2Y5KA

Orally active aminopyridines as inhibitors of tetrameric fructose 1,6- bisphosphatase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Orally Active Aminopyridines as Inhibitors of Tetrameric Fructose-1,6-Bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
total genus 103
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2y5kA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2y5kA02
1YXIA 3D1RA 3LV0A 1Q9DA 1FBCA 4I3EA 1XI6A 1IMCA 2QVVA 1IMAA 5J16A 1FBDA 1FPLA 2WBBA 2PCRA 4GBVA 1D9QA 3BIHA 5LDZA 1RDYA 1FBPA 1K9YA 1NUWA 4GWZA 2HHMA 2OWZA 1BK4A 1NV3A 4IR8A 1NV0A 4GWWA 1NV7A 2CZKA 1FPGA 2QFLA 2FBPA 2WBDA 1EYJA 5F24A 4GX4A 3RPLA 2Q74A 4O7IA 1IMDA 3QMFA 3KC1A 4HE2A 1NV5A 1RDZA 2JJKA 1NV4A 3T0JA 5EQ9A 5EQ8A 4I3YA 1FPIA 1FBFA 2QVRA 4KXPA 2VT5A 3A29A 4GWYA 1IMBA 1FJ6A 5IZ1A 2R8TA 1SPIA 1INPA 2FIEA 5ET7A 5EYGA 4AS5A 1KA0A 1EYKA 2P3VA 1FPJA 1IMFA 1NI9A 1LBVA 1EYIA 1RDXA 3IFAA 4HE0A 3ROJA 4PTKA 1KA1A 1NUXA 2OX3A 5FBPA 1FBEA 2P3NA 3IFCA 1FTAA 5IZ3A 1G0HA 1NUYA 1JP4A 2F3DA 5DW8A 5ET8A 3LUZA 4GBWA 4GWUA 1IMEA 2DDKA 4H46A 1LBWA 1FPDA 1VDWA 3RYDA 1YYZA 1FJ9A 4MJOA 1G0IA 3KC0A 2FHYA 5EQ7A 2BJIA 5EYHA 3KBZA 1AWBA 1DK4A 1DBZA 3FBPA 1NV6A 5I3SA 1FSAA 1LBYA 4QXDA 2FIXA 4N81A 1DCUA 5ET6A 1FBGA 1FPKA 3B8BA 3BIGA 5A5LA 2CZHA 1LBXA 1NV2A 4GWSA 4GX6A 1FBHA 1YZ0A 5ESYA 5IZ3B 4HXVA 1KZ8A 1CNQA 5ET5A 1FPEA 1FPBA 2Q8MA 1LBZA 4G61A 2CZIA 2GQ1A 5EQAA 4HE1A 1LEVA 2QVUA 4GWXA 2WEFA 2Y5LA 1K9ZA 4I40A 1FRPA 1NV1A 1NUZA 2FVZA 1QGXA 5T3JA 4GX3A 1FPFA 4H45A 3RPLB 4AS4A 2F3BA 2Y5KA 4FBPA
chains in the Genus database with same CATH superfamily
3G3KA 3E79A 4QSEA 4OWDA 1PB7A 4YB7A 1LAXA 4ONYA 1USYE 3TYHA 3SESA 2HZKA 4PE3A 4TQUQ 4OVPA 1JW4A 1FTMA 1B3HA 2PVUA 2XXHA 4RY1A 3IB0A 3FVGA 3LSWA 1FTKA 2VD3A 4OFOA 1LFHA 3THIA 5DT6A 3MP1A 4OERA 2RCBA 4N07A 2ZZWA 3ZS6A 2XA5A 3UORA 4R72A 5CBSA 2V3TA 4F3PA 2B3BA 1MQHA 2HXWA 2FIEA 4F22A 3H7MA 3M3LA 1QKAA 2V4CA 4KCCA 5I7IA 2CEXA 1KA1A 3FXBA 1M5BA 1VSOA 1LCFA 1SYIA 1IXIA 2XXQA 3KOTA 4IO3A 3S9LC 4IGRA 2VPNA 1LBWA 1FJ9A 3T9XB 3FGSA 2GHAA 3FBPA 4LA9A 4MX6A 4QXDA 1GV8A 2PBWA 3RGYA 4OVRA 1NV2A 2ESNA 4LP2B 4U4XA 1DOTA 3EHTA 5ICTA 2DQVA 3T1BA 2THIA 1I6AA 1MDP1 2D3IA 4QFNA 4ND9A 3G3FA 1B5HA 3M8UA 5IGAA 3FASA 5L9MA 5F7VA 1TXFA 5IZZA 3EPEA 2O7IA 1MXVA 4JXIA 1JEUA 2Z8EA 4HCYA 4JWXA 1M5CA 3MW0A 4N15A 1BKAA 3IOVA 1CE2A 1XT8A 2ZYMA 1FBPA 2HFBA 3A3CA 3FV2A 4YKJA 5K2YA 1FQFA 5L9SA 4QFLA 5I57A 4WEDA 3RT6B 5IAIA 2GHBA 4LN5A 1LGBC 3V89B 2JJKA 2PYYA 4JDFA 3IJXB 4OVSA 1NNPA 3IOTA 3VDFA 3WAEA 2UVHA 1NNKA 1IIWA 1MQDA 2I3WA 4HTGA 1N0TA 2AL4A 1A99A 4HE0A 3A09A 1MQJA 3GYYA 2F35A 1LBBA 1ZU0A 2I4BA 1NUYA 3DELB 1JP4A 5K2XA 4OVTA 3G3JA 1ZTYA 4PP0A 4POXA 3K01A 3N94A 2Z23A 3KC0A 3MC2A 1O7TA 1N3XA 4F3GA 3E4RA 1EU8A 1B32A 4GWSA 3FVOA 1RKMA 1BLFA 3PD8A 5ESYA 1KZ8A 1JW5A 1B0LA 1YPNA 4AB6A 1PB9A 3T22A 1S9TA 3CRBA 2A5TA 3PPRA 3GLBA 2Q2AA 1OQHA 4RNSA 5T3JA 2DSFA 4XKNA 2OWTA 3RPLB 4KYSA 4BDNA 3BBRA 1YTVA 2B3FA 3PD9A 1Q9DA 4ZS9A 2O1MA 2RINA 3FATA 4MHFA 5DEXB 5CC2A 3HO7A 4OEVA 3VLUA 5M2VA 1J1NA 1B58A 4ZECA 2R9JA 3TPAA 2H99A 3T66A 4Q8RA 3MVZA 4YZZA 4KXPA 4NEDA 1R9QA 3KSXA 2AIXA 1FQEA 2IEEA 4JWOA 3PMWA 4N8GA 5EYGA 2XX8A 2PMSA 1N76A 4LATA 1Q1KA 3A3UA 3EHUA 1NI9A 3UK4A 5I56B 3OEMA 2X7PA 1G0HA 4P11A 3MAMA 3LBSA 1LAFE 4JB7A 5H8NA 2L5VA 4R2FA 4X04A 1A8FA 3MJNA 3V8XB 2F34A 4F18A 1D9VA 3VLWA 5CM6A 4N17A 3FJMA 3O29A 3DP8A 5ITPA 4HXVA 2XXYA 4FJPA 1F9BA 3MBPA 5ELVA 2WEFA 4BDRA 2HXRA 2XXPA 1URSA 4H45A 1I69A 1IXCA 2ONKE 3RUMA 2F3BA 3OXNA 3H6TA 3FIRA 3LV0A 3U92A 4H5FA 4I3EA 3EN3A 1FPLA 1D9QA 1CB6A 3AXFA 3QAXA 1XVYA 1ANFA 4ZEFA 4XFEA 2UVJA 4JVDA 3L6HA 1B0HA 2QFLA 5B70A 4ELPA 1EYJA 5AA2D 1IMDA 4ECFA 4HE2A 3L6GA 1SI0A 1RDZA 4NMYA 1TFDA 2GH9A 5EHMA 3TCGA 1A55A 5LOMA 3RTFB 1EZPA 4E0XA 1A54A 4LQ2A 5ET7A 1Q35A 3IB1A 1B3EA 2H25A 1LBVA 3IR1A 1AIVA 3I3VA 1ELJA 5ET8A 3ECRA 4IGTA 3HHFA 4KCDA 1H43A 4H46A 1IQ7A 2DYXA 3CSBA 4X1DA 3G3GA 1G0IA 2NWJA 4U1OA 2ZXTA 4OESA 3OD7A 4ZEBA 3T96B 4HW8A 1N7WA 4P47A 1GTKA 3SERA 2HAUA 1JVXA 1XS5A 3PUYE 1LBZA 1VFEA 4QSCA 1P99A 3PTYA 3KZGA 2ZMBA 4F1YA 1QGXA 3SZPA 4PAIA 3TCFA 2ZNSA 2PFZA 4RK2A 3O9PA 3U94A 4GF8A 2DS9A 1VE4A 1BTJA 2QL3A 1IMAA 2WBBA 3V83A 2DE4A 3BIHA 3IORA 4OXVA 2H4IA 