2Y5CA

Structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
SDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Functional Studies on Human Mitochondrial Ferredoxins
rcsb
source organism Homo sapiens
molecule tags Electron transport
molecule keywords ADRENODOXIN-LIKE PROTEIN, MITOCHONDRIAL
total genus 29
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2y5cA00
3KWLA 4LTUA 1XO3A 3NVWA 1E10A 2W3SA 2W3RA 5H92C 4YT0B 1GPXA 1UWMA 3AH7A 4N58A 1TKYA 4JWSC 1SIJA 1TJEA 2BT6A 3AE7B 2WDQB 3AEEB 1NEKB 1R7SA 2DWQA 4KX6B 3FAHA 1N5WA 2ACZB 1NI3A 1FFUA 1ZUD2 2AX5A 2MJEA 1QF6A 3P4PB 3HRDD 2EKIA 1RWSA 2KAJA 1N5XA 1SB3C 1EWYC 1J7CA 1B9RA 3W9CB 1JRPA 1E0ZA 5G5HA 3VR8B 3AEGB 1WXQA 2M19A 2PIAA 3AE1B 4US8A 3VR9B 1JQ4A 2MH7A 1QOGA 1FRDA 2Q5WD 2WDVB 3DWGC 4N59A 1QOAA 3AV8A 3AM9A 4JX1C 3SFEB 1FXAA 1RM6C 3NVVA 2QIEB 3EUB2 1V97A 2WU5B 3AE3B 4YSXB 3AE8B 1A70A 2K9XA 1JWAD 3AB5A 3AEFB 1KF6B 4YSYB 2WP9B 1CJEA 2CJOA 1KFYB 4IDIA 1WRIA 3AE6B 1YQ3B 3BIID 1TKGA 4YTMB 2WLBA 4WQMA 1I7HA 3L4PA 3SFDB 3CIRB 2CU3A 1WYGA 4C7ZA 1YQ4B 2PVOD 2WS3B 1XLNA 1WWTA 1N63A 1FIQA 1E6EB 1OQRA 3AE4B 1N61A 1JW9D 1ZOYB 5EE0A 1QLBB 1TKEA 1FFVA 1T3QA 5EE1A 1FO4A 1JALA 2OHFA 3CWIA 3FC4A 2W55A 4US9A 1ZP0B 2N0SB 3NRZA 4HRSA 5H8YE 3P4QB 1NYQA 4USAA 4YSZB 1RYJA 3B2FA 1N60A 1F0ZA 5EE9A 4P6VF 5MPOA 3ZYYX 3P1MA 1OQQA 1J7AA 1SF0A 2BS2B 4N6EB 2B76B 2PKOA 2K5PA 1FRRA 2DBYA 1J7BA 1PUTA 3HUIA 1ZXIA 2KMMA 1FMAD 3AEBB 3DWMA 3PO0A 1IUEA 1QT9A 2PVGC 4ZHPA 2MJDA 3LXFA 3RPFC 1E9MA 1VLBA 2WQYB 1ROEA 3ETRA 2MJ3A 2G1EA 4A9AA 4ZHOA 1TYGB 2WDRB 1E7PB 1AYFA 2FBWB 4C7YA 3AE2B 1PDXA 2QJLA 2BS4B 3AE5B 5C2TB 2CJNA 1FM0D 2HTME 3AEDB 3SR6A 1NVID 3NS1A 1QOBA 4ZOHC 4ITKA 1DOXA 1DOIA 1QOFA 1YJJA 1VDVA 1KRHA 3LB8C 4YTPB 1GAQB 5C3JB 2E3TA 2JQRB 1L6UA 4HROA 1XLQA 2L52A 5EE3A 1XLPA 1L5PA 1RFKA 4WWMA 1V8CA 5G5GA 2JX5A 3AE9B 1N62A 2K22A 3P4SB 1YJIA 2WU2B 3AECB 3B2GA 3VRAB 4FXCA 1DGJA 4JWUC 2Y5CA 3P4RB 5GXGB 2M56B 3AMZA 3NVZA 2BS3B 3HVZA 3P63A 1XLOA 3W5VB 1PFDA 1WGKA 3AEAB 1JROA 3AN1A 1CZPA 1NYRA 1L6VA 1OFFA 3NVYA 4YXDB 1VJKA 5AUIA 4C80A 2H88B 3W5UB 4YTNB 1JWBD 3B9JA 1DOYA 1AWDA 3WCQA 2LEKA 3ABVB 2L83A 5AUKA 1NENB 2H89B 3VRBB 2W54A 1L0VB 1FXIA
chains in the Genus database with same CATH superfamily
4E3CA 3A4SC 3SEBA 2MW5A 3AE7B 2KQSA 3D32A 4LK0M 4FA6A 4M00A 3RNEC 1ISNA 5IO9A 2L0FA 3R66C 2ACZB 1NI3A 1I4XA 4HXDA 4M0WA 4A90A 1B9RA 4G50A 1CMXB 2XK5B 4RH6A 2IYDB 2WXLA 1WXQA 2L0TA 3AE1B 4DDID 4OVZA 4W9DA 2IPKD 2YEPF 5C1ZA 4YL8A 3DWGC 2MEKA 4G3XB 2WHIA 5TSSA 4EZKA 1QQRA 1WRIA 1WXAA 1GB4A 3ZQ4A 2KFKB 3BIID 3Q3OC 1P7FA 2EMTA 5CHFA 1VZ6A 3SFDB 3E56A 4NZLB 4C7ZA 3EECA 2PVOD 2HD5B 4J6IA 2D07B 1ZOYB 4K81A 5JZEB 3TIXA 1SSNA 1SE4A 2INDC 2LVOA 1PGBA 3ZLZA 2L05A 2M8SA 1TBEA 2WQYB 3VH3B 5HI1A 1RAXA 4AJYB 3QJZA 2KD0A 4W9KA 2CHWA 2RPQA 1FM0D 3AEDB 4PYUA 3VDZA 5L95C 4NJ6A 4YTPB 2KMAA 4KZ0A 2WXOA 4XWTA 1RFKA 3Q8EA 5G5GA 1P1AA 2KTRB 5D7GA 3WA0A 4HK2A 2Y5CA 3X0WA 3NVZA 5L83A 3A33B 3N30A 5JH5C 3SHQA 1TS4A 3NG0A 3DBRI 2J0JA 4JL9A 1NBFC 2KX3A 3NVWA 1UBQA 1TY0A 3DVNU 4JWSC 4MGKE 1T6BX 1WRDB 3H6NA 3IFWB 1TS5A 3BZDB 1LQBA 2DYBA 2DYOA 2K0PA 2FCNA 2MH7A 1FRDA 3ZXRA 5GMVA 2C5LC 2I1KA 1C4AA 4M8NA 1V97A 1F77A 1KF6B 2EELA 4OZBA 2L00B 4K3BA 4AQ7A 2LMCA 4KSKC 1P98A 1B1ZA 2FE8A 2PEAA 5CHVC 3UF8A 3JSVA 3ZDMC 5EE1A 4GLSC 1RFAA 5JXVA 2REXA 1WH3A 5IN7A 4KIKB 4HKZE 3N32A 3P4QB 3OLMD 1EF1A 3KW5B 1YX6B 2E6XA 3PSEB 4GU2A 4A20A 5EDSA 1ZXIA 3PHXB 4ZHPA 2J0MA 2MJ3A 4ARCA 2G1EA 2JWUA 4FHJA 1NVID 4BKGA 4PS8A 4NY0A 4A8XC 1L5PA 3TEXA 4WAFA 3Q3JA 2LUEA 3AECB 2QSDA 2PE6B 3FILA 2IGGA 3MJWA 2BYFA 1WX8A 1XF5L 4K7UA 1WXVA 5DPRA 4NAWA 3VRBB 1Q5WB 5J2RA 2O6VA 5DPWA 1SE9A 2DWQA 4DXAB 4URKA 5LLIA 3N3KB 4P7IA 4REZA 3TUOA 1ZW7A 2AX5A 1QF6A 4JPSA 1GUAB 3HRDD 3NZUA 4M01A 1YN5A 3DBLI 4OW0A 5J18A 1EU4A 4R3DA 2PIAA 3BVMA 1J19A 2KO3A 2RDGA 3APDA 5HG2A 1GC7A 4OZCA 1E7VA 4DHJD 3BYYB 4N59A 1MHHE 3AE8B 5AZGA 4EE2A 1UBIA 1CJEA 2D3BA 1IYFA 4A3OA 2NVUI 1EWCA 3IAS1 2LUMA 2ZPNA 1TIFA 5EE0A 1H4RA 5JHAA 3DVNV 1ACCA 4FJZA 2LHEA 3DHIC 5H8YE 3VTVA 2V3NA 2OJWA 2KTRA 4USAA 1FNUA 2Z59B 1N60A 4I6PA 1SF0A 3PTFC 3HIZA 1FMAD 1IUEA 1VLBA 3W1SA 2WXRA 1MHXA 4D2KA 2KVZA 3RD2A 4ZOHC 1YN4A 2BKRB 1QOFA 2KC1A 4XYCA 2JZ3B 1C77A 3HHMA 4L1BA 1F2RC 2G4DB 2D3AA 1YJIA 3ZW3A 3MC0B 4W9FA 4ZRPA 2D3GA 1E8XA 2CR5A 1CZPA 3QA8A 2ICIA 4DDGD 1WGHA 5AUIA 2H88B 3IHPC 1WJUA 1C3TA 4WWNA 2L83A 2H89B 2W54A 5HKHA 3R2IA 4WAAA 3RNBC 1WJNA 3N20C 4P1CC 2BT6A 3JVZX 5E6OA 3FAHA 2D10A 2WXFA 1JMLA 1F52A 1EWYC 3PPAA 1YN3A 2JSVX 1JWUD 2MCNB 4RGOS 2J52A 1QOGA 4LLGM 1YIWA 5BYRA 2WXGA 4PS7A 3C8YA 2INPE 4MGYE 3IG3A 2BTEA 1MG4A 3U7ZA 4MEMA 5LXIB 2CU3A 3R3MA 5CX3A 1M94A 4HJKA 1OQRA 4MSQB 1WJ4A 4HDQA 2BWFA 4WQOB 4IKGA 3M63B 2L7RA 1A5RA 1L4ZB 1MVKA 3NRZA 2UYZB 4FULA 3A4RA 4JQWC 2JYTA 2MLBA 4NQKE 4H2AA 3U52E 2B76B 2BYEA 2RPVA 4GDLB 4MGIE 1QKZA 1R4NB 4BKTA 1AYFA 1UH6A 3GZNB 3CF6E 3SR6A 2XBBC 4AP4C 3R7RA 2WNMA 4ACFA 4WWPA 2ZPYA 4W9HA 2N9KA 1MJDA 2B3AA 4IM3A 3RNGC 2BB5A 4FHKA 2XNAC 4B9KA 3RN9C 4KGSA 4JWUC 3W5VB 4LDTD 1XCQL 2BF8B 3DVGX 4C80A 1D6EC 1IPGA 3EGRA 4KDLB 1L4DB 2JRHA 3TCAA 2JYEA 3EC8A 1SGHA 3RMKC 4JLCA 4TQ0A 1E8WA 1BUIC 3IXSA 5IA7A 3IT6B 1E0ZA 1KLUD 1LFDA 1GG3A 5AZHA 5BMIA 4NJ7A 1XXGA 4DHZE 2WWZA 3TBLD 3WAOA 3AM9A 3BK2A 1YD8U 4NPNA 2K8BA 2RDBC 2MQJA 3H1UA 1LGRA 4KZCA 2DAFA 2GB1A 3UIOB 4G11A 2KKCA 1N63A 1UELA 3VFKA 1T3QA 1ET6A 1QILA 1FNVA 2OHFA 3LDZE 4HRSA 2M0AA 3U30A 1G6JA 3B2FA 4WIPA 2MP2A 4RF1A 4ANXA 5MPOA 2ZEQA 2SAKA 2V9HA 3N1XC 1WFYA 2PLPA 5KHQA 3A9JA 4BOZB 2NPTA 2FBWB 3GZNI 3B0AA 2AYOB 2K6QA 2Y3AA 3KUCB 4YWGG 