2Y5KA

Orally active aminopyridines as inhibitors of tetrameric fructose 1,6- bisphosphatase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
327
structure length
319
Chain Sequence
b'DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
publication title Orally Active Aminopyridines as Inhibitors of Tetrameric Fructose-1,6-Bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 103
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2y5kA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2y5kA02
1YYZA 1FPDA 4GWWA 5ET5A 4AS4A 3D1RA 1NUZA 1LBZA 4G61A 5ET8A 5EQ9A 5ESYA 1INPA 2Y5KA 5EYGA 5IZ3B 4FBPA 5I3SA 2Q74A 1FPKA 1FPBA 1LBYA 3RPLB 1JP4A 1G0HA 1LEVA 1FBHA 1FPEA 1RDXA 4GWZA 1FBPA 5T3JA 4I3EA 2FBPA 1EYKA 3IFCA 1NI9A 1IMEA 4AS5A 1CNQA 3A29A 4IR8A 2VT5A 2FIEA 1IMCA 1LBXA 5FBPA 2OX3A 1NUXA 2JJKA 1LBWA 1DBZA 5EQAA 1AWBA 1FBEA 1FPJA 1FSAA 1NV2A 4H46A 1FBCA 2F3BA 2PCRA 1FPLA 4HE1A 2Q8MA 1FBDA 2CZKA 1YZ0A 1NV0A 1YXIA 2WBDA 5J16A 2Y5LA 1BK4A 3BIHA 5ET6A 3KC1A 1KA0A 3KBZA 1NV7A 3RYDA 1FBGA 1NV6A 1XI6A 4I40A 4GBWA 2F3DA 2FHYA 3KC0A 3B8BA 1SPIA 1D9QA 1FRPA 1KZ8A 5ET7A 2CZHA 1IMFA 3BIGA 4GWYA 1DCUA 1QGXA 4GBVA 2CZIA 2OWZA 1IMBA 2GQ1A 1DK4A 3IFAA 5EQ7A 2QVRA 4H45A 5A5LA 1EYJA 1FJ9A 1Q9DA 3QMFA 4KXPA 1NV3A 3LV0A 5F24A 2QVUA 4GX6A 5IZ3A 2HHMA 2R8TA 1NUWA 5DW8A 5EQ8A 5LDZA 3RPLA 4GWXA 3ROJA 2BJIA 1IMAA 2QFLA 4PTKA 1FPIA 1LBVA 3FBPA 1FPFA 4MJOA 1K9YA 1FJ6A 2QVVA 1G0IA 1FBFA 2FVZA 4GWUA 1K9ZA 2P3VA 1NUYA 1NV1A 1IMDA 2DDKA 3T0JA 1NV4A 4HXVA 4GX4A 4O7IA 2WEFA 1EYIA 4GWSA 4I3YA 1FPGA 2P3NA 2FIXA 3LUZA 1FTAA 1KA1A 1RDZA 4N81A 5EYHA 1NV5A 1VDWA 4GX3A 5IZ1A 4HE2A 4QXDA 1RDYA 4HE0A 2WBBA
chains in the Genus database with same CATH superfamily
3MZ9A 3QXMA 1XT8A 4AS4A 3QAXA 5H8HB 3K00A 3FVKA 4ZEDA 5I2NA 3FXQA 3PPPA 4G8MA 5EHSA 3JZJA 2RKMA 1LBYA 4PCDA 4YKKA 1LEVA 4EXLA 1A55A 5T3JA 3RT6B 3PUYE 4ELOA 2FBPA 2CEYA 1CNQA 4XIGQ 3VFJA 1S9TA 4YU0A 5TP9B 4N13A 1Y3QA 3QK6A 1O64A 3H6TA 4NX1A 1IITA 3MYUA 5KDTA 4BDOA 3K01A 4P8BA 4R6KA 1UIVA 2Y7KA 2CMOA 1MXWA 2VOZA 3MW0A 1NV0A 1YXIA 1QVSA 2RCAA 3CR9A 5I2NB 4BDMA 3BIHA 2HPGA 2I0CA 3KC1A 2XWOA 4I62A 2F35A 3S9NC 2PYYA 1NV6A 2Y7IA 2DP8A 3B8BA 1IXCA 1XOCA 4JSOA 4GBVA 4NWCA 2GQ1A 1XHYA 1RYOA 2NXOA 4JXIA 2XA5A 4NAPA 4YB5A 2F36A 5KDTB 3AXFA 1MQHA 4YKPA 3QUFA 3ROJA 3HO7A 3MZBA 4JVDA 1LFIA 1FPFA 5DTBA 3MZ1A 1SBPA 3LR1A 3KN7A 1GGGA 3EN3A 4O7IA 4DDDA 3PUZE 2F7CA 4BDRA 4QFOA 5CBSA 1VDWA 1DPPA 1YYZA 1FPDA 2XXHA 1O63A 1QULA 1SYIA 2L5VA 1MY2A 3RNNA 1WDNA 5ICTA 3V83A 2I0BA 4GWZA 1EYKA 1AOVA 1EU8A 4OVRA 1TT1A 5FBPA 1ZMGA 4O3AA 4RNSA 3C33A 3LSXA 5AA2A 4KFQA 1M5DA 2YLNA 3TCGA 3TTRA 1P1UA 5EQAA 1FPJA 1NV2A 5I56A 3FVGA 3IB2A 3H06B 3GBBA 3IL1B 1FTMA 4EXKA 4LQ2A 5IGAA 1YZ0A 4RPNA 4DI4B 1FQCA 2QMWA 2HQ0A 3U92A 1JQFA 2OK2A 1XI6A 3UP9A 4HCWA 2OPDA 2ZZWA 3GYYA 2CZHA 2DVZA 2OWZA 1B3LA 1LBBA 3RY3A 5AA2B 4H45A 4M4GA 4ZZEA 3ZKLA 4LVQA 2XXIA 3FJ7A 5I59A 2QVUA 1MY3A 5I56B 2Z8FA 3PUVE 1H76A 3E78A 3FBPA 5AA1A 2H5YA 4PAKA 4YAHX 4F18A 1MXVA 3O6IA 1N0TA 4GOTA 3LSLA 1TFDA 4KHZE 4OEVA 3RGYA 1LBZA 2D5WA 3IJXB 5I59B 3A3CA 4MHFA 4F31B 1PB9A 4IB2A 2BJJX 3MP8A 3TDJA 4POWA 2XXXA 4ND9A 3C9HA 3PPNA 1YPNA 1LBXA 4C0RA 3I5OA 3KOSA 3ZSFA 1FQFA 2JJKA 2REJA 1PBPA 4O8MA 1FCKA 4XKRA 4H0WA 3ONMA 3CSBA 1OQGA 5A5XA 2VD2A 4C1TA 2IEEA 2R6GE 1JW1A 3E3KA 5CMBA 4MX6A 3HV1A 1NV7A 3H03A 3PUXE 5H8FB 4PFTA 4LN5A 1OLCA 1DSNA 2DWHA 5AA3A 2V3QA 4NGUA 3SEXA 1USYH 4PC9A 1QGXA 3K2DA 2ZYNA 2DWIA 4JVIA 4P11A 1EYJA 3QMFA 4POXA 3Q29A 1FW0A 4X1DA 3C4MA 1BLFA 5DW8A 4RK9A 4R6HA 1R9LA 5A5XB 4PQJA 1XS5A 4LQ5A 2REGA 3CFXA 2QVVA 4GWUA 4GFRA 4IY6A 1NV1A 1NV4A 2XD2A 4H8JA 2HZKA 2PT1A 2DQVA 3MJNA 1B3FA 1B4ZA 1FTAA 2AIXA 4LONB 4F2OA 2QS1A 2O6AA 4OENA 1B3EA 1EZOA 4M1VA 1B4HA 3H3GA 5H8SA 4EUOA 4P0IA 3E13X 2V4CA 5I3SA 4OVSA 3V89B 3TQWA 4P47A 1JP4A 1JNFA 5I5PA 4BDNA 3TAJA 4ESXA 4MEVA 3FGSA 3LSWA 1LBWA 2GHBA 1DBZA 2DOJA 4HS7A 5AA2D 2PCRA 1FPLA 4HE1A 2B4MA 1FBDA 1POTA 3VXCA 2B3FA 1FTKA 1B3GA 4G8NA 4ESWA 1VFDA 4GF8A 4PBHA 3K6VA 2E1SA 1EZPA 2H98A 1QUKA 3KGCA 3O66A 4N8YA 4GBWA 3TTLA 1LCTA 2AYSA 4GRKA 5I2KA 3M3FA 2CZIA 3CG3A 3KSXA 4KPTA 2P2AA 4MLQA 2XX7A 4NN3A 4GL8A 3H7MA 3H4ZA 4PTKA 3EHTA 1I6QA 3T9VA 3BKIB 1K9YA 2P3VA 2HCAA 1TXFA 3M3LA 4JWYA 