3K1PA 3FZVA 4H5GA 4GWZA 2NOOA 2HHMA 4XF5A 1NV7A 4NF6B 3G3HA 4QHQA 4N6KA 4R73A 4MMPA 4H67A 1Y3PA 1AMFA 4C1TA 2XHDA 1VR5A 2X7QA 1UIVA 1H44A 2VT5A 5IZ1A 3KOSA 4UA8A 1B3GA 4X8RA 4PF6A 4PFUA 4MNPA 3QK6A 1NFTA 4NF0A 4F2QA 3FJGA 2RKMA 3ZKKA 1QJMA 1NH7A 5KDTB 1YYZA 2E0SA 2F7BA 2IA4A 1R1NA 3Q28A 1RYOA 1Y4TA 4N6PA 4DXCA 4R75A 1MQGA 1MQIA 1DTGA 4G8HA 4GRKA 4RK9A 2CZHA 3K6XA 4EF1A 3KEIA 1UTBB 4THIA 2DXRA 1ZJLA 1Y3QA 4C1UA 4EUOA 3MVWA 1K9ZA 1QULA 3IOUA 4YMAA 3KSJA 1QW0A 3ONMA 4BDQA 5F1QA 2Z8FA 4GIZA 2PCRA 1RDYA 2O84X 5CMCA 1NUWA 1USYH 4MCOA 5H8FA 4ZDMA 4NAPA 4G8NA 4H0WA 1MM7A 1B52A 2UYFA 1R9LA 1FPGA 4XXUA 4Q5TA 5H8HA 3QMFA 3TAJA 4OYVA 1DMBA 2Y7IA 4AB5A 1I6QA 3CHGA 4MAGA 2QVRA 3A29A 2M8CA 2PT2A 1UQWA 3HPIA 4Q0CA 3RTWB 1N04A 5I59A 3MVXA 3EHSA 4OETA 3FUZA 3MP8A 3OO6A 4LZ5A 5DW8A 3R6UA 4FATA 4O8MA 4PGNA 2A5TB 3K6WA 1VDWA 1FQBA 5EQ7A 1FQAA 2XXKA 4PFTA 1GR2A 2PX1A 1LAGE 1MY3A 4TOZA 3H6WA 1B9JA 1EZOA 3CI8A 2O69A 4PBQA 3PPPA 1PBQA 3TCHA 5DEXA 1B40A 4DLDA 2Y5LA 4G2ZA 2VOZA 3HHGA 4WEPA 4G68B 3S9EA 3T93B 5FHNA 4I62A 5DVFA 3LSLA 1MY0A 5DVIA 4EXKA 3EKIA 3RQTA 3CFLA 3ZKLA 2UVIA 1UTHB 4PE5B 4P0IA 4DI4B 1JQFA 3IO6A 2OWZA 4GWWA 4NF5A 1II5A 4GL0A 3M3FA 4I9DA 3I6VA 3FVKA 2Q74A 2H5YA 4NWCA 4HS7A 1LCTA 4MNCA 2XXIA 1UTBA 3TTKA 5EQ8A 4JVIA 1LB8A 3OENA 3KBRA 5BUUA 1AH5A 1ZBMA 4C0RA 3DM0A 1SI1A 3VFJA 2HPGA 3QYTA 4LZ8A 5DYHA 2WYPA 3V5AA 1NL5A 4X9TA 2FYIA 2V93A 4XKPA 2F3DA 3CVGA 4MBPA 4PDDA 1P1UA 3BFUA 4GWUA 4F2OA 2VHAA 2YLNA 1GVCA 4U22A 1B7ZA 3TFLA 2V84A 2BJIA 3KBZA 1AWBA 5I2KB 4MLQA 5I84A 5ET6A 1A7LA 1B51A 4O94A 4H1XA 1MY2A 4OA4A 4KR5A 3VVEA 2Q8MA 2CMOA 1LEVA 3OSRA 4KQPA 2FVZA 3E13X 5AE4A 4N6DA 2XWVA 4P9KA 1N7XA 1MXWA 4ZZAA 3VV5A 1FBCA 1IMCA 3MPLA 4GBVA 3O6GA 2Y7KA 2OCUA 1QUJA 1LSTA 1MPDA 4RXLA 2Q89A 3O2AA 1JETA 2RC8A 3MVYA 1MS7A 4YKKA 1POTA 1EH3A 2Y7PA 1NKXA 2XX7A 3B6WA 3IB2A 3H03A 3T0JA 3HN0A 4P0GA 3QUFA 4F39A 2NXOA 3KN8A 1FW0A 3M3KA 1IMBA 4MLVA 2F7AA 1S50A 4PFRA 4ZEIA 4L17A 4F3BA 2P2AA 2QS4A 2REGA 3PUWE 3OO9A 1IMFA 4IO2A 4R9GA 3IFAA 2YJPA 4RPOA 4OHNA 3GXAA 2P3NA 5IZ3A 1FTAA 1HSLA 4M1VA 4R6KA 4R6HA 3OMBA 1PB8A 2I49A 3TZAA 2ABHA 4H8JA 4NX1A 4IB2A 1JW1A 2FHYA 5I5PA 1XVXA 2QRYA 1LBYA 3B50A 4OMBA 5ITOA 4FORA 1FPKA 5H8SA 3ODBA 4NWDA 2F36A 4KD5A 4E0WA 5AA2A 5H8QA 2NVUB 1FPEA 3N6TA 4QFOA 5EQAA 4WKMA 4HE1A 2HEUA 2RCAA 4KFQA 4YMBA 1IEJA 2PFYA 1M5DA 2QMXA 3USDA 3G7WA 3RT8A 3MSTA 4P8BA 2Q9TA 3PPOA 3UP9A 2I48A 2AYSA 4OEUA 2DOJA 1FBDA 4DCXA 4LONB 4PFIA 1BK4A 1NV3A 1NNTA 2O68A 4OQOA 4F3SA 3SEXA 4JWYA 3MYUA 1WODA 4GVOA 1FQCA 2FBPA 3VVFA 1TFAA 2W7YA 4XKRA 2O7UA 3PUZE 2REJA 1QKBA 3S9NC 1SQYA 1B2HA 4OTEA 5KCJB 4YB6A 1GGGA 1MY1A 4BDLA 1PEBA 2QMWA 4X48A 5J1DA 5TPAA 3MWBA 2OK2A 2H9BA 1SPIA 2R6GE 1FPJA 1OLCA 2P0SA 3GBBA 3MZBA 4FECA 1BIYA 2F6GA 4DXBA 3MPKA 1POY1 1IMEA 3FD3A 3IK6B 3MQ9A 5FHMA 5I58B 1SW1A 1DBZA 1MXZA 4PFYA 2DVZA 4DCYA 2QS3A 1MXUA 4N81A 5H8HB 3ZSFA 3OOAA 3QXMA 2I6EA 5CMKA 2OPDA 3PPQA 3O97A 4G61A 2GQ1A 1JEVA 4G4PA 4KI0E 3UIFA 3Q25A 4EQ9A 4GWXA 5KDTA 1SDXA 5I2NA 4O3AA 4GLIA 4IY6A 3TTLA 4UACA 3E9XA 4AQ4A 4XTCQ 4P3LA 2GFEA 3UA8A 4GQOA 3KJ7A 3B6TA 5DVJA 1MG1A 1US4A 2I0BA 4IR8A 1B05A 1KWHA 5HBCA 2AL5A 2O1LA 4G68A 3RN8A 4MFIA 1PBPA 2PT1A 3RPLA 2YPNA 4MNIA 2Z8DA 4JSOA 2Z22A 4O3CA 1NV4A 2UXAA 3K02A 2VGQA 3K0VA 1HSJA 4GWYA 4YKPA 3U1OA 1Y1ZA 1MRPA 3VXCA 1INPA 4XKQA 3TELA 1MH3A 3D4CA 5JK4A 4NF4B 5AA4B 3FXUA 3TUSA 4OANA 5A5XA 2Q2CA 3K00A 3TODA 3RLFE 2B65A 1P1WA 4YICA 2QJEA 4TLMB 1EZ9A 1P1QA 4NF5B 3TKDA 4QFPA 1MXYA 3CIJA 1B5JA 2CEYA 2O6AA 3U8QA 1SYHA 4GX6A 1CNQA 2FNCA 2WKYA 3N6UA 2ANJA 1XHYA 4I40A 3B7DA 1NV1A 1NUZA 3DP4A 2G93A 4IO4A 4U1ZA 2XXXA 1MY4A 3K4UA 2ZNTA 4F19A 1VFDA 4AS4A 1QUIA 1SD3A 2I3VA 3TQLA 2A5SA 3TTRA 4RA1A 4PDHA 2VD2A 3G3IA 1A40A 5CMMA 2VPOA 2WBDA 4ZZEA 3Q27A 3LUYA 4O7IA 3KC1A 5TP9B 3O6IA 3W9VA 2XD2A 3CFXA 4PBHA 4I3YA 2HQ0A 2LAOA 2G29A 5TU0A 1SBPA 1ZMGA 2UYEA 1ZLQA 2DVCA 1M5EA 1OIBA 4ZEDA 4R6YA 1O64A 4NF8A 4AS5A 1KA0A 3U65A 1US5A 5B7DA 3VXBA 1ATGA 4F29A 3PU5A 1N84A 4OVQA 3T9HB 4IY5A 1FTOA 1P1OA 2XXTA 1ZKBA 4NE4A 4BDOA 4UABA 2XWIA 3S2VA 1S7YA 1DK4A 3K2DA 1NV6A 5I3SA 1OQGA 1JNFA 3SDFA 4N91A 3BIGA 5A5LA 1B7UA 1B6HA 1OVTA 4QBAA 1FBHA 3KFMA 5ISUA 4MF3A 1LAHE 3EF7A 4GOTA 1JVYA 2GRVA 3O6HA 3PGFA 