3GE8C 4BBNF 1J8CA 2KWCA 2N9XA 1N62A 3IAM1 5HFYA 2WXHA 3P4RB 4MACA 5GXGB 3KLSX 4WJNA 2NBWB 4FN2A 4II2B 1WGKA 4P16A 2AQ3B 3VTUA 3PGEA 4JGHB 3ABVB 3KVFB 2BB6A 1MG8A 2QCZA 3ECIA 4MGZE 4K7WA 5I4DA 2N9PC 5CTRC 1GB1A 1WR6E 2V3PA 3P4PB 5D3IB 2LXCA 2NMQA 2D3CA 4W9GA 4HPPA 5TR5A 3VR9B 2C7NB 2CS4A 1IP9A 4JX1C 3SFEB 2ZW1A 1PQSA 2QEJC 2K9XA 3AEFB 4YSYB 2KDFB 2CJOA 3MC9A 1WE7A 4RGMA 4IDIA 3AE6B 3PZ7A 2BYTA 1KOTA 2OOBB 5IOIA 1JWMD 4LNNA 4A55A 3DCGA 2IY0B 4LNIA 2J7QB 3CSFA 1ZDXA 1FO4A 2LVPA 1JALA 2KFJA 3K9PB 2N0SB 4JE3B 4YSZB 2KLCA 4MT5A 4NQLB 3R2TA 2DZIA 2JUOA 3O13A 4LNKA 2GMIC 1ZE3D 1ZDVA 4IM0A 3PZDA 5AZFA 3GB1A 4KV2A 2JZPA 3HM6X 3PZ8A 3EFUA 1TYGB 1E7PB 3TJPA 4K1RB 2ZNVB 1FCLA 4NNJB 3A9JB 1I4RA 1VDVA 3LB8C 4O1NA 4Q2JA 1XLQA 1XLPA 1VRAB 1E7UA 2MSED 3VQIA 3L13A 3P63A 2NTTA 2JF5A 3O65B 1I4QA 4XX5A 3ZRCA 1V5OA 1WM3A 5IP4D 2W3SA 3NZSA 5H92C 2WDTB 2MA9B 3AEEB 2R61A 4K7SA 1FPYA 2MWSB 2EKEC 3T9LA 1WZ0A 2D5GA 2M17A 2VRRB 4B0MA 2DNFA 2JVCA 3M95A 1KH0A 1Q1OA 1TY2A 2G45B 1YMHE 1XD3B 4LCDE 1Q0WB 1WGYA 2NPTB 3T8MA 4EEWA 4GIVA 2IGDA 5DPSA 1RLFA 4XC2A 2BKFA 2AL3A 4F7ZA 1IGCA 1TS2A 4A6QA 5G2NA 2KTFA 3ZXVA 1U4AA 3BY4B 2KJHB 1CQVA 2WXQA 3BYTB 4A3PA 3FC4A 1HTQA 2N4FA 1SXTA 4RFBA 3DBLB 3UQAA 1V80A 3I63C 2L8JA 4GMVA 1YQBA 1HZ5A 3ZNID 2EMSA 4KKIA 4C00A 4W9CA 5FR6A 3PT2B 2PVGC 3VXWA 1C4PA 1KJTA 2CJNA 2BGFA 1V1PB 2BYVE 1OGWA 1QOBA 3KYCD 4ANVA 4EZLA 1V81A 3CMMB 4CYEA 5C3JB 2KYWA 2JQRB 1L6UA 1OEYJ 4LNFA 3OJ4B 4DHJB 1E90A 2Y5BB 1D5ZC 4IUMB 2KACA 3KWVA 5KHOA 3BVGA 1DYQA 2Z8LA 3KYDD 1JWBD 3WCQA 1OTRB 3H9DA 2QILA 2WXKA 2GI9A 2Z0DB 4WURA 4YT0B 4TUUA 1UWMA 3AH7A 1SIJA 1TS3A 1YOVB 4GGQA 3UQBA 3PLUA 2V3SA 4MH8A 1N5WA 1JRUA 1UGJA 1FFUA 3DDCB 3R7QA 1R4MI 1LXDA 1SB3C 2J53A 3I57A 1KM7A 2JZZA 4OZAA 2M19A 1V9JA 2GBMA 3DBHI 1K53A 1MFWA 3NHEB 4C4VB 1E5WA 3AE3B 3MTNB 1IBXA 2LWPA 4DQOC 2Y5PA 1ET9A 2M0XA 4GDKA 1F1HA 2WXNA 3U7DA 3QQ8B 4WQMA 3L4PA 1L0YB 2FIFA 3HVDA 2KQ4X 2QMTA 2Z0EB 1FIQA 1N61A 1ZKHA 4M0WB 3RYTA 2LGDA 4LNOA 2ZVNA 2K6DB 5CHWA 4HCPB 4MH0E 1FRRA 4RGTA 1J7BA 3VUYA 3MC8A 3VHTC 3RT3B 1WYWB 2K8HA 1UUPA 3H7PB 1WGDA 3AE2B 2QJLA 1C9FA 2CHXA 3NY5A 3H7SA 3FKYA 4HROA 2J0KA 4NJCA 2ZZPB 4RGNA 5EE3A 3GS2A 1HXYD 1DGJA 2C7HA 3PREA 1WSPA 4AS1A 3Q8FA 1NDDA 3V05A 2LGIA 1I4HA 2L76A 2LEKA 3QAQA 3TEZA 3QHTA 2RMMA 4N58A 2A4ZA 2YVCA 4AOFA 2KANA 1PGXA 4ASWC 3ZO5B 2FUHB 2W82A 4TMAB 3AU4A 2EKIA 3PRMB 3VUWA 3MP9A 1P3QU 3UIPB 3AEGB 4RM8A 4XWWA 4OVUA 3ZVVA 2FIDA 1R4MB 4TV3A 2OEDA 4YSXB 3WALA 2WX0A 3I9V1 2QC8A 2BW2A 1L7YA 2WS3B 2O2VA 1HTOA 3V61A 2KXJA 2V4LA 1LM8B 3I3TB 5D2MB 2C7MB 2VH1A 1I42A 2HTHA 3U4EG 4DK5A 5D94A 1WJ6A 4ICVA 2LGYA 1KTKA 3DWMA 4TKNA 4ZRQA 2LRUA 3ETRA 4RM9A 4NAWB 4NAMA 3DBSA 1XQQA 4ZDVA 2O6VB 4C7YA 3V6EB 2CKHB 1V5TA 4ITKA 1IBXB 2INCC 1DOIA 2NTSA 4OVVA 3B08A 4DXFA 2MBHA 3L10B 4KKJA 1V8CA 2JX5A 1WX7A 2MX2A 3HVZA 1JROA 2XN9C 3QCAA 2ZNVC 4B95A 2WXPA 3MHSD 3H8HA 3QK0A 4B0EA 1AWDA 1TZ1A 1K8RB 3E9SA 4GSWA 4C4VA 1ENFA 2IJ0A 3L17A 3RULA 3NZ3A 1VR9A 4WWOA 4MJSB 3N9YC 2I38A 2FCQA 2I1JA 4US8A 1JQ4A 5G55A 1SBBB 3QX1A 4EZJA 1D5XC 4IWPA 1TZOA 3AV8A 1V2YA 1FXAA 4XDDA 1WXSA 3W1YA 4DXGA 2M1MA 2XEWA 2GBNA 1PYWD 1IGDA 1EM7A 4GB9A 1E6EB 1WY8A 1FFVA 5E6NA 2IO3B 2BVCA 2RR9A 2AQ1B 3Q2AC 5JHBA 1C78A 4FADA 1F0ZA 2KC2A 3OG5A 1HQRD 1OQQA 2NCNA 4ZRIA 3TL5A 4HLEA 3AEBB 3MHZA 4W9EA 3OWEB 4A9AA 4ZHOA 1MPEA 4J3OD 2PJHA 4M02A 2WYQA 3I5JC 2AWTA 3Q6BA 1GOZA 5AEKB 3ZNZB 4DHZB 1GAQB 2DENB 2K1FA 2D11A 4WWMA 1WM2A 3ALBA 2M56B 3ZJTA 5HHDG 1PFDA 4HKQA 3KH0A 3DBRB 1VJKA 4YXDB 3W5UB 3GE3C 2DHZA 1FD6A 3B9JA 2KWUB 1Z2MA 3EHVA 2MBBB 1L2NA 2DAJA 4CQNA 2JU6X 3A1QA 2JXXA 4L2YA 3ZGZA 5BYSA 2VZKB 1RWSA 1QZEA 3Q3NC 2ONQA 3RZFA 3W9CB 3TEYA 1E8ZA 1I35A 2N7JA 3N1YC 2WXMA 4FBJB 1E8YA 2IY1B 2LGXA 3JW0X 3SDLC 2BQQA 1TGZB 1C76A 3OAWA 1KFYB 3MFGA 2OJRA 1TKGA 4HJGE 3B1LX 3RFZB 2FAZA 4K3CA 1XCTL 3AE4B 4IM2A 4S17A 1JWSD 3V6CB 1JW9D 4CO7A 3EA6A 2LXAA 4ZYSA 2G4SA 3RNCC 3UGBB 1UD7A 3ML9A 3IT4B 5J17A 2AL6A 4TSSA 1FNWA 1X1MA 1VZ8A 1FEHA 1SJED 2UWQA 1BMLC 2K5PA 4W9LA 1PUTA 1PGAA 4L23A 1QT9A 3JYUA 1R4NI 2QHOA 4LJOB 3ZNGC 2CHZA 2PTLA 3LJ3A 2KOXA 3JSVB 5BMGA 1VCBA 2K8CA 2NS5A 3DHGC 3QARA 4HCNB 1C1YB 1FXTB 2L52A 3RNAC 4KIKA 1AN8A 3P4SB 5IKCM 2KQ7A 2WU2B 1V6EA 5D3DA 2BS3B 4IWOA 2UU7A 3AN1A 4AUQC 1L6VA 1MI0A 1DOYA 4GDKB 4BZAA 3KWLA 2GBKA 3TEWA 2KFKA 4IOIE 3ZTDA 2W3RA 4E74A 1GPXA 4MJSA 3UINB 1WMHA 1NI2A 2GRIA 4KX6B 1HE8A 1WIAA 2KWDA 4WJPA 1YNTE 4F8CB 3Q8CA 3BINA 2LVQA 3W2DA 3MJ5A 3PVLA 1SE3A 2DLBA 4HWIB 3NVVA 3ONSA 4XGAB 1FCCC 3ZJUA 2WP9B 2K3UA 4F1SA 1GC6A 4MM3A 3T3NA 3AI5A 2KDBA 3S2AA 3L08A 4BOSC 2X8XX 4EFOA 3PHWB 5DCNA 2KWVB 1UGMA 2YEPB 4RNAA 3UI3A 3TSSA 1K52A 4LJPB 4GOCA 2MBQA 2A5UA 3Q3FA 2KDEB 4P6VF 3A9KA 3P1MA 1F9JA 3U8ZA 1OQYA 1TT5B 1H8CA 4GN1A 1T0RC 2V4IB 1E9MA 4LDTB 4XZ4A 2DYMA 4PK1A 3AU5A 1Z5SB 2FCMA 2GBRA 3NOBA 3V62A 1KRHA 1SEBD 2C60A 2ON8A 2KN5A 3RUIB 3TMPB 2WXIA 3ZDTA 1ZXHA 2IO0B 3B2GA 4W9IA 3VRAB 1M4VA 3VVWB 4KSLC 1KLGD 3AULA 1OFFA 4PYZA 4ARIA 2LGSA 2TSSA 3BWUD 5C23A 1NENB 2KVRA 4I6LB 4ICUA 1FXIA 4LTUA 2MHJA 1E10A 3APCA 4M8MA 5FKAC 1UF0A 4HDOA 3L0WB 2O2VB 1NEKB 2ZCBA 2JRIB 4HEA1 1HZ6A 3A1QB 4FJVB 5LNK1 2JWZA 2KAJA 3EFCA 1N5XA 2J4XA 3OJ3A 4BKSA 3VR8B 3GP7A 3DQVA 3P2BA 3P42A 2IGHA 3IVFA 4RF0A 4FJYA 2WDVB 2IO1B 1RM6C 4IG7B 2PE9A 2BBCA 4OHJA 3Q69A 4GXBA 3RNFC 4GDLA 2C9WB 4JIOU 3DVGY 3L16A 1WYGA 1GNUA 3QIJA 2IZVB 4EKUA 4RMAA 3CWIA 4N9F4 2XK5A 1EO6A 1WMHB 2M4NA 2LFIA 2DX5B 4RCOA 2KX0A 1EU3A 2LD9A 1V49A 4PT5A 4FLHA 2KMMA 1WZ3A 2MJDA 2KNBA 3RPFC 1ROEA 2KJ6A 3X23A 3J9CA 2JT4B 2AQ2B 5IAAC 2KJRA 1BT0A 4AWJA 3NS1A 2R2OA 3H7PA 3ZJVA 