2Y5CA

Structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
SDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADRENODOXIN-LIKE PROTEIN, MITOCHONDRIAL
publication title Structure and Functional Studies on Human Mitochondrial Ferredoxins
rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 29
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2y5cA00
2H88B 1B9RA 3PO0A 1ZOYB 3AEGB 1T3QA 1VJKA 3W5VB 3FAHA 3LXFA 2W54A 3AE1B 1WGKA 3NVYA 1DGJA 2WS3B 3CIRB 1TKEA 4ITKA 1IUEA 1SB3C 1TJEA 1WXQA 1NYQA 4WWMA 4JWSC 1NYRA 3AE7B 2M19A 2H89B 3ZYYX 1V97A 1VDVA 3LB8C 1ZP0B 3B2GA 1AWDA 3P4SB 5EE3A 2WDQB 3WCQA 1SIJA 1FMAD 2MJ3A 1KFYB 2WDRB 5EE9A 2K5PA 2MH7A 1QLBB 1TKGA 3AEFB 1J7CA 3AN1A 3NVWA 1JALA 1RFKA 5MPOA 3SFDB 3VR9B 4YTMB 5H92C 1QOAA 2BS2B 3AEEB 1I7HA 2KAJA 4US9A 1YQ4B 4YXDB 2WU5B 1N60A 1E9MA 1N5WA 1FXAA 2BT6A 2CJNA 1PFDA 5H8YE 1QOGA 4YTNB 1CZPA 3AMZA 2KMMA 1FIQA 3VRAB 3HRDD 1JROA 1AYFA 3NVVA 2JQRB 1JWAD 1YJIA 1UWMA 4HRSA 3SR6A 3AE8B 4US8A 1ZXIA 1N62A 2QJLA 2K22A 1XO3A 2OHFA 2WQYB 3P4PB 2G1EA 1JRPA 3VR8B 1FRDA 1JWBD 1NEKB 2WU2B 3L4PA 2DWQA 1QT9A 2W3SA 1E6EB 3KWLA 4C7ZA 1V8CA 1NENB 2K9XA 4KX6B 5EE0A 1A70A 3AM9A 3SFEB 1CJEA 2WLBA 2PVGC 1FRRA 3FC4A 4YSZB 2Q5WD 3B2FA 3P4RB 4HROA 4YTPB 4FXCA 1PUTA 3AE9B 3NVZA 5G5HA 1E7PB 1L6UA 1YJJA 3AE5B 1RM6C 1J7BA 3W9CB 3AE6B 5GXGB 1FXIA 1F0ZA 3RPFC 3AEBB 4YSYB 4A9AA 4YT0B 3B9JA 3HUIA 1R7SA 4ZHOA 1GAQB 1L0VB 2PKOA 2QIEB 1DOYA 1GPXA 1TKYA 2AX5A 2L52A 1DOIA 1TYGB 3DWGC 3P63A 2PVOD 1N63A 1XLNA 3DWMA 1L5PA 4N58A 5AUKA 2N0SB 4ZHPA 2CJOA 1N61A 2CU3A 3NS1A 2BS3B 5C3JB 5AUIA 5C2TB 2MJEA 2B76B 3AEAB 1JW9D 2JX5A 3ETRA 3P1MA 2BS4B 1OQQA 1E10A 1J7AA 2MJDA 4IDIA 4C7YA 1RWSA 1NVID 1VLBA 2LEKA 1XLQA 5G5GA 1FFUA 1FM0D 2ACZB 3EUB2 3AE4B 3AE3B 2WP9B 3W5UB 1N5XA 3VRBB 1FO4A 1WRIA 1XLOA 1ZUD2 4USAA 1KRHA 1FFVA 1WWTA 3AE2B 1DOXA 1EWYC 1OFFA 1OQRA 3AB5A 1SF0A 4C80A 1PDXA 1QOFA 1WYGA 2M56B 2PIAA 3AECB 3AV8A 1QF6A 2FBWB 3P4QB 4N59A 4JX1C 1RYJA 1ROEA 2WDVB 3NRZA 3BIID 1E0ZA 4ZOHC 3HVZA 4JWUC 3AH7A 3AEDB 4N6EB 4P6VF 4WQMA 1JQ4A 2DBYA 1YQ3B 2EKIA 4LTUA 2HTME 2L83A 2E3TA 1L6VA 5EE1A 1NI3A 1QOBA 4YSXB 3ABVB 2W55A 2Y5CA 1XLPA 1KF6B 3CWIA 2W3RA
chains in the Genus database with same CATH superfamily
4RF1A 2WXLA 4WQOB 4WJNA 3W5VB 3T9LA 2FIFA 3VHTC 3BK1A 3VTWA 3ZJTA 1TY0A 3A9JA 1KLUD 2WXJA 1V1OA 2HD5B 3MJWA 3SFDB 1C4PA 1ZDVA 2M4NA 1OEYJ 4US9A 2MHJA 2GRIA 4ZYSA 1T5XD 2WX0A 1V86A 3ZQ4A 5BYRA 1LFDA 1JROA 3TJPA 2IY1B 3H1UA 4MGIE 3KQ4A 1E5WA 3NZSA 1C78A 1E6EB 2KMAA 4J6IA 1V9JA 1R4MB 5E6JA 3ZDMC 1L0XB 4KX6B 2BVCA 2KQ7A 2JF5A 4M0WA 1L0YB 5LLIA 4HJGE 1XD3B 4YTPB 1I4XA 1E7VA 2KTRB 1CMXB 4AOFA 2N0SB 4NAWA 1M94A 1OTRB 3ETRA 1Z2MA 4B0EA 2LEKA 1QQRA 2D3GA 2J4XA 1HA5A 1L4ZB 1AW7A 4DDID 4E3CA 1DOXA 1XQQA 2KVZA 3ZJUA 2JY6A 3RT3B 1VR9A 1TBEA 2KHWB 2AQ3B 3PV1A 4NPNA 3VQIA 1JQ4A 1HE8A 1KLGD 5TSSA 2DZJA 1UGMA 3CWIA 1S1QB 5HI1A 4XZ4A 3KUDB 1ZOYB 3UI3A 2D3CA 2FAZA 2O2VB 3RMKC 1TKEA 1ET6A 3HM3A 4PT5A 3AE7B 2G4DB 4DHZE 4W9EA 1FMAD 1QLBB 1QOAA 2QILA 5C23A 4LDTB 1N60A 2MQJA 4YTNB 3HRDD 2LGDA 2K22A 4S0RA 2IJ0A 1E90A 4GDLB 3ZNZB 3ZGZA 1FRDA 1WMHB 4JE3B 3EGRA 5CHVC 2W3SA 2PEAA 3HK0A 4C7ZA 2LRWA 2AWTA 3Q2AC 3ZKJC 1EU4A 1K51A 1V49A 5JXVA 2GB1A 2M1MA 2Y5PA 3R7RA 1YJJA 3AE5B 2WXRA 4BAXA 4RF0A 1FXIA 3ALBA 2KWCA 3AEBB 2GBMA 3APFA 2DZMA 3A9KA 2QIEB 1P9DU 1SXTA 2JZPA 2KN5A 4KDIC 1C1YB 2CU3A 4KSLC 3AU4A 3VXWA 1KTKA 1VLBA 1E8YA 3PPAA 3TSSA 1CK1A 4ANWA 3A4RA 1EUVB 3B08A 1N5XA 3Q3JA 3IT6B 3SDLC 3L13A 2WWZA 4WAFA 1IBXA 1OQRA 3NS8A 4UDUC 1C77A 2RPQA 3R7QA 1WZ3A 3V6EB 2LRUA 3K9OB 4JIOU 3N1XC 4BKSD 2W3RA 4TV3A 3MHZA 2KDBA 2NR2A 5DPTA 3GS2A 2J42A 1JWSD 3DBRI 4W9IA 1J7CA 1V5OA 3AN1A 1RLFA 2LGXA 3PT2B 3SHQA 4B9KA 1I7HA 3VAWA 3FILB 3BYTB 5LXIB 2INPE 3CF6E 2C7HA 1WR1A 4S17A 4US8A 4CO7A 3TEWA 3KWLA 3V60A 4EZLA 4G0NB 3RZWC 1FRRA 4LNNA 1S3SG 2FCQA 1L6UA 4W9JA 2FUHB 1XCQL 1PGXA 2NPTB 3ZUNA 1JCKB 2NTSA 3QARA 4W9GA 2PKOA 1Q1OA 1WXSA 2PMVA 3DWMA 3Q3MC 2CR5A 4HPLB 2MJEA 4RGMA 1IGCA 2KDEB 1E10A 3JYUA 4IDIA 3IG3A 1DYQA 2K6DB 4KKIA 3AE4B 2KXJA 4NQLB 1YNTE 3V6CB 1ZUD2 3DVNU 3WANA 2OJWA 3GE8C 2B3AA 2M56B 4YWGG 3AV8A 3E9SA 2OJRA 1D6EC 1KOTA 3C19A 1NI2A 1RYJA 3KUCB 1E0ZA 3QA8A 3ZNID 1TY2A 3W1SA 3KLSX 4NAMA 3C8YA 4HCPB 2KWDA 3ZLZA 3L08A 2JVCA 2W54A 4GSWA 2HTHA 3I63C 3BVZA 1FEHA 2QMTA 1MI0A 3LJ3A 2NTTA 4K81A 2NMQA 2LJ5A 4TMAB 3Q14C 1RFKA 2KJRA 4FJZA 4YTMB 4I6PA 2WXHA 3PRZA 2KQSA 1I4PA 3NHEB 3H7SA 5BYQA 1AYFA 3T3OA 2JQRB 1JWAD 2JWZA 3SR6A 1SE3A 1HZ5A 2N7DA 1HTQA 1IGDA 1NEKB 3TIXA 4DXGA 2KWVB 4DDGD 2HJ1A 2PTLA 4JGHB 1YD8U 2V3NA 1WYWB 1C3TA 1Y56A 2RDHA 2BPSA 1SEBD 5GXGB 4KSKC 1SIFA 2N9EB 3HUIA 1GAQB 5KHQA 2WDTB 2WXOA 2FCNA 4N9F4 2XEWA 3V61A 3L10B 2SEBD 2MJDA 2JXTA 2ZCCA 5JZEB 5IOIA 4C56C 1EO6A 4MSMB 1ZKHA 3DBHI 2I38A 3VUWA 1J8CA 1EU3A 1EWYC 2XK5A 2I1KA 4LK0M 4MEMA 3P4QB 1UD7A 5CX3A 4GN1A 4WWPA 4KGTA 1WF9A 2HTME 3Q6BA 2I1JA 4EZKA 2C7NB 1F1HA 2IPKD 2AL6A 1UBQA 3DCGA 1XLPA 1WI0A 4KIKA 3MC9A 2L1AA 3DBRB 3I3TB 2H88B 2LUEA 2MBEA 1WX8A 2KT7A 2O6VA 1WGKA 1DGJA 3CIRB 1IUEA 1WXQA 1XF5L 3UINB 2ON8A 4FHJA 2N9KA 5BMHA 1SSNA 1XT9B 4PK1A 2RD0A 1I4RA 4II2B 4K1RB 1WE6A 1V2YA 1FPYA 5CHFA 2C5LC 3ZRCA 1N5WA 3IAM1 4MJSA 4LDTD 4NNJB 3NOBA 2SAKA 1ENFA 2W82A 3MC8A 2C9WB 3AE8B 1ZE3D 3RNCC 1F2RI 1Y8RC 4ICVA 1F2RC 2LGSA 1VZ6A 2DWQA 2NVUI 4NJCA 1MFWA 1A70A 1HEZE 4HK2A 1IPGA 4YSZB 1EM7A 2XNAC 3QIJA 3ZXVA 1KLVA 1XEEA 3B1LX 3MTNB 2ZVNA 2QSDA 2L0TA 5HHDG 3IBEA 2JPHA 4OVVA 2JUOA 3BVMA 3P63A 4I6NB 1WGYA 5L83A 3C0RB 3AULA 4NY0A 1JW9D 4CHKA 1YX5B 2HJ8A 4MM3A 3HHMA 4RGTA 3TL5A 4KGRA 3CMMB 2K25A 2BQQA 