2Y5KA

Orally active aminopyridines as inhibitors of tetrameric fructose 1,6- bisphosphatase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
publication title Orally Active Aminopyridines as Inhibitors of Tetrameric Fructose-1,6-Bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 103
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2y5kA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2y5kA02
5EYGA 1YXIA 2Y5KA 3B8BA 1FBHA 4AS5A 2FBPA 2FIEA 5A5LA 1DCUA 1LBVA 3KC1A 2CZHA 4HE0A 2P3NA 1FPKA 1IMEA 1FBDA 1LBWA 2QFLA 5ET7A 2FIXA 4GX6A 4I3YA 1RDYA 1CNQA 1Q9DA 2JJKA 1G0HA 5EQ8A 1LBZA 4GBVA 1FPBA 1IMAA 1DK4A 4H45A 1IMCA 2WEFA 2OX3A 1NUYA 5IZ1A 3RYDA 3RPLB 1FBCA 1FPJA 4HE1A 1NV3A 1K9YA 1KA0A 1YZ0A 5IZ3A 1INPA 3FBPA 1FSAA 2CZIA 3IFAA 1NV2A 4GWZA 4I3EA 5LDZA 1SPIA 5ET6A 4GX4A 1NUXA 1LEVA 3D1RA 1FPGA 1NI9A 4H46A 2Q8MA 5I3SA 2CZKA 4GWWA 1EYIA 2QVVA 1YYZA 1FPIA 1KA1A 2DDKA 1FRPA 1FPEA 2FVZA 2FHYA 2WBBA 1EYKA 1NUWA 2HHMA 3BIGA 1D9QA 1NUZA 1FBPA 1IMBA 3BIHA 3KC0A 1IMDA 1AWBA 1RDXA 4GWSA 5EQAA 1JP4A 4GWYA 1EYJA 5DW8A 5ET8A 3QMFA 5F24A 1IMFA 4I40A 4GBWA 4GX3A 4KXPA 1NV5A 3RPLA 3IFCA 2Q74A 2PCRA 4GWXA 4MJOA 1XI6A 1FJ9A 1NV7A 5J16A 4GWUA 2QVUA 4O7IA 3T0JA 5ESYA 1VDWA 2VT5A 4PTKA 1DBZA 2F3DA 3A29A 1KZ8A 4FBPA 4HXVA 2QVRA 1G0IA 1LBYA 5ET5A 2BJIA 5T3JA 4QXDA 1FBGA 5FBPA 4G61A 1NV1A 1LBXA 3LUZA 5EYHA 3ROJA 4IR8A 2GQ1A 1FBEA 1NV4A 2F3BA 4N81A 1QGXA 5EQ7A 4HE2A 3KBZA 1BK4A 2WBDA 5IZ3B 1FBFA 1FTAA 1K9ZA 2OWZA 2R8TA 2Y5LA 2P3VA 1FPLA 3LV0A 5EQ9A 1FJ6A 4AS4A 1NV6A 1RDZA 1NV0A 1FPFA 1FPDA
chains in the Genus database with same CATH superfamily
5DVJA 2HCAA 1AIVA 3BFUA 2XXYA 4QRZA 1GV8A 3K1NA 4PFTA 2CZHA 4F19A 2LAOA 1FBDA 2GFEA 1LB9A 2I49A 1SDXA 3TZAA 1LBCA 1R9QA 1JW5A 1MXYA 1QKBA 3MAMA 1RYXA 4XKPA 4NE4A 4NF6A 5IZ1A 1EH3A 2QPQA 2XD2A 3HCQA 4OYVA 3PV0E 1B4HA 1LB8A 5AA2A 4F3GA 3OENA 3RQTA 3G3HA 3IO6A 4XEQA 2PT2A 2I0BA 3UORA 4NF0A 2DE3A 3MPKA 3IO4A 3KN8A 5I57A 4H1XA 5H8SA 3E78A 4P0IA 1NFTA 4OZ9A 4U1ZA 3KJTA 3T96B 3U1OA 4EQ7A 5ELVA 4ISUA 4O3CA 1AWBA 1B7ZA 4YZZA 2DP8A 2DVCA 1B46A 4QHQA 4FORA 3RGYA 3TKDA 3M8UA 5H8HB 1SBPA 3GLBA 4NF4B 4LZ8A 4U2RA 1JEUA 3TODA 2D5WA 2V3QA 4OTEA 4HXVA 1FBGA 1IUDA 1N7WA 3GXAA 4X1BA 4ZECA 3WAEA 2DQVA 2PBWA 4NEDA 5BUUA 1R6ZA 2AL4A 4OFOA 1MY3A 4LVQA 1BKAA 3VVFA 4OWDA 3TCGA 5IGAA 2Q88A 1BP5A 3C9HA 1DPPA 1OIBA 5CC2A 1MPBA 3B8BA 1KWHA 4TLLB 2FBPA 3LSXA 2R9JA 1UIUA 1QKAA 5ET7A 1Q9DA 5I2NA 2JJKA 3FIRA 3O29A 4DCXA 1K9YA 4JWOA 4X1DA 2DSFA 3CVGA 3RLFE 1I6BA 1DTZA 3M3LA 2QVVA 1EZ9A 2DS9A 3E9XA 4WKMA 1BLFA 1XT8A 3LUYA 4KCCA 3PUVE 3SEYA 4N6DA 5DYHA 3EHSA 1B0HA 1P1QA 3FXQA 5JTYA 3H06B 2Q74A 4XKQA 3MW0A 2XWOA 2HXWA 1B3LA 1B5HA 1AOVA 1NNKA 5ICQA 2F3DA 1YAEA 3K0VA 5H8QA 4FBPA 4DZ1A 3TTRA 2M8CA 2F6GA 5DT6A 4Z0IA 4R2FA 5CMMA 3MZ9A 4IY6A 1B32A 3B6WA 3H3GA 4YKKA 1FBFA 4POWA 2P3VA 2WKYA 4MH5A 2F36A 3KOSA 3CR9A 5DTBA 4OVQA 4AS4A 4PBHA 2O1MA 3QUFA 4I1DA 4H8JA 4BDLA 1TFDA 1ELJA 5JK4A 3S9LC 1FBHA 2XXQA 4JXIA 2B4MA 2HZKA 1LAGE 1LBWA 4F3BA 1Y4CA 5EQ8A 3CHGA 3HHGA 2OX3A 1UQWA 3MVZA 4G8NA 2I58A 5DEXA 2R6GE 1FSAA 4GVOA 4EQ9A 1IEJA 5LOMA 1Y1MA 2XX9A 5I5PA 2F5XA 4U1OA 3IR1A 1ZMGA 4H5GA 1YYZA 1DMBA 1B3EA 3PTYA 4L17A 4PF8A 1VFEA 3G3JA 2UVHA 4Q0CA 4BDRA 2DYXA 2DWAA 1D4NA 3Q26A 4X04A 3RY3A 2GRVA 4DXCA 1URSA 4BDOA 2HZLA 4H0WA 1I6AA 1MQGA 4N4UA 3UIFA 4RNSA 4KD5A 1P1UA 3HHFA 1B5JA 1MXVA 5CMKA 5CMCA 5FBPA 3K00A 4KQPA 1BIYA 4MLQA 2GQ1A 1FBEA 1N84A 3FXUA 4MNIA 1FTAA 3MBPA 2ONKE 1B6HA 2A5TB 3S9NC 4PFBA 2XX8A 4F39A 4IO3A 1LLSA 4LP2B 1NV0A 2O51A 3KN3A 5ITPA 4PQJA 2ZYNA 3NOHA 3DELB 5HPQA 1VE4A 3MYUA 1PBQA 5H8QB 3MVYA 1A54A 4OFJA 4WEDA 3KSXA 1NH8A 1RDYA 2F6PA 5CMBA 4NX1A 2XXIA 2PVUA 4EF1A 3Q28A 4F31B 3G3FA 3IJXB 1M5FA 5IZ3A 2I3WA 4I3EA 5LDZA 1LFIA 3S2VA 4NF5A 3KJ7A 4NF8B 3FJ7A 4YB6A 1ZU0A 4E0XA 2CMOA 3QXMA 1PB9A 3O6HA 5LTCA 1FBPA 2VHAA 1IMDA 4P11A 2XD3A 1Y3PA 4ELRA 5M2VA 2L5VA 5DW8A 2ZYKA 1SQYA 4PCDA 4GX3A 5I2KB 3IFCA 2PCRA 1Q1KA 4M4GA 1OVTA 4IGTA 2R71A 4Q5TA 3OEKA 3HSTA 1OVBA 2RCBA 3I3VA 1VFDA 3FD3A 3FXRA 1FW0A 1IXIA 3T9UA 3VLUA 4DI3D 3MP1A 4I62A 1WDNA 4N15A 3SDFA 5L9MA 3H6TA 4OXVA 1FPDA 3TCFA 2Y7PA 5EYGA 5K2XA 4FE8A 3IB0A 3OO9A 5KCJB 1SW5A 1D3KA 2ALUA 2KR0A 3D4GA 3HN0A 4HS7A 1ZIUA 2Z22A 1YCJA 