3IO6A 5L9SA 2PMSA 3VLVA 4FJPA 3PD8A 5I2KB 1KA1A 4RJZA 1B46A 5ITPA 1D3KA 2QS4A 4QXDA 4HE0A 4P0GA 3FUZA 4F3BA 1B52A 5TPAA 4H5FA 1TFAA 4F3GA 2A5TA 2XXVA 4QRZA 1SYHA 4YICA 2DXYA 4XF5A 3TZAA 4NF6A 3TCFA 4OVTA 2XXYA 4QFPA 4Z7EA 4OA4A 1MRPA 4ZEKA 1PB7A 4NF5A 5TPAB 4IO5A 4H6DA 4DZ1A 3MPKA 3KBRA 5ET6A 5IKBA 3LC8A 1YCJA 3UA8A 4IGRA 1IMFA 1ELJA 1B5JA 2GFEA 2Z8EA 4NF6B 4RYAA 2I3VA 4IY5A 1P99A 4AB5A 1A8FA 2NUVA 4PFIA 1YAEA 2UVGA 3Q27A 3THIA 4I1DA 4ZECA 4KYSA 1H45A 3MVZA 4NF5B 2I6EA 4IO4A 1OMPA 4DLDA 1DPEA 1JETA 1VFEA 1Y1MA 2OZZA 2ZYOA 2AL4A 3TTKA 3MP1A 3IK6B 2O1LA 3SEVA 1F9BA 3IOTA 1P1NA 3C34A 4GIZA 2Z8DA 3TUSA 2M8CA 2WX9A 5ET8A 4DE8A 3TEPA 2XXPA 3PPRA 1LAHE 1DOTA 1B5HA 1ATGA 4FAJA 1P1WA 4I3EA 1XVYA 2E0SA 3T66A 3VXBA 1PBQA 1SW5A 1IMEA 3KJ7A 1OLAA 1IMCA 4LZ7A 3VVFA 3C32A 1BIYA 3U93A 1Y20A 4X8RA 1LFHA 5F1QA 2DSFA 2Q89A 1OIBA 2CZKA 1A99A 1LB9A 2X26A 1POY1 2Y7PA 4GVOA 4TLLB 2ALUA 4E0XA 1XVXA 3LBSA 4G8HA 1URGA 2OBGA 4MIJA 1T0KA 1D9QA 1FRPA 4R73A 4ONYA 4F29A 3KN8A 5L8DA 2R9JA 2XHDA 3FIRA 4FE8A 1FJ9A 4N6PA 3OOAA 3W9VA 4O7MA 3RLFE 5ELVA 3RQTA 3BFUA 1NNPA 3W9WA 2ANJA 1FBFA 4U22A 3VVEA 4QSEA 2UVIA 4R72A 3TYHA 1EYIA 4L17A 4OHNA 5IZZA 4IGTA 2Y7WA 5EYHA 1NNFA 5ITOA 3D4GA 3RTFB 3HN0A 3PGFA 3OXNA 5ET5A 1LGBC 3SZPA 3CFZA 3TELA 3EKIA 5EQ9A 4EF2A 1Q1KA 1QUJA 4OXVA 4HTGA 2Q74A 1LLSA 3RUMA 2UYFA 1JVXA 4GQOA 1RDXA 1NNKA 2QPQA 5AA4A 4U21A 3U65A 1MH3A 3QIMA 4LATA 1H3DA 1NUXA 1MM7A 4IO3A 1II5A 3SERA 4H46A 3JV9A 2XWKA 3G3FA 1NH8A 4N6KA 3ZS6A 4N15A 2F5XA 2O51A 3IO4A 4OESA 1NNTA 1KA0A 4GXSB 3VLWA 1B7UA 4EQ7A 1MXYA 4FEDA 3I6VA 1SPIA 1KZ8A 5ET7A 1I69A 1SI0A 2X7PA 3RT8A 5AA4B 4GWYA 3T22A 3K1PA 4DIGA 3IFAA 2ZYMA 4ZZAA 2QL3A 4PDDA 5CMMA 5EQ8A 3GBAA 2W7YA 3RPLA 3T9UA 4KCCA 1Z7NE 1BP5A 3OENA 5DT6A 4X04A 4THIA 1I6AA 3IX1A 1QKBA 2FVZA 1NUYA 4HXVA 3S9MC 2FNCA 4FEBA 5KZTA 1JW5A 4F19A 4ZEIA 2HAVA 3EQ1A 4I9DA 1NV5A 3DLNA 5I57A 1RDYA 2WBBA 2Z22A 1LAGE 2OWTA 3D1RA 1NUZA 5EHMA 1URDA 3O28A 1FPKA 1FPBA 3RPLB 1SDXA 1WODA 3VVDA 5I58A 3TKDA 5I7IA 1FPEA 4ELRA 4ZE8A 2PFYA 1B58A 5FTHA 2I58A 4KD5A 4PE5B 2FA7A 2KLFA 2WKYA 5H8NA 3FZVA 2OX3A 4JSDA 4P56A 1N7XA 4R9GA 3TTMA 5I57B 2OPEA 4R2BA 3FASA 1VSOA 2IA4A 5H8FA 3K1NA 4R2FA 4OMBA 3GLBA 4Q5TA 2WYPA 2DWJA 4NWDA 4RY1A 3UGWA 5I58B 4DI3D 3IAZA 1A7LA 1MY0A 2F3DA 1IZ1A 2HEUA 4LA9A 3KC0A 4JVCA 2PX1A 3OMBA 3S2VA 4FIMA 1DCUA 3V5AA 2HXRA 5H8NB 4MMPA 1NV3A 3QYTA 4OANA 4Q30B 1PEBA 1RYXA 2HHMA 1N76A 3L6GA 1UTHA 1Y3PA 1MM6A 4KCDA 3L6HA 1AH5A 1B40A 3OO9A 3NOHA 4MBPA 4MAGA 2CZLA 2UVHA 3W15C 1NKXA 1LBVA 1A40A 1N7WA 1G0IA 2QRYA 2VD3A 1MXUA 5CM6A 3E79A 2QS3A 3PPOA 4GX4A 3SESA 2B3BA 4I3YA 2FIXA 1AMFA 4MCOA 4YMBA 4GXAA 2G93A 3BBRA 1FQBA 5IZ1A 1JEVA 4XTCQ 2R71A 2A5SA 2P0SA 4QFNA 1Y4CA 2V25A 4U4SA 4U2RA 2ZYKA 5ESYA 4TQUQ 4GWOA 1UTHB 1ZKBA 3ISPA 2XXUA 3FXUA 4ZDMA 3N6UA 3IFCA 4AS5A 3S9LC 5L9OA 2VT5A 1R1NA 4XXUA 4OFLA 1SW1A 4U1ZA 5CMKA 3Q25A 3FD3A 1FQAA 2CEXA 4G2ZA 2V3TA 3ILTB 4ZEFA 3H6WA 3KFMA 3QUJA 3ILUB 2B4LA 5L9MA 4PP0A 1S50A 4YZZA 4Q0CA 1LFGA 1J1NA 3WAFA 2UYEA 2RC7A 2I4CA 2Q9TA 3G3GA 2FHYA 2YPNA 2O84X 4IO2A 4NF4A 3HCQA 1B32A 4G4PA 3MBPA 4GD5A 3OO6A 2MKZA 4KXPA 4OETA 3DP4A 4F3PA 3LV0A 2F6PA 4OVPA 4PGPA 5LDZA 4U23A 4LZ8A 2GH9A 3CRBA 2I3WA 4JWXA 5IAIA 2UVJA 3FVNA 4YMAA 3IOUA 3RTWB 1K9ZA 2XX8A 3GZGA 1R6ZA 1GTKA 3OO8A 4OWDA 4MH5A 2WEFA 4GWSA 4R6YA 4XKQA 3PV0E 1OVTA 4NF4B 3O2AA 4NQ8A 3DELB 4WEPA 4LUBA 1FQDA 3WAEA 2Q8JA 3K6UA 3MPLA 2G29A 1JW4A 1INPA 5KCJA 2RC9A 1IXGA 4ECFA 1G0HA 3R6UA 3U94A 1LB8A 3H6UA 2DXRA 1Y3NA 4NTLA 1NI9A 3A29A 2DE2A 4PBQA 1IUDA 3G3JA 2I4BA 2XXRA 2Q2AA 4FECA 3C36A 4H67A 1FBEA 3P7IA 1FSAA 3SKPA 3PTYA 2F3BA 2F8DA 3EF7A 1P1QA 1LSTA 1MY1A 2RF1A 5CMCA 2XD3A 4U4XA 3FXRA 4DXBA 5KCJB 3MC2A 3FXBA 3MQ9A 1M5BA 1MS7A 4N4UA 2HXWA 1TWYA 2Y84A 1RKMA 1PDAA 5JTYA 1ZJLA 1JEUA 4WKMA 1R9QA 4KI0E 3S9EA 2HFBA 4PE3A 5A5LA 5HM4B 2VHAA 2F34A 1NUWA 3CFLA 1SW2A 2PBWA 4KQPA 1N04A 3GXAA 1IMAA 2QFLA 1HSEA 3A3UA 3VLUA 3CHGA 1SQYA 4MJOA 2PFZA 4IO7A 2QSXA 1B51A 1MDP1 3M8UA 4YB6A 4UACA 2P3NA 1ZBMA 5EYFA 4N81A 5JTYB 3SEUA 1D4NA 2RCBA 2H4IA 3UN6A 4OYVA 2Y5KA 1MQJA 4MF3A 1A8EA 4MFIA 1MQDA 1CB6A 4O94A 4PF8A 1FBHA 4RXLA 1FBPA 1Y1ZA 3MAMA 5TU0A 4QHQA 5F7VA 4IO6A 3IR1A 5DEXA 2XXWA 1MQIA 1HSJA 3OEKA 4GL0A 2KQZA 5ISUA 3E4RA 2XXTA 