4WAAA 3T3NA 3U8ZA 3GOEA 2K0PA 1QF6A 4JX1C 3DPDA 1C9FA 4B6WA 3MFGA 1ESFA 3R3MA 2J0KA 2ZNVC 1L6VA 1ZW7A 5IN7A 4DBGA 3GB1A 4B95A 4RM8A 2JU6X 2K8CA 3M63B 2ZVOA 1JWMD 1B9RA 2LMCA 1H4RA 1IP9A 1V97A 3ZRFA 3RI7C 3QHTA 4DXAB 4HDQA 2WHIA 2KC2A 2NCNA 2K8BA 3PHXB 2DLBA 2KAJA 3PTFC 1YQ4B 3DBSA 4MGYE 5H8YE 5G55A 1GB4A 1CZPA 4TQ1A 1WXVA 3NVVA 2CS4A 4J3OD 2DYMA 2HE7A 2QC8A 1N62A 4L23A 2WXFA 1JRPA 4AQ7A 2NBWB 3KYDD 2IO0B 3ZNHB 1UGJA 1G6JA 4EKUA 3DVNV 3AE9B 1MVKA 3N20C 1E7PB 3ZIMA 3M62B 5DPSA 2N1WA 1SE4A 1P0RA 3NZ3A 5CHWA 2PJHA 1FXTB 2AX5A 3DWGC 1L2NA 3A9JB 1ACCA 4K7SA 3DBHB 3PSEB 3RULA 3VDZA 2JX5A 2LVOA 2CKHB 1D3ZA 2CU1A 4K7WA 5TR5A 4CYEA 2GOWA 1HZ6A 5FR3A 4X57B 1J19A 1YOVB 2M0AA 4GU2A 2GI9A 4GIVA 4JWUC 4C4VA 2ICIA 1WXMA 1D5MC 3L54A 3H7PA 2W55A 4WIPA 1TGZB 3U7ZA 2CHXA 4M0WB 1LQBA 1TT5B 1E8XA 1GOZA 1SJHD 1I4GA 2N4FA 4L2YA 1Q0WB 3NVYA 2J52A 2D3BA 2KX3A 1FCLA 4BZAA 2V9HA 3VTVA 1ZP0B 1AWDA 3HVDA 2MH7A 3VR9B 1CQVA 1IYFA 3TEZA 3AEEB 2D3AA 4ZDVA 2WU5B 4ARCA 5AEKB 1QILA 1E7UA 4GDKA 2O2VA 4P1CC 4FJVB 5E6PA 2Y3AA 1ZXIA 2KDFB 2PW9A 3Q69A 2WU2B 2FIDA 5JHBA 2C7MB 2KOXA 2N9PC 3DDCB 4LNKA 1M4VA 1TTNA 2Q5WD 1SE9A 4WJOA 2MRPA 2Z0EB 3ZTDA 4ZYNA 4FA6A 1AARA 2BYFA 3PZDA 4ANUA 4WJQA 1WMHA 3Q3NC 4KKJA 4N58A 2WXKA 4NZLB 3TUOA 3W1SC 4G3XB 2LI5A 4DWFA 2DHZA 2JWUA 2V3SA 4C7YA 4OZBA 3WIMA 1HQRD 2ZNVB 2M0XA 1FO4A 2K6QA 3OJ4B 4BOSC 1KRHA 3QJZA 3A1QA 3AB5A 3UIOB 3DQVA 2REXA 1PDXA 2KC1A 4QAYA 2WDVB 1P1AA 3NRZA 2AL3A 2L3ZA 5IAAC 2KLGA 2Z59B 2N9LA 4GLSC 4ACFA 2Y5CA 4BBNC 1T0SC 4FBJB 4DK5A 1RRBA 3PO0A 3RUIB 3JW0X 1QZEA 5HKHA 4CQNA 3CSFA 4PS3A 2L05A 3QCAA 1SGHA 3P2BA 2YLMA 4OZAA 4WWMA 2AYOB 4OHJA 2M19A 3A9KB 1GC6A 2WDQB 3EHVA 5BMIA 5DPWA 4HKQA 1U4AA 3R2IA 3PRPB 4G50A 3BYYB 1FXAA 2UYZB 1PFDA 4TKNA 4WJPA 4LCDE 4O1NA 1IBXB 2WXMA 2IZVB 3PRMB 4F7ZA 2FNJB 2D11A 3W1YA 3RNBC 2Y5BB 4HJKA 1QT9A 1V8CA 1NENB 5T8IA 4JPSA 5EE0A 2LHDA 1YN5A 3AM9A 1TS4A 1MPEA 4M00A 2JRIB 1PUTA 3NVZA 3X0WA 1K50A 3VH4B 2KO3A 3ZO5B 1F0ZA 2RGFA 3UQBA 2LGYA 2IO1B 3QK0A 1BXTA 1GG3A 4A55A 2BBCA 1L4DB 1D4BA 3I5JC 2EELA 4AP4C 4IWQA 2WXPA 3LDZE 3DHGC 4BFRA 2LUMA 2JYEA 3EFCA 3SU8X 1NVID 5IP4D 4REZA 3W5UB 3U7DA 4ASWC 1J0GA 3QX1A 4BKGA 2IGDA 3TEXA 4L1BA 4ZRKA 1T0RC 4ICUA 3AECB 2LD9A 3S2AA 4KDLB 2G9HD 5EE1A 2E3TA 2BGFA 1SJED 1F9JA 1BUIC 1KM7A 3AEGB 2I2YA 5LNK1 5LXHA 1E8WA 4P1BC 2WXGA 4JWSC 2BKRB 1T0YA 1UELA 1PGAA 5EE3A 1WH3A 1SIJA 5EE9A 2NBUA 2ZJDA 2K1FA 2LZ6A 1JALA 1K8RB 3ZTCA 1SBBB 4MELA 3SEBA 3TCAA 2DX5B 3VVWB 4ANXA 4BOZB 1UZXB 3PS6A 4WWNA 4A90A 4XYCA 4NQKE 1FNVA 2KDIA 2DZKA 3N1YC 2VH1A 1UF0A 3CSTA 2LGIA 5D3DA 1MHXA 2N9XA 1UH6A 2CHWA 4W9FA 2NBVB 1KH0A 2MWSB 3VTUA 1FCCC 2LHEA 5J17A 1VZ8A 3AE6B 2IGHA 4WURA 1MG4A 2V4LA 1NDDA 1YQBA 3V3XA 1WM3A 1R7SA 1VCBA 4ZHOA 4GGQA 2X8XX 2D2QA 2GBNA 4ZHPA 3NS1A 5C3JB 4TUUA 4IW0A 2ZZPB 1K52A 2UWQA 2RDGA 5FR6A 4E71A 2ACZB 1H8CA 2WP9B 2DENB 3Q8AA 1FD6A 4EOYA 1NBFC 1V1PA 2KZRA 4LLGM 4HVBA 3MJ5A 2X38A 4C80A 3V05A 4N59A 5IKCM 3APCA 3RNFC 2BWFA 4LTUA 4FN2A 2R2OA 2N1VA 4PS8A 2LVPA 3Q3FA 1WX9A 3EA6A 5D6JB 2ZEQA 3WAOA 3KWVA 1GJZA 1PQSA 2E6XA 3PGEA 2V1YA 1T6BX 2RMMA 4HPPA 4XDDA 1LM8B 1VDVA 3LB8C 3QWZB 2JRHA 2WDRB 4XC2A 5BO4B 2K5PA 1EF1A 2BYEA 3AEFB 2INCC 2OOBB 5MPOA 3NG0A 1C76A 3ECIA 2G45B 1I4HA 1WGDA 4IOIE 3BZDB 3DVGY 2BT6A 2CJNA 3N3KB 1QOGA 1YN4A 2RPVA 2XK5B 5JHAA 3IVFA 3R2TA 4HEA1 3VUYA 4RGOS 1TS3A 1JWBD 1ET9A 3L4PA 4BKSA 3QC8B 4WWOA 1Z5SB 2K9XA 3U30A 3FC4A 1C79A 2IBIB 2RR9A 4KIKB 5G5HA 2LASA 2KFKA 2M8SA 4MGKE 2O6VB 4HXDA 2L76A 1L5PA 2G4SA 2QCZA 2BKFA 2J0MA 2B76B 1OQQA 2PE9A 2MP2A 3RYTA 2INNE 1YN3A 5D7GA 4EFOA 4H2AA 4EE2A 4MJSB 4P16A 2A5UA 1WYGA 3GZNI 3JSVA 2C60A 2FUG1 4F1SA 4KZ0A 4N6EB 1WJUA 5EDSA 4GMVA 3QQ8B 1C4AA 1P7EA 2V4IB 3RFZB 3ABVB 1T0QC 2BF8B 2UU7A 1JMLA 4IC7B 4ITKA 4TQ0A 1XXGA 2KMCA 3B2GA 4EZJA 4RH6A 2K39A 2L8JA 2R2QA 1R4NI 4MACA 3BWUD 2BB6A 3L0WB 3VFKA 4K7UA 4B0MA 3AMZA 1FIQA 1WIAA 3B0AA 1YJIA 1P3QU 1LO5D 2INDC 1WGRA 3A4SC 2LWPA 4A20A 2K3UA 2KYWA 3N1ZC 1I42A 4LNIA 3PZ8A 4RGNA 1V5TA 5HG2A 2JYTA 2MW5A 3RPFC 4LNOA 4A9AA 1LXDA 1LGRA 1L0VB 2L52A 2VZKB 4DHZB 5AUKA 2BS3B 2BS4B 3H6NA 3GE3C 3V62A 4MH8A 4DQOC 3U52E 3VRBB 5AZGA 2DAFA 2WXIA 4XE0A 2IGGA 1JWUD 2J7QB 2L00B 3SD5A 1QOFA 2AQ1B 2KN4A 2FBWB 3PHWB 3RNAC 2JXXA 1TIFA 3DOWA 2EKIA 1TZOA 2L83A 3ML8A 3ZXRA 4JLCA 1WSPA 1I4QA 3WA0A 3LXFA 2LXAA 2ZPNA 4IM2A 2WXNA 4MT5A 2KTRA 2MBQA 2KACA 4LNFA 2HDEA 3TMPB 5IA7A 3I9V1 1TKGA 4ANVA 3RZFA 3BK2A 3BY4B 2BWES 1PGBA 2EKEC 4HCNB 4C00A 2KWUB 3IHPC 4LJPB 1UWMA 2AQ2B 2DNFA 2FCSA 1I35A 2BTEA 3Q8EA 4XX5A 2WYQA 4C4VB 1KJTA 4NAWB 1TS2A 4XGAB 5BYSA 2RDBC 3H7PB 3KUZA 1X1MA 4OW0A 2ZW0A 2V3PA 4FXCA 2GBRA 2YEPB 1RM6C 2KTFA 3EFUA 3U2SC 3MHSD 3BINA 3B9JA 3I57A 1F52A 2M17A 3N9YC 1FNWA 2CJOA 4FLHA 5AUIA 2JZ3B 3AXCA 3GZNB 4A3OA 4NJ7A 1WRDB 4II3B 4DXFA 3EUB2 2NS5A 4MH0E 4RFBA 4GDKB 2KVRA 4MSQB 1OFFA 2PIAA 4GDLA 3R66C 4W9KA 4BBNF 1ROEA 3BIID 3PZ7A 4ZOHC 2OEDA 3HIZA 5CTRC 4HLEA 1YMHE 3AI5A 4FHKA 3UIPB 1L7YA 1D5XC 3NY5A 2DAJA 2IO2B 3AU5A 1ZXHA 1GB1A 2WS3B 1R4NB 2ONQA 3KVFB 1VRAB 5JH5C 4KV2A 2WXQA 4KZCA 3MC0B 3ZYYX 4GOCA 4E74A 1TZ1A 1UWXA 1WM2A 2FE8A 2KK8A 3J9CA 2DYBA 3KH0A 3X23A 4ARIA 4BVUC 3TEYA 3O65B 2KMMA 3DBLI 3KYCD 2JT4B 3A1QB 4GXBA 2QJLA 3Q8CA 4HWIB 2G1EA 3UF8A 1P98A 2QHOA 5J18A 3TBLD 1WJ6A 2KD0A 4XWTA 5HFYA 3M95A 3WALA 2ZCBA 2IO3B 3RN9C 4RMAA 2O6VD 1GPXA 1AN8A 1GC7A 3ZDTA 2PVOD 2GBJA 4ZRJA 2WX1A 2L7RA 1WGHA 2ZPYA 1BMLC 3FILA 1A5RA 1XLQA 2YVCA 2Z8LA 3GP7A 3RNEC 4AWJA 4M01A 1WR6E 1XLOA 2IY0B 3AE2B 2MBOA 2MBHA 2LJIA 2L0FA 2QEJC 3MP9A 2V0GA 4W9HA 1WY8A 4W9LA 1V6EA 1HXYD 2GMIC 3HVZA 3OAWA 1WGGA 