3E3KA 3FXRA 1N3WA 2OBGA 2Y5KA 1B1HA 3C32A 1DPEA 4PFBA 4RJZA 2D21A 3TTNA 2DP8A 2HZLA 5J16A 1URDA 5H8NB 1Y1MA 2F5XA 1B3LA 1SW2A 2Q8JA 3MZ9A 1SW5A 3UN6A 2MKZA 4QRZA 1B1XA 4GL8A 4WXJA 4H8IA 1MPBA 3OO7A 4GWOA 4IO7A 4DDDA 2OJTA 1OVBA 4Z7EA 1FBFA 1MM6A 3HFUA 2QSXA 1Y3NA 1B7HA 5CRYA 5HPQA 3QUJA 2P3VA 4DE8A 4JVCA 3MP6A 2ZNUA 3JYRA 2ZZVA 2OX3A 5EHSA 2OZZA 4X1BA 3IFCA 2B4LA 5KCJA 1PDAA 3B6QA 4YU0A 2I58A 5JTYB 4N4UA 1RYXA 5TPAB 4N13A 4RYAA 1AL3A 2FIXA 1DCUA 4GFRA 3HV1A 2V3QA 3PUVE 5CBRA 2CZIA 3EQ1A 4ELOA 1DSNA 1NH8A 1D9YA 3JZJA 2QPQA 3HCQA 3N26A 3KG2A 3OELA 2F78A 4PCDA 2OWSA 4PQJA 3N5LA 3D1RA 4KYEA 3SEVA 1A8EA 4PAFA 3I5OA 1LFIA 3OEKA 1IITA 3Q29A 4FEBA 3LC8A 1NV0A 2Q88A 4QFKA 5I58A 1O63A 3U72A 3C33A 1Y4CA 3KN3A 1TWYA 3IAZA 4DXUA 4P56A 1SVXB 4FEDA 2KR0A 3K1NA 5ICQA 2QS2A 4TLLB 4XIGQ 5EQ9A 3PMXA 5L9OA 1B4HA 1MXXA 3T9UA 3Q26A 3C4MA 2V3UA 3H6VA 3K6UA 3F11A 3H4ZA 1QUKA 2DWAA 4JBZA 4O7MA 5I57B 1UIUA 3IL1B 3T9VA 1Z7ME 2XXUA 4EXLA 3C9HA 1MH4A 1NNFA 2ONSA 3H6UA 4MJOA 3ILUB 4BDMA 1HSEA 2KLFA 4QSDA 3S4UA 3R26A 2ZZXA 3W9WA 1YZ0A 1L5TA 4OENA 2NUVA 1LBCA 3IJOB 2ONRA 1FRPA 1FQDA 3H06B 1Y9UA 4NF8B 3FV1A 4Q30B 4PC9A 1XC1A 3KGCA 2XX9A 5LDZA 2VP1A 3LR1A 2DWHA 2WX9A 4NQ8A 4PFWA 3ISPA 3CG3A 3BKIB 5I2KA 1NV5A 5I59B 3GBAA 4NGUA 3C31A 1H76A 3SETA 4OFLA 5AA2B 5H8QB 3H3GA 4FAJA 1NMUA 3K1MA 1Y20A 4R9FA 2Y7RA 1I6BA 1D3KA 1SW4A 2R8TA 5LTCA 3FXQA 4F31B 4EDPA 4ISUA 4Z0IA 1MPCA 1ZIUA 3LSXA 1RDXA 4GXAA 4KPTA 3ROJA 2P1SA 2ZYOA 2F6PA 5TP9A 1AOVA 4G68C 3PPNA 2DDKA 2F97A 4IO6A 4LUBA 1B5IA 5I2NB 4HCWA 4ESXA 2E1SA 5FTHA 3D4GA 5I56A 1T0KA 2DWJA 5CI5A 1FBGA 4LZ7A 4OVJA 1R6ZA 1LBXA 3TTMA 3U93A 3CSGA 1LFGA 2I0CA 5JEIA 5CMBA 2ZYNA 3ILTB 5FHOA 4OZ9A 3RY3A 2QVUA 3FVNA 3RPWA 4P1EA 3SEUA 4GX3A 2RC7A 1D4NA 3RNNA 4FIMA 4H6DA 4EQBA 3TMGA 4F1VA 4M4GA 1IXGA 5A5XB 1YXIA 1QVSA 2XWOA 3O28A 4GD5A 3PV0E 2QVVA 2RC9A 1B3FA 2ALUA 5JTYA 3TEPA 4O3BA 4U4SA 4LVQA 2F7CA 4DIGA 2I4CA 4G8MA 4NF4A 4EF2A 5F24A 1OLAA 2UVGA 5AA4A 4U23A 5BWJA 3CFZA 1P1NA 1B46A 4JSDA 4ELQA 2D5WA 4PAKA 4NG7A 2QS1A 1URGA 2DXYA 2HAVA 2Y7WA 4DI3D 2DE3A 2O51A 1EYIA 5L8DA 2XWKA 4GXSB 3OSQA 4XEQA 3LSFB 2ZYKA 4MH5A 3DLNA 3O66A 4NN3A 3IX1A 1FTJA 4P1LA 1OMPA 3VLVA 3SEWA 1Z7NE 4YAHX 3KN7A 5H8FB 2XXVA 3RYDA 3VE1B 1TT1A 4R2BA 3NOHA 4U21A 4KYDA 3P7IA 4F1UA 3W15C 3DP6A 4R74A 3C34A 4OFJA 3OO8A 5EYFA 5HM4B 1UTHA 3S9MC 3PUXE 1FPBA 2F8DA 2DWIA 1XOCA 4BLAA 4MIJA 1LLSA 4DZ1A 1PC3A 4I8CA 4U2RA 3UGWA 1B4ZA 4ZEKA 3CR9A 3TQWA 1FPFA 1DPPA 3C35A 4FBPA 2Y84A 1M5FA 3BFTA 1IXHA 3VVDA 2KQZA 5IKBA 2H98A 4QF9A 1XI6A 2FA7A 4RPNA 2XXRA 5AA1A 4LQ5A 1K9YA 3E78A 2B4MA 4MEVA 4PF8A 3JV9A 1IUDA 2CZKA 2CZLA 2DE2A 4GX4A 1FCKA 4NHBA 4I1DA 1IZ1A 3IOWA 3C36A 3SEYA 3WAFA 1FTLA 1MDQA 1YAEA 2RF1A 1BP5A 1FPIA 2XXWA 3KJTA 1LB9A 5FTIA 1FJ6A 4KHZE 4YB5A 2BJJX 2WYKA 5KZTA 1EYKA 4N8YA 4FE8A 1H3DA 1YCJA 2R71A 2OPEA 3SKPA 4PTKA 4IO5A 1NUXA 5FBPA 3IO4A 4POWA 1FBEA 1WDNA 4NTLA 3R7XA 2V25A 3LUZA 1DTZA 4ZE9A 4GBWA 3GZGA 4G77A 3PMVA 1FPDA 3CG1A 3K6VA 3MUQA 5EYHA 5AA3A 4K3FA 3MZ1A 1FSAA 3QIMA 5IM2A 2X26A 4PETA 4EQ7A 1H45A 3B8BA 4H65A 3HSTA 3TDJA 4ZE8A 5IZ3B 2OLBA 1WVJA 5ET5A 2HCAA 3FJ7A 4NF6A 2XD3A 3QSLA 4YKIA 4PGPA 4ELRA 5DTBA 4ESWA
chains in the Genus database with same CATH topology
1YXIA 3E79A 3EKIA 3MSTA 4HCYA 4P3LA 2Q9TA 4P8BA 3D1RA 4PC9A 4PFBA 2KQZA 3LV0A 2XWOA 1Q9DA 1FBCA 4I3EA 1XI6A 1IMCA 2QVVA 1IMAA 4PAFA 2HZLA 5J16A 4N15A 1FBDA 1FPLA 2WBBA 2PCRA 4GBVA 1D9QA 2DE4A 4PDHA 3BIHA 4DI4B 5LDZA 1RDYA 2HZKA 4PE3A 1FBPA 1K9YA 1NUWA 4GWZA 2HHMA 4MCOA 4MHFA 2OWZA 4OVPA 1BK4A 1NV3A 2F5XA 4XF5A 4NAPA 4IR8A 2B4MA 1NV0A 4MEVA 4GWWA 2WX9A 1NV7A 4PF8A 4XFEA 4DI3D 3MYUA 2CZKA 2MKZA 2VPOA 4JVDA 2DE2A 4NQ8A 1FPGA 4N6KA 2QFLA 3ISPA 4MMPA 2FBPA 2WBDA 1EYJA 5F24A 4GX4A 3RPLA 2Q74A 4O7IA 1IMDA 4MNIA 3QMFA 4NHBA 3KC1A 4HE2A 4P56A 1NV5A 1RDZA 4NGUA 3W9VA 4LN5A 4MNCA 2KR0A 2ZZWA 2JJKA 2XA5A 1NV4A 3E78A 3T0JA 4PBHA 3CHGA 5EQ9A 5EQ8A 4I3YA 4JVIA 4OVSA 1FPIA 4MAGA 4YZZA 1FBFA 2QVRA 4PFIA 5J1DA 4KXPA 2VT5A 3HFUA 4NG7A 4PAKA 3A29A 4GWYA 1IMBA 1FJ6A 5IZ1A 2R8TA 1SPIA 4N8GA 5LTCA 1INPA 2FIEA 5ET7A 5EYGA 4AS5A 1KA0A 2HPGA 2WYKA 4PFRA 4X8RA 1EYKA 2P3VA 2DE3A 3U65A 4O7MA 1FPJA 4N8YA 2WYPA 2V4CA 4PF6A 4JVCA 5JK4A 4MNPA 1IMFA 1NI9A 1LBVA 