5CRYA 3ODBA 4FORA 1O7TA 1VR5A 2ESNA 3G3HA 5K2XA 5CBRA 3TCHA 1MQGA 2NOOA 1QW0A 3K6WA 2Y5LA 2V84A 4OVQA 3MP6A 3HHFA 5JEIA 3RYDA 1Q35A 1FBGA 3F11A 3K0VA 3B6WA 1LBCA 3PMWA 4F1YA 1DMBA 1B1XA 4N8GA 2O7IA 3FVOA 5DEXB 1DTGA 4OFJA 3QSLA 5F24A 1UQWA 1EH3A 2R8TA 1WVJA 4ZEBA 3TPAA 1FPIA 4PGNA 5FHMA 1IIWA 1BKAA 4N6DA 1ZLQA 3HSTA 4LZ5A 1LAXA 1MXZA 4E0WA 4JWOA 3Q28A 2AL5A 2NWJA 1EZ9A 5CC2A 2X7QA 2HAUA 2YJPA 4RK2A 4HE2A 3KOTA 4P1EA 2NVUB 2ZMBA 4F2QA 4OERA 3MSTA 1CE2A 1MPDA 3T9XB 1IEJA 3O97A 4JB7A 4C1UA 4IR8A 4OTEA 2ZNSA 4ELPA 1UTBA 3H6VA 4X48A 1OQHA 2RINA 4QSCA 3U1OA 3V8XB 3MUQA 2QMXA 4TOZA 4N91A 2ONKE 4X1BA 2WBDA 2DE3A 1SVXB 2O68A 4YB7A 4MNCA 2F97A 1M5EA 2DYXA 3RN8A 3R26A 4RA1A 4H1XA 1AL3A 1NL5A 4P1LA 1PB8A 3R7XA 3ECRA 1BTJA 2LAOA 3I3VA 1URSA 4QFLA 1MPCA 3O9PA 5HPQA 5LTCA 5I84A 1UTBB 1B1HA 1Y4TA 4XKPA 1S7YA 2VP1A 4KYDA 5IM2A 3FV1A 5FHNA 3U72A 1OVBA 1IMDA 3OO7A 2DDKA 2P1SA 1GV8A 2QS2A 5DYHA 3CVGA 4HW8A 2OLBA 3SDFA 1QKAA 2OWSA 4F22A 5ICQA 3TMGA 4QF9A 4QSDA 2DWAA 4MNPA 4OFOA 4F39A 1MPBA 5HBCA 3LUYA 4PFYA 2KR0A 3VDFA 3IB1A 1H43A 5B7DA 4PDHA 1QUIA 1B7HA 3G3IA 3CIJA 3IOVA 3TTNA 2FIEA 4H65A 3FV2A 4O3BA 4N17A 3S4UA 2GRVA 1FBCA 4NHBA 3PPQA 4G68A 3KSJA 4NE4A 4TLMB 1NFTA 5J16A 4YKIA 1P1OA 3Q26A 2F7BA 1SD3A 3BFTA 4P9KA 1IXHA 2RC8A 2ONSA 4AQ4A 1YTVA 2ZZXA 2OJTA 1IMBA 3O6HA 1DK4A 2THIA 2ZNUA 2QVRA 2V3UA 1Q9DA 3C31A 4F1UA 1UIUA 3B6TA 3HPIA 2XWVA 1US5A 4G68B 4G77A 3EHSA 5DVIA 1LAFE 4R75A 5FHOA 3MVWA 3SETA 1M5FA 5DVJA 4WXJA 2F6GA 3B6QA 5H8QA 3N26A 4GWWA 3O6GA 4G61A 2D3IA 1I6BA 1B0HA 2VPOA 5EYGA 2WYKA 1ZTYA 4WEDA 2V93A 3SEYA 4MLVA 4NF8A 4PFUA 3UK4A 4BLAA 2Q2CA 1XC1A 3T93B 1PC3A 2Z23A 2ZNTA 4RPOA 3G3KA 1AWBA 4I8CA 3C35A 2Q8MA 5H8QB 3T9HB 4MNIA 2XX9A 1GR2A 1BK4A 3VV5A 3M3KA 4NF0A 4PF6A 2UXAA 3KBZA 4PFWA 4G68C 3HFUA 3UORA 3K1MA 2Y7RA 4ZS9A 3PU5A 2ONRA 4NF8B 4I40A 2PVUA 1USYE 3IJOB 5J1DA 5B70A 3D4CA 1B2HA 4ZE9A 2D21A 4PFBA 4XFEA 4ELQA 2H99A 2OCUA 3OEMA 4H8IA 1B7ZA 1US4A 3FATA 2O69A 1MY4A 3EPEA 4U1OA 3PMVA 3SEWA 1N3WA 1FQEA 1MDQA 3TFLA 4KYEA 3T0JA 2H9BA 2Q88A 4BDLA 3MVXA 3LUZA 1ZIUA 1RDZA 1MXXA 2B65A 3A09A 3DP8A 4GX3A 4QBAA 2DS9A 1IXIA 2DVCA 1MG1A 4O3CA 2I49A 3K4UA 2O7UA 4FBPA 4OZ9A 2GHAA 3PMXA 1D9VA 4F1VA 5BWJA 2XXKA 1FTLA 3USDA 2H25A 1AIVA 5K2YA 3PD9A 3N6TA 3T1BA 4OEUA 3LSFB 4PETA 1B9JA 5FTIA 3CI8A 1SI1A 4FATA 4DXCA 1LCFA 4NEDA 1L5TA 1B3HA 1SW4A 3K02A 3PUWE 4UA8A 3OELA 4XKNA 3T96B 2FYIA 3KN3A 3BIGA 4EQ9A 3RPWA 5M2VA 4R74A 3OSQA 1N3XA 3G7WA 3OSRA 3CSGA 4GX6A 1GVCA 5IZ3A 1M5CA 2I48A 3KEIA 4GWXA 2XWIA 1Y9UA 3KJTA 4Q8RA 1FJ6A 1ANFA 4KR5A 1IQ7A 4OQOA 3DM0A 3VE1B 4PAIA 2HZLA 4NMYA 4R9FA 4DCYA 2PT2A 4JBZA 3IORA 2F7AA 1D9YA 2XXQA 5DVFA 4DXUA 1FTOA 5CI5A 3B7DA 1VE4A 3IOWA 1DTZA 3IB0A 5IZ3B 1B0LA 1NH7A 1N84A 2DE4A 3CG1A 4N07A 2VPNA 2A5TB 1B6HA 3O29A 1H44A 4QFKA 3TODA 3MWBA 4K3FA 3N5LA 3K6XA 3UIFA 3EHUA 4UABA 3ZKKA 4F3SA 2ZZVA 2VGQA 3B50A 1NMUA 4HCYA 4EDPA 4EQBA 4OVJA 4JDFA 1B05A 4NG7A 4GLIA 1ZU0A 4Z0IA 5JK4A 3JYRA 3U8QA 3KZGA 4LP2B 3DP6A 3FJMA 3FJGA 4PAFA 3KG2A 1QJMA 4YKJA 5AE4A 5EQ7A 1FTJA 5H8HA 2QJEA 3MVYA 4ISUA 1JVYA 1B5IA 2BJIA 2ABHA 3E9XA 4H5GA 1Z7ME 2F78A 4P3LA 4EF1A 1MH4A 4X9TA 4BDQA 5LOMA 1HSLA 2ZXTA 4PFRA 1KWHA 5TP9A 3OD7A 3TQLA 5BUUA 3N94A 1FPGA 1A54A 4XEQA 2O1MA 4AB6A 4DCXA 3HHGA
chains in the Genus database with same CATH topology
4AS4A 5ESYA 4MNPA 3ISPA 1LBYA 2KR0A 4PCDA 1LEVA 5T3JA 4PDHA 2FBPA 2CEYA 3IFCA 4AS5A 1CNQA 4YICA 4XF5A 2VT5A 2FIEA 4OVTA 2CEXA 4NX1A 4N17A 3MYUA 1FBCA 4OA4A 4NHBA 4P8BA 2B4LA 1NV0A 1YXIA 5J16A 4YZZA 3BIHA 2HPGA 5ET6A 3KC1A 2XWOA 4P9KA 1NV6A 2Q9TA 2FHYA 3B8BA 1IMFA 4GBVA 2ZZXA 1IMBA 2GQ1A 1DK4A 2QVRA 1Q9DA 2MKZA 4KXPA 4F1UA 3LV0A 2XA5A 4NAPA 4PFIA 4OVPA 4PGPA 2XWVA 5LDZA 3ROJA 4JVDA 1FPFA 1K9ZA 4O7IA 2WEFA 4GWSA 1VDWA 4NQ8A 1YYZA 1FPDA 4GWWA 2WX9A 4G61A 5ET8A 1INPA 2VPOA 5EYGA 2L5VA 2WYKA 1G0HA 4GWZA 4I3EA 1EYKA 1NI9A 1IMEA 3A29A 2DE2A 4OVRA 1IMCA 5FBPA 4PBQA 4X8RA 5EQAA 1AWBA 1FBEA 1FPJA 1FSAA 1NV2A 3PTYA 2F3BA 2Q8MA 2CZKA 4MNIA 5IGAA 1YZ0A 1BK4A 4DI4B 4NF0A 3FXBA 4PF6A 3KBZA 4N4UA 3HFUA 1XI6A 4I40A 4MIJA 4HCWA 2ZZWA 5J1DA 1D9QA 1FRPA 3GYYA 2CZHA 2DVZA 2OWZA 4PE3A 4H45A 5A5LA 4PFBA 1FJ9A 4XFEA 2QVUA 1NUWA 3W9VA 4O7MA 1IMAA 2QFLA 3E78A 3CHGA 3FBPA 3W9WA 4MJOA 4PAKA 1FBFA 