5D94A 3AEDB 3OLMD 4P6VF 4KGSA 2WNMA 4RCOA 3QAQA 4DHJD 5E6NA 1FNUA 2RSUA 5FK9C 4ZRIA 1K53A 2D5GA 3URYA 4OZCA 4ZRQA 2EMTA 2ASQA 4YL8A 2NPTA 1OEYA 1SB3C 1TJEA 4A8XC 4IM3A 1WXAA 5I4DA 4JL9A 1HTOA 1GUAB 1KFYB 3OJ3A 5GMVA 3NVWA 4MGZE 5L95C 2KDMA 4LJOB 4FULA 3U4EG 1ZDXA 4M02A 2FCMA 4IKGA 4GB9A 3VRAB 2G3QB 3JVZX 4NJ6A 3ZNGC 1Q10A 1N6ZA 1XO3A 2OHFA 2WQYB 1F77A 3VR8B 2BYVE 1V80A 3R8BA 3Q8FA 4W9DA 1BT0A 2XN9C 1QKZA 2BB5A 1RFAA 1YIWA 1CJEA 2PVGC 2N7JA 3P4RB 4HROA 3ZW3A 2PPHA 1B1ZA 2K8HA 2MX2A 1C4CA 1MHHE 1TKYA 1TYGB 3PLVA 3D32A 4XDCA 2VZKD 4RNAA 3AEAB 2KJ6A 1Q5WB 1WE7A 4MDKE 4Q2JA 5G5GA 1FFUA 1FM0D 3AE3B 4W9CA 1RAXA 4P7IA 4HDOA 1FFVA 1WWTA 2DZIA 5D2MB 5DCNA 4EEWA 2KKCA 1WJ4A 4PYZA 2DBYA 1YQ3B 2MEKA 4YSXB 1QOBA 3K9PB 2MBBB 1KF6B 3IFWB 1T3QA 1VJKA 1UUPA 3FAHA 3KW5B 4F8CB 2AEHA 1PYWD 1NYQA 2BW2A 1NYRA 2H89B 3WCQA 3IT4B 4M8NA 1YX6B 2XBBC 3DBLB 1WZ0A 3Q8BA 3WAMA 1V81A 2BS2B 3N30A 1XCTL 3H8HA 2PE6B 2GBKA 4KVGB 2KX0A 4M8MA 4EUTA 1ZGUB 3W2DA 2W9NA 3OWEB 1V1PB 4HKZE 1GNUA 4HRSA 5J2RA 3L17A 3FKYA 2LXCA 4URKA 4K3CA 2IYDB 1YJ1A 2KQ4X 1TS5A 3SFEB 4G11A 2JSVX 3IXSA 3Q3OC 2KJHB 2KFJA 4PYUA 4K3BA 1J7BA 3W9CB 2CHZA 3RNGC 2DYOA 2L32A 3VUXA 2YEPF 1R4MI 3PVLA 2VH2A 2D07B 3ONSA 3P42A 4HPMB 1DOYA 1DOIA 2QDFA 1MJDA 1XLNA 4ZRPA 1P7FA 3ENEA 2VRRB 1N61A 5AZFA 5C2TB 3IAS1 1J7AA 1UBIA 1STEA 4OVZA 3M3JA 1SE2A 3NUHB 1WRIA 3PLUA 3HM6X 5G2NA 3DHHC 3UQAA 1JRUA 2EMSA 5DPRA 1EWCA 4TSSA 3APDA 3PREA 1D5ZC 3WAPA 1WJNA 1WFYA 1UNSA 4I6LB 3AE1B 2KFKB 4OVUA 2KLCA 2TSSA 3O13A 3UGBB 3T8MA 3ML9A 3P4SB 2IDYA 2R61A 2MJ3A 2A4ZA 4DHJB 2N7EA 4AUQC 5H92C 2KNBA 2GLSA 3DHIC 2MP2B 4YXDB 1E9MA 1VZ7A 4IWOA 4R3DA 1ZPSA 4XWWA 2BYTA 2JZZA 1WX7A 2MCNB 4WH4A 1OQYA 2ZW1A 3ZVVA 3L16A 3P4PB 3JSVB 5D3IB 4FADA 3NZUA 5C1ZA 2WLBA 2WGSA 3B2FA 2PLPA 4MM3B 5FKAC 3BVGA 2MA9B 4YSYB 4PS7A 3LYYA 4YT0B 3A33B 3RCZA 4IM0A 3NJTA 3RD2A 1N63A 4A6QA 5BMGA 2KANA 4D2KA 2J53A 4IG7B 4A3PA 3N32A 2J0JA 1OGWA 3P1MA 3VH3B 5E6OA 1RWSA 4AS1A 5KHOA 1ISNA 4BKTA 4IWPA 1MG8A 4USAA 4AJWA 4FJYA 2LFIA 2LVQA 3DVGX 4IUMB 3ZJVA 1SF0A 3OG5A 2MLBA 3E56A 2MSED 1EF5A 2Z0DB 3EC8A 4RM9A 3EECA 3AH7A 4JQWC 4WQMA 5IO9A 1E8ZA 1NI3A 4AJYB 3H9DA 2D10A 1VD2A 5AZHA
chains in the Genus database with same CATH topology
2H88B 3AEGB 4RF1A 2I2YA 1ZXHA 2WXLA 5LNK1 3W5VB 1WGKA 1GB1A 1DGJA 2WS3B 3CIRB 1IUEA 3BK1A 2ONQA 1WXQA 1VRAB 1XF5L 2WXGA 4JWSC 3ZJTA 2ON8A 1TY0A 2WXQA 1KLUD 3ZYYX 3MC0B 1PGAA 5EE3A 2N9KA 2WXJA 1SIJA 5BMHA 5EE9A 1SSNA 1V1OA 1JALA 1I4RA 3SFDB 1SBBB 1C4PA 3SEBA 1UWXA 2FE8A 1ZDVA 3J9CA 4ARIA 4US9A 4A90A 2GRIA 4ZYSA 1FNVA 1N5WA 1T5XD 3TEYA 3IAM1 3ZQ4A 2SAKA 5BYRA 2KMMA 1ENFA 1JROA 2W82A 2LGIA 5D3DA 1MHXA 3AE8B 2QJLA 3Q8CA 1ZE3D 1F2RI 2G1EA 1F2RC 3KQ4A 1VZ6A 2DWQA 1C78A 1E6EB 4NJCA 1KH0A 5E6JA 1L0XB 4KX6B 1A70A 1HEZE 4M0WA 1FCCC 1L0YB 2LHEA 1EM7A 4HJGE 4YSZB 2XNAC 1VZ8A 4XWTA 4YTPB 5HFYA 1XEEA 2QSDA 1I4XA 5HHDG 3AE6B 2IGHA 4WURA 3V3XA 1R7SA 4ZHOA 1GPXA 1AN8A 3BVMA 3P63A 2PVOD 2N0SB 4ZHPA 3NS1A 5C3JB 1JW9D 3ETRA 1K52A 1BMLC 3FILA 4B0EA 2LEKA 2RDGA 1XLQA 3GP7A 1QQRA 2Z8LA 2ACZB 4RGTA 2J4XA 2WP9B 1HA5A 1L4ZB 3Q8AA 4KGRA 1FD6A 1AW7A 1XLOA 1V1PA 3AE2B 4LLGM 1DOXA 3T3NA 2LJIA 3MJ5A 2X38A 3ZJUA 2K0PA 2QEJC 4C80A 1QF6A 3MP9A 2V0GA 1VR9A 3V05A 4N59A 4JX1C 2AQ3B 1C9FA 1HXYD 3MFGA 1ESFA 3HVZA 3AEDB 4P6VF 3VQIA 1JQ4A 4KGSA 2WNMA 4LTUA 4RCOA 1L6VA 1KLGD 5TSSA 3GB1A 3CWIA 5HI1A 2JU6X 1FNUA 3EA6A 5FK9C 1JWMD 1K53A 2D5GA 3URYA 1B9RA 1ZOYB 4OZCA 3UI3A 4ZRQA 2LMCA 3KWVA 2E6XA 1TKEA 1ET6A 1SB3C 1TJEA 4A8XC 1T6BX 2RMMA 4PT5A 5I4DA 3AE7B 4XDDA 1V97A 1VDVA 3LB8C 1FMAD 1KFYB 2WDRB 2K5PA 1QLBB 3AEFB 3NVWA 5MPOA 1C76A 1QOAA 2KDMA 2QILA 2DLBA 2KAJA 3U4EG 1YQ4B 1I4HA 1N60A 4IOIE 1ZDXA 3BZDB 2BT6A 2CJNA 4IKGA 5H8YE 1QOGA 4YTNB 1CZPA 4TQ1A 1GB4A 3VRAB 3HRDD 1YN4A 3NVVA 2RPVA 4J3OD 2DYMA 1N62A 1Q10A 4L23A 2K22A 2IJ0A 3R2TA 1XO3A 2OHFA 2WQYB 4GDLB 2WXFA 4HEA1 1F77A 3ZGZA 4RGOS 1JRPA 1TS3A 1FRDA 1JWBD 3R8BA 3VR8B 1ET9A 3L4PA 4JE3B 3Q8FA 4AQ7A 3EGRA 2W3SA 2XN9C 1QKZA 4C7ZA 2BB5A 2K9XA 1EU4A 1K51A 1CJEA 1UGJA 3FC4A 2PVGC 1C79A 2N7JA 3P4RB 4HROA 5JXVA 2GB1A 3AE9B 1MVKA 2Y5PA 1E7PB 5G5HA 1YJJA 3AE5B 2WXRA 4RF0A 1B1ZA 1FXIA 3AEBB 1C4CA 1SE4A 3NZ3A 1MHHE 2QIEB 1TKYA 1SXTA 2AX5A 1TYGB 3DWGC 2JZPA 1ACCA 1L5PA 4XDCA 2VZKD 4RNAA 2CU3A 2B76B 3AEAB 2JX5A 1OQQA 1KTKA 1VLBA 3TSSA 4Q2JA 2INNE 1FFUA 1FM0D 1YN3A 5G5GA 1CK1A 3AE3B 5D7GA 4H2AA 4EE2A 1N5XA 3IT6B 1HZ6A 4P16A 1FFVA 1WWTA 4WAFA 1IBXA 5FR3A 1OQRA 4UDUC 1WYGA 1C77A 2M0AA 2FUG1 2GI9A 4JWUC 4N6EB 2DBYA 2ICIA 1YQ3B 1D5MC 2MEKA 4YSXB 1C4AA 1P7EA 1QOBA 2V4IB 3ABVB 3RFZB 2W55A 4WIPA 3U7ZA 1KF6B 2W3RA 3MHZA 1GOZA 1SJHD 1I4GA 1JMLA 1T3QA 1VJKA 1UUPA 4L2YA 3FAHA 3NVYA 2J52A 4ITKA 3GS2A 1PYWD 1FCLA 1NYQA 2J42A 2BW2A 1NYRA 4TQ0A 1XXGA 1JWSD 2H89B 3WCQA 1ZP0B 3B2GA 1AWDA 3IT4B 4RH6A 3HVDA 2MH7A 3Q8BA 1J7CA 3AN1A 3VR9B 1CQVA 3TEZA 2BS2B 3AEEB 1I7HA 3FILB 1XCTL 3H8HA 2WU5B 4MACA 3BWUD 4ARCA 3BYTB 1QILA 2BB6A 2INPE 4B0MA 3AMZA 1FIQA 3W2DA 3OWEB 1V1PB 4HKZE 1YJIA 4HRSA 1LO5D 2Y3AA 4US8A 1ZXIA 2PW9A 3Q69A 2WU2B 3TEWA 3KWLA 2K3UA 2KQ4X 1M4VA 1TS5A 3SFEB 1FRRA 2JSVX 3IXSA 2Q5WD 3PZ8A 4RGNA 1L6UA 1J7BA 1XCQL 5HG2A 3W9CB 1PGXA 2JYTA 3RPFC 2DYOA 2L32A 4A9AA 1JCKB 2NTSA 2YEPF 1L0VB 1DOYA 2PKOA 3P42A 2L52A 2VZKB 1DOIA 4KKJA 1XLNA 2PMVA 3DWMA 2WXKA 4N58A 1P7FA 4NZLB 4ZRPA 5AUKA 3TUOA 1N61A 2BS3B 5C2TB 2MJEA 4RGMA 1IGCA 3IAS1 1E10A 2BS4B 2JWUA 1J7AA 4IDIA 4C7YA 1DYQA 1STEA 4OZBA 4OVZA 1HQRD 4KKIA 3AE4B 4MH8A 1SE2A 3NUHB 3U52E 4DQOC 1YNTE 3VRBB 1FO4A 1WRIA 1ZUD2 2WXIA 1KRHA 4XE0A 2IGGA 1JWUD 3AB5A 1EWCA 1PDXA 1QOFA 2AQ1B 2KN4A 2M56B 