1EYIA 4X9TA 1RDXA 3IFAA 2XWKA 4HE0A 5I7IA 4OANA 3ROJA 4PTKA 4XEQA 2ZZVA 2CEXA 1KA1A 3FXBA 3GYYA 1NUXA 2OX3A 5FBPA 4OVQA 1FBEA 4NF0A 2P3NA 3IFCA 1FTAA 5IZ3A 2B4LA 1G0HA 1NUYA 4NN3A 1JP4A 2F3DA 5DW8A 4M1VA 4P1LA 4OVTA 5ET8A 4PDDA 3LUZA 4UABA 2L5VA 4GBWA 4GWUA 4N4UA 4O8MA 1IMEA 4PGNA 4X04A 4YICA 2VPNA 2DDKA 4H46A 1LBWA 1FPDA 1VDWA 3RYDA 4NX1A 1YYZA 1FJ9A 4MJOA 2XWIA 1G0IA 3KC0A 2FHYA 5EQ7A 2BJIA 5EYHA 3KBZA 4HCWA 1AWBA 1DK4A 1DBZA 3FBPA 4MX6A 1NV6A 5I5PA 5I3SA 1FSAA 3NOHA 5IM2A 1LBYA 4QXDA 2XXKA 2DVZA 3B50A 4F18A 2FIXA 4N81A 2CEYA 4N91A 4PETA 4F1UA 1DCUA 2ZZXA 5ET6A 1FBGA 1FPKA 5CM6A 4N17A 3B8BA 3BIGA 5A5LA 2CZHA 1LBXA 1NV2A 4GWSA 4GX6A 4O94A 4OVRA 3W9WA 4QBAA 1FBHA 1YZ0A 4P47A 5ESYA 5IZ3B 4HXVA 2V3QA 4OA4A 1KZ8A 1CNQA 5ET5A 4PBQA 3T1BA 1FPEA 1FPBA 2Q8MA 1LBZA 4G61A 2CZIA 2GQ1A 5EQAA 4HE1A 4MIJA 1LEVA 2QVUA 4GWXA 2WEFA 2Y5LA 1K9ZA 4I40A 3PTYA 1FRPA 1NV1A 1NUZA 5IGAA 2FVZA 1QGXA 4P1EA 2HXRA 2PFYA 2QPQA 5T3JA 4N6DA 4PAIA 3SZPA 5IZZA 4GX3A 2XWVA 4P9KA 4F19A 4PGPA 1FPFA 4H45A 2PFZA 3RPLB 4AS4A 2F3BA 2Y5KA 4FBPA 4F1VA 4PCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YXI A;  3D1R A;  3LV0 A;  1Q9D A;  1FBC A;  4I3E A;  1XI6 A;  1IMC A;  2QVV A;  1IMA A;  5J16 A;  1FBD A;  1FPL A;  2WBB A;  2PCR A;  4GBV A;  1D9Q A;  3BIH A;  5LDZ A;  1RDY A;  1FBP A;  1K9Y A;  1NUW A;  4GWZ A;  2HHM A;  2OWZ A;  1BK4 A;  1NV3 A;  4IR8 A;  1NV0 A;  4GWW A;  1NV7 A;  2CZK A;  1FPG A;  2QFL A;  2FBP A;  2WBD A;  1EYJ A;  5F24 A;  4GX4 A;  3RPL A;  2Q74 A;  4O7I A;  1IMD A;  3QMF A;  3KC1 A;  4HE2 A;  1NV5 A;  1RDZ A;  2JJK A;  1NV4 A;  3T0J A;  5EQ9 A;  5EQ8 A;  4I3Y A;  1FPI A;  1FBF A;  2QVR A;  4KXP A;  2VT5 A;  3A29 A;  4GWY A;  1IMB A;  1FJ6 A;  5IZ1 A;  2R8T A;  1SPI A;  1INP A;  2FIE A;  5ET7 A;  5EYG A;  4AS5 A;  1KA0 A;  1EYK A;  2P3V A;  1FPJ A;  1IMF A;  1NI9 A;  1LBV A;  1EYI A;  1RDX A;  3IFA A;  4HE0 A;  3ROJ A;  4PTK A;  1KA1 A;  1NUX A;  2OX3 A;  5FBP A;  1FBE A;  2P3N A;  3IFC A;  1FTA A;  5IZ3 A;  1G0H A;  1NUY A;  1JP4 A;  2F3D A;  5DW8 A;  5ET8 A;  3LUZ A;  4GBW A;  4GWU A;  1IME A;  2DDK A;  4H46 A;  1LBW A;  1FPD A;  1VDW A;  3RYD A;  1YYZ A;  1FJ9 A;  4MJO A;  1G0I A;  3KC0 A;  2FHY A;  5EQ7 A;  2BJI A;  5EYH A;  3KBZ A;  1AWB A;  1DK4 A;  1DBZ A;  3FBP A;  1NV6 A;  5I3S A;  1FSA A;  1LBY A;  4QXD A;  2FIX A;  4N81 A;  1DCU A;  5ET6 A;  1FBG A;  1FPK A;  3B8B A;  3BIG A;  5A5L A;  2CZH A;  1LBX A;  1NV2 A;  4GWS A;  4GX6 A;  1FBH A;  1YZ0 A;  5ESY A;  5IZ3 B;  4HXV A;  1KZ8 A;  1CNQ A;  5ET5 A;  1FPE A;  1FPB A;  2Q8M A;  1LBZ A;  4G61 A;  2CZI A;  2GQ1 A;  5EQA A;  4HE1 A;  1LEV A;  2QVU A;  4GWX A;  2WEF A;  2Y5L A;  1K9Z A;  4I40 A;  1FRP A;  1NV1 A;  1NUZ A;  2FVZ A;  1QGX A;  5T3J A;  4GX3 A;  1FPF A;  4H45 A;  3RPL B;  4AS4 A;  2F3B A;  2Y5K A;  4FBP A; 
#chains in the Genus database with same CATH topology
 3G3K A;  3E79 A;  4QSE A;  4OWD A;  1PB7 A;  4YB7 A;  1LAX A;  4ONY A;  1USY E;  3TYH A;  3SES A;  2HZK A;  4PE3 A;  4TQU Q;  4OVP A;  1JW4 A;  1FTM A;  1B3H A;  2PVU A;  2XXH A;  4RY1 A;  3IB0 A;  3FVG A;  3LSW A;  1FTK A;  2VD3 A;  4OFO A;  1LFH A;  3THI A;  5DT6 A;  3MP1 A;  4OER A;  2RCB A;  4N07 A;  2ZZW A;  3ZS6 A;  2XA5 A;  3UOR A;  4R72 A;  5CBS A;  2V3T A;  4F3P A;  2B3B A;  1MQH A;  2HXW A;  2FIE A;  4F22 A;  3H7M A;  3M3L A;  1QKA A;  2V4C A;  4KCC A;  5I7I A;  2CEX A;  1KA1 A;  3FXB A;  1M5B A;  1VSO A;  1LCF A;  1SYI A;  1IXI A;  2XXQ A;  3KOT A;  4IO3 A;  3S9L C;  4IGR A;  2VPN A;  1LBW A;  1FJ9 A;  3T9X B;  3FGS A;  2GHA A;  3FBP A;  4LA9 A;  4MX6 A;  4QXD A;  1GV8 A;  2PBW A;  3RGY A;  4OVR A;  1NV2 A;  2ESN A;  4LP2 B;  4U4X A;  1DOT A;  3EHT A;  5ICT A;  2DQV A;  3T1B A;  2THI A;  1I6A A;  1MDP 1;  2D3I A;  4QFN A;  4ND9 A;  3G3F A;  1B5H A;  3M8U A;  5IGA A;  3FAS A;  5L9M A;  5F7V A;  1TXF A;  5IZZ A;  3EPE A;  2O7I A;  1MXV A;  4JXI A;  1JEU A;  2Z8E A;  4HCY A;  4JWX A;  1M5C A;  3MW0 A;  4N15 A;  1BKA A;  3IOV A;  1CE2 A;  1XT8 A;  2ZYM A;  1FBP A;  2HFB A;  3A3C A;  3FV2 A;  4YKJ A;  5K2Y A;  1FQF A;  5L9S A;  4QFL A;  5I57 A;  4WED A;  3RT6 B;  5IAI A;  2GHB A;  4LN5 A;  1LGB C;  3V89 B;  2JJK A;  2PYY A;  4JDF A;  