2PFZA 4F18A 3T0JA 1EYIA 2P3NA 3LUZA 5IZZA 1RDZA 4N81A 5EYHA 4GX3A 4QBAA 3SZPA 5ET5A 1LBZA 3EKIA 5EQ9A 2Y5KA 4FBPA 2Q74A 4MHFA 4O94A 4PF8A 1FBHA 1RDXA 1FBPA 4F1VA 2QPQA 2XXKA 3U65A 1LBXA 1NUXA 2JJKA 3T1BA 4O8MA 4H46A 2KQZA 2XWKA 4PETA 4N6KA 4N15A 2Y5LA 2F5XA 4OVQA 4MX6A 1KA0A 1NV7A 3RYDA 1FBGA 4LN5A 2V3QA 1SPIA 1KZ8A 5ET7A 4NGUA 3BIGA 4GWYA 4PC9A 1QGXA 4N8GA 4JVIA 3IFAA 1EYJA 3QMFA 5F24A 4PDDA 4GX6A 5IZ3A 2R8TA 5DW8A 5EQ8A 3RPLA 4GWXA 2XWIA 1FPIA 4PGNA 4X04A 1FJ6A 2QVVA 2FVZA 4GWUA 4N6DA 1NUYA 1NV1A 4PAIA 2HZLA 1NV4A 4HXVA 2HZKA 4F19A 1FTAA 1NV5A 4HE2A 1RDYA 2WBBA 3D1RA 1NUZA 4P1EA 4M1VA 5IZ3B 2V4CA 5I3SA 4OVSA 3MSTA 1FPKA 4P47A 1FPBA 3RPLB 1JP4A 5I5PA 5I7IA 1FPEA 2DE4A 2PFYA 2VPNA 4IR8A 4MEVA 2OX3A 4P56A 1LBWA 1DBZA 2PCRA 1FPLA 4HE1A 4UABA 2B4MA 1FBDA 4N91A 2ZZVA 3B50A 2WBDA 2DE3A 4HCYA 2WYPA 4MNCA 4DI3D 4NG7A 4P1LA 4PBHA 4N8YA 4GBWA 2F3DA 5JK4A 3KC0A 4JVCA 4PAFA 1DCUA 2HXRA 2CZIA 4MMPA 5EQ7A 5LTCA 1NV3A 4OANA 2HHMA 4NN3A 3NOHA 2BJIA 4MAGA 4PTKA 5IM2A 1LBVA 4P3LA 1K9YA 4X9TA 1G0IA 2P3VA 5CM6A 3E79A 1IMDA 4PFRA 2DDKA 4GX4A 4I3YA 1FPGA 2FIXA 4MCOA 4XEQA 1KA1A 5IZ1A 4QXDA 4HE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYZ A;  1FPD A;  4GWW A;  5ET5 A;  4AS4 A;  3D1R A;  1NUZ A;  1LBZ A;  4G61 A;  5ET8 A;  5EQ9 A;  5ESY A;  1INP A;  2Y5K A;  5EYG A;  5IZ3 B;  4FBP A;  5I3S A;  2Q74 A;  1FPK A;  1FPB A;  1LBY A;  3RPL B;  1JP4 A;  1G0H A;  1LEV A;  1FBH A;  1FPE A;  1RDX A;  4GWZ A;  1FBP A;  5T3J A;  4I3E A;  2FBP A;  1EYK A;  3IFC A;  1NI9 A;  1IME A;  4AS5 A;  1CNQ A;  3A29 A;  4IR8 A;  2VT5 A;  2FIE A;  1IMC A;  1LBX A;  5FBP A;  2OX3 A;  1NUX A;  2JJK A;  1LBW A;  1DBZ A;  5EQA A;  1AWB A;  1FBE A;  1FPJ A;  1FSA A;  1NV2 A;  4H46 A;  1FBC A;  2F3B A;  2PCR A;  1FPL A;  4HE1 A;  2Q8M A;  1FBD A;  2CZK A;  1YZ0 A;  1NV0 A;  1YXI A;  2WBD A;  5J16 A;  2Y5L A;  1BK4 A;  3BIH A;  5ET6 A;  3KC1 A;  1KA0 A;  3KBZ A;  1NV7 A;  3RYD A;  1FBG A;  1NV6 A;  1XI6 A;  4I40 A;  4GBW A;  2F3D A;  2FHY A;  3KC0 A;  3B8B A;  1SPI A;  1D9Q A;  1FRP A;  1KZ8 A;  5ET7 A;  2CZH A;  1IMF A;  3BIG A;  4GWY A;  1DCU A;  1QGX A;  4GBV A;  2CZI A;  2OWZ A;  1IMB A;  2GQ1 A;  1DK4 A;  3IFA A;  5EQ7 A;  2QVR A;  4H45 A;  5A5L A;  1EYJ A;  1FJ9 A;  1Q9D A;  3QMF A;  4KXP A;  1NV3 A;  3LV0 A;  5F24 A;  2QVU A;  4GX6 A;  5IZ3 A;  2HHM A;  2R8T A;  1NUW A;  5DW8 A;  5EQ8 A;  5LDZ A;  3RPL A;  4GWX A;  3ROJ A;  2BJI A;  1IMA A;  2QFL A;  4PTK A;  1FPI A;  1LBV A;  3FBP A;  1FPF A;  4MJO A;  1K9Y A;  1FJ6 A;  2QVV A;  1G0I A;  1FBF A;  2FVZ A;  4GWU A;  1K9Z A;  2P3V A;  1NUY A;  1NV1 A;  1IMD A;  2DDK A;  3T0J A;  1NV4 A;  4HXV A;  4GX4 A;  4O7I A;  2WEF A;  1EYI A;  4GWS A;  4I3Y A;  1FPG A;  2P3N A;  2FIX A;  3LUZ A;  1FTA A;  1KA1 A;  1RDZ A;  4N81 A;  5EYH A;  1NV5 A;  1VDW A;  4GX3 A;  5IZ1 A;  4HE2 A;  4QXD A;  1RDY A;  4HE0 A;  2WBB A; 
#chains in the Genus database with same CATH topology
 3MZ9 A;  3QXM A;  1XT8 A;  4AS4 A;  3QAX A;  5H8H B;  3K00 A;  3FVK A;  4ZED A;  5I2N A;  3FXQ A;  3PPP A;  4G8M A;  5EHS A;  3JZJ A;  2RKM A;  1LBY A;  4PCD A;  4YKK A;  1LEV A;  4EXL A;  1A55 A;  5T3J A;  3RT6 B;  3PUY E;  4ELO A;  2FBP A;  2CEY A;  1CNQ A;  4XIG Q;  3VFJ A;  1S9T A;  4YU0 A;  5TP9 B;  4N13 A;  1Y3Q A;  3QK6 A;  1O64 A;  3H6T A;  4NX1 A;  1IIT A;  3MYU A;  5KDT A;  4BDO A;  3K01 A;  4P8B A;  4R6K A;  1UIV A;  2Y7K A;  2CMO A;  1MXW A;  2VOZ A;  3MW0 A;  1NV0 A;  1YXI A;  1QVS A;  2RCA A;  3CR9 A;  5I2N B;  4BDM A;  3BIH A;  2HPG A;  2I0C A;  3KC1 A;  2XWO A;  4I62 A;  2F35 A;  3S9N C;  2PYY A;  1NV6 A;  2Y7I A;  2DP8 A;  3B8B A;  1IXC A;  1XOC A;  4JSO A;  4GBV A;  4NWC A;  2GQ1 A;  1XHY A;  1RYO A;  2NXO A;  4JXI A;  2XA5 A;  4NAP A;  4YB5 A;  2F36 A;  5KDT B;  3AXF A;  1MQH A;  4YKP A;  3QUF A;  3ROJ A;  3HO7 A;  3MZB A;  4JVD A;  1LFI A;  1FPF A;  5DTB A;  3MZ1 A;  1SBP A;  3LR1 A;  3KN7 A;  1GGG A;  3EN3 A;  4O7I A;  4DDD A;  3PUZ E;  2F7C A;  4BDR A;  4QFO A;  5CBS A;  1VDW A;  1DPP A;  1YYZ A;  1FPD A;  2XXH A;  1O63 A;  1QUL A;  1SYI A;  2L5V A;  1MY2 A;  3RNN A;  1WDN A;  5ICT A;  3V83 A;  2I0B A;  4GWZ A;  1EYK A;  1AOV A;  1EU8 A;  4OVR A;  1TT1 A;  5FBP A;  