2Y5LA

Orally active aminopyridines as inhibitors of tetrameric fructose 1,6- bisphosphatase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
327
structure length
319
Chain Sequence
b'DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
molecule tags Hydrolase
source organism Homo sapiens
publication title Orally Active Aminopyridines as Inhibitors of Tetrameric Fructose-1,6-Bisphosphatase.
pubmed doi rcsb
total genus 106
structure length 319
sequence length 327
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2y5lA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2y5lA02
2OX3A 3BIHA 4HXVA 5ESYA 1FBGA 5IZ1A 1EYJA 4GX4A 5J16A 2DDKA 2FVZA 4I3YA 2HHMA 4PTKA 1G0IA 2FBPA 1FSAA 1NUYA 1FPEA 3IFAA 5IZ3A 1FPBA 2R8TA 4I3EA 5EQ7A 1FBDA 2PCRA 2QVUA 4GX3A 4KXPA 3RPLA 3RYDA 1LBWA 1QGXA 2JJKA 1IMEA 1FPDA 2WBDA 2QVRA 3BIGA 4GWXA 3KC1A 1IMCA 1FPIA 4HE1A 3B8BA 3ROJA 4GX6A 1YXIA 1IMDA 1D9QA 1NV2A 5A5LA 3A29A 4HE2A 1IMAA 3KC0A 4GWWA 5FBPA 1LBYA 5DW8A 2F3DA 3QMFA 2FHYA 2FIXA 1YYZA 5EQ8A 5EYGA 5T3JA 1VDWA 2Y5LA 1FPFA 1FPJA 1K9YA 1FBEA 4IR8A 1BK4A 2CZIA 1LBVA 1FJ6A 1FPGA 1RDXA 1NV6A 1RDZA 4G61A 3LV0A 4N81A 1LEVA 5ET6A 3D1RA 2WBBA 1AWBA 1NI9A 1FPKA 1FBCA 1NV4A 4GBWA 1G0HA 2Y5KA 1FJ9A 5LDZA 1FTAA 2CZHA 4GWZA 5ET8A 1NUXA 2BJIA 5EYHA 1DCUA 4H46A 1NV3A 5ET7A 3RPLB 5F24A 2VT5A 1YZ0A 4HE0A 1KZ8A 1FBHA 2QFLA 2CZKA 2P3NA 4QXDA 2Q8MA 4FBPA 1KA1A 1DK4A 1LBZA 1CNQA 4GWUA 1NV7A 1KA0A 3FBPA 4MJOA 5IZ3B 1SPIA 1FPLA 1NV0A 1JP4A 1NV5A 5ET5A 1INPA 1LBXA 2OWZA 4I40A 1NV1A 5EQ9A 1IMFA 4GWSA 2P3VA 1Q9DA 3T0JA 3KBZA 5I3SA 4GBVA 2Q74A 2FIEA 4AS4A 1DBZA 1XI6A 4GWYA 2QVVA 2F3BA 1FBPA 5EQAA 1K9ZA 3IFCA 1IMBA 2GQ1A 1NUZA 1RDYA 4H45A 4O7IA 1FBFA 1EYKA 1EYIA 4AS5A 1NUWA 1FRPA 2WEFA 3LUZA
chains in the Genus database with same CATH superfamily
4I3YA 2PFYA 1XVYA 3KFMA 3SZPA 1MQIA 1YCJA 4PDDA 2IEEA 3ONMA 4F3PA 3ZSFA 4QSDA 2QVUA 3TZAA 3RYDA 1FPDA 3MQ9A 3ROJA 1Z7ME 3LSWA 4MLQA 3K2DA 1QUJA 3U1OA 1JW5A 5I58A 3FXQA 1B3FA 5TP9A 2HAVA 5T3JA 5AA3A 1OVBA 1B5JA 5AA2A 3IR1A 4ESXA 3C36A 2DE2A 4N81A 1FQDA 2GRVA 3CVGA 2FA7A 2VP1A 3QIMA 3IORA 4PFYA 3S9NC 3W15C 4PGPA 5H8QB 2V4CA 1T0KA 1IZ1A 3CR9A 3K01A 4NF8A 4WXJA 5IM2A 3H06B 3TCFA 1OIBA 2HCAA 2XXQA 3VVFA 1INPA 5EQ9A 2XWIA 3RT8A 3MVYA 4G68A 1AIVA 1VSOA 4ELPA 3MSTA 4DXBA 