3IJX B;  4OVS A;  1NNP A;  3IOT A;  3VDF A;  3WAE A;  2UVH A;  1NNK A;  1IIW A;  1MQD A;  2I3W A;  4HTG A;  1N0T A;  2AL4 A;  1A99 A;  4HE0 A;  3A09 A;  1MQJ A;  3GYY A;  2F35 A;  1LBB A;  1ZU0 A;  2I4B A;  1NUY A;  3DEL B;  1JP4 A;  5K2X A;  4OVT A;  3G3J A;  1ZTY A;  4PP0 A;  4POX A;  3K01 A;  3N94 A;  2Z23 A;  3KC0 A;  3MC2 A;  1O7T A;  1N3X A;  4F3G A;  3E4R A;  1EU8 A;  1B32 A;  4GWS A;  3FVO A;  1RKM A;  1BLF A;  3PD8 A;  5ESY A;  1KZ8 A;  1JW5 A;  1B0L A;  1YPN A;  4AB6 A;  1PB9 A;  3T22 A;  1S9T A;  3CRB A;  2A5T A;  3PPR A;  3GLB A;  2Q2A A;  1OQH A;  4RNS A;  5T3J A;  2DSF A;  4XKN A;  2OWT A;  3RPL B;  4KYS A;  4BDN A;  3BBR A;  1YTV A;  2B3F A;  3PD9 A;  1Q9D A;  4ZS9 A;  2O1M A;  2RIN A;  3FAT A;  4MHF A;  5DEX B;  5CC2 A;  3HO7 A;  4OEV A;  3VLU A;  5M2V A;  1J1N A;  1B58 A;  4ZEC A;  2R9J A;  3TPA A;  2H99 A;  3T66 A;  4Q8R A;  3MVZ A;  4YZZ A;  4KXP A;  4NED A;  1R9Q A;  3KSX A;  2AIX A;  1FQE A;  2IEE A;  4JWO A;  3PMW A;  4N8G A;  5EYG A;  2XX8 A;  2PMS A;  1N76 A;  4LAT A;  1Q1K A;  3A3U A;  3EHU A;  1NI9 A;  3UK4 A;  5I56 B;  3OEM A;  2X7P A;  1G0H A;  4P11 A;  3MAM A;  3LBS A;  1LAF E;  4JB7 A;  5H8N A;  2L5V A;  4R2F A;  4X04 A;  1A8F A;  3MJN A;  3V8X B;  2F34 A;  4F18 A;  1D9V A;  3VLW A;  5CM6 A;  4N17 A;  3FJM A;  3O29 A;  3DP8 A;  5ITP A;  4HXV A;  2XXY A;  4FJP A;  1F9B A;  3MBP A;  5ELV A;  2WEF A;  4BDR A;  2HXR A;  2XXP A;  1URS A;  4H45 A;  1I69 A;  1IXC A;  2ONK E;  3RUM A;  2F3B A;  3OXN A;  3H6T A;  3FIR A;  3LV0 A;  3U92 A;  4H5F A;  4I3E A;  3EN3 A;  1FPL A;  1D9Q A;  1CB6 A;  3AXF A;  3QAX A;  1XVY A;  1ANF A;  4ZEF A;  4XFE A;  2UVJ A;  4JVD A;  3L6H A;  1B0H A;  2QFL A;  5B70 A;  4ELP A;  1EYJ A;  5AA2 D;  1IMD A;  4ECF A;  4HE2 A;  3L6G A;  1SI0 A;  1RDZ A;  4NMY A;  1TFD A;  2GH9 A;  5EHM A;  3TCG A;  1A55 A;  5LOM A;  3RTF B;  1EZP A;  4E0X A;  1A54 A;  4LQ2 A;  5ET7 A;  1Q35 A;  3IB1 A;  1B3E A;  2H25 A;  1LBV A;  3IR1 A;  1AIV A;  3I3V A;  1ELJ A;  5ET8 A;  3ECR A;  4IGT A;  3HHF A;  4KCD A;  1H43 A;  4H46 A;  1IQ7 A;  2DYX A;  3CSB A;  4X1D A;  3G3G A;  1G0I A;  2NWJ A;  4U1O A;  2ZXT A;  4OES A;  3OD7 A;  4ZEB A;  3T96 B;  4HW8 A;  1N7W A;  4P47 A;  1GTK A;  3SER A;  2HAU A;  1JVX A;  1XS5 A;  3PUY E;  1LBZ A;  1VFE A;  4QSC A;  1P99 A;  3PTY A;  3KZG A;  2ZMB A;  4F1Y A;  1QGX A;  3SZP A;  4PAI A;  3TCF A;  2ZNS A;  2PFZ A;  4RK2 A;  3O9P A;  3U94 A;  4GF8 A;  2DS9 A;  1VE4 A;  1BTJ A;  2QL3 A;  1IMA A;  2WBB A;  3V83 A;  2DE4 A;  3BIH A;  3IOR A;  4OXV A;  2H4I A;  3K1P A;  3FZV A;  4H5G A;  4GWZ A;  2NOO A;  2HHM A;  4XF5 A;  1NV7 A;  4NF6 B;  3G3H A;  4QHQ A;  4N6K A;  4R73 A;  4MMP A;  4H67 A;  1Y3P A;  1AMF A;  4C1T A;  2XHD A;  1VR5 A;  2X7Q A;  1UIV A;  1H44 A;  2VT5 A;  5IZ1 A;  3KOS A;  4UA8 A;  1B3G A;  4X8R A;  4PF6 A;  4PFU A;  4MNP A;  3QK6 A;  1NFT A;  4NF0 A;  4F2Q A;  3FJG A;  2RKM A;  3ZKK A;  1QJM A;  1NH7 A;  5KDT B;  1YYZ A;  2E0S A;  2F7B A;  2IA4 A;  1R1N A;  3Q28 A;  1RYO A;  1Y4T A;  4N6P A;  4DXC A;  4R75 A;  1MQG A;  1MQI A;  1DTG A;  4G8H A;  4GRK A;  4RK9 A;  2CZH A;  3K6X A;  4EF1 A;  3KEI A;  1UTB B;  4THI A;  2DXR A;  1ZJL A;  1Y3Q A;  4C1U A;  4EUO A;  3MVW A;  1K9Z A;  1QUL A;  3IOU A;  4YMA A;  3KSJ A;  1QW0 A;  3ONM A;  4BDQ A;  5F1Q A;  2Z8F A;  4GIZ A;  2PCR A;  1RDY A;  2O84 X;  5CMC A;  1NUW A;  1USY H;  4MCO A;  5H8F A;  4ZDM A;  4NAP A;  4G8N A;  4H0W A;  1MM7 A;  1B52 A;  2UYF A;  1R9L A;  1FPG A;  4XXU A;  4Q5T A;  5H8H A;  3QMF A;  3TAJ A;  4OYV A;  1DMB A;  2Y7I A;  4AB5 A;  1I6Q A;  3CHG A;  4MAG A;  2QVR A;  3A29 A;  2M8C A;  2PT2 A;  1UQW A;  3HPI A;  4Q0C A;  3RTW B;  1N04 A;  5I59 A;  3MVX A;  3EHS A;  4OET A;  3FUZ A;  3MP8 A;  3OO6 A;  4LZ5 A;  5DW8 A;  3R6U A;  4FAT A;  4O8M A;  4PGN A;  2A5T B;  3K6W A;  1VDW A;  1FQB A;  5EQ7 A;  1FQA A;  2XXK A;  4PFT A;  1GR2 A;  2PX1 A;  1LAG E;  1MY3 A;  4TOZ A;  3H6W A;  1B9J A;  1EZO A;  3CI8 A;  2O69 A;  4PBQ A;  3PPP A;  1PBQ A;  3TCH A;  5DEX A;  1B40 A;  4DLD A;  2Y5L A;  4G2Z A;  2VOZ A;  3HHG A;  4WEP A;  4G68 B;  3S9E A;  3T93 B;  5FHN A;  4I62 A;  5DVF A;  3LSL A;  1MY0 A;  5DVI A;  4EXK A;  3EKI A;  