3C32A 2PFZA 5FHNA 2XXTA 3QUJA 4F1UA 2FYIA 4MMPA 1YZ0A 4OA4A 2Z8FA 2Q2CA 3IFAA 1MQJA 4YAHX 1H44A 3PUWE 1RKMA 5TU0A 3MC2A 3OSQA 3RTFB 3EKIA 4OVPA 4GRKA 4P47A 4MCOA 2GH9A 4GD5A 1HSJA 3A09A 3TAJA 2XWVA 2Y7KA 4PBQA 1F9BA 1MXWA 4E0WA 3KC0A 3RPWA 4H67A 3BBRA 2QSXA 1MDP1 1QUIA 4WEPA 1XOCA 4GWSA 5IAIA 1JP4A 5TP9A 4PF6A 2HQ0A 3FJMA 3QK6A 4P9KA 2YJPA 4HCYA 3N26A 1N0TA 1CE2A 4O7IA 5ESYA 4PTKA 2FA7A 1TXFA 1KZ8A 3B6TA 1JNFA 4GWOA 1S50A 2AYSA 2NOOA 1NV1A 1D9VA 4WXJA 2H98A 2RINA 3CFXA 1JVYA 4LUBA 4PDHA 3C35A 1LCFA 3TYHA 4MBPA 1MH3A 2XWKA 4G68C 3O66A 5A5XB 1S7YA 2PMSA 3VVDA 4YICA 1O63A 3ISPA 2IEEA 2RC9A 1POY1 4JVDA 1Z7NE 4RK2A 2KLFA 4FIMA 2QS1A 1HSLA 3V83A 4XIGQ 4IO6A 4JSOA 3RPLB 1FBCA 1FPJA 2ZZVA 1Q35A 3TEPA 3OD7A 1INPA 2X7PA 3PGFA 4GWZA 1B2HA 1SPIA 5ET6A 3KOTA 3O9PA 3RNNA 3D1RA 3EF7A 3V5AA 3OO8A 4DXBA 1AL3A 4GWWA 4G77A 3U94A 3Q25A 2RKMA 1KA1A 4P3LA 2UVGA 1US5A 2UYEA 3SEXA 2XWIA 1XS5A 4IO4A 3IK6B 5EQAA 2O7UA 1EZPA 4JVCA 2Z23A 4PAKA 1XC1A 5AA4A 1N76A 4I40A 4LA9A 1IXCA 4F2OA 3PPNA 3H03A 4KPTA 4EDPA 2VD3A 3BFTA 3G3IA 4ONYA 1CB6A 5BWJA 5IZZA 4RJZA 4EXKA 4IO2A 2QL3A 4R74A 4ZS9A 1B1XA 1G0IA 4FATA 3QSLA 4QBAA 4F1YA 1OLAA 4OHNA 1YTVA 1GTKA 2VPNA 4HE2A 2H25A 5FTHA 2QS4A 3ILTB 1FPLA 3SZPA 5TP9B 1FQCA 1UTHA 3C31A 2QMXA 1II5A 4C0RA 1RDZA 4Z7EA 4O7MA 3F11A 1YXIA 2X26A 1PDAA 2OPEA 3R7XA 4AS5A 1QW0A 2VP1A 4BDNA 4C1TA 4JSDA 3T9VA 3VXCA 4H6DA 1DSNA 4N91A 5CBRA 4PFIA 4DE8A 2ZYMA 1IMCA 3DP8A 1ATGA 1PB7A 3PUZE 2I4BA 4RA1A 1SW1A 3FBPA 2VGQA 3HFUA 2Z8DA 3FZVA 2XHDA 1NH7A 1P99A 1LFGA 3LSFB 1M5EA 3G3KA 2ZNSA 2UVJA 2V4CA 1FPEA 3EHTA 2FHYA 5EHMA 5CM6A 4O94A 5KDTB 1DOTA 4GXSB 2F8DA 3GBBA 3VXBA 3U92A 1FCKA 2RC8A 3K6WA 3UN6A 3OO6A 4GWYA 1EYJA 2PFYA 4ZZEA 3MVXA 2F35A 2Q8JA 1FQEA 1NV5A 2ONRA 2AIXA 4N13A 3PPPA 4XXUA 1N04A 1LAFE 1FJ9A 5H8FA 3MPLA 3JZJA 1EZOA 2THIA 4G68A 2QVRA 4BLAA 2VD2A 2I6EA 3DM0A 1EU8A 3LSWA 4N07A 4NF6B 3I6VA 4JB7A 3CG3A 2ZZWA 2V3TA 4OEVA 5EQ9A 5AA2B 5L9OA 1ZKBA 2BJJX 1VSOA 1HSEA 4NN3A 2Y7IA 1DK4A 1MS7A 1USYE 3IORA 1S9TA 5AA3A 1MY2A 5I57B 4U4SA 4BDMA 1M5DA 2VPOA 4R6HA 4OVTA 4KYDA 2FIEA 4PE5B 4PDDA 2QFLA 5FHOA 3O6GA 4DLDA 4GQOA 3RYDA 3N6TA 5I56A 1UTHB 1MM6A 4DI4B 4P56A 2DXYA 3V8XB 3JYRA 3IOVA 2REGA 4Q30B 5ITOA 3WAFA 2FVZA 4GFRA 4PFWA 2NUVA 1NUWA 3PPQA 2QJEA 2V84A 2YLNA 4IO7A 2ONSA 3KBRA 1MXXA 1XVXA 4AB5A 5I59A 3E79A 2VOZA 3MUQA 4I9DA 1H3DA 1PEBA 1B9JA 3USDA 4ESWA 3V89B 1P1OA 4R2BA 1UTBA 4XKRA 4JWYA 1SYIA 2VT5A 3O28A 1GR2A 3EQ1A 4ZE9A 4P1LA 4HTGA 4QXDA 2H4IA 5I84A 5I2NB 4TQUQ 3DLNA 1QJMA 3LUZA 5I58A 1T0KA 2HFBA 2F7BA 1FTOA 4LONB 1OQHA 4U22A 4DIGA 4EXLA 4MEVA 3IAZA 3PU5A 2I3VA 2E1SA 5AA1A 4P1EA 3U93A 2ABHA 2O1LA 5H8NA 4IO5A 2P1SA 3FVNA 1YPNA 1ANFA 1JVXA 4NGUA 1B3HA 4H65A 3FV2A 5IM2A 1A40A 1IITA 1H45A 4N17A 5JTYB 3OMBA 1N7XA 4HE1A 1KA0A 4F1VA 2E0SA 1B40A 4R73A 1NKXA 1QUJA 1LFHA 3SESA 2DVZA 3P7IA 4ZEFA 4JBZA 5FHMA 4MNPA 4MIJA 1I6QA 2DDKA 1D9YA 1ZBMA 1BTJA 4YKIA 2XA5A 3DP6A 2NVUB 1IMBA 4F2QA 2CEXA 3CFLA 4JWXA 1A55A 4H8IA 4PGPA 3QMFA 2P0SA 4DDDA 5F24A 1MG1A 3FATA 3FJGA 3K01A 4YB5A 3T9HB 2HXRA 4IGRA 2QVUA 4MNCA 4MAGA 3A29A 1R1NA 4NQ8A 3B50A 5EHSA 4ZEIA 3D4CA 4ZEDA 4GIZA 4YKJA 4G61A 3B6QA 3TDJA 1MY4A 3U72A 4LATA 2UXAA 4EUOA 4IB2A 1OLCA 3O6IA 5B70A 4N81A 4PAIA 2WBDA 1URGA 5DEXB 5DVFA 2Y5LA 2OBGA 3SEVA 4LQ2A 2RCAA 1DTGA 4BDQA 3KSJA 4O3BA 4GLIA 5A5LA 3KC1A 3RUMA 1AH5A 1IXHA 3L6HA 3PMXA 4GX6A 4ZZAA 2O7IA 3N6UA 3EHUA 1IMAA 1UIVA 3H6UA 3C4MA 3S9EA 4QF9A 3ZKLA 2B3FA 4GX4A 3CFZA 2H99A 3S9MC 1Y4TA 2Q8MA 3CG1A 5H8NB 2HAVA 1VR5A 1D9QA 1NUZA 2D21A 2G93A 2CZLA 1SI0A 3TTKA 3IB1A 3EPEA 1Y1ZA 1B51A 3CSGA 4OERA 4FEBA 3LSLA 3K6UA 4GWXA 5KZTA 4MJOA 1O64A 4OETA 3IX1A 3OSRA 2Z8EA 1DBZA 2B65A 3IOUA 4R9GA 3TCHA 4QSDA 3OOAA 3RN8A 3SERA 5T3JA 4G2ZA 1A7LA 4NHBA 5B7DA 3TPAA 3K6VA 2CEYA 1NV4A 3KBZA 3OXNA 5IZ3B 1P1NA 3QYTA 1A8FA 4NF5B 1OQGA 1FTJA 1FJ6A 1FQAA 1OMPA 3LR1A 4TLMB 2AL5A 3E13X 1SVXB 1B0LA 3W9WA 3UK4A 3W15C 5H8HA 3ZSFA 4U4XA 4NF4A 3C33A 4DCYA 3HO7A 1B3FA 5TPAA 1L5TA 2DWHA 3OO7A 3FGSA 3MZ1A 4PP0A 2WYKA 1LBBA 1RYOA 1NUYA 1NV3A 3O97A 1H76A 3UA8A 2WYPA 1NV2A 2F7CA 1FPGA 5I3SA 4GF8A 1EYIA 1FTKA 3HV1A 1MPCA 1EYKA 4EQBA 2HHMA 2NXOA 1PC3A 4TOZA 1NNPA 4NWCA 1LAXA 3MWBA 2Y84A 4FEDA 2DE2A 4FECA 1Y9UA 2PX1A 4NAPA 