1ZMG A;  4O3A A;  4RNS A;  3C33 A;  3LSX A;  5AA2 A;  4KFQ A;  1M5D A;  2YLN A;  3TCG A;  3TTR A;  1P1U A;  5EQA A;  1FPJ A;  1NV2 A;  5I56 A;  3FVG A;  3IB2 A;  3H06 B;  3GBB A;  3IL1 B;  1FTM A;  4EXK A;  4LQ2 A;  5IGA A;  1YZ0 A;  4RPN A;  4DI4 B;  1FQC A;  2QMW A;  2HQ0 A;  3U92 A;  1JQF A;  2OK2 A;  1XI6 A;  3UP9 A;  4HCW A;  2OPD A;  2ZZW A;  3GYY A;  2CZH A;  2DVZ A;  2OWZ A;  1B3L A;  1LBB A;  3RY3 A;  5AA2 B;  4H45 A;  4M4G A;  4ZZE A;  3ZKL A;  4LVQ A;  2XXI A;  3FJ7 A;  5I59 A;  2QVU A;  1MY3 A;  5I56 B;  2Z8F A;  3PUV E;  1H76 A;  3E78 A;  3FBP A;  5AA1 A;  2H5Y A;  4PAK A;  4YAH X;  4F18 A;  1MXV A;  3O6I A;  1N0T A;  4GOT A;  3LSL A;  1TFD A;  4KHZ E;  4OEV A;  3RGY A;  1LBZ A;  2D5W A;  3IJX B;  5I59 B;  3A3C A;  4MHF A;  4F31 B;  1PB9 A;  4IB2 A;  2BJJ X;  3MP8 A;  3TDJ A;  4POW A;  2XXX A;  4ND9 A;  3C9H A;  3PPN A;  1YPN A;  1LBX A;  4C0R A;  3I5O A;  3KOS A;  3ZSF A;  1FQF A;  2JJK A;  2REJ A;  1PBP A;  4O8M A;  1FCK A;  4XKR A;  4H0W A;  3ONM A;  3CSB A;  1OQG A;  5A5X A;  2VD2 A;  4C1T A;  2IEE A;  2R6G E;  1JW1 A;  3E3K A;  5CMB A;  4MX6 A;  3HV1 A;  1NV7 A;  3H03 A;  3PUX E;  5H8F B;  4PFT A;  4LN5 A;  1OLC A;  1DSN A;  2DWH A;  5AA3 A;  2V3Q A;  4NGU A;  3SEX A;  1USY H;  4PC9 A;  1QGX A;  3K2D A;  2ZYN A;  2DWI A;  4JVI A;  4P11 A;  1EYJ A;  3QMF A;  4POX A;  3Q29 A;  1FW0 A;  4X1D A;  3C4M A;  1BLF A;  5DW8 A;  4RK9 A;  4R6H A;  1R9L A;  5A5X B;  4PQJ A;  1XS5 A;  4LQ5 A;  2REG A;  3CFX A;  2QVV A;  4GWU A;  4GFR A;  4IY6 A;  1NV1 A;  1NV4 A;  2XD2 A;  4H8J A;  2HZK A;  2PT1 A;  2DQV A;  3MJN A;  1B3F A;  1B4Z A;  1FTA A;  2AIX A;  4LON B;  4F2O A;  2QS1 A;  2O6A A;  4OEN A;  1B3E A;  1EZO A;  4M1V A;  1B4H A;  3H3G A;  5H8S A;  4EUO A;  4P0I A;  3E13 X;  2V4C A;  5I3S A;  4OVS A;  3V89 B;  3TQW A;  4P47 A;  1JP4 A;  1JNF A;  5I5P A;  4BDN A;  3TAJ A;  4ESX A;  4MEV A;  3FGS A;  3LSW A;  1LBW A;  2GHB A;  1DBZ A;  2DOJ A;  4HS7 A;  5AA2 D;  2PCR A;  1FPL A;  4HE1 A;  2B4M A;  1FBD A;  1POT A;  3VXC A;  2B3F A;  1FTK A;  1B3G A;  4G8N A;  4ESW A;  1VFD A;  4GF8 A;  4PBH A;  3K6V A;  2E1S A;  1EZP A;  2H98 A;  1QUK A;  3KGC A;  3O66 A;  4N8Y A;  4GBW A;  3TTL A;  1LCT A;  2AYS A;  4GRK A;  5I2K A;  3M3F A;  2CZI A;  3CG3 A;  3KSX A;  4KPT A;  2P2A A;  4MLQ A;  2XX7 A;  4NN3 A;  4GL8 A;  3H7M A;  3H4Z A;  4PTK A;  3EHT A;  1I6Q A;  3T9V A;  3BKI B;  1K9Y A;  2P3V A;  2HCA A;  1TXF A;  3M3L A;  4JWY A;  3IO6 A;  5L9S A;  2PMS A;  3VLV A;  4FJP A;  3PD8 A;  5I2K B;  1KA1 A;  4RJZ A;  1B46 A;  5ITP A;  1D3K A;  2QS4 A;  4QXD A;  4HE0 A;  4P0G A;  3FUZ A;  4F3B A;  1B52 A;  5TPA A;  4H5F A;  1TFA A;  4F3G A;  2A5T A;  2XXV A;  4QRZ A;  1SYH A;  4YIC A;  2DXY A;  4XF5 A;  3TZA A;  4NF6 A;  3TCF A;  4OVT A;  2XXY A;  4QFP A;  4Z7E A;  4OA4 A;  1MRP A;  4ZEK A;  1PB7 A;  4NF5 A;  5TPA B;  4IO5 A;  4H6D A;  4DZ1 A;  3MPK A;  3KBR A;  5ET6 A;  5IKB A;  3LC8 A;  1YCJ A;  3UA8 A;  4IGR A;  1IMF A;  1ELJ A;  1B5J A;  2GFE A;  2Z8E A;  4NF6 B;  4RYA A;  2I3V A;  4IY5 A;  1P99 A;  4AB5 A;  1A8F A;  2NUV A;  4PFI A;  1YAE A;  2UVG A;  3Q27 A;  3THI A;  4I1D A;  4ZEC A;  4KYS A;  1H45 A;  3MVZ A;  4NF5 B;  2I6E A;  4IO4 A;  1OMP A;  4DLD A;  1DPE A;  1JET A;  1VFE A;  1Y1M A;  2OZZ A;  2ZYO A;  2AL4 A;  3TTK A;  3MP1 A;  3IK6 B;  2O1L A;  3SEV A;  1F9B A;  3IOT A;  1P1N A;  3C34 A;  4GIZ A;  2Z8D A;  3TUS A;  2M8C A;  2WX9 A;  5ET8 A;  4DE8 A;  3TEP A;  2XXP A;  3PPR A;  1LAH E;  1DOT A;  1B5H A;  1ATG A;  4FAJ A;  1P1W A;  4I3E A;  1XVY A;  2E0S A;  3T66 A;  3VXB A;  1PBQ A;  1SW5 A;  1IME A;  3KJ7 A;  1OLA A;  1IMC A;  4LZ7 A;  3VVF A;  3C32 A;  1BIY A;  3U93 A;  1Y20 A;  4X8R A;  1LFH A;  5F1Q A;  2DSF A;  2Q89 A;  1OIB A;  2CZK A;  1A99 A;  1LB9 A;  2X26 A;  1POY 1;  2Y7P A;  4GVO A;  4TLL B;  2ALU A;  4E0X A;  1XVX A;  3LBS A;  4G8H A;  1URG A;  2OBG A;  4MIJ A;  1T0K A;  1D9Q A;  1FRP A;  4R73 A;  4ONY A;  4F29 A;  3KN8 A;  5L8D A;  2R9J A;  2XHD A;  3FIR A;  4FE8 A;  1FJ9 A;  4N6P A;  3OOA A;  3W9V A;  4O7M A;  3RLF E;  5ELV A;  3RQT A;  3BFU A;  1NNP A;  3W9W A;  2ANJ A;  1FBF A;  4U22 A;  3VVE A;  4QSE A;  2UVI A;  4R72 A;  3TYH A;  1EYI A;  4L17 