3RQT A;  3CFL A;  3ZKL A;  2UVI A;  1UTH B;  4PE5 B;  4P0I A;  4DI4 B;  1JQF A;  3IO6 A;  2OWZ A;  4GWW A;  4NF5 A;  1II5 A;  4GL0 A;  3M3F A;  4I9D A;  3I6V A;  3FVK A;  2Q74 A;  2H5Y A;  4NWC A;  4HS7 A;  1LCT A;  4MNC A;  2XXI A;  1UTB A;  3TTK A;  5EQ8 A;  4JVI A;  1LB8 A;  3OEN A;  3KBR A;  5BUU A;  1AH5 A;  1ZBM A;  4C0R A;  3DM0 A;  1SI1 A;  3VFJ A;  2HPG A;  3QYT A;  4LZ8 A;  5DYH A;  2WYP A;  3V5A A;  1NL5 A;  4X9T A;  2FYI A;  2V93 A;  4XKP A;  2F3D A;  3CVG A;  4MBP A;  4PDD A;  1P1U A;  3BFU A;  4GWU A;  4F2O A;  2VHA A;  2YLN A;  1GVC A;  4U22 A;  1B7Z A;  3TFL A;  2V84 A;  2BJI A;  3KBZ A;  1AWB A;  5I2K B;  4MLQ A;  5I84 A;  5ET6 A;  1A7L A;  1B51 A;  4O94 A;  4H1X A;  1MY2 A;  4OA4 A;  4KR5 A;  3VVE A;  2Q8M A;  2CMO A;  1LEV A;  3OSR A;  4KQP A;  2FVZ A;  3E13 X;  5AE4 A;  4N6D A;  2XWV A;  4P9K A;  1N7X A;  1MXW A;  4ZZA A;  3VV5 A;  1FBC A;  1IMC A;  3MPL A;  4GBV A;  3O6G A;  2Y7K A;  2OCU A;  1QUJ A;  1LST A;  1MPD A;  4RXL A;  2Q89 A;  3O2A A;  1JET A;  2RC8 A;  3MVY A;  1MS7 A;  4YKK A;  1POT A;  1EH3 A;  2Y7P A;  1NKX A;  2XX7 A;  3B6W A;  3IB2 A;  3H03 A;  3T0J A;  3HN0 A;  4P0G A;  3QUF A;  4F39 A;  2NXO A;  3KN8 A;  1FW0 A;  3M3K A;  1IMB A;  4MLV A;  2F7A A;  1S50 A;  4PFR A;  4ZEI A;  4L17 A;  4F3B A;  2P2A A;  2QS4 A;  2REG A;  3PUW E;  3OO9 A;  1IMF A;  4IO2 A;  4R9G A;  3IFA A;  2YJP A;  4RPO A;  4OHN A;  3GXA A;  2P3N A;  5IZ3 A;  1FTA A;  1HSL A;  4M1V A;  4R6K A;  4R6H A;  3OMB A;  1PB8 A;  2I49 A;  3TZA A;  2ABH A;  4H8J A;  4NX1 A;  4IB2 A;  1JW1 A;  2FHY A;  5I5P A;  1XVX A;  2QRY A;  1LBY A;  3B50 A;  4OMB A;  5ITO A;  4FOR A;  1FPK A;  5H8S A;  3ODB A;  4NWD A;  2F36 A;  4KD5 A;  4E0W A;  5AA2 A;  5H8Q A;  2NVU B;  1FPE A;  3N6T A;  4QFO A;  5EQA A;  4WKM A;  4HE1 A;  2HEU A;  2RCA A;  4KFQ A;  4YMB A;  1IEJ A;  2PFY A;  1M5D A;  2QMX A;  3USD A;  3G7W A;  3RT8 A;  3MST A;  4P8B A;  2Q9T A;  3PPO A;  3UP9 A;  2I48 A;  2AYS A;  4OEU A;  2DOJ A;  1FBD A;  4DCX A;  4LON B;  4PFI A;  1BK4 A;  1NV3 A;  1NNT A;  2O68 A;  4OQO A;  4F3S A;  3SEX A;  4JWY A;  3MYU A;  1WOD A;  4GVO A;  1FQC A;  2FBP A;  3VVF A;  1TFA A;  2W7Y A;  4XKR A;  2O7U A;  3PUZ E;  2REJ A;  1QKB A;  3S9N C;  1SQY A;  1B2H A;  4OTE A;  5KCJ B;  4YB6 A;  1GGG A;  1MY1 A;  4BDL A;  1PEB A;  2QMW A;  4X48 A;  5J1D A;  5TPA A;  3MWB A;  2OK2 A;  2H9B A;  1SPI A;  2R6G E;  1FPJ A;  1OLC A;  2P0S A;  3GBB A;  3MZB A;  4FEC A;  1BIY A;  2F6G A;  4DXB A;  3MPK A;  1POY 1;  1IME A;  3FD3 A;  3IK6 B;  3MQ9 A;  5FHM A;  5I58 B;  1SW1 A;  1DBZ A;  1MXZ A;  4PFY A;  2DVZ A;  4DCY A;  2QS3 A;  1MXU A;  4N81 A;  5H8H B;  3ZSF A;  3OOA A;  3QXM A;  2I6E A;  5CMK A;  2OPD A;  3PPQ A;  3O97 A;  4G61 A;  2GQ1 A;  1JEV A;  4G4P A;  4KI0 E;  3UIF A;  3Q25 A;  4EQ9 A;  4GWX A;  5KDT A;  1SDX A;  5I2N A;  4O3A A;  4GLI A;  4IY6 A;  3TTL A;  4UAC A;  3E9X A;  4AQ4 A;  4XTC Q;  4P3L A;  2GFE A;  3UA8 A;  4GQO A;  3KJ7 A;  3B6T A;  5DVJ A;  1MG1 A;  1US4 A;  2I0B A;  4IR8 A;  1B05 A;  1KWH A;  5HBC A;  2AL5 A;  2O1L A;  4G68 A;  3RN8 A;  4MFI A;  1PBP A;  2PT1 A;  3RPL A;  2YPN A;  4MNI A;  2Z8D A;  4JSO A;  2Z22 A;  4O3C A;  1NV4 A;  2UXA A;  3K02 A;  2VGQ A;  3K0V A;  1HSJ A;  4GWY A;  4YKP A;  3U1O A;  1Y1Z A;  1MRP A;  3VXC A;  1INP A;  4XKQ A;  3TEL A;  1MH3 A;  3D4C A;  5JK4 A;  4NF4 B;  5AA4 B;  3FXU A;  3TUS A;  4OAN A;  5A5X A;  2Q2C A;  3K00 A;  3TOD A;  3RLF E;  2B65 A;  1P1W A;  4YIC A;  2QJE A;  4TLM B;  1EZ9 A;  1P1Q A;  4NF5 B;  3TKD A;  4QFP A;  1MXY A;  3CIJ A;  1B5J A;  2CEY A;  2O6A A;  3U8Q A;  1SYH A;  4GX6 A;  1CNQ A;  2FNC A;  2WKY A;  3N6U A;  2ANJ A;  1XHY A;  4I40 A;  3B7D A;  1NV1 A;  1NUZ A;  3DP4 A;  2G93 A;  4IO4 A;  4U1Z A;  2XXX A;  1MY4 A;  3K4U A;  2ZNT A;  4F19 A;  1VFD A;  4AS4 A;  1QUI A;  1SD3 A;  2I3V A;  3TQL A;  2A5S A;  3TTR A;  4RA1 A;  4PDH A;  2VD2 A;  3G3I A;  1A40 A;  5CMM A;  2VPO A;  2WBD A;  4ZZE A;  3Q27 A;  3LUY A;  4O7I A;  3KC1 A;  5TP9 B;  3O6I A;  3W9V A;  2XD2 A;  3CFX A;  4PBH A;  4I3Y A;  2HQ0 A;  2LAO A;  2G29 A;  5TU0 A;  1SBP A;  1ZMG A;  2UYE A;  1ZLQ A;  2DVC A;  1M5E A;  1OIB A;  4ZED A;  4R6Y A;  1O64 A;  