1OLAA 2ONKE 3TTNA 1K9ZA 4F29A 3IAZA 1FQEA 2FYIA 2UVJA 4R74A 4XKQA 4YKKA 2YJPA 1EU8A 2XXXA 4WKMA 5DVFA 4RNSA 3VFJA 2Y7RA 1SVXB 1ZJLA 5ITOA 4EF1A 2Y84A 1IXGA 4OWDA 1B3LA 1MM6A 2B3FA 5H8SA 3TDJA 4JWOA 3CG3A 2PX1A 2O7UA 4GX3A 3VLVA 2REJA 4YB5A 1SBPA 4GWXA 3KJTA 3T9HB 1OQGA 2ABHA 4GOTA 3TTRA 2DWJA 3PUWE 2CZLA 2IA4A 2QS4A 4RK2A 1SYIA 4IR8A 2HXWA 3OSRA 1YAEA 4DZ1A 2CZIA 2VOZA 3TKDA 4TOZA 3CIJA 1NH8A 3TPAA 4Z7EA 1MPBA 4MCOA 1FBCA 5AA2B 1SW5A 3O29A 4OANA 2GH9A 1B3HA 4G8HA 4XFEA 4ZZAA 5LTCA 4IO7A 3RPWA 4QFPA 3T1BA 3RUMA 1B58A 4DXCA 4QSCA 1JVYA 5CBRA 3FBPA 4MJOA 1MY3A 3ILTB 3V8XB 4NF5A 1QULA 1MH4A 4F3GA 5BWJA 2DXRA 1QKAA 1MDQA 4YMBA 3B50A 4RYAA 3TCHA 3Q29A 4MMPA 3O6IA 3V89B 3E13X 4OFOA 1D9YA 4R9GA 5F7VA 2WEFA 2OX3A 4QHQA 4N8GA 5H8HB 1L5TA 3OO6A 1Y1MA 2DVZA 5CMCA 3THIA 1G0IA 2FBPA 1FPEA 1Y3NA 3OXNA 1SDXA 3ECRA 2I0BA 4GIZA 2MKZA 4DXUA 2A5SA 2DXYA 3UGWA 3TTMA 4LZ5A 4YU0A 1LGBC 3K6VA 4NHBA 5DEXB 1B3GA 3VLUA 2KR0A 3MVWA 4MLVA 2G29A 4MF3A 2Y7IA 2ONRA 1O63A 2QS2A 1FPFA 5ITPA 4NF6B 3UN6A 3UA8A 4P11A 1RDZA 1B40A 4G68B 3KEIA 5FTIA 2XHDA 2OWTA 5J1DA 3RGYA 1NI9A 4P47A 3VE1B 3V83A 1G0HA 4QFLA 5LDZA 1NUXA 2F7CA 1MQGA 2Z22A 4R2FA 1FBHA 2Z23A 2O84X 1GGGA 5JTYB 4ND9A 1LFIA 2DE4A 4H0WA 5I58B 5I7IA 1NV5A 1POY1 5CMKA 4MAGA 4IGTA 2P3VA 2F7AA 2P1SA 2O68A 4GWYA 2QMWA 2I49A 3IB1A 3FVNA 2HPGA 3H7MA 1RYXA 1M5FA 1MXWA 4ZEBA 4AS5A 1NNKA 3RLFE 5ESYA 4JWXA 2FVZA 4TQUQ 2PT1A 1ZBMA 1USYH 4MNPA 3IFAA 4P1EA 1FPBA 4BDNA 4XXUA 3K02A 5FHMA 4H1XA 4U23A 4JSDA 3UP9A 4P9KA 3PGFA 2DOJA 4N6KA 5KCJB 2X26A 1BP5A 4FECA 1GVCA 4PBHA 4LZ8A 5K2YA 1FQFA 3A3CA 4MH5A 1YYZA 4N15A 3CFXA 1FPJA 2XXKA 1ATGA 1LBVA 5ELVA 3DP4A 1QVSA 3TCGA 4HTGA 3LSLA 3WAEA 2Y7PA 3KJ7A 1LBBA 3T9UA 1CE2A 4LQ5A 4JXIA 3RPLB 5AA4B 3KGCA 4F19A 4HCWA 1S50A 2O7IA 3TQLA 3IB2A 4F3BA 3HV1A 4NMYA 2P0SA 5K2XA 3TELA 2THIA 4NQ8A 1R9LA 1NKXA 1FPLA 4Z0IA 4DIGA 4NTLA 1FTOA 2E1SA 4GWSA 2V3UA 3PPNA 2Q8JA 3H03A 1XI6A 1N3WA 5H8HA 4JWYA 4N8YA 3PD9A 4IO4A 1R1NA 3PU5A 4NF4B 3USDA 2NWJA 2GHBA 2XX9A 4BDLA 5IZ1A 3MVXA 2HHMA 3D4GA 3FV2A 4G2ZA 5BUUA 4RJZA 1B4ZA 2R8TA 4NF5B 3E78A 4EF2A 1S9TA 2JJKA 3FIRA 1LSTA 4OFLA 4GXAA 4GF8A 3TYHA 3W9WA 4GL0A 3DP8A 1D9QA 4POWA 3G3HA 3C34A 4UABA 4JVCA 2FHYA 1TT1A 4KD5A 3I5OA 3T66A 1N04A 3MP8A 1RDXA 1IXIA 4HW8A 4YZZA 3ZS6A 3O6HA 3QUFA 2QMXA 