3MP8A 4N6KA 2I48A 1QUKA 3ZKKA 4K3FA 1SYHA 1URDA 1FTLA 5ET5A 4P0GA 2QRYA 3VVEA 2PT1A 4LZ5A 4OVRA 3ROJA 4LZ7A 4ND9A 1QGXA 4N8YA 4YMBA 3GYYA 3PPRA 3FASA 4GOTA 1PBPA 4QSEA 3IOWA 1FQBA 3LC8A 5F7VA 2XXRA 3IOTA 4X8RA 2Q9TA 5AE4A 2OCUA 2H9BA 4ZEBA 4YU0A 4KYSA 1MY0A 1NL5A 4RY1A 4HE0A 2UYFA 4ELOA 1GGGA 2I4CA 1A99A 3SETA 2V3UA 2ZYOA 4GBVA 1FPBA 2F34A 4PE3A 3CI8A 2WEFA 4OVJA 2ANJA 3L6GA 3VE1B 2ESNA 4PC9A 3TFLA 2GHAA 1SI1A 4I8CA 1NUXA 3PMVA 4AQ4A 2CZKA 2Y7RA 3A3UA 3TUSA 4MHFA 3LBSA 1FRPA 4ECFA 5TPAB 1WODA 3T93B 3BIGA 4JVIA 3BIHA 1POTA 1DPEA 2OWSA 1IZ1A 2XXKA 4F3PA 3MVWA 2RF1A 1MDQA 2Q2AA 2ZXTA 4HCWA 5ET8A 1IMFA 4YKPA 2Q89A 3T1BA 2W7YA 5J16A 4GXAA 4QFLA 3KN7A 1TFAA 1MY1A 3VFJA 5EQ7A 4M1VA 1Y20A 2F97A 4OANA 2R8TA 3C34A 4U23A 2DWJA 3MP6A 4R75A 2FNCA 3K1PA 4RPOA 2O6AA 3K2DA 4PETA 4ESXA 3PD8A 3H4ZA 1IMEA 5HM4B 1R9LA 4I3YA 2GHBA 3E4RA 3UP9A 5AA4B 3KGCA 3K02A 3VDFA 4R6YA 1GVCA 4G4PA 2A5TA 2CZIA 4Q8RA 3MJNA 3TQWA 1N3XA 4RXLA 5HBCA 4OENA 2NWJA 4PGNA 3H6VA 3KZGA 4OVSA 4G8MA 1N3WA 2KQZA 3ODBA 3ZS6A 2DWIA 1MQIA 1WVJA 3MSTA 2OLBA 3OELA 2RC7A 4NF8A 5L9SA 3T0JA 4MF3A 2XXHA 5IKBA 3T66A 3VV5A 3Q29A 3SEUA 2B4LA 4F29A 4N8GA 3K4UA 1LBXA 3QAXA 1M5CA 3AXFA 3VLVA 1MPDA 1TWYA 2OJTA 1IQ7A 2ZZXA 2HAUA 3W9VA 3LV0A 1B7UA 3K1MA 2WX9A 2D3IA 4ZDMA 2O84X 1FPFA 4KCDA 4GL8A 2MKZA 4NG7A 5I2KA 4LQ5A 3OEMA 1LBVA 1MXZA 4EF2A 1FQDA 2DE4A 2ZMBA 4QFOA 4H45A 1FTMA 4NWDA 3B7DA 1NNFA 2DXRA 3ONMA 3PD9A 1JW4A 4OEUA 3RTWB 3IL1B 3H6WA 4RPNA 5H8FB 1MQDA 4U21A 3N94A 1LEVA 4O3AA 4G68B 4OFLA 1ZTYA 4QFNA 3CSBA 3PMWA 4R6KA 1MRPA 2DOJA 2Y7WA 1SW4A 5EYFA 1O7TA 1B1HA 4UABA 1LCTA 1Y3QA 5KCJA 1JETA 2IA4A 3KEIA 2HEUA 2XXXA 2ZNTA 2B3BA 1A8EA 2X7QA 3FV1A 3IB2A 3T9XB 1B4ZA 1ZLQA 5JEIA 1QVSA 4PFRA 1XI6A 4QSCA 4IY5A 3THIA 5I7IA 4F18A 3RT8A 4O8MA 3PUYE 4ZE8A 3C36A 1LBYA 4QFKA 5AA2D 3I5OA 5EYHA 3S4UA 5I56B 4ELPA 2OWZA 5K2YA 4THIA 3ECRA 3TTNA 3HPIA 2OPDA 3R6UA 1IIWA 1JW1A 3SEWA 2F78A 2Y5KA 4MX6A 2O69A 3TMGA 3T22A 4XFEA 2XXPA 1FPKA 3GBAA 4GL0A 2FIXA 1MXUA 4LN5A 1CNQA 5I59B 1G0HA 4F3SA 4MLVA 3M3FA 3G7WA 4FAJA 3H7MA 4NTLA 1UTBB 1NI9A 1QULA 4H46A 1MQHA 4P8BA 5DVIA 2XXUA 3ILUB 3K6XA 1FPIA 5A5XA 2YPNA 4KI0E 2WBBA 1FQFA 5I58B 3FVOA 4RYAA 2PYYA 1SD3A 1PB8A 4FJPA 1ZJLA 4XF5A 3RT6B 4OMBA 3PPOA 5J1DA 2OWTA 4R72A 4GBWA 4KXPA 3RPLA 3TQLA 4H5FA 3Q27A 3KG2A 1XHYA 4R9FA 1Z7ME 2QMWA 1J1NA 4POXA 4OQOA 4PAFA 4PFUA 1USYH 2F3BA 2F7AA 4XKNA 1IXGA 5ISUA 3MZBA 2QS2A 3TTMA 2P2AA 2OK2A 3TTLA 1Y3NA 2V25A 5FTIA 3DP4A 4AB6A 1XVYA 3N5LA 4C1UA 4G8HA 3UGWA 2O68A 1B3GA 3M3KA 1DCUA 5CRYA 2P3NA 1AMFA 4KFQA 2XXWA 1B7HA 1JEVA 1LBZA 1MM7A 1NMUA 2QS3A 1B52A 1LGBC 3R26A 1B58A 5ICTA 2A5SA 3IJOB 3FVGA 1LSTA 1MH4A 3O2AA 2I0CA 5CI5A 4DXUA 1I69A 3PUXE 4YB7A 2HPGA 3A3CA 4HW8A 3MQ9A 1B5IA 4YMAA 1LAHE 2REJA 3CIJA 1M5BA 4N6PA 1RDXA 3FUZA 3E3KA 1P1WA 4JDFA 3KFMA 1TT1A 3U65A 4KR5A 3QIMA 4UA8A 1JQFA 4QFPA 3JV9A 2V93A 3EN3A 3GZGA 3FXBA 1B05A 5CBSA 4UACA 3TELA 1NV7A 4GWUA 2OZZA 4ELQA 4XTCQ 1US4A 1VDWA 3BKIB 4F22A 1NNTA 5F1QA 2BJIA 4X9TA 4RK9A 3G3GA 3FVKA 2G29A 1H43A 2H5YA 2XX7A 5KDTA 2UVIA 3SKPA 4IR8A 4ZEKA 4OESA 1BK4A 4X48A 4MFIA 1K9ZA 2XXVA 3U8QA 3VLWA 4NMYA 2ZNUA 4PFYA 5L8DA 4KYEA 3CRBA 1NV6A 4KHZE 1SW2A
chains in the Genus database with same CATH topology
5EYGA 4P1EA 4PETA 2KR0A 2CZHA 4F19A 1IMEA 1FBDA 4NGUA 4I3YA 2PFZA 5IM2A 4N17A 4F1UA 5IZ1A 4HE1A 2QPQA 4MMPA 1KA0A 1YZ0A 4OA4A 4F1VA 2CZIA 3IFAA 2DVZA 4XEQA 3EKIA 4MNPA 4NF0A 2DE3A 4OVPA 4MIJA 4P47A 2DDKA 4MCOA 3E78A 2XA5A 2XWVA 4PBQA 1IMBA 3KC0A 2CEXA 1AWBA 4PGNA 4GWSA 4OVSA 4YZZA 1JP4A 2KQZA 4PGPA 4PF6A 3QMFA 5F24A 4P9KA 3MSTA 4HCYA 2HXRA 2QVUA 4O7IA 4MNCA 3T0JA 5ESYA 2V3QA 4MAGA 4PTKA 3A29A 4NQ8A 1KZ8A 4HXVA 3B50A 1FBGA 4G61A 2B4LA 4N8GA 1NV1A 1LBXA 4N81A 4PAIA 2WBDA 2ZZXA 2Y5LA 3W9VA 4PDHA 3LV0A 2WX9A 2XWKA 5IGAA 1FPFA 2MKZA 4NG7A 3B8BA 2FBPA 5A5LA 4YICA 1LBVA 3KC1A 3ISPA 5ET7A 4GX6A 4JVDA 2DE4A 1Q9DA 2JJKA 1IMAA 4H45A 3RPLB 1FBCA 1FPJA 2ZZVA 1K9YA 1INPA 4GWZA 1SPIA 5ET6A 4GX4A 1LEVA 3D1RA 2Q8MA 4GWWA 2QVVA 1KA1A 4UABA 1D9QA 4P3LA 1NUZA 4N6DA 2XWIA 5EQAA 4JVCA 4PAKA 4I40A 2Q74A 4GWXA 4MJOA 4PFRA 2XWOA 1XI6A 5I7IA 5IZZA 4F18A 1DBZA 2F3DA 4O8MA 4FBPA 1G0IA 1LBYA 5T3JA 4NHBA 4QBAA 5EYHA 2CEYA 1NV4A 2VPNA 4HE2A 3KBZA 5IZ3B 1FBFA 