A;  1NEK B;  2INN E;  3FC4 A;  2NTS A;  4H2A A;  4TQ0 A;  1QKZ A;  3SFD B;  1QOF A;  2WS3 B;  1NYR A;  1YQ3 B;  1UUP A;  1QLB B;  1YJI A;  3HVD A;  1CK1 A;  1I4Q A;  4KKI A;  3AE1 B;  1KLG D;  3IAM 1;  1FEH A;  2VZK D;  2BT6 A;  3BK2 A;  2BS2 B;  2PVG C;  1FM0 D;  2J52 A;  1VRA B;  4ZYS A;  1DOI A;  2GRI A;  2PW9 A;  1I4R A;  3R2T A;  3NZ3 A;  1N63 A;  5LNK 1;  2V3N A;  3ABV B;  4RGT A;  2E6X A;  1EU3 A;  1QOA A;  1JWS D;  4XDD A;  3VRB B;  5GXG B;  1I7H A;  3AV8 A;  4OZB A;  1ZOY B;  2L52 A;  4FXC A;  1L0V B;  4US9 A;  2WXM A;  2OHF A;  2KN4 A;  3TEZ A;  3MHZ A;  4NZL B;  4C80 A;  2CJO A;  2KAJ A;  1RWS A;  4N59 A;  2WXO A;  5BYQ A;  1WXQ A;  1UNS A;  3DWG C;  5H92 C;  4YTM B;  1KFY B;  2JXT A;  2IDY A;  3AE3 B;  3ZJU A;  2XNA C;  5D7G A;  3W9C B;  3AE6 B;  3PZ7 A;  3B2F A;  1ZXI A;  3EGR A;  1ET9 A;  1VZ7 A;  1PGX A;  1CZP A;  2WDQ B;  5BYR A;  1QQR A;  2K0P A;  1K52 A;  2JQR B;  2WXH A;  4GDL B;  5C2T B;  2JWU A;  4A55 A;  3BYY B;  4CQN A;  1QF6 A;  4DXG A;  5G5H A;  1C4A A;  2QJL A;  2M19 A;  2WU2 B;  1J7A A;  1I4X A;  1V8C A;  1ET6 A;  1GB4 A;  1GPX A;  1TYG B;  5EE3 A;  1HXY D;  2EEL A;  2PIA A;  4PT5 A;  1N5W A;  2X38 A;  2ONQ A;  2PVO D;  1FXA A;  2WP9 B;  3Q8A A;  4USA A;  3SFE B;  2MH7 A;  4KGS A;  1KF6 B;  3P4R B;  1XO3 A;  2FE8 A;  1YNT E;  2BB5 A;  2NMQ A;  3BZD B;  4TMA B;  5JXV A;  2SAK A;  2ZW1 A;  4RNA A;  1K50 A;  1VZ6 A;  2K3U A;  3KQ4 A;  2KAC A;  2DYO A;  4TSS A;  4US8 A;  1JRP A;  1IGD A;  4DQO C;  4JE3 B;  1C76 A;  2DLB A;  3GP7 A;  1YMH E;  1TS4 A;  1L0Y B;  4O1N A;  2RDH A;  2BB6 A;  2WXK A;  3VQI A;  5FKA C;  1JWB D;  4HEA 1;  4IKG A;  5EE9 A;  4RF1 A;  2KDM A;  1EU4 A;  3ZYY X;  1FNU A;  2YEP B;  2I38 A;  2ON8 A;  4ZRP A;  2KMM A;  1FNV A;  4RFB A;  2QEJ C;  1XEE A;  3WCQ A;  1LO5 D;  1DOX A;  2H89 B;  3HUI A;  3IXS A;  3UI3 A;  1PUT A;  4C56 C;  1VDV A;  1OQQ A;  1HZ5 A;  3T3N A;  1SE3 A;  1XF5 L;  4YT0 B;  1Y56 A;  1D6E C;  3BII D;  1N5X A;  4L1B A;  1I4G A;  2JYT A;  1XLQ A;  1L5P A;  1MHH E;  3AED B;  4RH6 A;  3NS1 A;  2IGH A;  3VR9 B;  1SSN A;  1MI0 A;  1UWM A;  2LHE A;  2QMT A;  2IPK D;  5D3I B;  1FO4 A;  3P1M A;  1TY2 A;  2LJI A;  4L2Y A;  2N7J A;  4RF0 A;  2V3P A;  1WWT A;  3RFZ B;  1N60 A;  2WXR A;  2V0G A;  4D2K A;  3AB5 A;  4WWM A;  2VZK B;  4UDU C;  4ARC A;  1FMA D;  1SXT A;  2Y5P A;  3TUO A;  4GDK B;  3AN1 A;  1DOY A;  1I4P A;  1JML A;  4YWG G;  1EM7 A;  1ZPS A;  1VR9 A;  2L83 A;  4NJC A;  4LK0 M;  4MT5 A;  5AUK A;  3W5V B;  3GS2 A;  3BVG A;  1YJJ A;  2MJE A;  1YN3 A;  1FFU A;  3B2G A;  1E9M A;  2PTL A;  1E7P B;  3TSS A;  2XN9 C;  2WXI A;  2EKI A;  2LGI A;  3C8Y A;  1IBX B;  2JYE A;  1NEN B;  1KTK A;  4ZOH C;  1CQV A;  3AEC B;  3IT6 B;  1FXI A;  1RFK A;  2L1A A;  3BVZ A;  3Q69 A;  4ZHO A;  1SE4 A;  1IBX A;  2N9K A;  3N9Y C;  4XWW A;  3Q8C A;  1ESF A;  1K51 A;  1C77 A;  4Q2J A;  3IAS 1;  