3AV8A 3E9SA 2FBWB 4TSSA 1D6EC 4YWGG 1D5ZC 1RYJA 2WDVB 3NRZA 1E0ZA 2EKIA 1TZOA 2N9LA 4GLSC 2L83A 1TY2A 1UNSA 2Y5CA 3W1SA 3KLSX 4NAMA 1WSPA 3C8YA 3PO0A 2KWDA 1I4QA 4CQNA 3LXFA 2W54A 2WXNA 3AE1B 4MT5A 2L1AA 3BVZA 1FEHA 4OZAA 4WWMA 2QMTA 2TSSA 1MI0A 3O13A 4OHJA 2NTTA 2M19A 2KACA 2NMQA 2HDEA 2IDYA 2WDQB 3P4SB 2R61A 2MJ3A 5BMIA 3I9V1 1TKGA 4HKQA 3R2IA 4TMAB 1RFKA 4YTMB 5H92C 3BK2A 4YXDB 1PGBA 2WXHA 3BYYB 1E9MA 1VZ7A 4R3DA 4XWWA 1ZPSA 1FXAA 2BYTA 1I4PA 1PFDA 5BYQA 4O1NA 1AYFA 3T3OA 2JQRB 1JWAD 2WXMA 1UWMA 2AQ2B 4WH4A 3SR6A 1IBXB 2ZW1A 1SE3A 1HZ5A 3P4PB 2BTEA 1IGDA 1NEKB 3Q8EA 5D3IB 4DXGA 1QT9A 1V8CA 4NAWB 1NENB 1TS2A 5T8IA 4JPSA 2PTLA 5EE0A 5BYSA 2LHDA 1YN5A 3AM9A 1TS4A 2WLBA 1MPEA 3B2FA 4OW0A 2PLPA 2V3NA 2ZW0A 2V3PA 4FXCA 1PUTA 3NVZA 4MM3B 1Y56A 2RDHA 2YEPB 5FKAC 1K50A 1RM6C 3BVGA 1SEBD 5GXGB 1F0ZA 3U2SC 4YSYB 3LYYA 4YT0B 3B9JA 3HUIA 1GAQB 1BXTA 4A55A 2BBCA 1L4DB 2WXOA 1D4BA 1N63A 3I57A 4A6QA 5BMGA 3N9YC 4D2KA 2EELA 2J53A 1FNWA 2CJOA 2WXPA 5AUIA 2SEBD 2LUMA 3P1MA 2JYEA 2MJDA 2JXTA 1RWSA 1NVID 4DXFA 4AS1A 3EUB2 4REZA 3W5UB 4RFBA 2IGDA 3TEXA 4C56C 4USAA 4GDKB 4L1BA 2LFIA 2I38A 1EU3A 1EWYC 1OFFA 3ZJVA 1SF0A 4LK0M 2PIAA 3AECB 3E56A 3P4QB 1ROEA 3BIID 3PZ7A 4ZOHC 3AH7A 4KGTA 2OEDA 4WQMA 2G9HD 5EE1A 2HTME 2E3TA 1NI3A 1YMHE 1SJED 2IPKD 1XLPA 1D5XC 1BUIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H88 B;  1B9R A;  3PO0 A;  1ZOY B;  3AEG B;  1T3Q A;  1VJK A;  3W5V B;  3FAH A;  3LXF A;  2W54 A;  3AE1 B;  1WGK A;  3NVY A;  1DGJ A;  2WS3 B;  3CIR B;  1TKE A;  4ITK A;  1IUE A;  1SB3 C;  1TJE A;  1WXQ A;  1NYQ A;  4WWM A;  4JWS C;  1NYR A;  3AE7 B;  2M19 A;  2H89 B;  3ZYY X;  1V97 A;  1VDV A;  3LB8 C;  1ZP0 B;  3B2G A;  1AWD A;  3P4S B;  5EE3 A;  2WDQ B;  3WCQ A;  1SIJ A;  1FMA D;  2MJ3 A;  1KFY B;  2WDR B;  5EE9 A;  2K5P A;  2MH7 A;  1QLB B;  1TKG A;  3AEF B;  1J7C A;  3AN1 A;  3NVW A;  1JAL A;  1RFK A;  5MPO A;  3SFD B;  3VR9 B;  4YTM B;  5H92 C;  1QOA A;  2BS2 B;  3AEE B;  1I7H A;  2KAJ A;  4US9 A;  1YQ4 B;  4YXD B;  2WU5 B;  1N60 A;  1E9M A;  1N5W A;  1FXA A;  2BT6 A;  2CJN A;  1PFD A;  5H8Y E;  1QOG A;  4YTN B;  1CZP A;  3AMZ A;  2KMM A;  1FIQ A;  3VRA B;  3HRD D;  1JRO A;  1AYF A;  3NVV A;  2JQR B;  1JWA D;  1YJI A;  1UWM A;  4HRS A;  3SR6 A;  3AE8 B;  4US8 A;  1ZXI A;  1N62 A;  2QJL A;  2K22 A;  1XO3 A;  2OHF A;  2WQY B;  3P4P B;  2G1E A;  1JRP A;  3VR8 B;  1FRD A;  1JWB D;  1NEK B;  2WU2 B;  3L4P A;  2DWQ A;  1QT9 A;  2W3S A;  1E6E B;  3KWL A;  4C7Z A;  1V8C A;  1NEN B;  2K9X A;  4KX6 B;  5EE0 A;  1A70 A;  3AM9 A;  3SFE B;  1CJE A;  2WLB A;  2PVG C;  1FRR A;  3FC4 A;  4YSZ B;  2Q5W D;  3B2F A;  3P4R B;  4HRO A;  4YTP B;  4FXC A;  1PUT A;  3AE9 B;  3NVZ A;  5G5H A;  1E7P B;  1L6U A;  1YJJ A;  3AE5 B;  1RM6 C;  1J7B A;  3W9C B;  3AE6 B;  5GXG B;  1FXI A;  1F0Z A;  3RPF C;  3AEB B;  4YSY B;  4A9A A;  4YT0 B;  3B9J A;  3HUI A;  1R7S A;  4ZHO A;  1GAQ B;  1L0V B;  2PKO A;  2QIE B;  1DOY A;  1GPX A;  1TKY A;  2AX5 A;  2L52 A;  1DOI A;  1TYG B;  3DWG C;  3P63 A;  2PVO D;  1N63 A;  1XLN A;  3DWM A;  1L5P A;  4N58 A;  5AUK A;  2N0S B;  4ZHP A;  2CJO A;  1N61 A;  2CU3 A;  3NS1 A;  2BS3 B;  5C3J B;  5AUI A;  5C2T B;  2MJE A;  2B76 B;  3AEA B;  1JW9 D;  2JX5 A;  3ETR A;  3P1M A;  2BS4 B;  1OQQ A;  1E10 A;  1J7A A;  2MJD A;  4IDI A;  4C7Y A;  1RWS A;  1NVI D;  1VLB A;  2LEK A;  1XLQ A;  5G5G A;  1FFU A;  1FM0 D;  2ACZ B;  3EUB 2;  3AE4 B;  3AE3 B;  2WP9 B;  3W5U B;  1N5X A;  3VRB B;  1FO4 A;  1WRI A;  1XLO A;  1ZUD 2;  4USA A;  1KRH A;  1FFV A;  1WWT A;  3AE2 B;  1DOX A;  1EWY C;  1OFF A;  1OQR A;  3AB5 A;  1SF0 A;  4C80 A;  1PDX A;  1QOF A;  1WYG A;  2M56 B;  2PIA A;  3AEC B;  3AV8 A;  1QF6 A;  2FBW B;  3P4Q B;  4N59 A;  4JX1 C;  1RYJ A;  1ROE A;  2WDV B;  3NRZ A;  3BII D;  1E0Z A;  4ZOH C;  3HVZ A;  4JWU C;  3AH7 A;  3AED B;  4N6E B;  4P6V F;  4WQM A;  1JQ4 A;  2DBY A;  1YQ3 B;  2EKI A;  4LTU A;  2HTM E;  2L83 A;  2E3T A;  1L6V A;  5EE1 A;  1NI3 A;  1QOB A;  4YSX B;  3ABV B;  2W55 A;  2Y5C A;  1XLP A;  1KF6 B;  3CWI A;  2W3R A; 
#chains in the Genus database with same CATH topology
 4RF1 A;  2WXL A;  4WQO B;  4WJN A;  3W5V B;  3T9L A;  2FIF A;  3VHT C;  3BK1 A;  3VTW A;  3ZJT A;  1TY0 A;  3A9J A;  1KLU D;  2WXJ A;  1V1O A;  2HD5 B;  3MJW A;  3SFD B;  1C4P A;  1ZDV A;  2M4N A;  1OEY J;  4US9 A;  2MHJ A;  2GRI A;  4ZYS A;  1T5X D;  2WX0 A;  1V86 A;  3ZQ4 A;  5BYR A;  1LFD A;  1JRO A;  3TJP A;  2IY1 B;  3H1U A;  4MGI E;  3KQ4 A;  1E5W A;  3NZS A;  1C78 A;  1E6E B;  2KMA A;  4J6I A;  1V9J A;  1R4M B;  5E6J A;  3ZDM C;  1L0X B;  4KX6 B;  2BVC A;  2KQ7 A;  2JF5 A;  4M0W A;  1L0Y B;  5LLI A;  4HJG E;  1XD3 B;  4YTP B;  1I4X A;  1E7V A;  2KTR B;  1CMX B;  4AOF A;  2N0S B;  4NAW A;  1M94 A;  1OTR B;  3ETR A;  1Z2M A;  4B0E A;  2LEK A;  1QQR A;  2D3G A;  2J4X A;  1HA5 A;  1L4Z B;  1AW7 A;  4DDI D;  4E3C A;  1DOX A;  1XQQ A;  2KVZ A;  3ZJU A;  2JY6 A;  3RT3 B;  1VR9 A;  1TBE A;  2KHW B;  2AQ3 B;  3PV1 A;  4NPN A;  3VQI A;  1JQ4 A;  1HE8 A;  1KLG D;  5TSS A;  2DZJ A;  1UGM A;  3CWI A;  1S1Q B;  5HI1 A;  4XZ4 A;  3KUD B;  1ZOY B;  3UI3 A;  2D3C A;  2FAZ A;  2O2V B;  3RMK C;  1TKE A;  1ET6 A;  3HM3 A;  4PT5 A;  3AE7 B;  2G4D B;  4DHZ E;  4W9E A;  1FMA D;  1QLB B;  1QOA A;  2QIL A;  5C23 A;  4LDT B;  1N60 A;  2MQJ A;  4YTN B;  3HRD D;  2LGD A;  2K22 A;  4S0R A;  2IJ0 A;  1E90 A;  4GDL B;  3ZNZ B;  3ZGZ A;  1FRD A;  1WMH B;  4JE3 B;  3EGR A;  5CHV C;  2W3S A;  2PEA A;  3HK0 A;  4C7Z A;  2LRW A;  2AWT A;  3Q2A C;  3ZKJ C;  1EU4 