2OWZA 3SZPA 2P3VA 1FPLA 1FJ6A 4OVQA 4AS4A 4PBHA 1RDZA 3W9WA 4O7MA 1YXIA 2Y5KA 5JK4A 4MX6A 1FBHA 4AS5A 2B4MA 4XFEA 2HZKA 1FPKA 1LBWA 4N91A 2FIXA 4LN5A 4PFIA 1CNQA 1G0HA 5EQ8A 2WYKA 3CHGA 1IMCA 2OX3A 1NUYA 1NV3A 3FBPA 2WYPA 1FSAA 1NV2A 3HFUA 1FPGA 1NI9A 5I5PA 2F5XA 4H46A 5I3SA 4P8BA 1EYIA 1YYZA 1FPIA 2V4CA 1FPEA 5CM6A 2FHYA 2WBBA 3PTYA 4O94A 1EYKA 2HHMA 4PF8A 4XF5A 4X04A 4GWYA 1EYJA 2DE2A 2PFYA 5J1DA 4GBWA 4KXPA 1NV5A 3RPLA 4NAPA 2HZLA 4N6KA 1FJ9A 4N4UA 2QVRA 5ET5A 5FBPA 4PAFA 4OVRA 3ROJA 2GQ1A 1FBEA 2F3BA 1QGXA 4N8YA 3GYYA 1FTAA 4MNIA 2ZZWA 5EQ9A 4PFBA 1NV0A 4NN3A 1DK4A 4X8RA 2Q9TA 3NOHA 2VPOA 4OVTA 2FIEA 3MYUA 1DCUA 4HE0A 2P3NA 4PDDA 2QFLA 1RDYA 4NX1A 1LBZA 4GBVA 1FPBA 4PE3A 2WEFA 3RYDA 5IZ3A 4PC9A 4DI4B 4I3EA 5LDZA 4P56A 1NUXA 2CZKA 4MHFA 1FRPA 2FVZA 2HPGA 1NUWA 3BIGA 5LTCA 1FBPA 4JVIA 3BIHA 1IMDA 2XXKA 1RDXA 3E79A 4HCWA 2L5VA 5DW8A 5ET8A 4PCDA 3U65A 1IMFA 4GX3A 3IFCA 2PCRA 3FXBA 3T1BA 1NV7A 5J16A 4GWUA 1VDWA 2VT5A 4P1LA 2BJIA 4X9TA 4QXDA 3LUZA 4IR8A 5EQ7A 1BK4A 4M1VA 4OANA 1K9ZA 2R8TA 4DI3D 4MEVA 4N15A 1NV6A 1FPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EYG A;  1YXI A;  2Y5K A;  3B8B A;  1FBH A;  4AS5 A;  2FBP A;  2FIE A;  5A5L A;  1DCU A;  1LBV A;  3KC1 A;  2CZH A;  4HE0 A;  2P3N A;  1FPK A;  1IME A;  1FBD A;  1LBW A;  2QFL A;  5ET7 A;  2FIX A;  4GX6 A;  4I3Y A;  1RDY A;  1CNQ A;  1Q9D A;  2JJK A;  1G0H A;  5EQ8 A;  1LBZ A;  4GBV A;  1FPB A;  1IMA A;  1DK4 A;  4H45 A;  1IMC A;  2WEF A;  2OX3 A;  1NUY A;  5IZ1 A;  3RYD A;  3RPL B;  1FBC A;  1FPJ A;  4HE1 A;  1NV3 A;  1K9Y A;  1KA0 A;  1YZ0 A;  5IZ3 A;  1INP A;  3FBP A;  1FSA A;  2CZI A;  3IFA A;  1NV2 A;  4GWZ A;  4I3E A;  5LDZ A;  1SPI A;  5ET6 A;  4GX4 A;  1NUX A;  1LEV A;  3D1R A;  1FPG A;  1NI9 A;  4H46 A;  2Q8M A;  5I3S A;  2CZK A;  4GWW A;  1EYI A;  2QVV A;  1YYZ A;  1FPI A;  1KA1 A;  2DDK A;  1FRP A;  1FPE A;  2FVZ A;  2FHY A;  2WBB A;  1EYK A;  1NUW A;  2HHM A;  3BIG A;  1D9Q A;  1NUZ A;  1FBP A;  1IMB A;  3BIH A;  3KC0 A;  1IMD A;  1AWB A;  1RDX A;  4GWS A;  5EQA A;  1JP4 A;  4GWY A;  1EYJ A;  5DW8 A;  5ET8 A;  3QMF A;  5F24 A;  1IMF A;  4I40 A;  4GBW A;  4GX3 A;  4KXP A;  1NV5 A;  3RPL A;  3IFC A;  2Q74 A;  2PCR A;  4GWX A;  4MJO A;  1XI6 A;  1FJ9 A;  1NV7 A;  5J16 A;  4GWU A;  2QVU A;  4O7I A;  3T0J A;  5ESY A;  1VDW A;  2VT5 A;  4PTK A;  1DBZ A;  2F3D A;  3A29 A;  1KZ8 A;  4FBP A;  4HXV A;  2QVR A;  1G0I A;  1LBY A;  5ET5 A;  2BJI A;  5T3J A;  4QXD A;  1FBG A;  5FBP A;  4G61 A;  1NV1 A;  1LBX A;  3LUZ A;  5EYH A;  3ROJ A;  4IR8 A;  2GQ1 A;  1FBE A;  1NV4 A;  2F3B A;  4N81 A;  1QGX A;  5EQ7 A;  4HE2 A;  3KBZ A;  1BK4 A;  2WBD A;  5IZ3 B;  1FBF A;  1FTA A;  1K9Z A;  2OWZ A;  2R8T A;  2Y5L A;  2P3V A;  1FPL A;  3LV0 A;  5EQ9 A;  1FJ6 A;  4AS4 A;  1NV6 A;  1RDZ A;  1NV0 A;  1FPF A;  1FPD A; 
#chains in the Genus database with same CATH topology
 5DVJ A;  2HCA A;  1AIV A;  3BFU A;  2XXY A;  4QRZ A;  1GV8 A;  3K1N A;  4PFT A;  2CZH A;  4F19 A;  2LAO A;  1FBD A;  2GFE A;  1LB9 A;  2I49 A;  1SDX A;  3TZA A;  1LBC A;  1R9Q A;  1JW5 A;  1MXY A;  1QKB A;  3MAM A;  1RYX A;  4XKP A;  4NE4 A;  4NF6 A;  5IZ1 A;  1EH3 A;  2QPQ A;  2XD2 A;  3HCQ A;  4OYV A;  3PV0 E;  1B4H A;  1LB8 A;  5AA2 A;  4F3G A;  3OEN A;  3RQT A;  3G3H A;  3IO6 A;  4XEQ A;  2PT2 A;  2I0B A;  3UOR A;  4NF0 A;  2DE3 A;  3MPK A;  3IO4 A;  3KN8 A;  5I57 A;  4H1X A;  5H8S A;  3E78 A;  4P0I A;  1NFT A;  4OZ9 A;  4U1Z A;  3KJT A;  3T96 B;  3U1O A;  4EQ7 A;  5ELV A;  4ISU A;  4O3C A;  1AWB A;  1B7Z A;  4YZZ A;  2DP8 A;  2DVC A;  1B46 A;  4QHQ A;  4FOR A;  3RGY A;  3TKD A;  3M8U A;  5H8H B;  1SBP A;  3GLB A;  4NF4 B;  4LZ8 A;  4U2R A;  1JEU A;  3TOD A;  2D5W A;  2V3Q A;  4OTE A;  4HXV A;  1FBG A;  1IUD A;  1N7W A;  3GXA A;  4X1B A;  4ZEC A;  3WAE A;  2DQV A;  2PBW A;  4NED A;  5BUU A;  1R6Z A;  2AL4 A;  4OFO A;  1MY3 A;  4LVQ A;  1BKA A;  3VVF A;  4OWD A;  3TCG A;  5IGA A;  2Q88 A;  1BP5 A;  3C9H A;  1DPP A;  1OIB A;  5CC2 A;  1MPB A;  3B8B A;  1KWH A;  4TLL B;  2FBP A;  3LSX A;  2R9J A;  1UIU A;  1QKA A;  5ET7 A;  1Q9D A;  5I2N A;  2JJK A;  3FIR A;  3O29 A;  4DCX A;  1K9Y A;  4JWO A;  4X1D A;  2DSF A;  3CVG A;  3RLF E;  1I6B