1FPKA 2AL4A 3GXAA 1ZTYA 1I6AA 3HFUA 3HHGA 4PF6A 4F3SA 3MBPA 3RTFB 2ESNA 2I4BA 3FXRA 2VT5A 4HE0A 2XD2A 1LBCA 2RC9A 2ZXTA 4NN3A 2D5WA 3FGSA 1BIYA 1UTHB 5KDTB 4PFTA 4U21A 2XWOA 1JEUA 4P56A 1NV0A 2RINA 1EZOA 4R6YA 3S9LC 1UTHA 1AMFA 3OEKA 4F39A 3T0JA 1QJMA 4GBVA 4U4XA 4EDPA 1MXXA 2F3BA 4I62A 4PFRA 4MX6A 3W9VA 5TU0A 5I57A 4OZ9A 3VVDA 2XXPA 3R6UA 1PB7A 4X1DA 2HZLA 4KCCA 4MBPA 3PUVE 4Q30B 3FV1A 4RPNA 5IZ3A 5EQ7A 2HAUA 4XKNA 4ESWA 1MQJA 1ZLQA 4NF8B 4FE8A 5A5XB 4KXPA 2R9JA 3G3FA 4H5FA 4OEVA 3BIGA 5I2KB 2OZZA 4C1TA 5TP9B 1POTA 3O2AA 3ZKLA 1RYOA 4HE2A 1SD3A 3EN3A 4G68C 5EQ8A 3C32A 4U1OA 5I2NA 4G8MA 3TQWA 4MNCA 4XF5A 3VVEA 3VDFA 4GLIA 1FTKA 3SEVA 3LV0A 1D9VA 3DM0A 5DVIA 3FUZA 5ET6A 1UIVA 3D1RA 4I9DA 1XHYA 2GFEA 5ET8A 2I3WA 3LC8A 4H67A 3BFUA 1URGA 1P1UA 1A55A 3RQTA 2P3NA 3MPKA 1JNFA 2Q8MA 3PMWA 4XIGQ 1IITA 4GWUA 2L5VA 4ELQA 3KN8A 4ZS9A 3E9XA 4NF6A 4EXLA 4N17A 2HZKA 3OO9A 1DMBA 3G3JA 2W7YA 5I57B 5IAIA 4LN5A 5IKBA 2DYXA 4OETA 3GZGA 1PC3A 4EQ7A 5EQAA 1IXCA 4F2QA 2XX7A 3MP6A 4G77A 4PF8A 4TLMB 4L17A 1IUDA 3P7IA 4OESA 3U92A 4GX4A 2RF1A 1SI0A 5I59A 3GBAA 4O3CA 1URSA 1NFTA 3G3GA 3DP6A 4I3EA 1MDP1 2R6GE 2H99A 4JDFA 1VE4A 2F36A 2ZZVA 3SDFA 2PCRA 2ZNSA 1MXVA 1TXFA 1A54A 3KC1A 1JQFA 2UVHA 1IMDA 3F11A 2LAOA 2V3TA 3UIFA 3DELB 4O3AA 3TFLA 3NOHA 1LLSA 1MG1A 4NWCA 2HXRA 2OCUA 4KCDA 1MY2A 1NNPA 4DDDA 4F1YA 4F1UA 4ISUA 1B3EA 3JV9A 3UK4A 2VD3A 1B05A 2WBBA 2NXOA 4JB7A 1Q1KA 4GBWA 2A5TB 5LOMA 2CZHA 4DCXA 4ZEFA 5AE4A 3IOUA 2XXHA 1B7UA 3PUZE 1HSJA 1II5A 1Z7NE 4QXDA 3DLNA 1LCTA 4XKRA 4YMAA 1PEBA 5ISUA 4N91A 3KN3A 4GD5A 3PTYA 4QBAA 1NV1A 4OVRA 5CM6A 1MM7A 3KBZA 2F35A 4PFBA 2FIEA 1MY4A 1DBZA 4PAIA 2XXWA 3M3LA 2I4CA 4NAPA 2H9BA 1H76A 3AXFA 4PE5B 5EHSA 2ZZWA 1EYKA 1N84A 1NUWA 1LCFA 3BIHA 4U1ZA 2HQ0A 4OXVA 4E0WA 3HO7A 5ICTA 1FSAA 1AH5A 1EZ9A 4O7MA 4N07A 4F31B 3IJXB 4KFQA 2Y7KA 4RXLA 2Z8EA 4ZEKA 1IMEA 3T22A 1IQ7A 3MW0A 3L6HA 3TODA 1WODA 1YXIA 5A5LA 2UYEA 3IK6B 3MUQA 3CG1A 1FQBA 5CMBA 3QMFA 4R75A 2DE3A 4GL8A 5FTHA 3L6GA 3FZVA 4NGUA 2HFBA 2ALUA 4FEDA 2V93A 3OENA 1FW0A 2DWIA 1ZIUA 1B1HA 3OSQA 1NNFA 2FNCA 5F24A 3PV0E 1YZ0A 3N6TA 3T9XB 1MRPA 2ANJA 2XWKA 1KA1A 1ZKBA 3IOTA 3PD8A 5IZ3B 1QUKA 1H45A 1OQHA 4DLDA 1QKBA 3R26A 1FQAA 1Q9DA 4TLLB 4NF4A 2X7QA 4PFWA 4JVDA 3CFZA 3SEYA 4N13A 1EZPA 1M5DA 1LAFE 5EHMA 3V5AA 2P2AA 