4NF8 A;  4AS5 A;  1KA0 A;  3U65 A;  1US5 A;  5B7D A;  3VXB A;  1ATG A;  4F29 A;  3PU5 A;  1N84 A;  4OVQ A;  3T9H B;  4IY5 A;  1FTO A;  1P1O A;  2XXT A;  1ZKB A;  4NE4 A;  4BDO A;  4UAB A;  2XWI A;  3S2V A;  1S7Y A;  1DK4 A;  3K2D A;  1NV6 A;  5I3S A;  1OQG A;  1JNF A;  3SDF A;  4N91 A;  3BIG A;  5A5L A;  1B7U A;  1B6H A;  1OVT A;  4QBA A;  1FBH A;  3KFM A;  5ISU A;  4MF3 A;  1LAH E;  3EF7 A;  4GOT A;  1JVY A;  2GRV A;  3O6H A;  3PGF A;  3E3K A;  3FXR A;  1N3W A;  2OBG A;  2Y5K A;  1B1H A;  3C32 A;  1DPE A;  4PFB A;  4RJZ A;  2D21 A;  3TTN A;  2DP8 A;  2HZL A;  5J16 A;  1URD A;  5H8N B;  1Y1M A;  2F5X A;  1B3L A;  1SW2 A;  2Q8J A;  3MZ9 A;  1SW5 A;  3UN6 A;  2MKZ A;  4QRZ A;  1B1X A;  4GL8 A;  4WXJ A;  4H8I A;  1MPB A;  3OO7 A;  4GWO A;  4IO7 A;  4DDD A;  2OJT A;  1OVB A;  4Z7E A;  1FBF A;  1MM6 A;  3HFU A;  2QSX A;  1Y3N A;  1B7H A;  5CRY A;  5HPQ A;  3QUJ A;  2P3V A;  4DE8 A;  4JVC A;  3MP6 A;  2ZNU A;  3JYR A;  2ZZV A;  2OX3 A;  5EHS A;  2OZZ A;  4X1B A;  3IFC A;  2B4L A;  5KCJ A;  1PDA A;  3B6Q A;  4YU0 A;  2I58 A;  5JTY B;  4N4U A;  1RYX A;  5TPA B;  4N13 A;  4RYA A;  1AL3 A;  2FIX A;  1DCU A;  4GFR A;  3HV1 A;  2V3Q A;  3PUV E;  5CBR A;  2CZI A;  3EQ1 A;  4ELO A;  1DSN A;  1NH8 A;  1D9Y A;  3JZJ A;  2QPQ A;  3HCQ A;  3N26 A;  3KG2 A;  3OEL A;  2F78 A;  4PCD A;  2OWS A;  4PQJ A;  3N5L A;  3D1R A;  4KYE A;  3SEV A;  1A8E A;  4PAF A;  3I5O A;  1LFI A;  3OEK A;  1IIT A;  3Q29 A;  4FEB A;  3LC8 A;  1NV0 A;  2Q88 A;  4QFK A;  5I58 A;  1O63 A;  3U72 A;  3C33 A;  1Y4C A;  3KN3 A;  1TWY A;  3IAZ A;  4DXU A;  4P56 A;  1SVX B;  4FED A;  2KR0 A;  3K1N A;  5ICQ A;  2QS2 A;  4TLL B;  4XIG Q;  5EQ9 A;  3PMX A;  5L9O A;  1B4H A;  1MXX A;  3T9U A;  3Q26 A;  3C4M A;  2V3U A;  3H6V A;  3K6U A;  3F11 A;  3H4Z A;  1QUK A;  2DWA A;  4JBZ A;  4O7M A;  5I57 B;  1UIU A;  3IL1 B;  3T9V A;  1Z7M E;  2XXU A;  4EXL A;  3C9H A;  1MH4 A;  1NNF A;  2ONS A;  3H6U A;  4MJO A;  3ILU B;  4BDM A;  1HSE A;  2KLF A;  4QSD A;  3S4U A;  3R26 A;  2ZZX A;  3W9W A;  1YZ0 A;  1L5T A;  4OEN A;  2NUV A;  1LBC A;  3IJO B;  2ONR A;  1FRP A;  1FQD A;  3H06 B;  1Y9U A;  4NF8 B;  3FV1 A;  4Q30 B;  4PC9 A;  1XC1 A;  3KGC A;  2XX9 A;  5LDZ A;  2VP1 A;  3LR1 A;  2DWH A;  2WX9 A;  4NQ8 A;  4PFW A;  3ISP A;  3CG3 A;  3BKI B;  5I2K A;  1NV5 A;  5I59 B;  3GBA A;  4NGU A;  3C31 A;  1H76 A;  3SET A;  4OFL A;  5AA2 B;  5H8Q B;  3H3G A;  4FAJ A;  1NMU A;  3K1M A;  1Y20 A;  4R9F A;  2Y7R A;  1I6B A;  1D3K A;  1SW4 A;  2R8T A;  5LTC A;  3FXQ A;  4F31 B;  4EDP A;  4ISU A;  4Z0I A;  1MPC A;  1ZIU A;  3LSX A;  1RDX A;  4GXA A;  4KPT A;  3ROJ A;  2P1S A;  2ZYO A;  2F6P A;  5TP9 A;  1AOV A;  4G68 C;  3PPN A;  2DDK A;  2F97 A;  4IO6 A;  4LUB A;  1B5I A;  5I2N B;  4HCW A;  4ESX A;  2E1S A;  5FTH A;  3D4G A;  5I56 A;  1T0K A;  2DWJ A;  5CI5 A;  1FBG A;  4LZ7 A;  4OVJ A;  1R6Z A;  1LBX A;  3TTM A;  3U93 A;  3CSG A;  1LFG A;  2I0C A;  5JEI A;  5CMB A;  2ZYN A;  3ILT B;  5FHO A;  4OZ9 A;  3RY3 A;  2QVU A;  3FVN A;  3RPW A;  4P1E A;  3SEU A;  4GX3 A;  2RC7 A;  1D4N A;  3RNN A;  4FIM A;  4H6D A;  4EQB A;  3TMG A;  4F1V A;  4M4G A;  1IXG A;  5A5X B;  1YXI A;  1QVS A;  2XWO A;  3O28 A;  4GD5 A;  3PV0 E;  2QVV A;  2RC9 A;  1B3F A;  2ALU A;  5JTY A;  3TEP A;  4O3B A;  4U4S A;  4LVQ A;  2F7C A;  4DIG A;  2I4C A;  4G8M A;  4NF4 A;  4EF2 A;  5F24 A;  1OLA A;  2UVG A;  5AA4 A;  4U23 A;  5BWJ A;  3CFZ A;  1P1N A;  1B46 A;  4JSD A;  4ELQ A;  2D5W A;  4PAK A;  4NG7 A;  2QS1 A;  1URG A;  2DXY A;  2HAV A;  2Y7W A;  4DI3 D;  2DE3 A;  2O51 A;  1EYI A;  5L8D A;  2XWK A;  4GXS B;  3OSQ A;  4XEQ A;  3LSF B;  2ZYK A;  4MH5 A;  3DLN A;  3O66 A;  4NN3 A;  3IX1 A;  1FTJ A;  4P1L A;  1OMP A;  3VLV A;  3SEW A;  1Z7N E;  4YAH X;  3KN7 A;  5H8F B;  2XXV A;  3RYD A;  3VE1 B;  1TT1 A;  4R2B A;  3NOH A;  4U21 A;  4KYD A;  3P7I A;  4F1U A;  3W15 C;  3DP6 A;  4R74 A;  3C34 A;  4OFJ A;  3OO8 A;  5EYF A;  5HM4 B;  1UTH A;  3S9M C;  3PUX E;  1FPB A;  2F8D A;  2DWI A;  1XOC A;  4BLA A;  4MIJ A;  1LLS A;  4DZ1 A;  1PC3 A;  4I8C A;  4U2R A;  3UGW A;  1B4Z A;  4ZEK A;  3CR9 A;  3TQW A;  1FPF A;  1DPP A;  3C35 A;  4FBP A;  2Y84 A;  1M5F A;  3BFT A;  1IXH