A;  1DTZ A;  3M3L A;  2QVV A;  1EZ9 A;  2DS9 A;  3E9X A;  4WKM A;  1BLF A;  1XT8 A;  3LUY A;  4KCC A;  3PUV E;  3SEY A;  4N6D A;  5DYH A;  3EHS A;  1B0H A;  1P1Q A;  3FXQ A;  5JTY A;  3H06 B;  2Q74 A;  4XKQ A;  3MW0 A;  2XWO A;  2HXW A;  1B3L A;  1B5H A;  1AOV A;  1NNK A;  5ICQ A;  2F3D A;  1YAE A;  3K0V A;  5H8Q A;  4FBP A;  4DZ1 A;  3TTR A;  2M8C A;  2F6G A;  5DT6 A;  4Z0I A;  4R2F A;  5CMM A;  3MZ9 A;  4IY6 A;  1B32 A;  3B6W A;  3H3G A;  4YKK A;  1FBF A;  4POW A;  2P3V A;  2WKY A;  4MH5 A;  2F36 A;  3KOS A;  3CR9 A;  5DTB A;  4OVQ A;  4AS4 A;  4PBH A;  2O1M A;  3QUF A;  4I1D A;  4H8J A;  4BDL A;  1TFD A;  1ELJ A;  5JK4 A;  3S9L C;  1FBH A;  2XXQ A;  4JXI A;  2B4M A;  2HZK A;  1LAG E;  1LBW A;  4F3B A;  1Y4C A;  5EQ8 A;  3CHG A;  3HHG A;  2OX3 A;  1UQW A;  3MVZ A;  4G8N A;  2I58 A;  5DEX A;  2R6G E;  1FSA A;  4GVO A;  4EQ9 A;  1IEJ A;  5LOM A;  1Y1M A;  2XX9 A;  5I5P A;  2F5X A;  4U1O A;  3IR1 A;  1ZMG A;  4H5G A;  1YYZ A;  1DMB A;  1B3E A;  3PTY A;  4L17 A;  4PF8 A;  1VFE A;  3G3J A;  2UVH A;  4Q0C A;  4BDR A;  2DYX A;  2DWA A;  1D4N A;  3Q26 A;  4X04 A;  3RY3 A;  2GRV A;  4DXC A;  1URS A;  4BDO A;  2HZL A;  4H0W A;  1I6A A;  1MQG A;  4N4U A;  3UIF A;  4RNS A;  4KD5 A;  1P1U A;  3HHF A;  1B5J A;  1MXV A;  5CMK A;  5CMC A;  5FBP A;  3K00 A;  4KQP A;  1BIY A;  4MLQ A;  2GQ1 A;  1FBE A;  1N84 A;  3FXU A;  4MNI A;  1FTA A;  3MBP A;  2ONK E;  1B6H A;  2A5T B;  3S9N C;  4PFB A;  2XX8 A;  4F39 A;  4IO3 A;  1LLS A;  4LP2 B;  1NV0 A;  2O51 A;  3KN3 A;  5ITP A;  4PQJ A;  2ZYN A;  3NOH A;  3DEL B;  5HPQ A;  1VE4 A;  3MYU A;  1PBQ A;  5H8Q B;  3MVY A;  1A54 A;  4OFJ A;  4WED A;  3KSX A;  1NH8 A;  1RDY A;  2F6P A;  5CMB A;  4NX1 A;  2XXI A;  2PVU A;  4EF1 A;  3Q28 A;  4F31 B;  3G3F A;  3IJX B;  1M5F A;  5IZ3 A;  2I3W A;  4I3E A;  5LDZ A;  1LFI A;  3S2V A;  4NF5 A;  3KJ7 A;  4NF8 B;  3FJ7 A;  4YB6 A;  1ZU0 A;  4E0X A;  2CMO A;  3QXM A;  1PB9 A;  3O6H A;  5LTC A;  1FBP A;  2VHA A;  1IMD A;  4P11 A;  2XD3 A;  1Y3P A;  4ELR A;  5M2V A;  2L5V A;  5DW8 A;  2ZYK A;  1SQY A;  4PCD A;  4GX3 A;  5I2K B;  3IFC A;  2PCR A;  1Q1K A;  4M4G A;  1OVT A;  4IGT A;  2R71 A;  4Q5T A;  3OEK A;  3HST A;  1OVB A;  2RCB A;  3I3V A;  1VFD A;  3FD3 A;  3FXR A;  1FW0 A;  1IXI A;  3T9U A;  3VLU A;  4DI3 D;  3MP1 A;  4I62 A;  1WDN A;  4N15 A;  3SDF A;  5L9M A;  3H6T A;  4OXV A;  1FPD A;  3TCF A;  2Y7P A;  5EYG A;  5K2X A;  4FE8 A;  3IB0 A;  3OO9 A;  5KCJ B;  1SW5 A;  1D3K A;  2ALU A;  2KR0 A;  3D4G A;  3HN0 A;  4HS7 A;  1ZIU A;  2Z22 A;  1YCJ A;  3C32 A;  2PFZ A;  5FHN A;  2XXT A;  3QUJ A;  4F1U A;  2FYI A;  4MMP A;  1YZ0 A;  4OA4 A;  2Z8F A;  2Q2C A;  3IFA A;  1MQJ A;  4YAH X;  1H44 A;  3PUW E;  1RKM A;  5TU0 A;  3MC2 A;  3OSQ A;  3RTF B;  3EKI A;  4OVP A;  4GRK A;  4P47 A;  4MCO A;  2GH9 A;  4GD5 A;  1HSJ A;  3A09 A;  3TAJ A;  2XWV A;  2Y7K A;  4PBQ A;  1F9B A;  1MXW A;  4E0W A;  3KC0 A;  3RPW A;  4H67 A;  3BBR A;  2QSX A;  1MDP 1;  1QUI A;  4WEP A;  1XOC A;  4GWS A;  5IAI A;  1JP4 A;  5TP9 A;  4PF6 A;  2HQ0 A;  3FJM A;  3QK6 A;  4P9K A;  2YJP A;  4HCY A;  3N26 A;  1N0T A;  1CE2 A;  4O7I A;  5ESY A;  4PTK A;  2FA7 A;  1TXF A;  1KZ8 A;  3B6T A;  1JNF A;  4GWO A;  1S50 A;  2AYS A;  2NOO A;  1NV1 A;  1D9V A;  4WXJ A;  2H98 A;  2RIN A;  3CFX A;  1JVY A;  4LUB A;  4PDH A;  3C35 A;  1LCF A;  3TYH A;  4MBP A;  1MH3 A;  2XWK A;  4G68 C;  3O66 A;  5A5X B;  1S7Y A;  2PMS A;  3VVD A;  4YIC A;  1O63 A;  3ISP A;  2IEE A;  2RC9 A;  1POY 1;  4JVD A;  1Z7N E;  4RK2 A;  2KLF A;  4FIM A;  2QS1 A;  1HSL A;  3V83 A;  4XIG Q;  4IO6 A;  4JSO A;  3RPL B;  1FBC A;  1FPJ A;  2ZZV A;  1Q35 A;  3TEP A;  3OD7 A;  1INP A;  2X7P A;  3PGF A;  4GWZ A;  1B2H A;  1SPI A;  5ET6 A;  3KOT A;  3O9P A;  3RNN A;  3D1R A;  3EF7 A;  3V5A A;  3OO8 A;  4DXB A;  1AL3 A;  4GWW A;  4G77 A;  3U94 A;  3Q25 A;  2RKM A;  1KA1 A;  4P3L A;  2UVG A;  1US5 A;  2UYE A;  3SEX A;  2XWI A;  1XS5 A;  4IO4 A;  3IK6 B;  5EQA A;  2O7U A;  1EZP A;  4JVC A;  2Z23 A;  4PAK A;  1XC1 A;  5AA4 A;  1N76 A;  4I40 A;  4LA9 A;  1IXC A;  4F2O A;  3PPN A;  3H03 A;  4KPT A;  4EDP A;  2VD3 A;  3BFT A;  3G3I A;  4ONY A;  1CB6 A;  5BWJ A;  5IZZ A;  4RJZ A;  4EXK