3PUXE 1DTGA 1YTVA 3RY3A 1WVJA 3G7WA 3MYUA 1EYIA 3KZGA 1Q35A 1UIUA 2B4LA 1IXHA 4QFNA 1EYJA 3CSGA 2QPQA 4FJPA 1IIWA 2QS1A 1N7WA 5TPAA 4H8JA 5CMMA 4UACA 3SEUA 1P1WA 4MEVA 3EF7A 3RPLA 5AA4A 5EYFA 1FPIA 1GR2A 4DI4B 4KI0E 1UQWA 3MJNA 1GTKA 2I48A 3KC0A 4MFIA 2NVUB 5KDTA 3IO4A 3EHUA 2KLFA 3A09A 1OVTA 3KN7A 2Q2CA 3PUYE 4XEQA 3M3KA 2XXYA 4P1LA 1EH3A 1I6QA 1A40A 1O64A 3K6WA 2DWAA 1VFDA 4YKJA 5H8FA 2F78A 3HSTA 4GFRA 1B52A 4NWDA 2OWZA 4ZEIA 4U2RA 1A99A 1S7YA 4P3LA 3B6QA 3Q28A 4IY6A 3PPPA 3KSJA 1IMBA 2GQ1A 1NUZA 4RPOA 4O7IA 4IO2A 2V25A 5AA1A 4OHNA 1B0HA 1MS7A 2UXAA 4PCDA 1DPEA 3FJMA 4WEDA 2XXIA 5H8NA 1A7LA 3VXBA 3BKIB 1OLCA 1URDA 3GBBA 3K0VA 4IB2A 3CHGA 4EQ9A 1B51A 3U8QA 3EHSA 2O51A 3GLBA 2QVRA 2RKMA 1N3XA 2E0SA 1PBPA 4JSOA 1O7TA 4R9FA 3HN0A 5H8FB 3A29A 3OEMA 4BDMA 3A3UA 4GWWA 5DW8A 4YAHX 3LSXA 2WX9A 2B4MA 2Z8FA 3PPOA 1VDWA 1Y4TA 1FBEA 1BK4A 5I56A 2UYFA 4OMBA 3C33A 4F1VA 2XXTA 4HCYA 3CRBA 5L9SA 5DYHA 1TWYA 4P0GA 3MZ9A 2AYSA 2BJIA 1DCUA 3U94A 2KQZA 1Y1ZA 3QYTA 3IOWA 1NMUA 3QAXA 5JEIA 4GVOA 3ODBA 1SI1A 1OMPA 4IO5A 3R7XA 1NV7A 3B6WA 2H25A 1KA0A 3O6GA 3IJOB 5L9OA 2ZZXA 1LFHA 3TEPA 4G4PA 5I3SA 3K1PA 3RT6B 3FXUA 3K6UA 5HBCA 3BFTA 3FJ7A 4KHZE 1AL3A 4ZDMA 2DWHA 5M2VA 2QJEA 1FRPA 4LONB 1B1XA 2DDKA 1LB9A 5I2NB 3KG2A 1XC1A 3OO7A 3C35A 4PTKA 4X48A 1B46A 1DSNA 1SW4A 2Q88A 1N76A 1B5IA 2PFZA 4OVTA 3C4MA 1LAGE 4OERA 1FTMA 2G93A 1MXZA 4C1UA 2V3QA 3SEWA 3B8BA 5B70A 3H6TA 4M4GA 4IO3A 2YPNA 3RTWB 2NUVA 4QFKA 2B3BA 1B32A 4R2BA 5EYGA 4U22A 4KYDA 2F34A 2PT2A 2Y5LA 2UVGA 1FTJA 4PAKA 4G61A 1N0TA 1PB9A 1M5CA 1UTBB 3H6WA 4ZE8A 3OMBA 3MZ1A 3N26A 1FTAA 2GHAA 4H46A 5I84A 4ELRA 1JETA 5I59B 1JEVA 3RN8A 5FHNA 4FBPA 3S4UA 1B4HA 5AA2D 4EQBA 4I1DA 4YB6A 4BDRA 3MC2A 1LFGA 1I69A 2X7PA 5DVJA 2RC7A 4AB6A 1FQCA 5KCJA 4N6DA 4X9TA 2F8DA 1D4NA 2ZYMA 3S9EA 2UVIA 1JW4A 2XXUA 1FBGA 3MVZA 5DTBA 3K00A 2PMSA 5DT6A 4JVIA 4LQ2A 1J1NA 3U72A 2AIXA 4U4SA 4OQOA 2F6GA 3HHFA 1NL5A 4F22A 2CEYA 1LAHE 4ZE9A 1LBWA 1MQDA 2QSXA 4MIJA 1CB6A 2DVCA 4KQPA 1YPNA 3I3VA 2DSFA 1H44A 2HEUA 2Z8DA 2O69A 1TFAA 2CEXA 4MHFA 1LB8A 3MP1A 1MY0A 1UTBA 4Q0CA 2B65A 2A5TA 5CRYA 3BBRA 3FD3A 4PP0A 1BKAA 4PFIA 4LATA 1WDNA 4NEDA 3C9HA 3PPRA 1SYHA 4NG7A 4ECFA 4PETA 1DTZA 2WYKA 2Y5KA 3VLWA 2I3VA 5EYHA 3TMGA 5ET7A 2H98A 4RK9A 4P0IA 1MXYA 3O66A 3PMVA 4R73A 2QFLA 1USYE 