1CK1A 4BAXA 3BK1A 3NJTA 3AE9B 1WGRA 2VZKD 2J42A 2INNE 2MRPA 3M3JA 4BVUC 2LHDA 5BMHA 1SIFA 3NVYA 2GLSA 3R8BA 3ZKJC 3CSTA 3GOEA 1HEZE 3DPDA 2LRWA 4DBGA 1Y56A 1TKYA 4MM3B 2NR2A 1R7SA 2K39A 4KGTA 1AARA 3KUDB 5DPTA 2MJEA 1VZ7A 4MSMB 2O6VD 2WGSA 3WAPA 2RGFA 3ENEA 2ZCCA 4WJQA 5G5HA 1EF5A 1ZGUB 3ZRFA 4I6NB 3RCZA 3WIMA 1WE6A 1XEEA 3PLVA 3IBEA 1T0SC 2KDMA 1WXMA 2QIEB 3AB5A 1I4PA 1D3ZA 2GBJA 2GOWA 4HPMB 4S0RA 1UZXB 4X57B 4UDUC 2WLBA 1I7HA 1WX9A 2VH2A 1V1OA 3C19A 2BPSA 2X38A 1XLNA 1K50A 3HM3A 3Q14C 1TKEA 3T3OA 3WAMA 3PRPB 1ZP0B 2DZMA 1NYQA 1LO5D 2N1VA 1I4GA 2L32A 3APFA 2PW9A 4N6EB 2PKOA 3V60A 3PO0A 3A9KB 3Q3MC 2KLGA 2KK8A 2WDRB 3W1SC 1PDXA 1KLVA 5C2TB 2HTME 3AXCA 1DOXA 4XDCA 4IW0A 3U2SC 1YJ1A 2K22A 2FUG1 2KN4A 3VUXA 1XLOA 1EUVB 4ZYNA 2KZRA 2KDIA 2N7EA 3N1ZC 1SJHD 3HK0A 5FK9C 2AEHA 5E6JA 5AUKA 1N6ZA 4QAYA 3PV1A 4BFRA 3SU8X 1V1PA 4DWFA 3RI7C 3PS6A 3QWZB 3WANA 3M62B 1T5XD 4W9JA 4MDKE 3Q8BA 2K25A 4P1BC 1WF9A 2SEBD 1P0RA 2N7DA 2Q5WD 2WU5B 1YX5B 2YLMA 1A70A 5E6PA 3C0RB 3V3XA 3CIRB 1J0GA 1RRBA 3ZNHB 1F2RI 1STEA 2IDYA 2JPHA 4XE0A 2WXJA 5LXHA 1D5MC 2D2QA 4US9A 1D4BA 5BYQA 2R2QA 2RDHA 4EOYA 4ZRJA 1C4CA 2DZKA 3VTWA 4C56C 3PRZA 2ASQA 2N1WA 2JY6A 5EE9A 3ZYYX 4KVGB 1J7AA 2BS2B 2CU1A 4IC7B 2QDFA 1S1QB 4ZRKA 2ZVOA 3DHHC 4EUTA 3QC8B 1WGGA 3ZUNA 4ANWA 2FNJB 1BXTA 1YJJA 2E3TA 1TTNA 3ML8A 1AW7A 1L0XB 1UWXA 2HE7A 1T0YA 3AMZA 2N9EB 4HPLB 3AEAB 2LASA 2MBOA 2KT7A 5BO4B 3NS8A 5D6JB 2ZW0A 2RSUA 1P9DU 2IBIB 2HJ1A 1XO3A 4TQ1A 2G3QB 3K9OB 4BKSD 1TJEA 2WDQB 4WH4A 1Y8RC 2W9NA 3KQ4A 3L54A 1ZUD2 4WJOA 1S3SG 1J7CA 3LYYA 2G9HD 1VD2A 2KMCA 1JRPA 4PS3A 2LJ5A 1T0QC 3DOWA 1Q10A 2MP2B 1P7EA 1QOAA 2WX1A 3EUB2 3NUHB 1JWAD 4G0NB 3BVZA 3VH4B 5FR3A 4IWQA 1YQ3B 3FILB 4YTMB 1XT9B 2MBEA 3SD5A 2ZJDA 1YQ4B 2V0GA 1HA5A 1WI0A 5T8IA 2HJ8A 1WWTA 2PMVA 4II3B 1OEYA 1QLBB 3ZTCA 3KUZA 1L0VB 2W55A 2KHWB 2RD0A 3VAWA 1SE2A 1ESFA 4AJWA 1RYJA 2N9LA 2NBUA 4MELA 3Q8AA 1K51A 1WR1A 2V1YA 4KDIC 2DBYA 3HUIA 4CHKA 1GJZA 2L3ZA 2LI5A 4BBNC 2HDEA 3LXFA 1V86A 4ANUA 3ZIMA 2FCSA 2LJIA 2I2YA 3AE5B 2BS4B 2DZJA 1C79A 2L1AA 4B6WA 2BWES 3URYA 1UNSA 1ZPSA 4E71A 2JXTA 4FXCA 2IO2B 1JCKB 4KGRA 1NYRA 2LZ6A 4HVBA 3DBHB 4YTNB 3RZWC 2PPHA 2NBVB
chains in the Genus database with same CATH topology
4LTUA 1E10A 2RMMA 3SEBA 2JYEA 5FKAC 4N58A 3AE7B 4LK0M 1NEKB 1PGXA 4HEA1 1HZ6A 2W82A 2ACZB 1NI3A 4TMAB 4TQ0A 5LNK1 1I4XA 4M0WA 1BUIC 2EKIA 3IXSA 4A90A 2KAJA 1N5XA 2J4XA 3MP9A 1B9RA 3IT6B 4RH6A 1E0ZA 2WXLA 1KLUD 3VR8B 3AEGB 1WXQA 3GP7A 3AE1B 4OVZA 3P42A 2IGHA 2IPKD 2YEPF 5BMIA 4RF0A 1XXGA 4XWWA 2WDVB 3DWGC 3AM9A 3BK2A 1RM6C 2MEKA 2OEDA 4YSXB 2BBCA 4OHJA 3I9V1 3Q69A 5TSSA 1QQRA 1WRIA 1GB4A 3ZQ4A 2BW2A 3BIID 1P7FA 1VZ6A 3SFDB 2GB1A 1WYGA 3E56A 4NZLB 4C7ZA 2PVOD 2WS3B 1N63A 1ZOYB 1T3QA 1ET6A 1QILA 1FNVA 2OHFA 3CWIA 3U4EG 4HRSA 1SSNA 2M0AA 1SE4A 3B2FA 4WIPA 2LFIA 1PGBA 4RF1A 5MPOA 4RCOA 1EU3A 1KTKA 2SAKA 4PT5A 2KMMA 3DWMA 2MJDA 3RPFC 4ZRQA 2WQYB 2PLPA 1ROEA 3ETRA 4NAWB 4NAMA 5HI1A 3J9CA 2AQ2B 2FBWB 4C7YA 3AEDB 1FM0D 3NS1A 4ITKA 1IBXB 1DOIA 4YTPB 2Y3AA 2NTSA 2WXOA 3ZJVA 4DXFA 4XWTA 1CK1A 4YWGG 1RFKA 3Q8EA 3BK1A 4KKJA 1V8CA 5G5GA 2JX5A 3AE9B 5D7GA 1N62A 3IAM1 2VZKD 2J42A 2INNE 5HFYA 2WXHA 2LHDA 2Y5CA 3P4RB 4MACA 5GXGB 5BMHA 3NVZA 3HVZA 3KLSX 1WGKA 1JROA 2XN9C 2WXPA 1TS4A 3NVYA 4P16A 3R8BA 3H8HA 2AQ3B 4B0EA 1AWDA 3ABVB 3E9SA 1HEZE 2BB6A 3NVWA 1TY0A 1ENFA 1Y56A 2IJ0A 1TKYA 4JWSC 1T6BX 4MM3B 5I4DA 1R7SA 3NZ3A 4KGTA 1VR9A 1GB1A 2MJEA 1VZ7A 2V3PA 3N9YC 3P4PB 1TS5A 2I38A 3BZDB 5D3IB 2NMQA 5G5HA 2DYOA 2K0PA 4US8A 3VR9B 1JQ4A 2MH7A 1SBBB 1FRDA 1D5XC 1XEEA 1TZOA 3AV8A 4JX1C 3SFEB 2ZW1A 1FXAA 4XDDA 1C4AA 2KDMA 2QEJC 1V97A 2QIEB 4DXGA 2K9XA 1F77A 3AB5A 1I4PA 3AEFB 1KF6B 2EELA 4OZBA 4YSYB 2CJOA 4AQ7A 4IDIA 2LMCA 3AE6B 3PZ7A 4RGMA 2BYTA 4UDUC 1B1ZA 2FE8A 2WLBA 1I7HA 1JWMD 1V1OA 1PYWD 1IGDA 4A55A 1EM7A 2X38A 1XLNA 1K50A 1E6EB 1TKEA 1FFVA 5EE1A 3T3OA 4GLSC 1ZDXA 1FO4A 5JXVA 1JALA 1ZP0B 2AQ1B 2N0SB 4JE3B 4HKZE 3P4QB 1NYQA 1LO5D 4YSZB 1C78A 4MT5A 1I4GA 2L32A 3R2TA 1F0ZA 2PW9A 3O13A 1HQRD 2E6XA 1OQQA 4N6EB 2PKOA 1ZE3D 1ZXIA 3AEBB 3PO0A 4ZHPA 3MHZA 1ZDVA 3GB1A 2MJ3A 2JZPA 3OWEB 4ARCA 2G1EA 4A9AA 3PZ8A 4ZHOA 1MPEA 1TYGB 2JWUA 2WDRB 1E7PB 4J3OD 1PDXA 5C2TB 2HTME 1FCLA 1NVID 1GOZA 1DOXA 1I4RA 1VDVA 3LB8C 1GAQB 4XDCA 4O1NA 4Q2JA 1XLQA 4A8XC 1XLPA 1L5PA 3U2SC 3TEXA 4WWMA 4WAFA 1VRAB 2K22A 3AECB 2FUG1 3VQIA 2QSDA 2KN4A 2M56B 3P63A 3ZJTA 1XLOA 3FILA 5HHDG 2IGGA 1PFDA 2NTTA 4HKQA 1I4QA 1XF5L 1VJKA 4YXDB 1SJHD 3W5UB 1FD6A 3B9JA 5FK9C 5E6JA 5AUKA 3VRBB 2W3SA 1V1PA 5H92C 4CQNA 2JU6X 4L2YA 3AEEB 3ZGZA 2DWQA 2R61A 5BYSA 2VZKB 4REZA 3TUOA 1T5XD 2AX5A 1QF6A 4JPSA 3Q8BA 3HRDD 1RWSA 2D5GA 2ONQA 1YN5A 4OW0A 3W9CB 3TEYA 4B0MA 1EU4A 4R3DA 2PIAA 3BVMA 1KH0A 2SEBD 2N7JA 1TY2A 2RDGA 5HG2A 4OZCA 1YMHE 2WXMA 3BYYB 2Q5WD 4N59A 2IGDA 1MHHE 2WU5B 3AE8B 1A70A 1C76A 4EE2A 1CJEA 1KFYB 3MFGA 1TKGA 4HJGE 3V3XA 1IGCA 1TS2A 3CIRB 4A6QA 3RFZB 1EWCA 1F2RI 2LUMA 3IAS1 1XCTL 3AE4B 1STEA 1JWSD 1JW9D 5EE0A 2IDYA 4XE0A 3EA6A 1CQVA 2WXQA 3BYTB 4ZYSA 2WXJA 3FC4A 1D5MC 4US9A 1D4BA 5BYQA 1ACCA 1SXTA 2LHEA 5H8YE 4RFBA 2RDHA 2V3NA 4USAA 1C4CA 3IT4B 1FNUA 4C56C 1N60A 4TSSA 5EE9A 1FNWA 3ZYYX 1VZ8A 1FEHA 1J7AA 1HZ5A 1SF0A 1SJED 2BS2B 1BMLC 2K5PA 4KKIA 1PUTA 1FMAD 1PGAA 4L23A 1IUEA 1QT9A 2PVGC 1C4PA 1VLBA 3W1SA 2WXRA 1MHXA 4D2KA 2PTLA 2CJNA 1BXTA 1V1PB 4ZOHC 1QOBA 5BMGA 1YN4A 1QOFA 1YJJA 1C77A 5C3JB 2E3TA 2JQRB 1L6UA 4L1BA 2L52A 1AW7A 1F2RC 1L0XB 1AN8A 3P4SB 1YJIA 2WU2B 1UWXA 3MC0B 1D5ZC 5D3DA 4ZRPA 3AMZA 2BS3B 3AEAB 2KACA 3AN1A 3KWVA 1CZPA 1L6VA 2ICIA 3BVGA 1DYQA 5AUIA 2H88B 2Z8LA 