1B9R A;  1JCK B;  1SB3 C;  2Y5C A;  1A70 A;  1STE A;  4ITK A;  1L0X B;  2GB1 A;  3AEF B;  5HFY A;  3P42 A;  4AQ7 A;  4RGO S;  4ZHP A;  3P4S B;  3AE5 B;  3PO0 A;  1N61 A;  4YSZ B;  2WLB A;  2E3T A;  3NVV A;  3R8B A;  3AEA B;  1SE2 A;  4JX1 C;  1F2R I;  1TZO A;  1WRI A;  2W82 A;  2HDE A;  2J53 A;  4IDI A;  3AE9 B;  4MH8 A;  3W1S A;  4LLG M;  2RDG A;  2W3R A;  5HHD G;  1FRD A;  1FCC C;  3SR6 A;  1N62 A;  2JSV X;  4OW0 A;  1PDX A;  1XCT L;  3W5U B;  2IGD A;  1AWD A;  1KH0 A;  3TEY A;  2CJN A;  2J42 A;  4NAW B;  1D5X C;  2PMV A;  2BTE A;  3AE8 B;  4RGM A;  5H8Y E;  4C7Z A;  1JWU D;  4B0E A;  2KQ4 X;  1SEB D;  2WXJ A;  2JX5 A;  5EE0 A;  3I57 A;  3VR8 B;  3NUH B;  4YXD B;  5D3D A;  2N9L A;  2J4X A;  4AS1 A;  2ICI A;  3GB1 A;  1Q10 A;  4HRS A;  5EE1 A;  4C7Y A;  4KKJ A;  4YTP B;  4MAC A;  3MC0 B;  1C78 A;  2KWD A;  2NTT A;  2DWQ A;  1C79 A;  1ACC A;  1TY0 A;  3U2S C;  2IGG A;  4JPS A;  4ARI A;  4R3D A;  1RYJ A;  2FUG 1;  2ZW0 A;  1FFV A;  4A90 A;  2IJ0 A;  1IGC A;  2PLP A;  5G5G A;  5MPO A;  2FBW B;  4WH4 A;  1ZUD 2;  1TS5 A;  1E6E B;  4JWU C;  2I2Y A;  4GLS C;  4OZC A;  5E6J A;  1OFF A;  1XXG A;  2WXG A;  1XLO A;  1HZ6 A;  3LYY A;  1L6V A;  3KLS X;  4A6Q A;  3EUB 2;  3ZGZ A;  2SEB D;  1QOB A;  3AE7 B;  1HA5 A;  1C4C A;  1VLB A;  1BUI C;  1VZ8 A;  3NVZ A;  3AE4 B;  1FCL A;  1TS2 A;  1TKE A;  4RGN A;  1T3Q A;  2N0S B;  2W55 A;  1SJH D;  1C4P A;  1TJE A;  5BMG A;  1ZXH A;  3AEE B;  4YSX B;  2Z8L A;  1V1P B;  4IOI E;  4DXF A;  3E56 A;  3U7Z A;  1HEZ E;  3AEB B;  2WXP A;  1V1O A;  2RMM A;  2G1E A;  3V3X A;  2WDV B;  1CJE A;  2K22 A;  1TKG A;  2V4I B;  3W2D A;  1AN8 A;  3AH7 A;  4HRO A;  3NVY A;  1OQR A;  1GAQ B;  1V97 A;  2B76 B;  2JZP A;  4HJG E;  4XE0 A;  2AQ2 B;  2BYT A;  4KX6 B;  4P16 A;  1D4B A;  2WDR B;  1JAL A;  3BK1 A;  3KWL A;  3LB8 C;  3URY A;  1RM6 C;  2AQ3 B;  2LEK A;  1FNW A;  3MFG A;  1FD6 A;  1ZP0 B;  4XWT A;  1SF0 A;  1JRO A;  4LTU A;  3AM9 A;  1IUE A;  1SIJ A;  3Q8B A;  5FK9 C;  2LUM A;  1D5Z C;  1AYF A;  1YN4 A;  3V05 A;  1FRR A;  3NRZ A;  1WGK A;  4WQM A;  1YQ4 B;  4L23 A;  4OHJ A;  1J7C A;  1SBB B;  3FIL B;  5HG2 A;  1L4Z B;  2AQ1 B;  4RCO A;  3E9S A;  1QIL A;  4NAM A;  1UGJ A;  3BVM A;  1GOZ A;  3P4P B;  3FIL A;  4M0W A;  2G9H D;  1YN5 A;  1TKY A;  5BMI A;  1DGJ A;  2GI9 A;  4TQ1 A;  4WIP A;  4A8X C;  3BWU D;  1P7F A;  2ACZ B;  2DYM A;  3AMZ A;  5BMH A;  1PGA A;  3U52 E;  1PYW D;  2WXF A;  3Q8E A;  4B0M A;  1F2R C;  3O13 A;  3AEG B;  3MJ5 A;  3TEX A;  1J7B A;  2BS4 B;  1F0Z A;  2INP E;  1ENF A;  1BXT A;  4KGR A;  1ZDV A;  4HKZ E;  4MM3 B;  1L4D B;  1TS3 A;  1T5X D;  3ZJV A;  2WQY B;  3DWM A;  5C3J B;  1M4V A;  3HVZ A;  3HRD D;  1F77 A;  4YSY B;  2HTM E;  5FR3 A;  3ZQ4 A;  2Q5W D;  3P4Q B;  5I4D A;  3U4E G;  1B1Z A;  1R7S A;  2BBC A;  2QIE B;  1QT9 A;  3BYT B;  4OVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...