1GV8A 4QSEA 1NH7A 4MNIA 3SERA 4OENA 3CSBA 4K3FA 1JP4A 4XTCQ 4I40A 1LBXA 4YB7A 1A8EA 3FJGA 4PQJA 1Y4CA 4LVQA 4AQ4A 4OFJA 1Y3PA 3M3FA 3KOSA 3FVOA 3T9VA 1TFDA 3M8UA 2PYYA 3E3KA 2XX8A 1FBFA 1B7HA 3KSXA 2Y7WA 3B7DA 5L9MA 2Q9TA 2M8CA 1XS5A 2OLBA 4LA9A 1MY1A 3WAFA 3IO6A 3Q25A 4ZZEA 3ILUB 3K6XA 4H5GA 3IL1B 4HS7A 1SW2A 2O6AA 4KPTA 5IZZA 1BLFA 2I0CA 4NF0A 1FBDA 4PFUA 3MPLA 4PDHA 2I6EA 4PAFA 2WBDA 1I6BA 3ZKKA 1AOVA 4GX6A 2OBGA 4I8CA 1MXUA 1PDAA 4Q8RA 2Q2AA 4G8NA 1NNTA 1QW0A 4NE4A 2F6PA 4IO6A 1IMAA 3U65A 4ZECA 5IGAA 4IGRA 1ZU0A 3MZBA 4PGNA 4EUOA 1FTLA 2VPNA 2ZNTA 1DPPA 1N7XA 1Y3QA 4PBQA 2R71A 5H8NB 3S2VA 1DOTA 1PBQA 4LZ7A 3OD7A 2REGA 3QK6A 4KR5A 1MQHA 4QRZA 2D21A 4BLAA 3PPQA 4FORA 2NOOA 1CNQA 3SESA 5KZTA 1Y20A 1KWHA 2XWVA 4H6DA 5A5XA 2QRYA 1SW1A 4GRKA 2WYPA 3TAJA 4WEPA 4GXSB 2OJTA 4DI3D 3KBRA 1XOCA 3K1NA 1FCKA 3OO8A 2VGQA 3O28A 3TTKA 3CI8A 3IX1A 2XXVA 4E0XA 3KOTA 5CI5A 3ISPA 1R6ZA 4X1BA 2XXRA 4O3BA 4PE3A 2OPDA 4DCYA 4FATA 3EHTA 1M5EA 4XKPA 2D3IA 2I58A 4FAJA 5B7DA 3LBSA 4OVJA 5FBPA 2RC8A 4IY5A 3Q26A 3QSLA 1H43A 3VXCA 3K4UA 1MH3A 2OPEA 3O97A 1FPGA 1SQYA 2V84A 2H4IA 3SEXA 3S9MC 2ZYOA 3HPIA 5TPAB 3RNNA 3LSFB 1AWBA 1B7ZA 3B6TA 5F1QA 3GYYA 3UORA 2ZNUA 4GWZA 3MAMA 1NV3A 1QUIA 3FVGA 1KZ8A 4RY1A 2DP8A 5I5PA 2Q89A 4O8MA 1LBZA 4AB5A 2ZYKA 1SPIA 2AL5A 5I56B 4R6KA 4H8IA 2Q74A 4AS4A 4YKIA 4OEUA 1P1OA 4GWOA 4KYEA 3EKIA 1RDYA 4YICA 4N6PA 1P99A 4HXVA 5J16A 5CC2A 3TTLA 3LUYA 3VV5A 1JW1A 1NUYA 3C31A 3U93A 3E79A 4UA8A 2F97A 3EPEA 3QXMA 1RKMA 3H3GA 4QF9A 2BJJX 4OVQA 1XVXA 1IMCA 4H65A 4HE1A 1XT8A 4FEBA 3G3IA 1NV2A 5JK4A 3PMXA 2XA5A 5I2KA 1LBYA 2F3DA 1P1NA 1P1QA 3H4ZA 2DS9A 1K9YA 2OK2A 3JYRA 2ONSA 2RCBA 2F7BA 1ELJA 3G3KA 4OYVA 2O1MA 4DE8A 3SKPA 3H6VA 4PC9A 4F2OA 4O94A 2QS3A 1ZMGA 2XD3A 2QL3A 1IEJA 4ONYA 1A8FA 2CZKA 5DEXA 4OVSA 4BDOA 3FATA 1Y9UA 5HPQA 4N4UA 4P8BA 1B2HA 3SETA 4ELOA 3CFLA 3Q27A 5H8QA 5ET5A 4C0RA 2ZMBA 1IMFA 1B0LA 2O1LA 4LP2B 4M1VA 5L8DA 2QVVA 3E4RA 2VHAA 2CMOA 4EXKA 3IFCA 4OVPA 1R9QA 1B6HA 3OELA 2WKYA 1F9BA 3LUZA 3I6VA 4FIMA 2H5YA 4YKPA 4X04A 4KYSA 3MWBA 3IB0A 4OA4A 2PBWA 5FHOA 1H3DA 3T96B 2VD2A 1VFEA 4RA1A 5ICQA 2PVUA 3N5LA 4QFOA 1MPDA 5CBSA 1QGXA 3HCQA 4JBZA 4Q5TA 2F5XA 4LUBA 5JTYA 4F18A 1US4A 4OTEA 3TUSA 3QUJA 2FIXA 3FXBA 1BTJA 4R72A 1HSEA 1ANFA 1LAXA 4GQOA 3N6UA 3FASA 1FJ6A 1NV6A 3OOAA 5HM4B 4ZEDA 2YLNA 4THIA 1LEVA 1NV4A 3N94A 4NX1A 1PB8A 1FJ9A 1VR5A 2ZYNA 2DQVA 2RCAA 3EQ1A 4BDQA 4POXA 3D4CA 3FVKA 3O9PA 1M5BA 4X8RA 1DK4A 1US5A 2OWSA 4R6HA 1HSLA 3H6UA 3JZJA 3K1MA 1D3KA 1B9JA 1FBPA 3LR1A 1B5HA 4H45A 2VPOA 3IOVA 1JVXA 1MPCA 3T93B