1JWBD 1MI0A 1DOYA 3WCQA 2L83A 2ZW0A 2H89B 2W54A 4GDKB 2QILA 3R2IA 2WXKA 2GI9A 3KWLA 3TEWA 1XO3A 4IOIE 4TQ1A 2W3RA 4WURA 4YT0B 1GPXA 1UWMA 3AH7A 1SIJA 1TJEA 1TS3A 2BT6A 2GRIA 2WDQB 4WH4A 4KX6B 3FAHA 1N5WA 3KQ4A 4MH8A 1UGJA 2WXFA 1JMLA 1FFUA 1ZUD2 2KWDA 1SB3C 1EWYC 2J53A 1J7CA 3I57A 2G9HD 1YNTE 3LYYA 4OZAA 1JRPA 1YN3A 2M19A 3Q8CA 2JSVX 1JWUD 4RGOS 1K53A 2J52A 1QOGA 4LLGM 1Q10A 5BYRA 3W2DA 1P7EA 3MJ5A 1QOAA 2WXGA 3C8YA 1SE3A 2DLBA 2INPE 3NVVA 3EUB2 3AE3B 3NUHB 1IBXA 1JWAD 1FCCC 3BVZA 3ZJUA 4DQOC 2WP9B 5FR3A 2Y5PA 1ET9A 2K3UA 2BTEA 2WXNA 1YQ3B 3FILB 3U7ZA 4YTMB 4WQMA 3L4PA 1L0YB 2CU3A 1YQ4B 3T3NA 2V0GA 1HA5A 5T8IA 3HVDA 2KQ4X 2QMTA 1WWTA 1FIQA 1OQRA 2PMVA 1N61A 1QLBB 4IKGA 2W55A 1L4ZB 1SE2A 2YEPB 1MVKA 3NRZA 4RNAA 3UI3A 1ESFA 3TSSA 1K52A 1RYJA 2N9LA 3Q8AA 1K51A 2JYTA 4P6VF 3P1MA 4H2AA 3U52E 2B76B 1FRRA 2DBYA 4RGTA 2RPVA 1J7BA 3HUIA 4GDLB 2HDEA 2V4IB 3LXFA 1E9MA 1QKZA 2DYMA 2LJIA 2I2YA 1UUPA 1AYFA 3AE2B 2QJLA 3AE5B 2BS4B 1C9FA 1C79A 3SR6A 2L1AA 1KRHA 1SEBD 2ON8A 2WNMA 4HROA 3URYA 2WXIA 4NJCA 2N9KA 4RGNA 5EE3A 1UNSA 1ZXHA 1ZPSA 3GS2A 2BB5A 2XNAC 3B2GA 4KGSA 1HXYD 2JXTA 4FXCA 1DGJA 4JWUC 1M4VA 3VRAB 1JCKB 1KLGD 3W5VB 4KGRA 1WSPA 1NYRA 1XCQL 1OFFA 4AS1A 3Q8FA 4ARIA 4C80A 3V05A 2LGIA 4YTNB 1D6EC 1I4HA 3EGRA 2LEKA 2TSSA 3BWUD 1L4DB 1NENB 1L0VB 3TEZA 1FXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWL A;  4LTU A;  1XO3 A;  3NVW A;  1E10 A;  2W3S A;  2W3R A;  5H92 C;  4YT0 B;  1GPX A;  1UWM A;  3AH7 A;  4N58 A;  1TKY A;  4JWS C;  1SIJ A;  1TJE A;  2BT6 A;  3AE7 B;  2WDQ B;  3AEE B;  1NEK B;  1R7S A;  2DWQ A;  4KX6 B;  3FAH A;  1N5W A;  2ACZ B;  1NI3 A;  1FFU A;  1ZUD 2;  2AX5 A;  2MJE A;  1QF6 A;  3P4P B;  3HRD D;  2EKI A;  1RWS A;  2KAJ A;  1N5X A;  1SB3 C;  1EWY C;  1J7C A;  1B9R A;  3W9C B;  1JRP A;  1E0Z A;  5G5H A;  3VR8 B;  3AEG B;  1WXQ A;  2M19 A;  2PIA A;  3AE1 B;  4US8 A;  3VR9 B;  1JQ4 A;  2MH7 A;  1QOG A;  1FRD A;  2Q5W D;  2WDV B;  3DWG C;  4N59 A;  1QOA A;  3AV8 A;  3AM9 A;  4JX1 C;  3SFE B;  1FXA A;  1RM6 C;  3NVV A;  2QIE B;  3EUB 2;  1V97 A;  2WU5 B;  3AE3 B;  4YSX B;  3AE8 B;  1A70 A;  2K9X A;  1JWA D;  3AB5 A;  3AEF B;  1KF6 B;  4YSY B;  2WP9 B;  1CJE A;  2CJO A;  1KFY B;  4IDI A;  1WRI A;  3AE6 B;  1YQ3 B;  3BII D;  1TKG A;  4YTM B;  2WLB A;  4WQM A;  1I7H A;  3L4P A;  3SFD B;  3CIR B;  2CU3 A;  1WYG A;  4C7Z A;  1YQ4 B;  2PVO D;  2WS3 B;  1XLN A;  1WWT A;  1N63 A;  1FIQ A;  1E6E B;  1OQR A;  3AE4 B;  1N61 A;  1JW9 D;  1ZOY B;  5EE0 A;  1QLB B;  1TKE A;  1FFV A;  1T3Q A;  5EE1 A;  1FO4 A;  1JAL A;  2OHF A;  3CWI A;  3FC4 A;  2W55 A;  4US9 A;  1ZP0 B;  2N0S B;  3NRZ A;  4HRS A;  5H8Y E;  3P4Q B;  1NYQ A;  4USA A;  4YSZ B;  1RYJ A;  3B2F A;  1N60 A;  1F0Z A;  5EE9 A;  4P6V F;  5MPO A;  3ZYY X;  3P1M A;  1OQQ A;  1J7A A;  1SF0 A;  2BS2 B;  4N6E B;  2B76 B;  2PKO A;  2K5P A;  1FRR A;  2DBY A;  1J7B A;  1PUT A;  3HUI A;  1ZXI A;  2KMM A;  1FMA D;  3AEB B;  3DWM A;  3PO0 A;  1IUE A;  1QT9 A;  2PVG C;  4ZHP A;  2MJD A;  3LXF A;  3RPF C;  1E9M A;  1VLB A;  2WQY B;  1ROE A;  3ETR A;  2MJ3 A;  2G1E A;  4A9A A;  4ZHO A;  1TYG B;  2WDR B;  1E7P B;  1AYF A;  2FBW B;  4C7Y A;  3AE2 B;  1PDX A;  2QJL A;  2BS4 B;  3AE5 B;  5C2T B;  2CJN A;  1FM0 D;  2HTM E;  3AED B;  3SR6 A;  1NVI D;  3NS1 A;  1QOB A;  4ZOH C;  4ITK A;  1DOX A;  1DOI A;  1QOF A;  1YJJ A;  1VDV A;  1KRH A;  3LB8 C;  4YTP B;  1GAQ B;  5C3J B;  2E3T A;  2JQR B;  1L6U A;  4HRO A;  1XLQ A;  2L52 A;  5EE3 A;  1XLP A;  1L5P A;  1RFK A;  4WWM A;  1V8C A;  5G5G A;  2JX5 A;  3AE9 B;  1N62 A;  2K22 A;  3P4S B;  1YJI A;  2WU2 B;  3AEC B;  3B2G A;  3VRA B;  4FXC A;  1DGJ A;  4JWU C;  2Y5C A;  3P4R B;  5GXG B;  2M56 B;  3AMZ A;  3NVZ A;  2BS3 B;  3HVZ A;  3P63 A;  1XLO A;  3W5V B;  1PFD A;  1WGK A;  3AEA B;  1JRO A;  3AN1 A;  1CZP A;  1NYR A;  1L6V A;  1OFF A;  3NVY A;  4YXD B;  1VJK A;  5AUI A;  4C80 A;  2H88 B;  3W5U B;  4YTN B;  1JWB D;  3B9J A;  1DOY A;  1AWD A;  3WCQ A;  2LEK A;  3ABV B;  2L83 A;  5AUK A;  1NEN B;  2H89 B;  3VRB B;  2W54 A;  1L0V B;  1FXI A; 
#chains in the Genus database with same CATH topology
 4E3C A;  3A4S C;  3SEB A;  2MW5 A;  3AE7 B;  2KQS A;  3D32 A;  4LK0 M;  4FA6 A;  4M00 A;  3RNE C;  1ISN A;  5IO9 A;  2L0F A;  3R66 C;  2ACZ B;  1NI3 A;  1I4X A;  4HXD A;  4M0W A;  4A90 A;  1B9R A;  4G50 A;  1CMX B;  2XK5 B;  4RH6 A;  2IYD B;  2WXL A;  1WXQ A;  2L0T A;  3AE1 B;  4DDI D;  4OVZ A;  4W9D A;  2IPK D;  2YEP F;  5C1Z A;  4YL8 A;  3DWG C;  2MEK A;  4G3X B;  2WHI A;  5TSS A;  4EZK A;  1QQR A;  1WRI A;  1WXA A;  1GB4 A;  3ZQ4 A;  2KFK B;  3BII D;  3Q3O C;  1P7F A;  2EMT A;  5CHF A;  1VZ6 A;  3SFD B;  3E56 A;  4NZL B;  4C7Z A;  3EEC A;  2PVO D;  2HD5 B;  4J6I A;  2D07 B;  1ZOY B;  4K81 A;  5JZE B;  3TIX A;  1SSN A;  1SE4 A;  2IND C;  2LVO A;  1PGB A;  3ZLZ A;  2L05 A;  2M8S A;  1TBE A;  2WQY B;  3VH3 B;  5HI1 A;  1RAX A;  4AJY B;  3QJZ A;  2KD0 A;  4W9K A;  2CHW A;  2RPQ A;  1FM0 D;  3AED B;  4PYU A;  3VDZ A;  5L95 C;  4NJ6 A;  4YTP B;  2KMA A;  4KZ0 A;  2WXO A;  4XWT A;  1RFK A;  3Q8E A;  5G5G A;  1P1A A;  2KTR B;  5D7G A;  3WA0 A;  4HK2 A;  2Y5C A;  3X0W A;  3NVZ A;  5L83 A;  3A33 B;  3N30 A;  5JH5 C;  3SHQ A;  1TS4 A;  3NG0 A;  3DBR I;  2J0J A;  4JL9 A;  1NBF C;  2KX3 A;  3NVW A;  1UBQ A;  1TY0 A;  3DVN U;  4JWS C;  4MGK E;  1T6B X;  1WRD B;  3H6N A;  3IFW B;  1TS5 A;  3BZD B;  1LQB A;  2DYB A;  2DYO A;  2K0P A;  2FCN A;  2MH7 A;  1FRD A;  3ZXR A;  5GMV A;  2C5L C;  2I1K A;  1C4A A;  4M8N A;  1V97 A;  1F77 A;  1KF6 B;  