A;  1K51 A;  1V49 A;  5JXV A;  2GB1 A;  2M1M A;  2Y5P A;  3R7R A;  1YJJ A;  3AE5 B;  2WXR A;  4BAX A;  4RF0 A;  1FXI A;  3ALB A;  2KWC A;  3AEB B;  2GBM A;  3APF A;  2DZM A;  3A9K A;  2QIE B;  1P9D U;  1SXT A;  2JZP A;  2KN5 A;  4KDI C;  1C1Y B;  2CU3 A;  4KSL C;  3AU4 A;  3VXW A;  1KTK A;  1VLB A;  1E8Y A;  3PPA A;  3TSS A;  1CK1 A;  4ANW A;  3A4R A;  1EUV B;  3B08 A;  1N5X A;  3Q3J A;  3IT6 B;  3SDL C;  3L13 A;  2WWZ A;  4WAF A;  1IBX A;  1OQR A;  3NS8 A;  4UDU C;  1C77 A;  2RPQ A;  3R7Q A;  1WZ3 A;  3V6E B;  2LRU A;  3K9O B;  4JIO U;  3N1X C;  4BKS D;  2W3R A;  4TV3 A;  3MHZ A;  2KDB A;  2NR2 A;  5DPT A;  3GS2 A;  2J42 A;  1JWS D;  3DBR I;  4W9I A;  1J7C A;  1V5O A;  3AN1 A;  1RLF A;  2LGX A;  3PT2 B;  3SHQ A;  4B9K A;  1I7H A;  3VAW A;  3FIL B;  3BYT B;  5LXI B;  2INP E;  3CF6 E;  2C7H A;  1WR1 A;  4S17 A;  4US8 A;  4CO7 A;  3TEW A;  3KWL A;  3V60 A;  4EZL A;  4G0N B;  3RZW C;  1FRR A;  4LNN A;  1S3S G;  2FCQ A;  1L6U A;  4W9J A;  2FUH B;  1XCQ L;  1PGX A;  2NPT B;  3ZUN A;  1JCK B;  2NTS A;  3QAR A;  4W9G A;  2PKO A;  1Q1O A;  1WXS A;  2PMV A;  3DWM A;  3Q3M C;  2CR5 A;  4HPL B;  2MJE A;  4RGM A;  1IGC A;  2KDE B;  1E10 A;  3JYU A;  4IDI A;  3IG3 A;  1DYQ A;  2K6D B;  4KKI A;  3AE4 B;  2KXJ A;  4NQL B;  1YNT E;  3V6C B;  1ZUD 2;  3DVN U;  3WAN A;  2OJW A;  3GE8 C;  2B3A A;  2M56 B;  4YWG G;  3AV8 A;  3E9S A;  2OJR A;  1D6E C;  1KOT A;  3C19 A;  1NI2 A;  1RYJ A;  3KUC B;  1E0Z A;  3QA8 A;  3ZNI D;  1TY2 A;  3W1S A;  3KLS X;  4NAM A;  3C8Y A;  4HCP B;  2KWD A;  3ZLZ A;  3L08 A;  2JVC A;  2W54 A;  4GSW A;  2HTH A;  3I63 C;  3BVZ A;  1FEH A;  2QMT A;  1MI0 A;  3LJ3 A;  2NTT A;  4K81 A;  2NMQ A;  2LJ5 A;  4TMA B;  3Q14 C;  1RFK A;  2KJR A;  4FJZ A;  4YTM B;  4I6P A;  2WXH A;  3PRZ A;  2KQS A;  1I4P A;  3NHE B;  3H7S A;  5BYQ A;  1AYF A;  3T3O A;  2JQR B;  1JWA D;  2JWZ A;  3SR6 A;  1SE3 A;  1HZ5 A;  2N7D A;  1HTQ A;  1IGD A;  1NEK B;  3TIX A;  4DXG A;  2KWV B;  4DDG D;  2HJ1 A;  2PTL A;  4JGH B;  1YD8 U;  2V3N A;  1WYW B;  1C3T A;  1Y56 A;  2RDH A;  2BPS A;  1SEB D;  5GXG B;  4KSK C;  1SIF A;  2N9E B;  3HUI A;  1GAQ B;  5KHQ A;  2WDT B;  2WXO A;  2FCN A;  4N9F 4;  2XEW A;  3V61 A;  3L10 B;  2SEB D;  2MJD A;  2JXT A;  2ZCC A;  5JZE B;  5IOI A;  4C56 C;  1EO6 A;  4MSM B;  1ZKH A;  3DBH I;  2I38 A;  3VUW A;  1J8C A;  1EU3 A;  1EWY C;  2XK5 A;  2I1K A;  4LK0 M;  4MEM A;  3P4Q B;  1UD7 A;  5CX3 A;  4GN1 A;  4WWP A;  4KGT A;  1WF9 A;  2HTM E;  3Q6B A;  2I1J A;  4EZK A;  2C7N B;  1F1H A;  2IPK D;  2AL6 A;  1UBQ A;  3DCG A;  1XLP A;  1WI0 A;  4KIK A;  3MC9 A;  2L1A A;  3DBR B;  3I3T B;  2H88 B;  2LUE A;  2MBE A;  1WX8 A;  2KT7 A;  2O6V A;  1WGK A;  1DGJ A;  3CIR B;  1IUE A;  1WXQ A;  1XF5 L;  3UIN B;  2ON8 A;  4FHJ A;  2N9K A;  5BMH A;  1SSN A;  1XT9 B;  4PK1 A;  2RD0 A;  1I4R A;  4II2 B;  4K1R B;  1WE6 A;  1V2Y A;  1FPY A;  5CHF A;  2C5L C;  3ZRC A;  1N5W A;  3IAM 1;  4MJS A;  4LDT D;  4NNJ B;  3NOB A;  2SAK A;  1ENF A;  2W82 A;  3MC8 A;  2C9W B;  3AE8 B;  1ZE3 D;  3RNC C;  1F2R I;  1Y8R C;  4ICV A;  1F2R C;  2LGS A;  1VZ6 A;  2DWQ A;  2NVU I;  4NJC A;  1MFW A;  1A70 A;  1HEZ E;  4HK2 A;  1IPG A;  4YSZ B;  1EM7 A;  2XNA C;  3QIJ A;  3ZXV A;  1KLV A;  1XEE A;  3B1L X;  3MTN B;  2ZVN A;  2QSD A;  2L0T A;  5HHD G;  3IBE A;  2JPH A;  4OVV A;  2JUO A;  3BVM A;  3P63 A;  4I6N B;  1WGY A;  5L83 A;  3C0R B;  3AUL A;  4NY0 A;  1JW9 D;  4CHK A;  1YX5 B;  2HJ8 A;  4MM3 A;  3HHM A;  4RGT A;  3TL5 A;  4KGR A;  3CMM B;  2K25 A;  2BQQ A;  4WAA A;  3T3N A;  3U8Z A;  3GOE A;  2K0P A;  1QF6 A;  4JX1 C;  3DPD A;  1C9F A;  4B6W A;  3MFG A;  1ESF A;  3R3M A;  2J0K A;  2ZNV C;  1L6V A;  1ZW7 A;  5IN7 A;  4DBG A;  3GB1 A;  4B95 A;  4RM8 A;  2JU6 X;  2K8C A;  3M63 B;  2ZVO A;  1JWM D;  1B9R A;  2LMC A;  1H4R A;  1IP9 A;  1V97 A;  3ZRF A;  3RI7 C;  3QHT A;  4DXA B;  4HDQ A;  2WHI A;  2KC2 A;  2NCN A;  2K8B A;  3PHX B;  2DLB A;  2KAJ A;  3PTF C;  1YQ4 B;  3DBS A;  4MGY E;  5H8Y E;  5G55 A;  1GB4 A;  1CZP A;  4TQ1 A;  1WXV A;  3NVV A;  2CS4 A;  4J3O D;  2DYM A;  2HE7 A;  2QC8 A;  1N62 A;  4L23 A;  2WXF A;  1JRP A;  4AQ7 A;  2NBW B;  3KYD D;  2IO0 B;  3ZNH B;  1UGJ A;  1G6J A;  4EKU A;  3DVN V;  3AE9 B;  1MVK A;  3N20 C;  1E7P B;  3ZIM A;  3M62 B;  5DPS A;  2N1W A;  1SE4 A;  1P0R A;  3NZ3 A;  5CHW A;  2PJH A;  1FXT B;  2AX5 A;  3DWG C;  1L2N A;  3A9J B;  1ACC A;  4K7S A;  3DBH B;  3PSE B;  3RUL A;  3VDZ A;  2JX5 A;  2LVO A;  2CKH B;  1D3Z A;  2CU1 A;  4K7W A;  5TR5 A;  4CYE A;  2GOW A;  1HZ6 A;  5FR3 A;  4X57 B;  1J19 A;  1YOV B;  2M0A A;  4GU2 A;  2GI9 A;  4GIV A;  4JWU C;  4C4V A;  2ICI A;  1WXM A;  1D5M C;  3L54 A;  3H7P A;  2W55 A;  4WIP A;  1TGZ B;  3U7Z A;  2CHX A;  4M0W B;  1LQB A;  1TT5 B;  1E8X A;  1GOZ A;  1SJH D;  1I4G A;  2N4F A;  4L2Y A;  1Q0W B;  3NVY A;  2J52 A;  2D3B A;  2KX3 A;  1FCL A;  4BZA A;  2V9H A;  3VTV A;  1ZP0 B;  1AWD A;  3HVD A;  2MH7 A;  3VR9 B;  1CQV A;  1IYF A;  3TEZ A;  3AEE B;  2D3A A;  4ZDV A;  2WU5 B;  4ARC A;  5AEK B;  1QIL A;  1E7U A;  4GDK A;  2O2V A;  4P1C C;  4FJV B;  5E6P A;  2Y3A A;  1ZXI A;  2KDF B;  2PW9 A;  3Q69 A;  2WU2 B;  2FID A;  5JHB A;  2C7M B;  2KOX A;  2N9P C;  3DDC B;  4LNK A;  1M4V A;  1TTN A;  2Q5W D;  1SE9 A;  4WJO A;  2MRP A;  2Z0E B;  3ZTD A;  4ZYN A;  4FA6 A;  1AAR A;  2BYF A;  3PZD A;  4ANU A;  4WJQ A;  1WMH A;  3Q3N C;  4KKJ A;  4N58 A;  2WXK A;  4NZL B;  3TUO A;  3W1S C;  4G3X B;  2LI5 A;  4DWF A;  2DHZ A;  2JWU A;  2V3S A;  4C7Y A;  4OZB A;  3WIM A;  1HQR D;  2ZNV B;  