A;  4OHN A;  5IZZ A;  4IGT A;  2Y7W A;  5EYH A;  1NNF A;  5ITO A;  3D4G A;  3RTF B;  3HN0 A;  3PGF A;  3OXN A;  5ET5 A;  1LGB C;  3SZP A;  3CFZ A;  3TEL A;  3EKI A;  5EQ9 A;  4EF2 A;  1Q1K A;  1QUJ A;  4OXV A;  4HTG A;  2Q74 A;  1LLS A;  3RUM A;  2UYF A;  1JVX A;  4GQO A;  1RDX A;  1NNK A;  2QPQ A;  5AA4 A;  4U21 A;  3U65 A;  1MH3 A;  3QIM A;  4LAT A;  1H3D A;  1NUX A;  1MM7 A;  4IO3 A;  1II5 A;  3SER A;  4H46 A;  3JV9 A;  2XWK A;  3G3F A;  1NH8 A;  4N6K A;  3ZS6 A;  4N15 A;  2F5X A;  2O51 A;  3IO4 A;  4OES A;  1NNT A;  1KA0 A;  4GXS B;  3VLW A;  1B7U A;  4EQ7 A;  1MXY A;  4FED A;  3I6V A;  1SPI A;  1KZ8 A;  5ET7 A;  1I69 A;  1SI0 A;  2X7P A;  3RT8 A;  5AA4 B;  4GWY A;  3T22 A;  3K1P A;  4DIG A;  3IFA A;  2ZYM A;  4ZZA A;  2QL3 A;  4PDD A;  5CMM A;  5EQ8 A;  3GBA A;  2W7Y A;  3RPL A;  3T9U A;  4KCC A;  1Z7N E;  1BP5 A;  3OEN A;  5DT6 A;  4X04 A;  4THI A;  1I6A A;  3IX1 A;  1QKB A;  2FVZ A;  1NUY A;  4HXV A;  3S9M C;  2FNC A;  4FEB A;  5KZT A;  1JW5 A;  4F19 A;  4ZEI A;  2HAV A;  3EQ1 A;  4I9D A;  1NV5 A;  3DLN A;  5I57 A;  1RDY A;  2WBB A;  2Z22 A;  1LAG E;  2OWT A;  3D1R A;  1NUZ A;  5EHM A;  1URD A;  3O28 A;  1FPK A;  1FPB A;  3RPL B;  1SDX A;  1WOD A;  3VVD A;  5I58 A;  3TKD A;  5I7I A;  1FPE A;  4ELR A;  4ZE8 A;  2PFY A;  1B58 A;  5FTH A;  2I58 A;  4KD5 A;  4PE5 B;  2FA7 A;  2KLF A;  2WKY A;  5H8N A;  3FZV A;  2OX3 A;  4JSD A;  4P56 A;  1N7X A;  4R9G A;  3TTM A;  5I57 B;  2OPE A;  4R2B A;  3FAS A;  1VSO A;  2IA4 A;  5H8F A;  3K1N A;  4R2F A;  4OMB A;  3GLB A;  4Q5T A;  2WYP A;  2DWJ A;  4NWD A;  4RY1 A;  3UGW A;  5I58 B;  4DI3 D;  3IAZ A;  1A7L A;  1MY0 A;  2F3D A;  1IZ1 A;  2HEU A;  4LA9 A;  3KC0 A;  4JVC A;  2PX1 A;  3OMB A;  3S2V A;  4FIM A;  1DCU A;  3V5A A;  2HXR A;  5H8N B;  4MMP A;  1NV3 A;  3QYT A;  4OAN A;  4Q30 B;  1PEB A;  1RYX A;  2HHM A;  1N76 A;  3L6G A;  1UTH A;  1Y3P A;  1MM6 A;  4KCD A;  3L6H A;  1AH5 A;  1B40 A;  3OO9 A;  3NOH A;  4MBP A;  4MAG A;  2CZL A;  2UVH A;  3W15 C;  1NKX A;  1LBV A;  1A40 A;  1N7W A;  1G0I A;  2QRY A;  2VD3 A;  1MXU A;  5CM6 A;  3E79 A;  2QS3 A;  3PPO A;  4GX4 A;  3SES A;  2B3B A;  4I3Y A;  2FIX A;  1AMF A;  4MCO A;  4YMB A;  4GXA A;  2G93 A;  3BBR A;  1FQB A;  5IZ1 A;  1JEV A;  4XTC Q;  2R71 A;  2A5S A;  2P0S A;  4QFN A;  1Y4C A;  2V25 A;  4U4S A;  4U2R A;  2ZYK A;  5ESY A;  4TQU Q;  4GWO A;  1UTH B;  1ZKB A;  3ISP A;  2XXU A;  3FXU A;  4ZDM A;  3N6U A;  3IFC A;  4AS5 A;  3S9L C;  5L9O A;  2VT5 A;  1R1N A;  4XXU A;  4OFL A;  1SW1 A;  4U1Z A;  5CMK A;  3Q25 A;  3FD3 A;  1FQA A;  2CEX A;  4G2Z A;  2V3T A;  3ILT B;  4ZEF A;  3H6W A;  3KFM A;  3QUJ A;  3ILU B;  2B4L A;  5L9M A;  4PP0 A;  1S50 A;  4YZZ A;  4Q0C A;  1LFG A;  1J1N A;  3WAF A;  2UYE A;  2RC7 A;  2I4C A;  2Q9T A;  3G3G A;  2FHY A;  2YPN A;  2O84 X;  4IO2 A;  4NF4 A;  3HCQ A;  1B32 A;  4G4P A;  3MBP A;  4GD5 A;  3OO6 A;  2MKZ A;  4KXP A;  4OET A;  3DP4 A;  4F3P A;  3LV0 A;  2F6P A;  4OVP A;  4PGP A;  5LDZ A;  4U23 A;  4LZ8 A;  2GH9 A;  3CRB A;  2I3W A;  4JWX A;  5IAI A;  2UVJ A;  3FVN A;  4YMA A;  3IOU A;  3RTW B;  1K9Z A;  2XX8 A;  3GZG A;  1R6Z A;  1GTK A;  3OO8 A;  4OWD A;  4MH5 A;  2WEF A;  4GWS A;  4R6Y A;  4XKQ A;  3PV0 E;  1OVT A;  4NF4 B;  3O2A A;  4NQ8 A;  3DEL B;  4WEP A;  4LUB A;  1FQD A;  3WAE A;  2Q8J A;  3K6U A;  3MPL A;  2G29 A;  1JW4 A;  1INP A;  5KCJ A;  2RC9 A;  1IXG A;  4ECF A;  1G0H A;  3R6U A;  3U94 A;  1LB8 A;  3H6U A;  2DXR A;  1Y3N A;  4NTL A;  1NI9 A;  3A29 A;  2DE2 A;  4PBQ A;  1IUD A;  3G3J A;  2I4B A;  2XXR A;  2Q2A A;  4FEC A;  3C36 A;  4H67 A;  1FBE A;  3P7I A;  1FSA A;  3SKP A;  3PTY A;  2F3B A;  2F8D A;  3EF7 A;  1P1Q A;  1LST A;  1MY1 A;  2RF1 A;  5CMC A;  2XD3 A;  4U4X A;  3FXR A;  4DXB A;  5KCJ B;  3MC2 A;  3FXB A;  3MQ9 A;  1M5B A;  1MS7 A;  4N4U A;  2HXW A;  1TWY A;  2Y84 A;  1RKM A;  1PDA A;  5JTY A;  1ZJL A;  1JEU A;  4WKM A;  1R9Q A;  4KI0 E;  3S9E A;  2HFB A;  4PE3 A;  5A5L A;  5HM4 B;  2VHA A;  2F34 A;  1NUW A;  3CFL A;  1SW2 A;  2PBW A;  4KQP A;  1N04 A;  3GXA A;  1IMA A;  2QFL A;  1HSE A;  3A3U A;  3VLU A;  3CHG A;  1SQY A;  4MJO A;  2PFZ A;  4IO7 A;  2QSX A;  1B51 A;  1MDP 1;  3M8U A;  4YB6 A;  4UAC A;  2P3N A;  