2EEL A;  4OZB A;  2L00 B;  4K3B A;  4AQ7 A;  2LMC A;  4KSK C;  1P98 A;  1B1Z A;  2FE8 A;  2PEA A;  5CHV C;  3UF8 A;  3JSV A;  3ZDM C;  5EE1 A;  4GLS C;  1RFA A;  5JXV A;  2REX A;  1WH3 A;  5IN7 A;  4KIK B;  4HKZ E;  3N32 A;  3P4Q B;  3OLM D;  1EF1 A;  3KW5 B;  1YX6 B;  2E6X A;  3PSE B;  4GU2 A;  4A20 A;  5EDS A;  1ZXI A;  3PHX B;  4ZHP A;  2J0M A;  2MJ3 A;  4ARC A;  2G1E A;  2JWU A;  4FHJ A;  1NVI D;  4BKG A;  4PS8 A;  4NY0 A;  4A8X C;  1L5P A;  3TEX A;  4WAF A;  3Q3J A;  2LUE A;  3AEC B;  2QSD A;  2PE6 B;  3FIL A;  2IGG A;  3MJW A;  2BYF A;  1WX8 A;  1XF5 L;  4K7U A;  1WXV A;  5DPR A;  4NAW A;  3VRB B;  1Q5W B;  5J2R A;  2O6V A;  5DPW A;  1SE9 A;  2DWQ A;  4DXA B;  4URK A;  5LLI A;  3N3K B;  4P7I A;  4REZ A;  3TUO A;  1ZW7 A;  2AX5 A;  1QF6 A;  4JPS A;  1GUA B;  3HRD D;  3NZU A;  4M01 A;  1YN5 A;  3DBL I;  4OW0 A;  5J18 A;  1EU4 A;  4R3D A;  2PIA A;  3BVM A;  1J19 A;  2KO3 A;  2RDG A;  3APD A;  5HG2 A;  1GC7 A;  4OZC A;  1E7V A;  4DHJ D;  3BYY B;  4N59 A;  1MHH E;  3AE8 B;  5AZG A;  4EE2 A;  1UBI A;  1CJE A;  2D3B A;  1IYF A;  4A3O A;  2NVU I;  1EWC A;  3IAS 1;  2LUM A;  2ZPN A;  1TIF A;  5EE0 A;  1H4R A;  5JHA A;  3DVN V;  1ACC A;  4FJZ A;  2LHE A;  3DHI C;  5H8Y E;  3VTV A;  2V3N A;  2OJW A;  2KTR A;  4USA A;  1FNU A;  2Z59 B;  1N60 A;  4I6P A;  1SF0 A;  3PTF C;  3HIZ A;  1FMA D;  1IUE A;  1VLB A;  3W1S A;  2WXR A;  1MHX A;  4D2K A;  2KVZ A;  3RD2 A;  4ZOH C;  1YN4 A;  2BKR B;  1QOF A;  2KC1 A;  4XYC A;  2JZ3 B;  1C77 A;  3HHM A;  4L1B A;  1F2R C;  2G4D B;  2D3A A;  1YJI A;  3ZW3 A;  3MC0 B;  4W9F A;  4ZRP A;  2D3G A;  1E8X A;  2CR5 A;  1CZP A;  3QA8 A;  2ICI A;  4DDG D;  1WGH A;  5AUI A;  2H88 B;  3IHP C;  1WJU A;  1C3T A;  4WWN A;  2L83 A;  2H89 B;  2W54 A;  5HKH A;  3R2I A;  4WAA A;  3RNB C;  1WJN A;  3N20 C;  4P1C C;  2BT6 A;  3JVZ X;  5E6O A;  3FAH A;  2D10 A;  2WXF A;  1JML A;  1F52 A;  1EWY C;  3PPA A;  1YN3 A;  2JSV X;  1JWU D;  2MCN B;  4RGO S;  2J52 A;  1QOG A;  4LLG M;  1YIW A;  5BYR A;  2WXG A;  4PS7 A;  3C8Y A;  2INP E;  4MGY E;  3IG3 A;  2BTE A;  1MG4 A;  3U7Z A;  4MEM A;  5LXI B;  2CU3 A;  3R3M A;  5CX3 A;  1M94 A;  4HJK A;  1OQR A;  4MSQ B;  1WJ4 A;  4HDQ A;  2BWF A;  4WQO B;  4IKG A;  3M63 B;  2L7R A;  1A5R A;  1L4Z B;  1MVK A;  3NRZ A;  2UYZ B;  4FUL A;  3A4R A;  4JQW C;  2JYT A;  2MLB A;  4NQK E;  4H2A A;  3U52 E;  2B76 B;  2BYE A;  2RPV A;  4GDL B;  4MGI E;  1QKZ A;  1R4N B;  4BKT A;  1AYF A;  1UH6 A;  3GZN B;  3CF6 E;  3SR6 A;  2XBB C;  4AP4 C;  3R7R A;  2WNM A;  4ACF A;  4WWP A;  2ZPY A;  4W9H A;  2N9K A;  1MJD A;  2B3A A;  4IM3 A;  3RNG C;  2BB5 A;  4FHK A;  2XNA C;  4B9K A;  3RN9 C;  4KGS A;  4JWU C;  3W5V B;  4LDT D;  1XCQ L;  2BF8 B;  3DVG X;  4C80 A;  1D6E C;  1IPG A;  3EGR A;  4KDL B;  1L4D B;  2JRH A;  3TCA A;  2JYE A;  3EC8 A;  1SGH A;  3RMK C;  4JLC A;  4TQ0 A;  1E8W A;  1BUI C;  3IXS A;  5IA7 A;  3IT6 B;  1E0Z A;  1KLU D;  1LFD A;  1GG3 A;  5AZH A;  5BMI A;  4NJ7 A;  1XXG A;  4DHZ E;  2WWZ A;  3TBL D;  3WAO A;  3AM9 A;  3BK2 A;  1YD8 U;  4NPN A;  2K8B A;  2RDB C;  2MQJ A;  3H1U A;  1LGR A;  4KZC A;  2DAF A;  2GB1 A;  3UIO B;  4G11 A;  2KKC A;  1N63 A;  1UEL A;  3VFK A;  1T3Q A;  1ET6 A;  1QIL A;  1FNV A;  2OHF A;  3LDZ E;  4HRS A;  2M0A A;  3U30 A;  1G6J A;  3B2F A;  4WIP A;  2MP2 A;  4RF1 A;  4ANX A;  5MPO A;  2ZEQ A;  2SAK A;  2V9H A;  3N1X C;  1WFY A;  2PLP A;  5KHQ A;  3A9J A;  4BOZ B;  2NPT A;  2FBW B;  3GZN I;  3B0A A;  2AYO B;  2K6Q A;  2Y3A A;  3KUC B;  4YWG G;  3GE8 C;  4BBN F;  1J8C A;  2KWC A;  2N9X A;  1N62 A;  3IAM 1;  5HFY A;  2WXH A;  3P4R B;  4MAC A;  5GXG B;  3KLS X;  4WJN A;  2NBW B;  4FN2 A;  4II2 B;  1WGK A;  4P16 A;  2AQ3 B;  3VTU A;  3PGE A;  4JGH B;  3ABV B;  3KVF B;  2BB6 A;  1MG8 A;  2QCZ A;  3ECI A;  4MGZ E;  4K7W A;  5I4D A;  2N9P C;  5CTR C;  1GB1 A;  1WR6 E;  2V3P A;  3P4P B;  5D3I B;  2LXC A;  2NMQ A;  2D3C A;  4W9G A;  4HPP A;  5TR5 A;  3VR9 B;  2C7N B;  2CS4 A;  1IP9 A;  4JX1 C;  3SFE B;  2ZW1 A;  1PQS A;  2QEJ C;  2K9X A;  3AEF B;  4YSY B;  2KDF B;  2CJO A;  3MC9 A;  1WE7 A;  4RGM A;  4IDI A;  3AE6 B;  3PZ7 A;  2BYT A;  1KOT A;  2OOB B;  5IOI A;  1JWM D;  4LNN A;  4A55 A;  3DCG A;  2IY0 B;  4LNI A;  2J7Q B;  3CSF A;  1ZDX A;  1FO4 A;  2LVP A;  1JAL A;  2KFJ A;  3K9P B;  2N0S B;  4JE3 B;  4YSZ B;  2KLC A;  4MT5 A;  4NQL B;  3R2T A;  2DZI A;  2JUO A;  3O13 A;  4LNK A;  2GMI C;  1ZE3 D;  1ZDV A;  4IM0 A;  3PZD A;  5AZF A;  3GB1 A;  4KV2 A;  2JZP A;  3HM6 X;  3PZ8 A;  3EFU A;  1TYG B;  1E7P B;  3TJP A;  4K1R B;  2ZNV B;  1FCL A;  4NNJ B;  3A9J B;  1I4R A;  1VDV A;  3LB8 C;  4O1N A;  4Q2J A;  1XLQ A;  1XLP A;  1VRA B;  1E7U A;  2MSE D;  3VQI A;  3L13 A;  3P63 A;  2NTT A;  2JF5 A;  3O65 B;  1I4Q A;  4XX5 A;  3ZRC A;  1V5O A;  1WM3 A;  5IP4 D;  2W3S A;  3NZS A;  5H92 C;  2WDT B;  2MA9 B;  3AEE B;  2R61 A;  4K7S A;  1FPY A;  2MWS B;  2EKE C;  3T9L A;  1WZ0 A;  2D5G A;  2M17 A;  2VRR B;  4B0M A;  2DNF A;  2JVC A;  3M95 A;  1KH0 A;  1Q1O A;  1TY2 A;  2G45 B;  1YMH E;  1XD3 B;  4LCD E;  1Q0W B;  1WGY A;  2NPT B;  3T8M A;  4EEW A;  4GIV A;  2IGD A;  5DPS A;  1RLF A;  4XC2 A;  2BKF A;  2AL3 A;  4F7Z A;  1IGC A;  1TS2 A;  4A6Q A;  5G2N A;  2KTF A;  3ZXV A;  1U4A A;  3BY4 B;  2KJH B;  1CQV A;  2WXQ A;  3BYT B;  4A3P A;  3FC4 A;  1HTQ A;  2N4F A;  1SXT A;  4RFB A;  3DBL B;  3UQA A;  1V80 A;  3I63 C;  2L8J A;  4GMV A;  1YQB A;  1HZ5 A;  3ZNI D;  2EMS A;  4KKI A;  4C00 A;  4W9C A;  5FR6 A;  3PT2 B;  2PVG C;  3VXW A;  1C4P A;  1KJT A;  2CJN A;  2BGF