A;  3VVD A;  2KQZ A;  5IKB A;  2H98 A;  4QF9 A;  1XI6 A;  2FA7 A;  4RPN A;  2XXR A;  5AA1 A;  4LQ5 A;  1K9Y A;  3E78 A;  2B4M A;  4MEV A;  4PF8 A;  3JV9 A;  1IUD A;  2CZK A;  2CZL A;  2DE2 A;  4GX4 A;  1FCK A;  4NHB A;  4I1D A;  1IZ1 A;  3IOW A;  3C36 A;  3SEY A;  3WAF A;  1FTL A;  1MDQ A;  1YAE A;  2RF1 A;  1BP5 A;  1FPI A;  2XXW A;  3KJT A;  1LB9 A;  5FTI A;  1FJ6 A;  4KHZ E;  4YB5 A;  2BJJ X;  2WYK A;  5KZT A;  1EYK A;  4N8Y A;  4FE8 A;  1H3D A;  1YCJ A;  2R71 A;  2OPE A;  3SKP A;  4PTK A;  4IO5 A;  1NUX A;  5FBP A;  3IO4 A;  4POW A;  1FBE A;  1WDN A;  4NTL A;  3R7X A;  2V25 A;  3LUZ A;  1DTZ A;  4ZE9 A;  4GBW A;  3GZG A;  4G77 A;  3PMV A;  1FPD A;  3CG1 A;  3K6V A;  3MUQ A;  5EYH A;  5AA3 A;  4K3F A;  3MZ1 A;  1FSA A;  3QIM A;  5IM2 A;  2X26 A;  4PET A;  4EQ7 A;  1H45 A;  3B8B A;  4H65 A;  3HST A;  3TDJ A;  4ZE8 A;  5IZ3 B;  2OLB A;  1WVJ A;  5ET5 A;  2HCA A;  3FJ7 A;  4NF6 A;  2XD3 A;  3QSL A;  4YKI A;  4PGP A;  4ELR A;  5DTB A;  4ESW A; 
#chains in the Genus database with same CATH homology
 1YXI A;  3E79 A;  3EKI A;  3MST A;  4HCY A;  4P3L A;  2Q9T A;  4P8B A;  3D1R A;  4PC9 A;  4PFB A;  2KQZ A;  3LV0 A;  2XWO A;  1Q9D A;  1FBC A;  4I3E A;  1XI6 A;  1IMC A;  2QVV A;  1IMA A;  4PAF A;  2HZL A;  5J16 A;  4N15 A;  1FBD A;  1FPL A;  2WBB A;  2PCR A;  4GBV A;  1D9Q A;  2DE4 A;  4PDH A;  3BIH A;  4DI4 B;  5LDZ A;  1RDY A;  2HZK A;  4PE3 A;  1FBP A;  1K9Y A;  1NUW A;  4GWZ A;  2HHM A;  4MCO A;  4MHF A;  2OWZ A;  4OVP A;  1BK4 A;  1NV3 A;  2F5X A;  4XF5 A;  4NAP A;  4IR8 A;  2B4M A;  1NV0 A;  4MEV A;  4GWW A;  2WX9 A;  1NV7 A;  4PF8 A;  4XFE A;  4DI3 D;  3MYU A;  2CZK A;  2MKZ A;  2VPO A;  4JVD A;  2DE2 A;  4NQ8 A;  1FPG A;  4N6K A;  2QFL A;  3ISP A;  4MMP A;  2FBP A;  2WBD A;  1EYJ A;  5F24 A;  4GX4 A;  3RPL A;  2Q74 A;  4O7I A;  1IMD A;  4MNI A;  3QMF A;  4NHB A;  3KC1 A;  4HE2 A;  4P56 A;  1NV5 A;  1RDZ A;  4NGU A;  3W9V A;  4LN5 A;  4MNC A;  2KR0 A;  2ZZW A;  2JJK A;  2XA5 A;  1NV4 A;  3E78 A;  3T0J A;  4PBH A;  3CHG A;  5EQ9 A;  5EQ8 A;  4I3Y A;  4JVI A;  4OVS A;  1FPI A;  4MAG A;  4YZZ A;  1FBF A;  2QVR A;  4PFI A;  5J1D A;  4KXP A;  2VT5 A;  3HFU A;  4NG7 A;  4PAK A;  3A29 A;  4GWY A;  1IMB A;  1FJ6 A;  5IZ1 A;  2R8T A;  1SPI A;  4N8G A;  5LTC A;  1INP A;  2FIE A;  5ET7 A;  5EYG A;  4AS5 A;  1KA0 A;  2HPG A;  2WYK A;  4PFR A;  4X8R A;  1EYK A;  2P3V A;  2DE3 A;  3U65 A;  4O7M A;  1FPJ A;  4N8Y A;  2WYP A;  2V4C A;  4PF6 A;  4JVC A;  5JK4 A;  4MNP A;  1IMF A;  1NI9 A;  1LBV A;  1EYI A;  4X9T A;  1RDX A;  3IFA A;  2XWK A;  4HE0 A;  5I7I A;  4OAN A;  3ROJ A;  4PTK A;  4XEQ A;  2ZZV A;  2CEX A;  1KA1 A;  3FXB A;  3GYY A;  1NUX A;  2OX3 A;  5FBP A;  4OVQ A;  1FBE A;  4NF0 A;  2P3N A;  3IFC A;  1FTA A;  5IZ3 A;  2B4L A;  1G0H A;  1NUY A;  4NN3 A;  1JP4 A;  2F3D A;  5DW8 A;  4M1V A;  4P1L A;  4OVT A;  5ET8 A;  4PDD A;  3LUZ A;  4UAB A;  2L5V A;  4GBW A;  4GWU A;  4N4U A;  4O8M A;  1IME A;  4PGN A;  4X04 A;  4YIC A;  2VPN A;  2DDK A;  4H46 A;  1LBW A;  1FPD A;  1VDW A;  3RYD A;  4NX1 A;  1YYZ A;  1FJ9 A;  4MJO A;  2XWI A;  1G0I A;  3KC0 A;  2FHY A;  5EQ7 A;  2BJI A;  5EYH A;  3KBZ A;  4HCW A;  1AWB A;  1DK4 A;  1DBZ A;  3FBP A;  4MX6 A;  1NV6 A;  5I5P A;  5I3S A;  1FSA A;  3NOH A;  5IM2 A;  1LBY A;  4QXD A;  2XXK A;  2DVZ A;  3B50 A;  4F18 A;  2FIX A;  4N81 A;  2CEY A;  4N91 A;  4PET A;  4F1U A;  1DCU A;  2ZZX A;  5ET6 A;  1FBG A;  1FPK A;  5CM6 A;  4N17 A;  3B8B A;  3BIG A;  5A5L A;  2CZH A;  1LBX A;  1NV2 A;  4GWS A;  4GX6 A;  4O94 A;  4OVR A;  3W9W A;  4QBA A;  1FBH A;  1YZ0 A;  4P47 A;  5ESY A;  5IZ3 B;  4HXV A;  2V3Q A;  4OA4 A;  1KZ8 A;  1CNQ A;  5ET5 A;  4PBQ A;  3T1B A;  1FPE A;  1FPB A;  2Q8M A;  1LBZ A;  4G61 A;  2CZI A;  2GQ1 A;  5EQA A;  4HE1 A;  4MIJ A;  1LEV A;  2QVU A;  4GWX A;  2WEF A;  2Y5L A;  1K9Z A;  4I40 A;  3PTY A;  1FRP A;  1NV1 A;  1NUZ A;  5IGA A;  2FVZ A;  1QGX A;  4P1E A;  2HXR A;  2PFY A;  2QPQ A;  5T3J A;  4N6D A;  4PAI A;  3SZP A;  5IZZ A;  4GX3 A;  2XWV A;  4P9K A;  4F19 A;  4PGP A;  1FPF A;  4H45 A;  2PFZ A;  3RPL B;  4AS4 A;  2F3B A;  2Y5K A;  4FBP A;  4F1V A;  4PCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...