chains in the Genus database with same CATH topology
2OX3A 3BIHA 4HXVA 5ESYA 2B4LA 1FBGA 5IZ1A 1EYJA 4GX4A 4N8GA 5J16A 2DDKA 2Q9TA 2FVZA 4I3YA 2HHMA 2DVZA 2PFYA 4JVIA 4PCDA 4X04A 4PTKA 2QPQA 3ISPA 1G0IA 2HZLA 2FBPA 1FSAA 3SZPA 4PDDA 1NUYA 1FPEA 4MNPA 4O7MA 4PE3A 3IFAA 5IZ3A 4P1EA 3E79A 1FPBA 2R8TA 4I3EA 5EQ7A 5IZZA 4OA4A 2MKZA 4MEVA 2ZZVA 2CEYA 3CHGA 4NF0A 1FBDA 2PCRA 2QVUA 4GX3A 2PFZA 4OVTA 4PDHA 3E78A 4KXPA 3RPLA 3RYDA 1LBWA 1QGXA 2JJKA 1IMEA 1FPDA 4PAFA 2WBDA 2QVRA 3BIGA 4GWXA 4OVQA 2V3QA 3KC1A 4MIJA 1IMCA 1FPIA 4HE1A 3B8BA 3ROJA 4P9KA 3W9WA 4GX6A 1YXIA 4DI4B 1IMDA 2F5XA 1D9QA 1NV2A 4N6KA 5JK4A 5A5LA 3A29A 4NHBA 4F18A 4PBHA 4HE2A 2XA5A 4UABA 4JVCA 1IMAA 3KC0A 4GWWA 5FBPA 1LBYA 5DW8A 2F3DA 2KR0A 3QMFA 3U65A 2FHYA 2FIXA 1YYZA 2DE3A 2CEXA 3FXBA 3NOHA 4MHFA 4N15A 5EQ8A 4YICA 5IGAA 2WX9A 2B4MA 5EYGA 2HXRA 5T3JA 1VDWA 4F1UA 2Y5LA 1FPFA 1FPJA 1K9YA 1FBEA 4IR8A 1BK4A 2XXKA 4PGNA 2CZIA 4PAKA 1LBVA 1FJ6A 2VPNA 1FPGA 1RDXA 4MNCA 4XF5A 4F1VA 1NV6A 1RDZA 4G61A 4YZZA 4HCYA 3LV0A 4PFIA 4NGUA 4XEQA 2DE2A 4N81A 1LEVA 4P1LA 5ET6A 4NG7A 3D1RA 4PBQA 5J1DA 2WBBA 1AWBA 1NI9A 4PETA 1FPKA 4MCOA 1FBCA 4P47A 3HFUA 3GYYA 1NV4A 2WYKA 4GBWA 1G0HA 2Y5KA 4NX1A 1FJ9A 4PC9A 4PF6A 5LDZA 1FTAA 2CZHA 4OANA 4GWZA 5ET8A 1NUXA 4O94A 2BJIA 5EYHA 1DCUA 4H46A 1NV3A 5ET7A 3RPLB 2KQZA 4XFEA 5F24A 5LTCA 4F19A 4HCWA 2VT5A 1YZ0A 4PGPA 4HE0A 1KZ8A 1FBHA 2QFLA 4NN3A 3T1BA 2V4CA 2CZKA 2P3NA 4X8RA 5I5PA 4QXDA 2XWKA 2Q8MA 4OVSA 4FBPA 1KA1A 1DK4A 4MNIA 4O8MA 1LBZA 1CNQA 2DE4A 4GWUA 5I7IA 2L5VA 1NV7A 4N4UA 4NQ8A 4N91A 4P8BA 1KA0A 3FBPA 4MJOA 5IZ3B 2XWOA 3PTYA 5IM2A 1SPIA 1FPLA 1NV0A 4P56A 1JP4A 1NV5A 4QBAA 5ET5A 1INPA 1LBXA 2OWZA 4I40A 1NV1A 5EQ9A 2XWIA 1IMFA 2ZZXA 2HZKA 4MAGA 2XWVA 4N17A 4OVRA 5CM6A 4GWSA 2P3VA 1Q9DA 3T0JA 3KBZA 5I3SA 4GBVA 2WYPA 2Q74A 4M1VA 4LN5A 4PFBA 4JVDA 3B50A 2FIEA 4AS4A 3MSTA 4MMPA 1DBZA 1XI6A 4N6DA 4GWYA 4P3LA 4PAIA 2QVVA 2F3BA 4PFRA 4N8YA 1FBPA 4MX6A 3W9VA 5EQAA 2HPGA 4NAPA 3EKIA 4DI3D 1K9ZA 4X9TA 3IFCA 1IMBA 4OVPA 2GQ1A 1NUZA 1RDYA 