2M0X A;  1FO4 A;  2K6Q A;  3OJ4 B;  4BOS C;  1KRH A;  3QJZ A;  3A1Q A;  3AB5 A;  3UIO B;  3DQV A;  2REX A;  1PDX A;  2KC1 A;  4QAY A;  2WDV B;  1P1A A;  3NRZ A;  2AL3 A;  2L3Z A;  5IAA C;  2KLG A;  2Z59 B;  2N9L A;  4GLS C;  4ACF A;  2Y5C A;  4BBN C;  1T0S C;  4FBJ B;  4DK5 A;  1RRB A;  3PO0 A;  3RUI B;  3JW0 X;  1QZE A;  5HKH A;  4CQN A;  3CSF A;  4PS3 A;  2L05 A;  3QCA A;  1SGH A;  3P2B A;  2YLM A;  4OZA A;  4WWM A;  2AYO B;  4OHJ A;  2M19 A;  3A9K B;  1GC6 A;  2WDQ B;  3EHV A;  5BMI A;  5DPW A;  4HKQ A;  1U4A A;  3R2I A;  3PRP B;  4G50 A;  3BYY B;  1FXA A;  2UYZ B;  1PFD A;  4TKN A;  4WJP A;  4LCD E;  4O1N A;  1IBX B;  2WXM A;  2IZV B;  3PRM B;  4F7Z A;  2FNJ B;  2D11 A;  3W1Y A;  3RNB C;  2Y5B B;  4HJK A;  1QT9 A;  1V8C A;  1NEN B;  5T8I A;  4JPS A;  5EE0 A;  2LHD A;  1YN5 A;  3AM9 A;  1TS4 A;  1MPE A;  4M00 A;  2JRI B;  1PUT A;  3NVZ A;  3X0W A;  1K50 A;  3VH4 B;  2KO3 A;  3ZO5 B;  1F0Z A;  2RGF A;  3UQB A;  2LGY A;  2IO1 B;  3QK0 A;  1BXT A;  1GG3 A;  4A55 A;  2BBC A;  1L4D B;  1D4B A;  3I5J C;  2EEL A;  4AP4 C;  4IWQ A;  2WXP A;  3LDZ E;  3DHG C;  4BFR A;  2LUM A;  2JYE A;  3EFC A;  3SU8 X;  1NVI D;  5IP4 D;  4REZ A;  3W5U B;  3U7D A;  4ASW C;  1J0G A;  3QX1 A;  4BKG A;  2IGD A;  3TEX A;  4L1B A;  4ZRK A;  1T0R C;  4ICU A;  3AEC B;  2LD9 A;  3S2A A;  4KDL B;  2G9H D;  5EE1 A;  2E3T A;  2BGF A;  1SJE D;  1F9J A;  1BUI C;  1KM7 A;  3AEG B;  2I2Y A;  5LNK 1;  5LXH A;  1E8W A;  4P1B C;  2WXG A;  4JWS C;  2BKR B;  1T0Y A;  1UEL A;  1PGA A;  5EE3 A;  1WH3 A;  1SIJ A;  5EE9 A;  2NBU A;  2ZJD A;  2K1F A;  2LZ6 A;  1JAL A;  1K8R B;  3ZTC A;  1SBB B;  4MEL A;  3SEB A;  3TCA A;  2DX5 B;  3VVW B;  4ANX A;  4BOZ B;  1UZX B;  3PS6 A;  4WWN A;  4A90 A;  4XYC A;  4NQK E;  1FNV A;  2KDI A;  2DZK A;  3N1Y C;  2VH1 A;  1UF0 A;  3CST A;  2LGI A;  5D3D A;  1MHX A;  2N9X A;  1UH6 A;  2CHW A;  4W9F A;  2NBV B;  1KH0 A;  2MWS B;  3VTU A;  1FCC C;  2LHE A;  5J17 A;  1VZ8 A;  3AE6 B;  2IGH A;  4WUR A;  1MG4 A;  2V4L A;  1NDD A;  1YQB A;  3V3X A;  1WM3 A;  1R7S A;  1VCB A;  4ZHO A;  4GGQ A;  2X8X X;  2D2Q A;  2GBN A;  4ZHP A;  3NS1 A;  5C3J B;  4TUU A;  4IW0 A;  2ZZP B;  1K52 A;  2UWQ A;  2RDG A;  5FR6 A;  4E71 A;  2ACZ B;  1H8C A;  2WP9 B;  2DEN B;  3Q8A A;  1FD6 A;  4EOY A;  1NBF C;  1V1P A;  2KZR A;  4LLG M;  4HVB A;  3MJ5 A;  2X38 A;  4C80 A;  3V05 A;  4N59 A;  5IKC M;  3APC A;  3RNF C;  2BWF A;  4LTU A;  4FN2 A;  2R2O A;  2N1V A;  4PS8 A;  2LVP A;  3Q3F A;  1WX9 A;  3EA6 A;  5D6J B;  2ZEQ A;  3WAO A;  3KWV A;  1GJZ A;  1PQS A;  2E6X A;  3PGE A;  2V1Y A;  1T6B X;  2RMM A;  4HPP A;  4XDD A;  1LM8 B;  1VDV A;  3LB8 C;  3QWZ B;  2JRH A;  2WDR B;  4XC2 A;  5BO4 B;  2K5P A;  1EF1 A;  2BYE A;  3AEF B;  2INC C;  2OOB B;  5MPO A;  3NG0 A;  1C76 A;  3ECI A;  2G45 B;  1I4H A;  1WGD A;  4IOI E;  3BZD B;  3DVG Y;  2BT6 A;  2CJN A;  3N3K B;  1QOG A;  1YN4 A;  2RPV A;  2XK5 B;  5JHA A;  3IVF A;  3R2T A;  4HEA 1;  3VUY A;  4RGO S;  1TS3 A;  1JWB D;  1ET9 A;  3L4P A;  4BKS A;  3QC8 B;  4WWO A;  1Z5S B;  2K9X A;  3U30 A;  3FC4 A;  1C79 A;  2IBI B;  2RR9 A;  4KIK B;  5G5H A;  2LAS A;  2KFK A;  2M8S A;  4MGK E;  2O6V B;  4HXD A;  2L76 A;  1L5P A;  2G4S A;  2QCZ A;  2BKF A;  2J0M A;  2B76 B;  1OQQ A;  2PE9 A;  2MP2 A;  3RYT A;  2INN E;  1YN3 A;  5D7G A;  4EFO A;  4H2A A;  4EE2 A;  4MJS B;  4P16 A;  2A5U A;  1WYG A;  3GZN I;  3JSV A;  2C60 A;  2FUG 1;  4F1S A;  4KZ0 A;  4N6E B;  1WJU A;  5EDS A;  4GMV A;  3QQ8 B;  1C4A A;  1P7E A;  2V4I B;  3RFZ B;  3ABV B;  1T0Q C;  2BF8 B;  2UU7 A;  1JML A;  4IC7 B;  4ITK A;  4TQ0 A;  1XXG A;  2KMC A;  3B2G A;  4EZJ A;  4RH6 A;  2K39 A;  2L8J A;  2R2Q A;  1R4N I;  4MAC A;  3BWU D;  2BB6 A;  3L0W B;  3VFK A;  4K7U A;  4B0M A;  3AMZ A;  1FIQ A;  1WIA A;  3B0A A;  1YJI A;  1P3Q U;  1LO5 D;  2IND C;  1WGR A;  3A4S C;  2LWP A;  4A20 A;  2K3U A;  2KYW A;  3N1Z C;  1I42 A;  4LNI A;  3PZ8 A;  4RGN A;  1V5T A;  5HG2 A;  2JYT A;  2MW5 A;  3RPF C;  4LNO A;  4A9A A;  1LXD A;  1LGR A;  1L0V B;  2L52 A;  2VZK B;  4DHZ B;  5AUK A;  2BS3 B;  2BS4 B;  3H6N A;  3GE3 C;  3V62 A;  4MH8 A;  4DQO C;  3U52 E;  3VRB B;  5AZG A;  2DAF A;  2WXI A;  4XE0 A;  2IGG A;  1JWU D;  2J7Q B;  2L00 B;  3SD5 A;  1QOF A;  2AQ1 B;  2KN4 A;  2FBW B;  3PHW B;  3RNA C;  2JXX A;  1TIF A;  3DOW A;  2EKI A;  1TZO A;  2L83 A;  3ML8 A;  3ZXR A;  4JLC A;  1WSP A;  1I4Q A;  3WA0 A;  3LXF A;  2LXA A;  2ZPN A;  4IM2 A;  2WXN A;  4MT5 A;  2KTR A;  2MBQ A;  2KAC A;  4LNF A;  2HDE A;  3TMP B;  5IA7 A;  3I9V 1;  1TKG A;  4ANV A;  3RZF A;  3BK2 A;  3BY4 B;  2BWE S;  1PGB A;  2EKE C;  4HCN B;  4C00 A;  2KWU B;  3IHP C;  4LJP B;  1UWM A;  2AQ2 B;  2DNF A;  2FCS A;  1I35 A;  2BTE A;  3Q8E A;  4XX5 A;  2WYQ A;  4C4V B;  1KJT A;  4NAW B;  1TS2 A;  4XGA B;  5BYS A;  2RDB C;  3H7P B;  3KUZ A;  1X1M A;  4OW0 A;  2ZW0 A;  2V3P A;  4FXC A;  2GBR A;  2YEP B;  1RM6 C;  2KTF A;  3EFU A;  3U2S C;  3MHS D;  3BIN A;  3B9J A;  3I57 A;  1F52 A;  2M17 A;  3N9Y C;  1FNW A;  2CJO A;  4FLH A;  5AUI A;  2JZ3 B;  3AXC A;  3GZN B;  4A3O A;  4NJ7 A;  1WRD B;  4II3 B;  4DXF A;  3EUB 2;  2NS5 A;  4MH0 E;  4RFB A;  4GDK B;  2KVR A;  4MSQ B;  1OFF A;  2PIA A;  4GDL A;  3R66 C;  4W9K A;  4BBN F;  1ROE A;  3BII D;  3PZ7 A;  4ZOH C;  2OED A;  3HIZ A;  5CTR C;  4HLE A;  1YMH E;  3AI5 A;  4FHK A;  3UIP B;  1L7Y A;  1D5X C;  3NY5 A;  2DAJ A;  2IO2 B;  3AU5 A;  1ZXH A;  1GB1 A;  2WS3 B;  1R4N B;  2ONQ A;  3KVF B;  1VRA B;  5JH5 C;  4KV2 A;  2WXQ A;  4KZC A;  3MC0 B;  3ZYY X;  4GOC A;  