A;  4IO2 A;  2QL3 A;  4R74 A;  4ZS9 A;  1B1X A;  1G0I A;  4FAT A;  3QSL A;  4QBA A;  4F1Y A;  1OLA A;  4OHN A;  1YTV A;  1GTK A;  2VPN A;  4HE2 A;  2H25 A;  5FTH A;  2QS4 A;  3ILT B;  1FPL A;  3SZP A;  5TP9 B;  1FQC A;  1UTH A;  3C31 A;  2QMX A;  1II5 A;  4C0R A;  1RDZ A;  4Z7E A;  4O7M A;  3F11 A;  1YXI A;  2X26 A;  1PDA A;  2OPE A;  3R7X A;  4AS5 A;  1QW0 A;  2VP1 A;  4BDN A;  4C1T A;  4JSD A;  3T9V A;  3VXC A;  4H6D A;  1DSN A;  4N91 A;  5CBR A;  4PFI A;  4DE8 A;  2ZYM A;  1IMC A;  3DP8 A;  1ATG A;  1PB7 A;  3PUZ E;  2I4B A;  4RA1 A;  1SW1 A;  3FBP A;  2VGQ A;  3HFU A;  2Z8D A;  3FZV A;  2XHD A;  1NH7 A;  1P99 A;  1LFG A;  3LSF B;  1M5E A;  3G3K A;  2ZNS A;  2UVJ A;  2V4C A;  1FPE A;  3EHT A;  2FHY A;  5EHM A;  5CM6 A;  4O94 A;  5KDT B;  1DOT A;  4GXS B;  2F8D A;  3GBB A;  3VXB A;  3U92 A;  1FCK A;  2RC8 A;  3K6W A;  3UN6 A;  3OO6 A;  4GWY A;  1EYJ A;  2PFY A;  4ZZE A;  3MVX A;  2F35 A;  2Q8J A;  1FQE A;  1NV5 A;  2ONR A;  2AIX A;  4N13 A;  3PPP A;  4XXU A;  1N04 A;  1LAF E;  1FJ9 A;  5H8F A;  3MPL A;  3JZJ A;  1EZO A;  2THI A;  4G68 A;  2QVR A;  4BLA A;  2VD2 A;  2I6E A;  3DM0 A;  1EU8 A;  3LSW A;  4N07 A;  4NF6 B;  3I6V A;  4JB7 A;  3CG3 A;  2ZZW A;  2V3T A;  4OEV A;  5EQ9 A;  5AA2 B;  5L9O A;  1ZKB A;  2BJJ X;  1VSO A;  1HSE A;  4NN3 A;  2Y7I A;  1DK4 A;  1MS7 A;  1USY E;  3IOR A;  1S9T A;  5AA3 A;  1MY2 A;  5I57 B;  4U4S A;  4BDM A;  1M5D A;  2VPO A;  4R6H A;  4OVT A;  4KYD A;  2FIE A;  4PE5 B;  4PDD A;  2QFL A;  5FHO A;  3O6G A;  4DLD A;  4GQO A;  3RYD A;  3N6T A;  5I56 A;  1UTH B;  1MM6 A;  4DI4 B;  4P56 A;  2DXY A;  3V8X B;  3JYR A;  3IOV A;  2REG A;  4Q30 B;  5ITO A;  3WAF A;  2FVZ A;  4GFR A;  4PFW A;  2NUV A;  1NUW A;  3PPQ A;  2QJE A;  2V84 A;  2YLN A;  4IO7 A;  2ONS A;  3KBR A;  1MXX A;  1XVX A;  4AB5 A;  5I59 A;  3E79 A;  2VOZ A;  3MUQ A;  4I9D A;  1H3D A;  1PEB A;  1B9J A;  3USD A;  4ESW A;  3V89 B;  1P1O A;  4R2B A;  1UTB A;  4XKR A;  4JWY A;  1SYI A;  2VT5 A;  3O28 A;  1GR2 A;  3EQ1 A;  4ZE9 A;  4P1L A;  4HTG A;  4QXD A;  2H4I A;  5I84 A;  5I2N B;  4TQU Q;  3DLN A;  1QJM A;  3LUZ A;  5I58 A;  1T0K A;  2HFB A;  2F7B A;  1FTO A;  4LON B;  1OQH A;  4U22 A;  4DIG A;  4EXL A;  4MEV A;  3IAZ A;  3PU5 A;  2I3V A;  2E1S A;  5AA1 A;  4P1E A;  3U93 A;  2ABH A;  2O1L A;  5H8N A;  4IO5 A;  2P1S A;  3FVN A;  1YPN A;  1ANF A;  1JVX A;  4NGU A;  1B3H A;  4H65 A;  3FV2 A;  5IM2 A;  1A40 A;  1IIT A;  1H45 A;  4N17 A;  5JTY B;  3OMB A;  1N7X A;  4HE1 A;  1KA0 A;  4F1V A;  2E0S A;  1B40 A;  4R73 A;  1NKX A;  1QUJ A;  1LFH A;  3SES A;  2DVZ A;  3P7I A;  4ZEF A;  4JBZ A;  5FHM A;  4MNP A;  4MIJ A;  1I6Q A;  2DDK A;  1D9Y A;  1ZBM A;  1BTJ A;  4YKI A;  2XA5 A;  3DP6 A;  2NVU B;  1IMB A;  4F2Q A;  2CEX A;  3CFL A;  4JWX A;  1A55 A;  4H8I A;  4PGP A;  3QMF A;  2P0S A;  4DDD A;  5F24 A;  1MG1 A;  3FAT A;  3FJG A;  3K01 A;  4YB5 A;  3T9H B;  2HXR A;  4IGR A;  2QVU A;  4MNC A;  4MAG A;  3A29 A;  1R1N A;  4NQ8 A;  3B50 A;  5EHS A;  4ZEI A;  3D4C A;  4ZED A;  4GIZ A;  4YKJ A;  4G61 A;  3B6Q A;  3TDJ A;  1MY4 A;  3U72 A;  4LAT A;  2UXA A;  4EUO A;  4IB2 A;  1OLC A;  3O6I A;  5B70 A;  4N81 A;  4PAI A;  2WBD A;  1URG A;  5DEX B;  5DVF A;  2Y5L A;  2OBG A;  3SEV A;  4LQ2 A;  2RCA A;  1DTG A;  4BDQ A;  3KSJ A;  4O3B A;  4GLI A;  5A5L A;  3KC1 A;  3RUM A;  1AH5 A;  1IXH A;  3L6H A;  3PMX A;  4GX6 A;  4ZZA A;  2O7I A;  3N6U A;  3EHU A;  1IMA A;  1UIV A;  3H6U A;  3C4M A;  3S9E A;  4QF9 A;  3ZKL A;  2B3F A;  4GX4 A;  3CFZ A;  2H99 A;  3S9M C;  1Y4T A;  2Q8M A;  3CG1 A;  5H8N B;  2HAV A;  1VR5 A;  1D9Q A;  1NUZ A;  2D21 A;  2G93 A;  2CZL A;  1SI0 A;  3TTK A;  3IB1 A;  3EPE A;  1Y1Z A;  1B51 A;  3CSG A;  4OER A;  4FEB A;  3LSL A;  3K6U A;  4GWX A;  5KZT A;  4MJO A;  1O64 A;  4OET A;  3IX1 A;  3OSR A;  2Z8E A;  1DBZ A;  2B65 A;  3IOU A;  4R9G A;  3TCH A;  4QSD A;  3OOA A;  3RN8 A;  3SER A;  5T3J A;  4G2Z A;  1A7L A;  4NHB A;  5B7D A;  3TPA A;  3K6V A;  2CEY A;  1NV4 A;  3KBZ A;  3OXN A;  5IZ3 B;  1P1N A;  3QYT A;  1A8F A;  4NF5 B;  1OQG A;  1FTJ A;  1FJ6 A;  1FQA A;  1OMP A;  3LR1 A;  4TLM B;  2AL5 A;  3E13 X;  1SVX B;  1B0L A;  3W9W A;  3UK4 A;  3W15 C;  5H8H A;  3ZSF