A;  1V1P B;  2BYV E;  1OGW A;  1QOB A;  3KYC D;  4ANV A;  4EZL A;  1V81 A;  3CMM B;  4CYE A;  5C3J B;  2KYW A;  2JQR B;  1L6U A;  1OEY J;  4LNF A;  3OJ4 B;  4DHJ B;  1E90 A;  2Y5B B;  1D5Z C;  4IUM B;  2KAC A;  3KWV A;  5KHO A;  3BVG A;  1DYQ A;  2Z8L A;  3KYD D;  1JWB D;  3WCQ A;  1OTR B;  3H9D A;  2QIL A;  2WXK A;  2GI9 A;  2Z0D B;  4WUR A;  4YT0 B;  4TUU A;  1UWM A;  3AH7 A;  1SIJ A;  1TS3 A;  1YOV B;  4GGQ A;  3UQB A;  3PLU A;  2V3S A;  4MH8 A;  1N5W A;  1JRU A;  1UGJ A;  1FFU A;  3DDC B;  3R7Q A;  1R4M I;  1LXD A;  1SB3 C;  2J53 A;  3I57 A;  1KM7 A;  2JZZ A;  4OZA A;  2M19 A;  1V9J A;  2GBM A;  3DBH I;  1K53 A;  1MFW A;  3NHE B;  4C4V B;  1E5W A;  3AE3 B;  3MTN B;  1IBX A;  2LWP A;  4DQO C;  2Y5P A;  1ET9 A;  2M0X A;  4GDK A;  1F1H A;  2WXN A;  3U7D A;  3QQ8 B;  4WQM A;  3L4P A;  1L0Y B;  2FIF A;  3HVD A;  2KQ4 X;  2QMT A;  2Z0E B;  1FIQ A;  1N61 A;  1ZKH A;  4M0W B;  3RYT A;  2LGD A;  4LNO A;  2ZVN A;  2K6D B;  5CHW A;  4HCP B;  4MH0 E;  1FRR A;  4RGT A;  1J7B A;  3VUY A;  3MC8 A;  3VHT C;  3RT3 B;  1WYW B;  2K8H A;  1UUP A;  3H7P B;  1WGD A;  3AE2 B;  2QJL A;  1C9F A;  2CHX A;  3NY5 A;  3H7S A;  3FKY A;  4HRO A;  2J0K A;  4NJC A;  2ZZP B;  4RGN A;  5EE3 A;  3GS2 A;  1HXY D;  1DGJ A;  2C7H A;  3PRE A;  1WSP A;  4AS1 A;  3Q8F A;  1NDD A;  3V05 A;  2LGI A;  1I4H A;  2L76 A;  2LEK A;  3QAQ A;  3TEZ A;  3QHT A;  2RMM A;  4N58 A;  2A4Z A;  2YVC A;  4AOF A;  2KAN A;  1PGX A;  4ASW C;  3ZO5 B;  2FUH B;  2W82 A;  4TMA B;  3AU4 A;  2EKI A;  3PRM B;  3VUW A;  3MP9 A;  1P3Q U;  3UIP B;  3AEG B;  4RM8 A;  4XWW A;  4OVU A;  3ZVV A;  2FID A;  1R4M B;  4TV3 A;  2OED A;  4YSX B;  3WAL A;  2WX0 A;  3I9V 1;  2QC8 A;  2BW2 A;  1L7Y A;  2WS3 B;  2O2V A;  1HTO A;  3V61 A;  2KXJ A;  2V4L A;  1LM8 B;  3I3T B;  5D2M B;  2C7M B;  2VH1 A;  1I42 A;  2HTH A;  3U4E G;  4DK5 A;  5D94 A;  1WJ6 A;  4ICV A;  2LGY A;  1KTK A;  3DWM A;  4TKN A;  4ZRQ A;  2LRU A;  3ETR A;  4RM9 A;  4NAW B;  4NAM A;  3DBS A;  1XQQ A;  4ZDV A;  2O6V B;  4C7Y A;  3V6E B;  2CKH B;  1V5T A;  4ITK A;  1IBX B;  2INC C;  1DOI A;  2NTS A;  4OVV A;  3B08 A;  4DXF A;  2MBH A;  3L10 B;  4KKJ A;  1V8C A;  2JX5 A;  1WX7 A;  2MX2 A;  3HVZ A;  1JRO A;  2XN9 C;  3QCA A;  2ZNV C;  4B95 A;  2WXP A;  3MHS D;  3H8H A;  3QK0 A;  4B0E A;  1AWD A;  1TZ1 A;  1K8R B;  3E9S A;  4GSW A;  4C4V A;  1ENF A;  2IJ0 A;  3L17 A;  3RUL A;  3NZ3 A;  1VR9 A;  4WWO A;  4MJS B;  3N9Y C;  2I38 A;  2FCQ A;  2I1J A;  4US8 A;  1JQ4 A;  5G55 A;  1SBB B;  3QX1 A;  4EZJ A;  1D5X C;  4IWP A;  1TZO A;  3AV8 A;  1V2Y A;  1FXA A;  4XDD A;  1WXS A;  3W1Y A;  4DXG A;  2M1M A;  2XEW A;  2GBN A;  1PYW D;  1IGD A;  1EM7 A;  4GB9 A;  1E6E B;  1WY8 A;  1FFV A;  5E6N A;  2IO3 B;  2BVC A;  2RR9 A;  2AQ1 B;  3Q2A C;  5JHB A;  1C78 A;  4FAD A;  1F0Z A;  2KC2 A;  3OG5 A;  1HQR D;  1OQQ A;  2NCN A;  4ZRI A;  3TL5 A;  4HLE A;  3AEB B;  3MHZ A;  4W9E A;  3OWE B;  4A9A A;  4ZHO A;  1MPE A;  4J3O D;  2PJH A;  4M02 A;  2WYQ A;  3I5J C;  2AWT A;  3Q6B A;  1GOZ A;  5AEK B;  3ZNZ B;  4DHZ B;  1GAQ B;  2DEN B;  2K1F A;  2D11 A;  4WWM A;  1WM2 A;  3ALB A;  2M56 B;  3ZJT A;  5HHD G;  1PFD A;  4HKQ A;  3KH0 A;  3DBR B;  1VJK A;  4YXD B;  3W5U B;  3GE3 C;  2DHZ A;  1FD6 A;  3B9J A;  2KWU B;  1Z2M A;  3EHV A;  2MBB B;  1L2N A;  2DAJ A;  4CQN A;  2JU6 X;  3A1Q A;  2JXX A;  4L2Y A;  3ZGZ A;  5BYS A;  2VZK B;  1RWS A;  1QZE A;  3Q3N C;  2ONQ A;  3RZF A;  3W9C B;  3TEY A;  1E8Z A;  1I35 A;  2N7J A;  3N1Y C;  2WXM A;  4FBJ B;  1E8Y A;  2IY1 B;  2LGX A;  3JW0 X;  3SDL C;  2BQQ A;  1TGZ B;  1C76 A;  3OAW A;  1KFY B;  3MFG A;  2OJR A;  1TKG A;  4HJG E;  3B1L X;  3RFZ B;  2FAZ A;  4K3C A;  1XCT L;  3AE4 B;  4IM2 A;  4S17 A;  1JWS D;  3V6C B;  1JW9 D;  4CO7 A;  3EA6 A;  2LXA A;  4ZYS A;  2G4S A;  3RNC C;  3UGB B;  1UD7 A;  3ML9 A;  3IT4 B;  5J17 A;  2AL6 A;  4TSS A;  1FNW A;  1X1M A;  1VZ8 A;  1FEH A;  1SJE D;  2UWQ A;  1BML C;  2K5P A;  4W9L A;  1PUT A;  1PGA A;  4L23 A;  1QT9 A;  3JYU A;  1R4N I;  2QHO A;  4LJO B;  3ZNG C;  2CHZ A;  2PTL A;  3LJ3 A;  2KOX A;  3JSV B;  5BMG A;  1VCB A;  2K8C A;  2NS5 A;  3DHG C;  3QAR A;  4HCN B;  1C1Y B;  1FXT B;  2L52 A;  3RNA C;  4KIK A;  1AN8 A;  3P4S B;  5IKC M;  2KQ7 A;  2WU2 B;  1V6E A;  5D3D A;  2BS3 B;  4IWO A;  2UU7 A;  3AN1 A;  4AUQ C;  1L6V A;  1MI0 A;  1DOY A;  4GDK B;  4BZA A;  3KWL A;  2GBK A;  3TEW A;  2KFK A;  4IOI E;  3ZTD A;  2W3R A;  4E74 A;  1GPX A;  4MJS A;  3UIN B;  1WMH A;  1NI2 A;  2GRI A;  4KX6 B;  1HE8 A;  1WIA A;  2KWD A;  4WJP A;  1YNT E;  4F8C B;  3Q8C A;  3BIN A;  2LVQ A;  3W2D A;  3MJ5 A;  3PVL A;  1SE3 A;  2DLB A;  4HWI B;  3NVV A;  3ONS A;  4XGA B;  1FCC C;  3ZJU A;  2WP9 B;  2K3U A;  4F1S A;  1GC6 A;  4MM3 A;  3T3N A;  3AI5 A;  2KDB A;  3S2A A;  3L08 A;  4BOS C;  2X8X X;  4EFO A;  3PHW B;  5DCN A;  2KWV B;  1UGM A;  2YEP B;  4RNA A;  3UI3 A;  3TSS A;  1K52 A;  4LJP B;  4GOC A;  2MBQ A;  2A5U A;  3Q3F A;  2KDE B;  4P6V F;  3A9K A;  3P1M A;  1F9J A;  3U8Z A;  1OQY A;  1TT5 B;  1H8C A;  4GN1 A;  1T0R C;  2V4I B;  1E9M A;  4LDT B;  4XZ4 A;  2DYM A;  4PK1 A;  3AU5 A;  1Z5S B;  2FCM A;  2GBR A;  3NOB A;  3V62 A;  1KRH A;  1SEB D;  2C60 A;  2ON8 A;  2KN5 A;  3RUI B;  3TMP B;  2WXI A;  3ZDT A;  1ZXH A;  2IO0 B;  3B2G A;  4W9I A;  3VRA B;  1M4V A;  3VVW B;  4KSL C;  1KLG D;  3AUL A;  1OFF A;  4PYZ A;  4ARI A;  2LGS A;  2TSS A;  3BWU D;  5C23 A;  1NEN B;  2KVR A;  4I6L B;  4ICU A;  1FXI A;  4LTU A;  2MHJ A;  1E10 A;  3APC A;  4M8M A;  5FKA C;  1UF0 A;  4HDO A;  3L0W B;  