4H45A 2VPOA 4O7IA 1FBFA 2ZZWA 3MYUA 4PF8A 1EYKA 1EYIA 4AS5A 1NUWA 1FRPA 2WEFA 3LUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OX3 A;  3BIH A;  4HXV A;  5ESY A;  1FBG A;  5IZ1 A;  1EYJ A;  4GX4 A;  5J16 A;  2DDK A;  2FVZ A;  4I3Y A;  2HHM A;  4PTK A;  1G0I A;  2FBP A;  1FSA A;  1NUY A;  1FPE A;  3IFA A;  5IZ3 A;  1FPB A;  2R8T A;  4I3E A;  5EQ7 A;  1FBD A;  2PCR A;  2QVU A;  4GX3 A;  4KXP A;  3RPL A;  3RYD A;  1LBW A;  1QGX A;  2JJK A;  1IME A;  1FPD A;  2WBD A;  2QVR A;  3BIG A;  4GWX A;  3KC1 A;  1IMC A;  1FPI A;  4HE1 A;  3B8B A;  3ROJ A;  4GX6 A;  1YXI A;  1IMD A;  1D9Q A;  1NV2 A;  5A5L A;  3A29 A;  4HE2 A;  1IMA A;  3KC0 A;  4GWW A;  5FBP A;  1LBY A;  5DW8 A;  2F3D A;  3QMF A;  2FHY A;  2FIX A;  1YYZ A;  5EQ8 A;  5EYG A;  5T3J A;  1VDW A;  2Y5L A;  1FPF A;  1FPJ A;  1K9Y A;  1FBE A;  4IR8 A;  1BK4 A;  2CZI A;  1LBV A;  1FJ6 A;  1FPG A;  1RDX A;  1NV6 A;  1RDZ A;  4G61 A;  3LV0 A;  4N81 A;  1LEV A;  5ET6 A;  3D1R A;  2WBB A;  1AWB A;  1NI9 A;  1FPK A;  1FBC A;  1NV4 A;  4GBW A;  1G0H A;  2Y5K A;  1FJ9 A;  5LDZ A;  1FTA A;  2CZH A;  4GWZ A;  5ET8 A;  1NUX A;  2BJI A;  5EYH A;  1DCU A;  4H46 A;  1NV3 A;  5ET7 A;  3RPL B;  5F24 A;  2VT5 A;  1YZ0 A;  4HE0 A;  1KZ8 A;  1FBH A;  2QFL A;  2CZK A;  2P3N A;  4QXD A;  2Q8M A;  4FBP A;  1KA1 A;  1DK4 A;  1LBZ A;  1CNQ A;  4GWU A;  1NV7 A;  1KA0 A;  3FBP A;  4MJO A;  5IZ3 B;  1SPI A;  1FPL A;  1NV0 A;  1JP4 A;  1NV5 A;  5ET5 A;  1INP A;  1LBX A;  2OWZ A;  4I40 A;  1NV1 A;  5EQ9 A;  1IMF A;  4GWS A;  2P3V A;  1Q9D A;  3T0J A;  3KBZ A;  5I3S A;  4GBV A;  2Q74 A;  2FIE A;  4AS4 A;  1DBZ A;  1XI6 A;  4GWY A;  2QVV A;  2F3B A;  1FBP A;  5EQA A;  1K9Z A;  3IFC A;  1IMB A;  2GQ1 A;  1NUZ A;  1RDY A;  4H45 A;  4O7I A;  1FBF A;  1EYK A;  1EYI A;  4AS5 A;  1NUW A;  1FRP A;  2WEF A;  3LUZ A; 
#chains in the Genus database with same CATH topology
 4I3Y A;  2PFY A;  1XVY A;  3KFM A;  3SZP A;  1MQI A;  1YCJ A;  4PDD A;  2IEE A;  3ONM A;  4F3P A;  3ZSF A;  4QSD A;  2QVU A;  3TZA A;  3RYD A;  1FPD A;  3MQ9 A;  3ROJ A;  1Z7M E;  3LSW A;  4MLQ A;  3K2D A;  1QUJ A;  3U1O A;  1JW5 A;  5I58 A;  3FXQ A;  1B3F A;  5TP9 A;  2HAV A;  5T3J A;  5AA3 A;  1OVB A;  1B5J A;  5AA2 A;  3IR1 A;  4ESX A;  3C36 A;  2DE2 A;  4N81 A;  1FQD A;  2GRV