A;  4U4X A;  4NF4 A;  3C33 A;  4DCY A;  3HO7 A;  1B3F A;  5TPA A;  1L5T A;  2DWH A;  3OO7 A;  3FGS A;  3MZ1 A;  4PP0 A;  2WYK A;  1LBB A;  1RYO A;  1NUY A;  1NV3 A;  3O97 A;  1H76 A;  3UA8 A;  2WYP A;  1NV2 A;  2F7C A;  1FPG A;  5I3S A;  4GF8 A;  1EYI A;  1FTK A;  3HV1 A;  1MPC A;  1EYK A;  4EQB A;  2HHM A;  2NXO A;  1PC3 A;  4TOZ A;  1NNP A;  4NWC A;  1LAX A;  3MWB A;  2Y84 A;  4FED A;  2DE2 A;  4FEC A;  1Y9U A;  2PX1 A;  4NAP A;  3MP8 A;  4N6K A;  2I48 A;  1QUK A;  3ZKK A;  4K3F A;  1SYH A;  1URD A;  1FTL A;  5ET5 A;  4P0G A;  2QRY A;  3VVE A;  2PT1 A;  4LZ5 A;  4OVR A;  3ROJ A;  4LZ7 A;  4ND9 A;  1QGX A;  4N8Y A;  4YMB A;  3GYY A;  3PPR A;  3FAS A;  4GOT A;  1PBP A;  4QSE A;  3IOW A;  1FQB A;  3LC8 A;  5F7V A;  2XXR A;  3IOT A;  4X8R A;  2Q9T A;  5AE4 A;  2OCU A;  2H9B A;  4ZEB A;  4YU0 A;  4KYS A;  1MY0 A;  1NL5 A;  4RY1 A;  4HE0 A;  2UYF A;  4ELO A;  1GGG A;  2I4C A;  1A99 A;  3SET A;  2V3U A;  2ZYO A;  4GBV A;  1FPB A;  2F34 A;  4PE3 A;  3CI8 A;  2WEF A;  4OVJ A;  2ANJ A;  3L6G A;  3VE1 B;  2ESN A;  4PC9 A;  3TFL A;  2GHA A;  1SI1 A;  4I8C A;  1NUX A;  3PMV A;  4AQ4 A;  2CZK A;  2Y7R A;  3A3U A;  3TUS A;  4MHF A;  3LBS A;  1FRP A;  4ECF A;  5TPA B;  1WOD A;  3T93 B;  3BIG A;  4JVI A;  3BIH A;  1POT A;  1DPE A;  2OWS A;  1IZ1 A;  2XXK A;  4F3P A;  3MVW A;  2RF1 A;  1MDQ A;  2Q2A A;  2ZXT A;  4HCW A;  5ET8 A;  1IMF A;  4YKP A;  2Q89 A;  3T1B A;  2W7Y A;  5J16 A;  4GXA A;  4QFL A;  3KN7 A;  1TFA A;  1MY1 A;  3VFJ A;  5EQ7 A;  4M1V A;  1Y20 A;  2F97 A;  4OAN A;  2R8T A;  3C34 A;  4U23 A;  2DWJ A;  3MP6 A;  4R75 A;  2FNC A;  3K1P A;  4RPO A;  2O6A A;  3K2D A;  4PET A;  4ESX A;  3PD8 A;  3H4Z A;  1IME A;  5HM4 B;  1R9L A;  4I3Y A;  2GHB A;  3E4R A;  3UP9 A;  5AA4 B;  3KGC A;  3K02 A;  3VDF A;  4R6Y A;  1GVC A;  4G4P A;  2A5T A;  2CZI A;  4Q8R A;  3MJN A;  3TQW A;  1N3X A;  4RXL A;  5HBC A;  4OEN A;  2NWJ A;  4PGN A;  3H6V A;  3KZG A;  4OVS A;  4G8M A;  1N3W A;  2KQZ A;  3ODB A;  3ZS6 A;  2DWI A;  1MQI A;  1WVJ A;  3MST A;  2OLB A;  3OEL A;  2RC7 A;  4NF8 A;  5L9S A;  3T0J A;  4MF3 A;  2XXH A;  5IKB A;  3T66 A;  3VV5 A;  3Q29 A;  3SEU A;  2B4L A;  4F29 A;  4N8G A;  3K4U A;  1LBX A;  3QAX A;  1M5C A;  3AXF A;  3VLV A;  1MPD A;  1TWY A;  2OJT A;  1IQ7 A;  2ZZX A;  2HAU A;  3W9V A;  3LV0 A;  1B7U A;  3K1M A;  2WX9 A;  2D3I A;  4ZDM A;  2O84 X;  1FPF A;  4KCD A;  4GL8 A;  2MKZ A;  4NG7 A;  5I2K A;  4LQ5 A;  3OEM A;  1LBV A;  1MXZ A;  4EF2 A;  1FQD A;  2DE4 A;  2ZMB A;  4QFO A;  4H45 A;  1FTM A;  4NWD A;  3B7D A;  1NNF A;  2DXR A;  3ONM A;  3PD9 A;  1JW4 A;  4OEU A;  3RTW B;  3IL1 B;  3H6W A;  4RPN A;  5H8F B;  1MQD A;  4U21 A;  3N94 A;  1LEV A;  4O3A A;  4G68 B;  4OFL A;  1ZTY A;  4QFN A;  3CSB A;  3PMW A;  4R6K A;  1MRP A;  2DOJ A;  2Y7W A;  1SW4 A;  5EYF A;  1O7T A;  1B1H A;  4UAB A;  1LCT A;  1Y3Q A;  5KCJ A;  1JET A;  2IA4 A;  3KEI A;  2HEU A;  2XXX A;  2ZNT A;  2B3B A;  1A8E A;  2X7Q A;  3FV1 A;  3IB2 A;  3T9X B;  1B4Z A;  1ZLQ A;  5JEI A;  1QVS A;  4PFR A;  1XI6 A;  4QSC A;  4IY5 A;  3THI A;  5I7I A;  4F18 A;  3RT8 A;  4O8M A;  3PUY E;  4ZE8 A;  3C36 A;  1LBY A;  4QFK A;  5AA2 D;  3I5O A;  5EYH A;  3S4U A;  5I56 B;  4ELP A;  2OWZ A;  5K2Y A;  4THI A;  3ECR A;  3TTN A;  3HPI A;  2OPD A;  3R6U A;  1IIW A;  1JW1 A;  3SEW A;  2F78 A;  2Y5K A;  4MX6 A;  2O69 A;  3TMG A;  3T22 A;  4XFE A;  2XXP A;  1FPK A;  3GBA A;  4GL0 A;  2FIX A;  1MXU A;  4LN5 A;  1CNQ A;  5I59 B;  1G0H A;  4F3S A;  4MLV A;  3M3F A;  3G7W A;  4FAJ A;  3H7M A;  4NTL A;  1UTB B;  1NI9 A;  1QUL A;  4H46 A;  1MQH A;  4P8B A;  5DVI A;  2XXU A;  3ILU B;  3K6X A;  1FPI A;  5A5X A;  2YPN A;  4KI0 E;  2WBB A;  1FQF A;  5I58 B;  3FVO A;  4RYA A;  2PYY A;  1SD3 A;  1PB8 A;  4FJP A;  1ZJL A;  4XF5 A;  3RT6 B;  4OMB A;  3PPO A;  5J1D A;  2OWT A;  4R72 A;  4GBW A;  4KXP A;  3RPL A;  3TQL A;  4H5F A;  3Q27 A;  3KG2 A;  1XHY A;  4R9F A;  1Z7M E;  2QMW A;  1J1N A;  4POX A;  4OQO A;  4PAF A;  4PFU A;  1USY H;  2F3B A;  2F7A A;  4XKN A;  1IXG A;  5ISU A;  3MZB A;  2QS2 A;  3TTM A;  2P2A A;  2OK2 A;  3TTL A;  1Y3N A;  2V25 A;  5FTI A;  3DP4 A;  4AB6 A;  1XVY A;  3N5L A;  4C1U A;  4G8H A;  3UGW A;  2O68 