2O2V B;  1NEK B;  2ZCB A;  2JRI B;  4HEA 1;  1HZ6 A;  3A1Q B;  4FJV B;  5LNK 1;  2JWZ A;  2KAJ A;  3EFC A;  1N5X A;  2J4X A;  3OJ3 A;  4BKS A;  3VR8 B;  3GP7 A;  3DQV A;  3P2B A;  3P42 A;  2IGH A;  3IVF A;  4RF0 A;  4FJY A;  2WDV B;  2IO1 B;  1RM6 C;  4IG7 B;  2PE9 A;  2BBC A;  4OHJ A;  3Q69 A;  4GXB A;  3RNF C;  4GDL A;  2C9W B;  4JIO U;  3DVG Y;  3L16 A;  1WYG A;  1GNU A;  3QIJ A;  2IZV B;  4EKU A;  4RMA A;  3CWI A;  4N9F 4;  2XK5 A;  1EO6 A;  1WMH B;  2M4N A;  2LFI A;  2DX5 B;  4RCO A;  2KX0 A;  1EU3 A;  2LD9 A;  1V49 A;  4PT5 A;  4FLH A;  2KMM A;  1WZ3 A;  2MJD A;  2KNB A;  3RPF C;  1ROE A;  2KJ6 A;  3X23 A;  3J9C A;  2JT4 B;  2AQ2 B;  5IAA C;  2KJR A;  1BT0 A;  4AWJ A;  3NS1 A;  2R2O A;  3H7P A;  3ZJV A;  1CK1 A;  4BAX A;  3BK1 A;  3NJT A;  3AE9 B;  1WGR A;  2VZK D;  2J42 A;  2INN E;  2MRP A;  3M3J A;  4BVU C;  2LHD A;  5BMH A;  1SIF A;  3NVY A;  2GLS A;  3R8B A;  3ZKJ C;  3CST A;  3GOE A;  1HEZ E;  3DPD A;  2LRW A;  4DBG A;  1Y56 A;  1TKY A;  4MM3 B;  2NR2 A;  1R7S A;  2K39 A;  4KGT A;  1AAR A;  3KUD B;  5DPT A;  2MJE A;  1VZ7 A;  4MSM B;  2O6V D;  2WGS A;  3WAP A;  2RGF A;  3ENE A;  2ZCC A;  4WJQ A;  5G5H A;  1EF5 A;  1ZGU B;  3ZRF A;  4I6N B;  3RCZ A;  3WIM A;  1WE6 A;  1XEE A;  3PLV A;  3IBE A;  1T0S C;  2KDM A;  1WXM A;  2QIE B;  3AB5 A;  1I4P A;  1D3Z A;  2GBJ A;  2GOW A;  4HPM B;  4S0R A;  1UZX B;  4X57 B;  4UDU C;  2WLB A;  1I7H A;  1WX9 A;  2VH2 A;  1V1O A;  3C19 A;  2BPS A;  2X38 A;  1XLN A;  1K50 A;  3HM3 A;  3Q14 C;  1TKE A;  3T3O A;  3WAM A;  3PRP B;  1ZP0 B;  2DZM A;  1NYQ A;  1LO5 D;  2N1V A;  1I4G A;  2L32 A;  3APF A;  2PW9 A;  4N6E B;  2PKO A;  3V60 A;  3PO0 A;  3A9K B;  3Q3M C;  2KLG A;  2KK8 A;  2WDR B;  3W1S C;  1PDX A;  1KLV A;  5C2T B;  2HTM E;  3AXC A;  1DOX A;  4XDC A;  4IW0 A;  3U2S C;  1YJ1 A;  2K22 A;  2FUG 1;  2KN4 A;  3VUX A;  1XLO A;  1EUV B;  4ZYN A;  2KZR A;  2KDI A;  2N7E A;  3N1Z C;  1SJH D;  3HK0 A;  5FK9 C;  2AEH A;  5E6J A;  5AUK A;  1N6Z A;  4QAY A;  3PV1 A;  4BFR A;  3SU8 X;  1V1P A;  4DWF A;  3RI7 C;  3PS6 A;  3QWZ B;  3WAN A;  3M62 B;  1T5X D;  4W9J A;  4MDK E;  3Q8B A;  2K25 A;  4P1B C;  1WF9 A;  2SEB D;  1P0R A;  2N7D A;  2Q5W D;  2WU5 B;  1YX5 B;  2YLM A;  1A70 A;  5E6P A;  3C0R B;  3V3X A;  3CIR B;  1J0G A;  1RRB A;  3ZNH B;  1F2R I;  1STE A;  2IDY A;  2JPH A;  4XE0 A;  2WXJ A;  5LXH A;  1D5M C;  2D2Q A;  4US9 A;  1D4B A;  5BYQ A;  2R2Q A;  2RDH A;  4EOY A;  4ZRJ A;  1C4C A;  2DZK A;  3VTW A;  4C56 C;  3PRZ A;  2ASQ A;  2N1W A;  2JY6 A;  5EE9 A;  3ZYY X;  4KVG B;  1J7A A;  2BS2 B;  2CU1 A;  4IC7 B;  2QDF A;  1S1Q B;  4ZRK A;  2ZVO A;  3DHH C;  4EUT A;  3QC8 B;  1WGG A;  3ZUN A;  4ANW A;  2FNJ B;  1BXT A;  1YJJ A;  2E3T A;  1TTN A;  3ML8 A;  1AW7 A;  1L0X B;  1UWX A;  2HE7 A;  1T0Y A;  3AMZ A;  2N9E B;  4HPL B;  3AEA B;  2LAS A;  2MBO A;  2KT7 A;  5BO4 B;  3NS8 A;  5D6J B;  2ZW0 A;  2RSU A;  1P9D U;  2IBI B;  2HJ1 A;  1XO3 A;  4TQ1 A;  2G3Q B;  3K9O B;  4BKS D;  1TJE A;  2WDQ B;  4WH4 A;  1Y8R C;  2W9N A;  3KQ4 A;  3L54 A;  1ZUD 2;  4WJO A;  1S3S G;  1J7C A;  3LYY A;  2G9H D;  1VD2 A;  2KMC A;  1JRP A;  4PS3 A;  2LJ5 A;  1T0Q C;  3DOW A;  1Q10 A;  2MP2 B;  1P7E A;  1QOA A;  2WX1 A;  3EUB 2;  3NUH B;  1JWA D;  4G0N B;  3BVZ A;  3VH4 B;  5FR3 A;  4IWQ A;  1YQ3 B;  3FIL B;  4YTM B;  1XT9 B;  2MBE A;  3SD5 A;  2ZJD A;  1YQ4 B;  2V0G A;  1HA5 A;  1WI0 A;  5T8I A;  2HJ8 A;  1WWT A;  2PMV A;  4II3 B;  1OEY A;  1QLB B;  3ZTC A;  3KUZ A;  1L0V B;  2W55 A;  2KHW B;  2RD0 A;  3VAW A;  1SE2 A;  1ESF A;  4AJW A;  1RYJ A;  2N9L A;  2NBU A;  4MEL A;  3Q8A A;  1K51 A;  1WR1 A;  2V1Y A;  4KDI C;  2DBY A;  3HUI A;  4CHK A;  1GJZ A;  2L3Z A;  2LI5 A;  4BBN C;  2HDE A;  3LXF A;  1V86 A;  4ANU A;  3ZIM A;  2FCS A;  2LJI A;  2I2Y A;  3AE5 B;  2BS4 B;  2DZJ A;  1C79 A;  2L1A A;  4B6W A;  2BWE S;  3URY A;  1UNS A;  1ZPS A;  4E71 A;  2JXT A;  4FXC A;  2IO2 B;  1JCK B;  4KGR A;  1NYR A;  2LZ6 A;  4HVB A;  3DBH B;  4YTN B;  3RZW C;  2PPH A;  2NBV B; 
#chains in the Genus database with same CATH homology
 4LTU A;  1E10 A;  2RMM A;  3SEB A;  2JYE A;  5FKA C;  4N58 A;  3AE7 B;  4LK0 M;  1NEK B;  1PGX A;  4HEA 1;  1HZ6 A;  2W82 A;  2ACZ B;  1NI3 A;  4TMA B;  4TQ0 A;  5LNK 1;  1I4X A;  4M0W A;  1BUI C;  2EKI A;  3IXS A;  4A90 A;  2KAJ A;  1N5X A;  2J4X A;  3MP9 A;  1B9R A;  3IT6 B;  4RH6 A;  1E0Z A;  2WXL A;  1KLU D;  3VR8 B;  3AEG B;  1WXQ A;  3GP7 A;  3AE1 B;  4OVZ A;  3P42 A;  2IGH A;  2IPK D;  2YEP F;  5BMI A;  4RF0 A;  1XXG A;  4XWW A;  2WDV B;  3DWG C;  3AM9 A;  3BK2 A;  1RM6 C;  2MEK A;  2OED A;  4YSX B;  2BBC A;  4OHJ A;  3I9V 1;  3Q69 A;  5TSS A;  1QQR A;  1WRI A;  1GB4 A;  3ZQ4 A;  2BW2 A;  3BII D;  1P7F A;  1VZ6 A;  3SFD B;  2GB1 A;  1WYG A;  3E56 A;  4NZL B;  4C7Z A;  2PVO D;  2WS3 B;  1N63 A;  1ZOY B;  1T3Q A;  1ET6 A;  1QIL A;  1FNV A;  2OHF A;  3CWI A;  3U4E G;  4HRS A;  1SSN A;  2M0A A;  1SE4 A;  3B2F A;  4WIP A;  2LFI A;  1PGB A;  4RF1 A;  5MPO A;  4RCO A;  1EU3 A;  1KTK A;  2SAK A;  4PT5 A;  2KMM A;  3DWM A;  2MJD A;  3RPF C;  4ZRQ A;  2WQY B;  2PLP A;  1ROE A;  3ETR A;  4NAW B;  4NAM A;  5HI1 A;  3J9C A;  2AQ2 B;  2FBW B;  4C7Y A;  3AED B;  1FM0 D;  3NS1 A;  4ITK A;  1IBX B;  1DOI A;  4YTP B;  2Y3A A;  2NTS A;  2WXO A;  3ZJV A;  4DXF A;  4XWT A;  1CK1 A;  4YWG G;  1RFK A;  3Q8E A;  3BK1 A;  4KKJ A;  1V8C A;  5G5G A;  2JX5 A;  3AE9 B;  5D7G A;  1N62 A;  3IAM 1;  2VZK D;  2J42 A;  2INN E;  5HFY A;  2WXH A;  2LHD A;  2Y5C A;  3P4R B;  4MAC A;  5GXG B;  5BMH A;  