1ZBM A;  5EYF A;  4N81 A;  5JTY B;  3SEU A;  1D4N A;  2RCB A;  2H4I A;  3UN6 A;  4OYV A;  2Y5K A;  1MQJ A;  4MF3 A;  1A8E A;  4MFI A;  1MQD A;  1CB6 A;  4O94 A;  4PF8 A;  1FBH A;  4RXL A;  1FBP A;  1Y1Z A;  3MAM A;  5TU0 A;  4QHQ A;  5F7V A;  4IO6 A;  3IR1 A;  5DEX A;  2XXW A;  1MQI A;  1HSJ A;  3OEK A;  4GL0 A;  2KQZ A;  5ISU A;  3E4R A;  2XXT A;  5CRY A;  3ODB A;  4FOR A;  1O7T A;  1VR5 A;  2ESN A;  3G3H A;  5K2X A;  5CBR A;  3TCH A;  1MQG A;  2NOO A;  1QW0 A;  3K6W A;  2Y5L A;  2V84 A;  4OVQ A;  3MP6 A;  3HHF A;  5JEI A;  3RYD A;  1Q35 A;  1FBG A;  3F11 A;  3K0V A;  3B6W A;  1LBC A;  3PMW A;  4F1Y A;  1DMB A;  1B1X A;  4N8G A;  2O7I A;  3FVO A;  5DEX B;  1DTG A;  4OFJ A;  3QSL A;  5F24 A;  1UQW A;  1EH3 A;  2R8T A;  1WVJ A;  4ZEB A;  3TPA A;  1FPI A;  4PGN A;  5FHM A;  1IIW A;  1BKA A;  4N6D A;  1ZLQ A;  3HST A;  4LZ5 A;  1LAX A;  1MXZ A;  4E0W A;  4JWO A;  3Q28 A;  2AL5 A;  2NWJ A;  1EZ9 A;  5CC2 A;  2X7Q A;  2HAU A;  2YJP A;  4RK2 A;  4HE2 A;  3KOT A;  4P1E A;  2NVU B;  2ZMB A;  4F2Q A;  4OER A;  3MST A;  1CE2 A;  1MPD A;  3T9X B;  1IEJ A;  3O97 A;  4JB7 A;  4C1U A;  4IR8 A;  4OTE A;  2ZNS A;  4ELP A;  1UTB A;  3H6V A;  4X48 A;  1OQH A;  2RIN A;  4QSC A;  3U1O A;  3V8X B;  3MUQ A;  2QMX A;  4TOZ A;  4N91 A;  2ONK E;  4X1B A;  2WBD A;  2DE3 A;  1SVX B;  2O68 A;  4YB7 A;  4MNC A;  2F97 A;  1M5E A;  2DYX A;  3RN8 A;  3R26 A;  4RA1 A;  4H1X A;  1AL3 A;  1NL5 A;  4P1L A;  1PB8 A;  3R7X A;  3ECR A;  1BTJ A;  2LAO A;  3I3V A;  1URS A;  4QFL A;  1MPC A;  3O9P A;  5HPQ A;  5LTC A;  5I84 A;  1UTB B;  1B1H A;  1Y4T A;  4XKP A;  1S7Y A;  2VP1 A;  4KYD A;  5IM2 A;  3FV1 A;  5FHN A;  3U72 A;  1OVB A;  1IMD A;  3OO7 A;  2DDK A;  2P1S A;  1GV8 A;  2QS2 A;  5DYH A;  3CVG A;  4HW8 A;  2OLB A;  3SDF A;  1QKA A;  2OWS A;  4F22 A;  5ICQ A;  3TMG A;  4QF9 A;  4QSD A;  2DWA A;  4MNP A;  4OFO A;  4F39 A;  1MPB A;  5HBC A;  3LUY A;  4PFY A;  2KR0 A;  3VDF A;  3IB1 A;  1H43 A;  5B7D A;  4PDH A;  1QUI A;  1B7H A;  3G3I A;  3CIJ A;  3IOV A;  3TTN A;  2FIE A;  4H65 A;  3FV2 A;  4O3B A;  4N17 A;  3S4U A;  2GRV A;  1FBC A;  4NHB A;  3PPQ A;  4G68 A;  3KSJ A;  4NE4 A;  4TLM B;  1NFT A;  5J16 A;  4YKI A;  1P1O A;  3Q26 A;  2F7B A;  1SD3 A;  3BFT A;  4P9K A;  1IXH A;  2RC8 A;  2ONS A;  4AQ4 A;  1YTV A;  2ZZX A;  2OJT A;  1IMB A;  3O6H A;  1DK4 A;  2THI A;  2ZNU A;  2QVR A;  2V3U A;  1Q9D A;  3C31 A;  4F1U A;  1UIU A;  3B6T A;  3HPI A;  2XWV A;  1US5 A;  4G68 B;  4G77 A;  3EHS A;  5DVI A;  1LAF E;  4R75 A;  5FHO A;  3MVW A;  3SET A;  1M5F A;  5DVJ A;  4WXJ A;  2F6G A;  3B6Q A;  5H8Q A;  3N26 A;  4GWW A;  3O6G A;  4G61 A;  2D3I A;  1I6B A;  1B0H A;  2VPO A;  5EYG A;  2WYK A;  1ZTY A;  4WED A;  2V93 A;  3SEY A;  4MLV A;  4NF8 A;  4PFU A;  3UK4 A;  4BLA A;  2Q2C A;  1XC1 A;  3T93 B;  1PC3 A;  2Z23 A;  2ZNT A;  4RPO A;  3G3K A;  1AWB A;  4I8C A;  3C35 A;  2Q8M A;  5H8Q B;  3T9H B;  4MNI A;  2XX9 A;  1GR2 A;  1BK4 A;  3VV5 A;  3M3K A;  4NF0 A;  4PF6 A;  2UXA A;  3KBZ A;  4PFW A;  4G68 C;  3HFU A;  3UOR A;  3K1M A;  2Y7R A;  4ZS9 A;  3PU5 A;  2ONR A;  4NF8 B;  4I40 A;  2PVU A;  1USY E;  3IJO B;  5J1D A;  5B70 A;  3D4C A;  1B2H A;  4ZE9 A;  2D21 A;  4PFB A;  4XFE A;  4ELQ A;  2H99 A;  2OCU A;  3OEM A;  4H8I A;  1B7Z A;  1US4 A;  3FAT A;  2O69 A;  1MY4 A;  3EPE A;  4U1O A;  3PMV A;  3SEW A;  1N3W A;  1FQE A;  1MDQ A;  3TFL A;  4KYE A;  3T0J A;  2H9B A;  2Q88 A;  4BDL A;  3MVX A;  3LUZ A;  1ZIU A;  1RDZ A;  1MXX A;  2B65 A;  3A09 A;  3DP8 A;  4GX3 A;  4QBA A;  2DS9 A;  1IXI A;  2DVC A;  1MG1 A;  4O3C A;  2I49 A;  3K4U A;  2O7U A;  4FBP A;  4OZ9 A;  2GHA A;  3PMX A;  1D9V A;  4F1V A;  5BWJ A;  2XXK A;  1FTL A;  3USD A;  2H25 A;  1AIV A;  5K2Y A;  3PD9 A;  3N6T A;  3T1B A;  4OEU A;  3LSF B;  4PET A;  1B9J A;  5FTI A;  3CI8 A;  1SI1 A;  4FAT A;  4DXC A;  1LCF A;  4NED A;  1L5T A;  1B3H A;  1SW4 A;  3K02 A;  3PUW E;  4UA8 A;  3OEL A;  4XKN A;  3T96 B;  2FYI A;  3KN3 A;  3BIG A;  4EQ9 A;  3RPW A;  5M2V A;  4R74 A;  3OSQ A;  1N3X A;  3G7W A;  3OSR A;  3CSG A;  4GX6 A;  1GVC A;  5IZ3 A;  1M5C A;  2I48 A;  3KEI A;  4GWX A;  2XWI A;  1Y9U A;  3KJT A;  4Q8R A;  1FJ6 A;  1ANF A;  4KR5 A;  1IQ7 A;  4OQO A;  3DM0 