A;  1B3G A;  3M3K A;  1DCU A;  5CRY A;  2P3N A;  1AMF A;  4KFQ A;  2XXW A;  1B7H A;  1JEV A;  1LBZ A;  1MM7 A;  1NMU A;  2QS3 A;  1B52 A;  1LGB C;  3R26 A;  1B58 A;  5ICT A;  2A5S A;  3IJO B;  3FVG A;  1LST A;  1MH4 A;  3O2A A;  2I0C A;  5CI5 A;  4DXU A;  1I69 A;  3PUX E;  4YB7 A;  2HPG A;  3A3C A;  4HW8 A;  3MQ9 A;  1B5I A;  4YMA A;  1LAH E;  2REJ A;  3CIJ A;  1M5B A;  4N6P A;  1RDX A;  3FUZ A;  3E3K A;  1P1W A;  4JDF A;  3KFM A;  1TT1 A;  3U65 A;  4KR5 A;  3QIM A;  4UA8 A;  1JQF A;  4QFP A;  3JV9 A;  2V93 A;  3EN3 A;  3GZG A;  3FXB A;  1B05 A;  5CBS A;  4UAC A;  3TEL A;  1NV7 A;  4GWU A;  2OZZ A;  4ELQ A;  4XTC Q;  1US4 A;  1VDW A;  3BKI B;  4F22 A;  1NNT A;  5F1Q A;  2BJI A;  4X9T A;  4RK9 A;  3G3G A;  3FVK A;  2G29 A;  1H43 A;  2H5Y A;  2XX7 A;  5KDT A;  2UVI A;  3SKP A;  4IR8 A;  4ZEK A;  4OES A;  1BK4 A;  4X48 A;  4MFI A;  1K9Z A;  2XXV A;  3U8Q A;  3VLW A;  4NMY A;  2ZNU A;  4PFY A;  5L8D A;  4KYE A;  3CRB A;  1NV6 A;  4KHZ E;  1SW2 A; 
#chains in the Genus database with same CATH homology
 5EYG A;  4P1E A;  4PET A;  2KR0 A;  2CZH A;  4F19 A;  1IME A;  1FBD A;  4NGU A;  4I3Y A;  2PFZ A;  5IM2 A;  4N17 A;  4F1U A;  5IZ1 A;  4HE1 A;  2QPQ A;  4MMP A;  1KA0 A;  1YZ0 A;  4OA4 A;  4F1V A;  2CZI A;  3IFA A;  2DVZ A;  4XEQ A;  3EKI A;  4MNP A;  4NF0 A;  2DE3 A;  4OVP A;  4MIJ A;  4P47 A;  2DDK A;  4MCO A;  3E78 A;  2XA5 A;  2XWV A;  4PBQ A;  1IMB A;  3KC0 A;  2CEX A;  1AWB A;  4PGN A;  4GWS A;  4OVS A;  4YZZ A;  1JP4 A;  2KQZ A;  4PGP A;  4PF6 A;  3QMF A;  5F24 A;  4P9K A;  3MST A;  4HCY A;  2HXR A;  2QVU A;  4O7I A;  4MNC A;  3T0J A;  5ESY A;  2V3Q A;  4MAG A;  4PTK A;  3A29 A;  4NQ8 A;  1KZ8 A;  4HXV A;  3B50 A;  1FBG A;  4G61 A;  2B4L A;  4N8G A;  1NV1 A;  1LBX A;  4N81 A;  4PAI A;  2WBD A;  2ZZX A;  2Y5L A;  3W9V A;  4PDH A;  3LV0 A;  2WX9 A;  2XWK A;  5IGA A;  1FPF A;  2MKZ A;  4NG7 A;  3B8B A;  2FBP A;  5A5L A;  4YIC A;  1LBV A;  3KC1 A;  3ISP A;  5ET7 A;  4GX6 A;  4JVD A;  2DE4 A;  1Q9D A;  2JJK A;  1IMA A;  4H45 A;  3RPL B;  1FBC A;  1FPJ A;  2ZZV A;  1K9Y A;  1INP A;  4GWZ A;  1SPI A;  5ET6 A;  4GX4 A;  1LEV A;  3D1R A;  2Q8M A;  4GWW A;  2QVV A;  1KA1 A;  4UAB A;  1D9Q A;  4P3L A;  1NUZ A;  4N6D A;  2XWI A;  5EQA A;  4JVC A;  4PAK A;  4I40 A;  2Q74 A;  4GWX A;  4MJO A;  4PFR A;  2XWO A;  1XI6 A;  5I7I A;  5IZZ A;  4F18 A;  1DBZ A;  2F3D A;  4O8M A;  4FBP A;  1G0I A;  1LBY A;  5T3J A;  4NHB A;  4QBA A;  5EYH A;  2CEY A;  1NV4 A;  2VPN A;  4HE2 A;  3KBZ A;  5IZ3 B;  1FBF A;  2OWZ A;  3SZP A;  2P3V A;  1FPL A;  1FJ6 A;  4OVQ A;  4AS4 A;  4PBH A;  1RDZ A;  3W9W A;  4O7M A;  1YXI A;  2Y5K A;  5JK4 A;  4MX6 A;  1FBH A;  4AS5 A;  2B4M A;  4XFE A;  2HZK A;  1FPK A;  1LBW A;  4N91 A;  2FIX A;  4LN5 A;  4PFI A;  1CNQ A;  1G0H A;  5EQ8 A;  2WYK A;  3CHG A;  1IMC A;  2OX3 A;  1NUY A;  1NV3 A;  3FBP A;  2WYP A;  1FSA A;  1NV2 A;  3HFU A;  1FPG A;  1NI9 A;  5I5P A;  2F5X A;  4H46 A;  5I3S A;  4P8B A;  1EYI A;  1YYZ A;  1FPI A;  2V4C A;  1FPE A;  5CM6 A;  2FHY A;  2WBB A;  3PTY A;  4O94 A;  1EYK A;  2HHM A;  4PF8 A;  4XF5 A;  4X04 A;  4GWY A;  1EYJ A;  2DE2 A;  2PFY A;  5J1D A;  4GBW A;  4KXP A;  1NV5 A;  3RPL A;  4NAP A;  2HZL A;  4N6K A;  1FJ9 A;  4N4U A;  2QVR A;  5ET5 A;  5FBP A;  4PAF A;  4OVR A;  3ROJ A;  2GQ1 A;  1FBE A;  2F3B A;  1QGX A;  4N8Y A;  3GYY A;  1FTA A;  4MNI A;  2ZZW A;  5EQ9 A;  4PFB A;  1NV0 A;  4NN3 A;  1DK4 A;  4X8R A;  2Q9T A;  3NOH A;  2VPO A;  4OVT A;  2FIE A;  3MYU A;  1DCU A;  4HE0 A;  2P3N A;  4PDD A;  2QFL A;  1RDY A;  4NX1 A;  1LBZ A;  4GBV A;  1FPB A;  4PE3 A;  2WEF A;  3RYD A;  5IZ3 A;  4PC9 A;  4DI4 B;  4I3E A;  5LDZ A;  4P56 A;  1NUX A;  2CZK A;  4MHF A;  1FRP A;  2FVZ A;  2HPG A;  1NUW A;  3BIG A;  5LTC A;  1FBP A;  4JVI A;  3BIH A;  1IMD A;  2XXK A;  1RDX A;  3E79 A;  4HCW A;  2L5V A;  5DW8 A;  5ET8 A;  4PCD A;  3U65 A;  1IMF A;  4GX3 A;  3IFC A;  2PCR A;  3FXB A;  3T1B A;  1NV7 A;  5J16 A;  4GWU A;  1VDW A;  2VT5 A;  4P1L A;  2BJI A;  4X9T A;  4QXD A;  3LUZ A;  4IR8 A;  5EQ7 A;  1BK4 A;  4M1V A;  4OAN A;  1K9Z A;  2R8T A;  4DI3 D;  4MEV A;  4N15 A;  1NV6 A;  1FPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...