4E74 A;  1TZ1 A;  1UWX A;  1WM2 A;  2FE8 A;  2KK8 A;  3J9C A;  2DYB A;  3KH0 A;  3X23 A;  4ARI A;  4BVU C;  3TEY A;  3O65 B;  2KMM A;  3DBL I;  3KYC D;  2JT4 B;  3A1Q B;  4GXB A;  2QJL A;  3Q8C A;  4HWI B;  2G1E A;  3UF8 A;  1P98 A;  2QHO A;  5J18 A;  3TBL D;  1WJ6 A;  2KD0 A;  4XWT A;  5HFY A;  3M95 A;  3WAL A;  2ZCB A;  2IO3 B;  3RN9 C;  4RMA A;  2O6V D;  1GPX A;  1AN8 A;  1GC7 A;  3ZDT A;  2PVO D;  2GBJ A;  4ZRJ A;  2WX1 A;  2L7R A;  1WGH A;  2ZPY A;  1BML C;  3FIL A;  1A5R A;  1XLQ A;  2YVC A;  2Z8L A;  3GP7 A;  3RNE C;  4AWJ A;  4M01 A;  1WR6 E;  1XLO A;  2IY0 B;  3AE2 B;  2MBO A;  2MBH A;  2LJI A;  2L0F A;  2QEJ C;  3MP9 A;  2V0G A;  4W9H A;  1WY8 A;  4W9L A;  1V6E A;  1HXY D;  2GMI C;  3HVZ A;  3OAW A;  1WGG A;  5D94 A;  3AED B;  3OLM D;  4P6V F;  4KGS A;  2WNM A;  4RCO A;  3QAQ A;  4DHJ D;  5E6N A;  1FNU A;  2RSU A;  5FK9 C;  4ZRI A;  1K53 A;  2D5G A;  3URY A;  4OZC A;  4ZRQ A;  2EMT A;  2ASQ A;  4YL8 A;  2NPT A;  1OEY A;  1SB3 C;  1TJE A;  4A8X C;  4IM3 A;  1WXA A;  5I4D A;  4JL9 A;  1HTO A;  1GUA B;  1KFY B;  3OJ3 A;  5GMV A;  3NVW A;  4MGZ E;  5L95 C;  2KDM A;  4LJO B;  4FUL A;  3U4E G;  1ZDX A;  4M02 A;  2FCM A;  4IKG A;  4GB9 A;  3VRA B;  2G3Q B;  3JVZ X;  4NJ6 A;  3ZNG C;  1Q10 A;  1N6Z A;  1XO3 A;  2OHF A;  2WQY B;  1F77 A;  3VR8 B;  2BYV E;  1V80 A;  3R8B A;  3Q8F A;  4W9D A;  1BT0 A;  2XN9 C;  1QKZ A;  2BB5 A;  1RFA A;  1YIW A;  1CJE A;  2PVG C;  2N7J A;  3P4R B;  4HRO A;  3ZW3 A;  2PPH A;  1B1Z A;  2K8H A;  2MX2 A;  1C4C A;  1MHH E;  1TKY A;  1TYG B;  3PLV A;  3D32 A;  4XDC A;  2VZK D;  4RNA A;  3AEA B;  2KJ6 A;  1Q5W B;  1WE7 A;  4MDK E;  4Q2J A;  5G5G A;  1FFU A;  1FM0 D;  3AE3 B;  4W9C A;  1RAX A;  4P7I A;  4HDO A;  1FFV A;  1WWT A;  2DZI A;  5D2M B;  5DCN A;  4EEW A;  2KKC A;  1WJ4 A;  4PYZ A;  2DBY A;  1YQ3 B;  2MEK A;  4YSX B;  1QOB A;  3K9P B;  2MBB B;  1KF6 B;  3IFW B;  1T3Q A;  1VJK A;  1UUP A;  3FAH A;  3KW5 B;  4F8C B;  2AEH A;  1PYW D;  1NYQ A;  2BW2 A;  1NYR A;  2H89 B;  3WCQ A;  3IT4 B;  4M8N A;  1YX6 B;  2XBB C;  3DBL B;  1WZ0 A;  3Q8B A;  3WAM A;  1V81 A;  2BS2 B;  3N30 A;  1XCT L;  3H8H A;  2PE6 B;  2GBK A;  4KVG B;  2KX0 A;  4M8M A;  4EUT A;  1ZGU B;  3W2D A;  2W9N A;  3OWE B;  1V1P B;  4HKZ E;  1GNU A;  4HRS A;  5J2R A;  3L17 A;  3FKY A;  2LXC A;  4URK A;  4K3C A;  2IYD B;  1YJ1 A;  2KQ4 X;  1TS5 A;  3SFE B;  4G11 A;  2JSV X;  3IXS A;  3Q3O C;  2KJH B;  2KFJ A;  4PYU A;  4K3B A;  1J7B A;  3W9C B;  2CHZ A;  3RNG C;  2DYO A;  2L32 A;  3VUX A;  2YEP F;  1R4M I;  3PVL A;  2VH2 A;  2D07 B;  3ONS A;  3P42 A;  4HPM B;  1DOY A;  1DOI A;  2QDF A;  1MJD A;  1XLN A;  4ZRP A;  1P7F A;  3ENE A;  2VRR B;  1N61 A;  5AZF A;  5C2T B;  3IAS 1;  1J7A A;  1UBI A;  1STE A;  4OVZ A;  3M3J A;  1SE2 A;  3NUH B;  1WRI A;  3PLU A;  3HM6 X;  5G2N A;  3DHH C;  3UQA A;  1JRU A;  2EMS A;  5DPR A;  1EWC A;  4TSS A;  3APD A;  3PRE A;  1D5Z C;  3WAP A;  1WJN A;  1WFY A;  1UNS A;  4I6L B;  3AE1 B;  2KFK B;  4OVU A;  2KLC A;  2TSS A;  3O13 A;  3UGB B;  3T8M A;  3ML9 A;  3P4S B;  2IDY A;  2R61 A;  2MJ3 A;  2A4Z A;  4DHJ B;  2N7E A;  4AUQ C;  5H92 C;  2KNB A;  2GLS A;  3DHI C;  2MP2 B;  4YXD B;  1E9M A;  1VZ7 A;  4IWO A;  4R3D A;  1ZPS A;  4XWW A;  2BYT A;  2JZZ A;  1WX7 A;  2MCN B;  4WH4 A;  1OQY A;  2ZW1 A;  3ZVV A;  3L16 A;  3P4P B;  3JSV B;  5D3I B;  4FAD A;  3NZU A;  5C1Z A;  2WLB A;  2WGS A;  3B2F A;  2PLP A;  4MM3 B;  5FKA C;  3BVG A;  2MA9 B;  4YSY B;  4PS7 A;  3LYY A;  4YT0 B;  3A33 B;  3RCZ A;  4IM0 A;  3NJT A;  3RD2 A;  1N63 A;  4A6Q A;  5BMG A;  2KAN A;  4D2K A;  2J53 A;  4IG7 B;  4A3P A;  3N32 A;  2J0J A;  1OGW A;  3P1M A;  3VH3 B;  5E6O A;  1RWS A;  4AS1 A;  5KHO A;  1ISN A;  4BKT A;  4IWP A;  1MG8 A;  4USA A;  4AJW A;  4FJY A;  2LFI A;  2LVQ A;  3DVG X;  4IUM B;  3ZJV A;  1SF0 A;  3OG5 A;  2MLB A;  3E56 A;  2MSE D;  1EF5 A;  2Z0D B;  3EC8 A;  4RM9 A;  3EEC A;  3AH7 A;  4JQW C;  4WQM A;  5IO9 A;  1E8Z A;  1NI3 A;  4AJY B;  3H9D A;  2D10 A;  1VD2 A;  5AZH A; 
#chains in the Genus database with same CATH homology
 2H88 B;  3AEG B;  4RF1 A;  2I2Y A;  1ZXH A;  2WXL A;  5LNK 1;  3W5V B;  1WGK A;  1GB1 A;  1DGJ A;  2WS3 B;  3CIR B;  1IUE A;  3BK1 A;  2ONQ A;  1WXQ A;  1VRA B;  1XF5 L;  2WXG A;  4JWS C;  3ZJT A;  2ON8 A;  1TY0 A;  2WXQ A;  1KLU D;  3ZYY X;  3MC0 B;  1PGA A;  5EE3 A;  2N9K A;  2WXJ A;  1SIJ A;  5BMH A;  5EE9 A;  1SSN A;  1V1O A;  1JAL A;  1I4R A;  3SFD B;  1SBB B;  1C4P A;  3SEB A;  1UWX A;  2FE8 A;  1ZDV A;  3J9C A;  4ARI A;  4US9 A;  4A90 A;  2GRI A;  4ZYS A;  1FNV A;  1N5W A;  1T5X D;  3TEY A;  3IAM 1;  3ZQ4 A;  2SAK A;  5BYR A;  2KMM A;  1ENF A;  1JRO A;  2W82 A;  2LGI A;  5D3D A;  1MHX A;  3AE8 B;  2QJL A;  3Q8C A;  1ZE3 D;  1F2R I;  2G1E A;  1F2R C;  3KQ4 A;  1VZ6 A;  2DWQ A;  1C78 A;  1E6E B;  4NJC A;  1KH0 A;  5E6J A;  1L0X B;  4KX6 B;  1A70 A;  1HEZ E;  4M0W A;  1FCC C;  1L0Y B;  2LHE A;  1EM7 A;  4HJG E;  4YSZ B;  2XNA C;  1VZ8 A;  4XWT A;  4YTP B;  5HFY A;  1XEE A;  2QSD A;  1I4X A;  5HHD G;  3AE6 B;  2IGH A;  4WUR A;  3V3X A;  1R7S A;  4ZHO A;  1GPX A;  1AN8 A;  3BVM A;  3P63 A;  2PVO D;  2N0S B;  4ZHP A;  3NS1 A;  5C3J B;  1JW9 D;  3ETR A;  1K52 A;  1BML C;  3FIL A;  4B0E A;  2LEK A;  2RDG A;  1XLQ A;  3GP7 A;  1QQR A;  2Z8L A;  2ACZ B;  4RGT A;  2J4X A;  2WP9 B;  1HA5 A;  1L4Z B;  3Q8A A;  4KGR A;  1FD6 A;  1AW7 A;  1XLO A;  1V1P A;  3AE2 B;  4LLG M;  1DOX A;  3T3N A;  2LJI A;  3MJ5 A;  2X38 A;  3ZJU A;  2K0P A;  2QEJ C;  4C80 A;  1QF6 A;  3MP9 A;  2V0G A;  1VR9 