A;  3VE1 B;  4PAI A;  2HZL A;  4NMY A;  4R9F A;  4DCY A;  2PT2 A;  4JBZ A;  3IOR A;  2F7A A;  1D9Y A;  2XXQ A;  5DVF A;  4DXU A;  1FTO A;  5CI5 A;  3B7D A;  1VE4 A;  3IOW A;  1DTZ A;  3IB0 A;  5IZ3 B;  1B0L A;  1NH7 A;  1N84 A;  2DE4 A;  3CG1 A;  4N07 A;  2VPN A;  2A5T B;  1B6H A;  3O29 A;  1H44 A;  4QFK A;  3TOD A;  3MWB A;  4K3F A;  3N5L A;  3K6X A;  3UIF A;  3EHU A;  4UAB A;  3ZKK A;  4F3S A;  2ZZV A;  2VGQ A;  3B50 A;  1NMU A;  4HCY A;  4EDP A;  4EQB A;  4OVJ A;  4JDF A;  1B05 A;  4NG7 A;  4GLI A;  1ZU0 A;  4Z0I A;  5JK4 A;  3JYR A;  3U8Q A;  3KZG A;  4LP2 B;  3DP6 A;  3FJM A;  3FJG A;  4PAF A;  3KG2 A;  1QJM A;  4YKJ A;  5AE4 A;  5EQ7 A;  1FTJ A;  5H8H A;  2QJE A;  3MVY A;  4ISU A;  1JVY A;  1B5I A;  2BJI A;  2ABH A;  3E9X A;  4H5G A;  1Z7M E;  2F78 A;  4P3L A;  4EF1 A;  1MH4 A;  4X9T A;  4BDQ A;  5LOM A;  1HSL A;  2ZXT A;  4PFR A;  1KWH A;  5TP9 A;  3OD7 A;  3TQL A;  5BUU A;  3N94 A;  1FPG A;  1A54 A;  4XEQ A;  2O1M A;  4AB6 A;  4DCX A;  3HHG A; 
#chains in the Genus database with same CATH homology
 4AS4 A;  5ESY A;  4MNP A;  3ISP A;  1LBY A;  2KR0 A;  4PCD A;  1LEV A;  5T3J A;  4PDH A;  2FBP A;  2CEY A;  3IFC A;  4AS5 A;  1CNQ A;  4YIC A;  4XF5 A;  2VT5 A;  2FIE A;  4OVT A;  2CEX A;  4NX1 A;  4N17 A;  3MYU A;  1FBC A;  4OA4 A;  4NHB A;  4P8B A;  2B4L A;  1NV0 A;  1YXI A;  5J16 A;  4YZZ A;  3BIH A;  2HPG A;  5ET6 A;  3KC1 A;  2XWO A;  4P9K A;  1NV6 A;  2Q9T A;  2FHY A;  3B8B A;  1IMF A;  4GBV A;  2ZZX A;  1IMB A;  2GQ1 A;  1DK4 A;  2QVR A;  1Q9D A;  2MKZ A;  4KXP A;  4F1U A;  3LV0 A;  2XA5 A;  4NAP A;  4PFI A;  4OVP A;  4PGP A;  2XWV A;  5LDZ A;  3ROJ A;  4JVD A;  1FPF A;  1K9Z A;  4O7I A;  2WEF A;  4GWS A;  1VDW A;  4NQ8 A;  1YYZ A;  1FPD A;  4GWW A;  2WX9 A;  4G61 A;  5ET8 A;  1INP A;  2VPO A;  5EYG A;  2L5V A;  2WYK A;  1G0H A;  4GWZ A;  4I3E A;  1EYK A;  1NI9 A;  1IME A;  3A29 A;  2DE2 A;  4OVR A;  1IMC A;  5FBP A;  4PBQ A;  4X8R A;  5EQA A;  1AWB A;  1FBE A;  1FPJ A;  1FSA A;  1NV2 A;  3PTY A;  2F3B A;  2Q8M A;  2CZK A;  4MNI A;  5IGA A;  1YZ0 A;  1BK4 A;  4DI4 B;  4NF0 A;  3FXB A;  4PF6 A;  3KBZ A;  4N4U A;  3HFU A;  1XI6 A;  4I40 A;  4MIJ A;  4HCW A;  2ZZW A;  5J1D A;  1D9Q A;  1FRP A;  3GYY A;  2CZH A;  2DVZ A;  2OWZ A;  4PE3 A;  4H45 A;  5A5L A;  4PFB A;  1FJ9 A;  4XFE A;  2QVU A;  1NUW A;  3W9V A;  4O7M A;  1IMA A;  2QFL A;  3E78 A;  3CHG A;  3FBP A;  3W9W A;  4MJO A;  4PAK A;  1FBF A;  2PFZ A;  4F18 A;  3T0J A;  1EYI A;  2P3N A;  3LUZ A;  5IZZ A;  1RDZ A;  4N81 A;  5EYH A;  4GX3 A;  4QBA A;  3SZP A;  5ET5 A;  1LBZ A;  3EKI A;  5EQ9 A;  2Y5K A;  4FBP A;  2Q74 A;  4MHF A;  4O94 A;  4PF8 A;  1FBH A;  1RDX A;  1FBP A;  4F1V A;  2QPQ A;  2XXK A;  3U65 A;  1LBX A;  1NUX A;  2JJK A;  3T1B A;  4O8M A;  4H46 A;  2KQZ A;  2XWK A;  4PET A;  4N6K A;  4N15 A;  2Y5L A;  2F5X A;  4OVQ A;  4MX6 A;  1KA0 A;  1NV7 A;  3RYD A;  1FBG A;  4LN5 A;  2V3Q A;  1SPI A;  1KZ8 A;  5ET7 A;  4NGU A;  3BIG A;  4GWY A;  4PC9 A;  1QGX A;  4N8G A;  4JVI A;  3IFA A;  1EYJ A;  3QMF A;  5F24 A;  4PDD A;  4GX6 A;  5IZ3 A;  2R8T A;  5DW8 A;  5EQ8 A;  3RPL A;  4GWX A;  2XWI A;  1FPI A;  4PGN A;  4X04 A;  1FJ6 A;  2QVV A;  2FVZ A;  4GWU A;  4N6D A;  1NUY A;  1NV1 A;  4PAI A;  2HZL A;  1NV4 A;  4HXV A;  2HZK A;  4F19 A;  1FTA A;  1NV5 A;  4HE2 A;  1RDY A;  2WBB A;  3D1R A;  1NUZ A;  4P1E A;  4M1V A;  5IZ3 B;  2V4C A;  5I3S A;  4OVS A;  3MST A;  1FPK A;  4P47 A;  1FPB A;  3RPL B;  1JP4 A;  5I5P A;  5I7I A;  1FPE A;  2DE4 A;  2PFY A;  2VPN A;  4IR8 A;  4MEV A;  2OX3 A;  4P56 A;  1LBW A;  1DBZ A;  2PCR A;  1FPL A;  4HE1 A;  4UAB A;  2B4M A;  1FBD A;  4N91 A;  2ZZV A;  3B50 A;  2WBD A;  2DE3 A;  4HCY A;  2WYP A;  4MNC A;  4DI3 D;  4NG7 A;  4P1L A;  4PBH A;  4N8Y A;  4GBW A;  2F3D A;  5JK4 A;  3KC0 A;  4JVC A;  4PAF A;  1DCU A;  2HXR A;  2CZI A;  4MMP A;  5EQ7 A;  5LTC A;  1NV3 A;  4OAN A;  2HHM A;  4NN3 A;  3NOH A;  2BJI A;  4MAG A;  4PTK A;  5IM2 A;  1LBV A;  4P3L A;  1K9Y A;  4X9T A;  1G0I A;  2P3V A;  5CM6 A;  3E79 A;  1IMD A;  4PFR A;  2DDK A;  4GX4 A;  4I3Y A;  1FPG A;  2FIX A;  4MCO A;  4XEQ A;  1KA1 A;  5IZ1 A;  4QXD A;  4HE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...