3NVZ A;  3HVZ A;  3KLS X;  1WGK A;  1JRO A;  2XN9 C;  2WXP A;  1TS4 A;  3NVY A;  4P16 A;  3R8B A;  3H8H A;  2AQ3 B;  4B0E A;  1AWD A;  3ABV B;  3E9S A;  1HEZ E;  2BB6 A;  3NVW A;  1TY0 A;  1ENF A;  1Y56 A;  2IJ0 A;  1TKY A;  4JWS C;  1T6B X;  4MM3 B;  5I4D A;  1R7S A;  3NZ3 A;  4KGT A;  1VR9 A;  1GB1 A;  2MJE A;  1VZ7 A;  2V3P A;  3N9Y C;  3P4P B;  1TS5 A;  2I38 A;  3BZD B;  5D3I B;  2NMQ A;  5G5H A;  2DYO A;  2K0P A;  4US8 A;  3VR9 B;  1JQ4 A;  2MH7 A;  1SBB B;  1FRD A;  1D5X C;  1XEE A;  1TZO A;  3AV8 A;  4JX1 C;  3SFE B;  2ZW1 A;  1FXA A;  4XDD A;  1C4A A;  2KDM A;  2QEJ C;  1V97 A;  2QIE B;  4DXG A;  2K9X A;  1F77 A;  3AB5 A;  1I4P A;  3AEF B;  1KF6 B;  2EEL A;  4OZB A;  4YSY B;  2CJO A;  4AQ7 A;  4IDI A;  2LMC A;  3AE6 B;  3PZ7 A;  4RGM A;  2BYT A;  4UDU C;  1B1Z A;  2FE8 A;  2WLB A;  1I7H A;  1JWM D;  1V1O A;  1PYW D;  1IGD A;  4A55 A;  1EM7 A;  2X38 A;  1XLN A;  1K50 A;  1E6E B;  1TKE A;  1FFV A;  5EE1 A;  3T3O A;  4GLS C;  1ZDX A;  1FO4 A;  5JXV A;  1JAL A;  1ZP0 B;  2AQ1 B;  2N0S B;  4JE3 B;  4HKZ E;  3P4Q B;  1NYQ A;  1LO5 D;  4YSZ B;  1C78 A;  4MT5 A;  1I4G A;  2L32 A;  3R2T A;  1F0Z A;  2PW9 A;  3O13 A;  1HQR D;  2E6X A;  1OQQ A;  4N6E B;  2PKO A;  1ZE3 D;  1ZXI A;  3AEB B;  3PO0 A;  4ZHP A;  3MHZ A;  1ZDV A;  3GB1 A;  2MJ3 A;  2JZP A;  3OWE B;  4ARC A;  2G1E A;  4A9A A;  3PZ8 A;  4ZHO A;  1MPE A;  1TYG B;  2JWU A;  2WDR B;  1E7P B;  4J3O D;  1PDX A;  5C2T B;  2HTM E;  1FCL A;  1NVI D;  1GOZ A;  1DOX A;  1I4R A;  1VDV A;  3LB8 C;  1GAQ B;  4XDC A;  4O1N A;  4Q2J A;  1XLQ A;  4A8X C;  1XLP A;  1L5P A;  3U2S C;  3TEX A;  4WWM A;  4WAF A;  1VRA B;  2K22 A;  3AEC B;  2FUG 1;  3VQI A;  2QSD A;  2KN4 A;  2M56 B;  3P63 A;  3ZJT A;  1XLO A;  3FIL A;  5HHD G;  2IGG A;  1PFD A;  2NTT A;  4HKQ A;  1I4Q A;  1XF5 L;  1VJK A;  4YXD B;  1SJH D;  3W5U B;  1FD6 A;  3B9J A;  5FK9 C;  5E6J A;  5AUK A;  3VRB B;  2W3S A;  1V1P A;  5H92 C;  4CQN A;  2JU6 X;  4L2Y A;  3AEE B;  3ZGZ A;  2DWQ A;  2R61 A;  5BYS A;  2VZK B;  4REZ A;  3TUO A;  1T5X D;  2AX5 A;  1QF6 A;  4JPS A;  3Q8B A;  3HRD D;  1RWS A;  2D5G A;  2ONQ A;  1YN5 A;  4OW0 A;  3W9C B;  3TEY A;  4B0M A;  1EU4 A;  4R3D A;  2PIA A;  3BVM A;  1KH0 A;  2SEB D;  2N7J A;  1TY2 A;  2RDG A;  5HG2 A;  4OZC A;  1YMH E;  2WXM A;  3BYY B;  2Q5W D;  4N59 A;  2IGD A;  1MHH E;  2WU5 B;  3AE8 B;  1A70 A;  1C76 A;  4EE2 A;  1CJE A;  1KFY B;  3MFG A;  1TKG A;  4HJG E;  3V3X A;  1IGC A;  1TS2 A;  3CIR B;  4A6Q A;  3RFZ B;  1EWC A;  1F2R I;  2LUM A;  3IAS 1;  1XCT L;  3AE4 B;  1STE A;  1JWS D;  1JW9 D;  5EE0 A;  2IDY A;  4XE0 A;  3EA6 A;  1CQV A;  2WXQ A;  3BYT B;  4ZYS A;  2WXJ A;  3FC4 A;  1D5M C;  4US9 A;  1D4B A;  5BYQ A;  1ACC A;  1SXT A;  2LHE A;  5H8Y E;  4RFB A;  2RDH A;  2V3N A;  4USA A;  1C4C A;  3IT4 B;  1FNU A;  4C56 C;  1N60 A;  4TSS A;  5EE9 A;  1FNW A;  3ZYY X;  1VZ8 A;  1FEH A;  1J7A A;  1HZ5 A;  1SF0 A;  1SJE D;  2BS2 B;  1BML C;  2K5P A;  4KKI A;  1PUT A;  1FMA D;  1PGA A;  4L23 A;  1IUE A;  1QT9 A;  2PVG C;  1C4P A;  1VLB A;  3W1S A;  2WXR A;  1MHX A;  4D2K A;  2PTL A;  2CJN A;  1BXT A;  1V1P B;  4ZOH C;  1QOB A;  5BMG A;  1YN4 A;  1QOF A;  1YJJ A;  1C77 A;  5C3J B;  2E3T A;  2JQR B;  1L6U A;  4L1B A;  2L52 A;  1AW7 A;  1F2R C;  1L0X B;  1AN8 A;  3P4S B;  1YJI A;  2WU2 B;  1UWX A;  3MC0 B;  1D5Z C;  5D3D A;  4ZRP A;  3AMZ A;  2BS3 B;  3AEA B;  2KAC A;  3AN1 A;  3KWV A;  1CZP A;  1L6V A;  2ICI A;  3BVG A;  1DYQ A;  5AUI A;  2H88 B;  2Z8L A;  1JWB D;  1MI0 A;  1DOY A;  3WCQ A;  2L83 A;  2ZW0 A;  2H89 B;  2W54 A;  4GDK B;  2QIL A;  3R2I A;  2WXK A;  2GI9 A;  3KWL A;  3TEW A;  1XO3 A;  4IOI E;  4TQ1 A;  2W3R A;  4WUR A;  4YT0 B;  1GPX A;  1UWM A;  3AH7 A;  1SIJ A;  1TJE A;  1TS3 A;  2BT6 A;  2GRI A;  2WDQ B;  4WH4 A;  4KX6 B;  3FAH A;  1N5W A;  3KQ4 A;  4MH8 A;  1UGJ A;  2WXF A;  1JML A;  1FFU A;  1ZUD 2;  2KWD A;  1SB3 C;  1EWY C;  2J53 A;  1J7C A;  3I57 A;  2G9H D;  1YNT E;  3LYY A;  4OZA A;  1JRP A;  1YN3 A;  2M19 A;  3Q8C A;  2JSV X;  1JWU D;  4RGO S;  1K53 A;  2J52 A;  1QOG A;  4LLG M;  1Q10 A;  5BYR A;  3W2D A;  1P7E A;  3MJ5 A;  1QOA A;  2WXG A;  3C8Y A;  1SE3 A;  2DLB A;  2INP E;  3NVV A;  3EUB 2;  3AE3 B;  3NUH B;  1IBX A;  1JWA D;  1FCC C;  3BVZ A;  3ZJU A;  4DQO C;  2WP9 B;  5FR3 A;  2Y5P A;  1ET9 A;  2K3U A;  2BTE A;  2WXN A;  1YQ3 B;  3FIL B;  3U7Z A;  4YTM B;  4WQM A;  3L4P A;  1L0Y B;  2CU3 A;  1YQ4 B;  3T3N A;  2V0G A;  1HA5 A;  5T8I A;  3HVD A;  2KQ4 X;  2QMT A;  1WWT A;  1FIQ A;  1OQR A;  2PMV A;  1N61 A;  1QLB B;  4IKG A;  2W55 A;  1L4Z B;  1SE2 A;  2YEP B;  1MVK A;  3NRZ A;  4RNA A;  3UI3 A;  1ESF A;  3TSS A;  1K52 A;  1RYJ A;  2N9L A;  3Q8A A;  1K51 A;  2JYT A;  4P6V F;  3P1M A;  4H2A A;  3U52 E;  2B76 B;  1FRR A;  2DBY A;  4RGT A;  2RPV A;  1J7B A;  3HUI A;  4GDL B;  2HDE A;  2V4I B;  3LXF A;  1E9M A;  1QKZ A;  2DYM A;  2LJI A;  2I2Y A;  1UUP A;  1AYF A;  3AE2 B;  2QJL A;  3AE5 B;  2BS4 B;  1C9F A;  1C79 A;  3SR6 A;  2L1A A;  1KRH A;  1SEB D;  2ON8 A;  2WNM A;  4HRO A;  3URY A;  2WXI A;  4NJC A;  2N9K A;  4RGN A;  5EE3 A;  1UNS A;  1ZXH A;  1ZPS A;  3GS2 A;  2BB5 A;  2XNA C;  3B2G A;  4KGS A;  1HXY D;  2JXT A;  4FXC A;  1DGJ A;  4JWU C;  1M4V A;  3VRA B;  1JCK B;  1KLG D;  3W5V B;  4KGR A;  1WSP A;  1NYR A;  1XCQ L;  1OFF A;  4AS1 A;  3Q8F A;  4ARI A;  4C80 A;  3V05 A;  2LGI A;  4YTN B;  1D6E C;  1I4H A;  3EGR A;  2LEK A;  2TSS A;  3BWU D;  1L4D B;  1NEN B;  1L0V B;  3TEZ A;  1FXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...