A;  3V05 A;  4N59 A;  4JX1 C;  2AQ3 B;  1C9F A;  1HXY D;  3MFG A;  1ESF A;  3HVZ A;  3AED B;  4P6V F;  3VQI A;  1JQ4 A;  4KGS A;  2WNM A;  4LTU A;  4RCO A;  1L6V A;  1KLG D;  5TSS A;  3GB1 A;  3CWI A;  5HI1 A;  2JU6 X;  1FNU A;  3EA6 A;  5FK9 C;  1JWM D;  1K53 A;  2D5G A;  3URY A;  1B9R A;  1ZOY B;  4OZC A;  3UI3 A;  4ZRQ A;  2LMC A;  3KWV A;  2E6X A;  1TKE A;  1ET6 A;  1SB3 C;  1TJE A;  4A8X C;  1T6B X;  2RMM A;  4PT5 A;  5I4D A;  3AE7 B;  4XDD A;  1V97 A;  1VDV A;  3LB8 C;  1FMA D;  1KFY B;  2WDR B;  2K5P A;  1QLB B;  3AEF B;  3NVW A;  5MPO A;  1C76 A;  1QOA A;  2KDM A;  2QIL A;  2DLB A;  2KAJ A;  3U4E G;  1YQ4 B;  1I4H A;  1N60 A;  4IOI E;  1ZDX A;  3BZD B;  2BT6 A;  2CJN A;  4IKG A;  5H8Y E;  1QOG A;  4YTN B;  1CZP A;  4TQ1 A;  1GB4 A;  3VRA B;  3HRD D;  1YN4 A;  3NVV A;  2RPV A;  4J3O D;  2DYM A;  1N62 A;  1Q10 A;  4L23 A;  2K22 A;  2IJ0 A;  3R2T A;  1XO3 A;  2OHF A;  2WQY B;  4GDL B;  2WXF A;  4HEA 1;  1F77 A;  3ZGZ A;  4RGO S;  1JRP A;  1TS3 A;  1FRD A;  1JWB D;  3R8B A;  3VR8 B;  1ET9 A;  3L4P A;  4JE3 B;  3Q8F A;  4AQ7 A;  3EGR A;  2W3S A;  2XN9 C;  1QKZ A;  4C7Z A;  2BB5 A;  2K9X A;  1EU4 A;  1K51 A;  1CJE A;  1UGJ A;  3FC4 A;  2PVG C;  1C79 A;  2N7J A;  3P4R B;  4HRO A;  5JXV A;  2GB1 A;  3AE9 B;  1MVK A;  2Y5P A;  1E7P B;  5G5H A;  1YJJ A;  3AE5 B;  2WXR A;  4RF0 A;  1B1Z A;  1FXI A;  3AEB B;  1C4C A;  1SE4 A;  3NZ3 A;  1MHH E;  2QIE B;  1TKY A;  1SXT A;  2AX5 A;  1TYG B;  3DWG C;  2JZP A;  1ACC A;  1L5P A;  4XDC A;  2VZK D;  4RNA A;  2CU3 A;  2B76 B;  3AEA B;  2JX5 A;  1OQQ A;  1KTK A;  1VLB A;  3TSS A;  4Q2J A;  2INN E;  1FFU A;  1FM0 D;  1YN3 A;  5G5G A;  1CK1 A;  3AE3 B;  5D7G A;  4H2A A;  4EE2 A;  1N5X A;  3IT6 B;  1HZ6 A;  4P16 A;  1FFV A;  1WWT A;  4WAF A;  1IBX A;  5FR3 A;  1OQR A;  4UDU C;  1WYG A;  1C77 A;  2M0A A;  2FUG 1;  2GI9 A;  4JWU C;  4N6E B;  2DBY A;  2ICI A;  1YQ3 B;  1D5M C;  2MEK A;  4YSX B;  1C4A A;  1P7E A;  1QOB A;  2V4I B;  3ABV B;  3RFZ B;  2W55 A;  4WIP A;  3U7Z A;  1KF6 B;  2W3R A;  3MHZ A;  1GOZ A;  1SJH D;  1I4G A;  1JML A;  1T3Q A;  1VJK A;  1UUP A;  4L2Y A;  3FAH A;  3NVY A;  2J52 A;  4ITK A;  3GS2 A;  1PYW D;  1FCL A;  1NYQ A;  2J42 A;  2BW2 A;  1NYR A;  4TQ0 A;  1XXG A;  1JWS D;  2H89 B;  3WCQ A;  1ZP0 B;  3B2G A;  1AWD A;  3IT4 B;  4RH6 A;  3HVD A;  2MH7 A;  3Q8B A;  1J7C A;  3AN1 A;  3VR9 B;  1CQV A;  3TEZ A;  2BS2 B;  3AEE B;  1I7H A;  3FIL B;  1XCT L;  3H8H A;  2WU5 B;  4MAC A;  3BWU D;  4ARC A;  3BYT B;  1QIL A;  2BB6 A;  2INP E;  4B0M A;  3AMZ A;  1FIQ A;  3W2D A;  3OWE B;  1V1P B;  4HKZ E;  1YJI A;  4HRS A;  1LO5 D;  2Y3A A;  4US8 A;  1ZXI A;  2PW9 A;  3Q69 A;  2WU2 B;  3TEW A;  3KWL A;  2K3U A;  2KQ4 X;  1M4V A;  1TS5 A;  3SFE B;  1FRR A;  2JSV X;  3IXS A;  2Q5W D;  3PZ8 A;  4RGN A;  1L6U A;  1J7B A;  1XCQ L;  5HG2 A;  3W9C B;  1PGX A;  2JYT A;  3RPF C;  2DYO A;  2L32 A;  4A9A A;  1JCK B;  2NTS A;  2YEP F;  1L0V B;  1DOY A;  2PKO A;  3P42 A;  2L52 A;  2VZK B;  1DOI A;  4KKJ A;  1XLN A;  2PMV A;  3DWM A;  2WXK A;  4N58 A;  1P7F A;  4NZL B;  4ZRP A;  5AUK A;  3TUO A;  1N61 A;  2BS3 B;  5C2T B;  2MJE A;  4RGM A;  1IGC A;  3IAS 1;  1E10 A;  2BS4 B;  2JWU A;  1J7A A;  4IDI A;  4C7Y A;  1DYQ A;  1STE A;  4OZB A;  4OVZ A;  1HQR D;  4KKI A;  3AE4 B;  4MH8 A;  1SE2 A;  3NUH B;  3U52 E;  4DQO C;  1YNT E;  3VRB B;  1FO4 A;  1WRI A;  1ZUD 2;  2WXI A;  1KRH A;  4XE0 A;  2IGG A;  1JWU D;  3AB5 A;  1EWC A;  1PDX A;  1QOF A;  2AQ1 B;  2KN4 A;  2M56 B;  3AV8 A;  3E9S A;  2FBW B;  4TSS A;  1D6E C;  4YWG G;  1D5Z C;  1RYJ A;  2WDV B;  3NRZ A;  1E0Z A;  2EKI A;  1TZO A;  2N9L A;  4GLS C;  2L83 A;  1TY2 A;  1UNS A;  2Y5C A;  3W1S A;  3KLS X;  4NAM A;  1WSP A;  3C8Y A;  3PO0 A;  2KWD A;  1I4Q A;  4CQN A;  3LXF A;  2W54 A;  2WXN A;  3AE1 B;  4MT5 A;  2L1A A;  3BVZ A;  1FEH A;  4OZA A;  4WWM A;  2QMT A;  2TSS A;  1MI0 A;  3O13 A;  4OHJ A;  2NTT A;  2M19 A;  2KAC A;  2NMQ A;  2HDE A;  2IDY A;  2WDQ B;  3P4S B;  2R61 A;  2MJ3 A;  5BMI A;  3I9V 1;  1TKG A;  4HKQ A;  3R2I A;  4TMA B;  1RFK A;  4YTM B;  5H92 C;  3BK2 A;  4YXD B;  1PGB A;  2WXH A;  3BYY B;  1E9M A;  1VZ7 A;  4R3D A;  4XWW A;  1ZPS A;  1FXA A;  2BYT A;  1I4P A;  1PFD A;  5BYQ A;  4O1N A;  1AYF A;  3T3O A;  2JQR B;  1JWA D;  2WXM A;  1UWM A;  2AQ2 B;  4WH4 A;  3SR6 A;  1IBX B;  2ZW1 A;  1SE3 A;  1HZ5 A;  3P4P B;  2BTE A;  1IGD A;  1NEK B;  3Q8E A;  5D3I B;  4DXG A;  1QT9 A;  1V8C A;  4NAW B;  1NEN B;  1TS2 A;  5T8I A;  4JPS A;  2PTL A;  5EE0 A;  5BYS A;  2LHD A;  1YN5 A;  3AM9 A;  1TS4 A;  2WLB A;  1MPE A;  3B2F A;  4OW0 A;  2PLP A;  2V3N A;  2ZW0 A;  2V3P A;  4FXC A;  1PUT A;  3NVZ A;  4MM3 B;  1Y56 A;  2RDH A;  2YEP B;  5FKA C;  1K50 A;  1RM6 C;  3BVG A;  1SEB D;  5GXG B;  1F0Z A;  3U2S C;  4YSY B;  3LYY A;  4YT0 B;  3B9J A;  3HUI A;  1GAQ B;  1BXT A;  4A55 A;  2BBC A;  1L4D B;  2WXO A;  1D4B A;  1N63 A;  3I57 A;  4A6Q A;  5BMG A;  3N9Y C;  4D2K A;  2EEL A;  2J53 A;  1FNW A;  2CJO A;  2WXP A;  5AUI A;  2SEB D;  2LUM A;  3P1M A;  2JYE A;  2MJD A;  2JXT A;  1RWS A;  1NVI D;  4DXF A;  4AS1 A;  3EUB 2;  4REZ A;  3W5U B;  4RFB A;  2IGD A;  3TEX A;  4C56 C;  4USA A;  4GDK B;  4L1B A;  2LFI A;  2I38 A;  1EU3 A;  1EWY C;  1OFF A;  3ZJV A;  1SF0 A;  4LK0 M;  2PIA A;  3AEC B;  3E56 A;  3P4Q B;  1ROE A;  3BII D;  3PZ7 A;  4ZOH C;  3AH7 A;  4KGT A;  2OED A;  4WQM A;  2G9H D;  5EE1 A;  2HTM E;  2E3T A;  1NI3 A;  1YMH E;  1SJE D;  2IPK D;  1XLP A;  1D5X C;  1BUI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...