A;  3CVG A;  2FA7 A;  2VP1 A;  3QIM A;  3IOR A;  4PFY A;  3S9N C;  3W15 C;  4PGP A;  5H8Q B;  2V4C A;  1T0K A;  1IZ1 A;  3CR9 A;  3K01 A;  4NF8 A;  4WXJ A;  5IM2 A;  3H06 B;  3TCF A;  1OIB A;  2HCA A;  2XXQ A;  3VVF A;  1INP A;  5EQ9 A;  2XWI A;  3RT8 A;  3MVY A;  4G68 A;  1AIV A;  1VSO A;  4ELP A;  3MST A;  4DXB A;  1OLA A;  2ONK E;  3TTN A;  1K9Z A;  4F29 A;  3IAZ A;  1FQE A;  2FYI A;  2UVJ A;  4R74 A;  4XKQ A;  4YKK A;  2YJP A;  1EU8 A;  2XXX A;  4WKM A;  5DVF A;  4RNS A;  3VFJ A;  2Y7R A;  1SVX B;  1ZJL A;  5ITO A;  4EF1 A;  2Y84 A;  1IXG A;  4OWD A;  1B3L A;  1MM6 A;  2B3F A;  5H8S A;  3TDJ A;  4JWO A;  3CG3 A;  2PX1 A;  2O7U A;  4GX3 A;  3VLV A;  2REJ A;  4YB5 A;  1SBP A;  4GWX A;  3KJT A;  3T9H B;  1OQG A;  2ABH A;  4GOT A;  3TTR A;  2DWJ A;  3PUW E;  2CZL A;  2IA4 A;  2QS4 A;  4RK2 A;  1SYI A;  4IR8 A;  2HXW A;  3OSR A;  1YAE A;  4DZ1 A;  2CZI A;  2VOZ A;  3TKD A;  4TOZ A;  3CIJ A;  1NH8 A;  3TPA A;  4Z7E A;  1MPB A;  4MCO A;  1FBC A;  5AA2 B;  1SW5 A;  3O29 A;  4OAN A;  2GH9 A;  1B3H A;  4G8H A;  4XFE A;  4ZZA A;  5LTC A;  4IO7 A;  3RPW A;  4QFP A;  3T1B A;  3RUM A;  1B58 A;  4DXC A;  4QSC A;  1JVY A;  5CBR A;  3FBP A;  4MJO A;  1MY3 A;  3ILT B;  3V8X B;  4NF5 A;  1QUL A;  1MH4 A;  4F3G A;  5BWJ A;  2DXR A;  1QKA A;  1MDQ A;  4YMB A;  3B50 A;  4RYA A;  3TCH A;  3Q29 A;  4MMP A;  3O6I A;  3V89 B;  3E13 X;  4OFO A;  1D9Y A;  4R9G A;  5F7V A;  2WEF A;  2OX3 A;  4QHQ A;  4N8G A;  5H8H B;  1L5T A;  3OO6 A;  1Y1M A;  2DVZ A;  5CMC A;  3THI A;  1G0I A;  2FBP A;  1FPE A;  1Y3N A;  3OXN A;  1SDX A;  3ECR A;  2I0B A;  4GIZ A;  2MKZ A;  4DXU A;  2A5S A;  2DXY A;  3UGW A;  3TTM A;  4LZ5 A;  4YU0 A;  1LGB C;  3K6V A;  4NHB A;  5DEX B;  1B3G A;  3VLU A;  2KR0 A;  3MVW A;  4MLV A;  2G29 A;  4MF3 A;  2Y7I A;  2ONR A;  1O63 A;  2QS2 A;  1FPF A;  5ITP A;  4NF6 B;  3UN6 A;  3UA8 A;  4P11 A;  1RDZ A;  1B40 A;  4G68 B;  3KEI A;  5FTI A;  2XHD A;  2OWT A;  5J1D A;  3RGY A;  1NI9 A;  4P47 A;  3VE1 B;  3V83 A;  1G0H A;  4QFL A;  5LDZ A;  1NUX A;  2F7C A;  1MQG A;  2Z22 A;  4R2F A;  1FBH A;  2Z23 A;  2O84 X;  1GGG A;  5JTY B;  4ND9 A;  1LFI A;  2DE4 A;  4H0W A;  5I58 B;  5I7I A;  1NV5 A;  1POY 1;  5CMK A;  4MAG A;  4IGT A;  2P3V A;  2F7A A;  2P1S A;  2O68 A;  4GWY A;  2QMW A;  2I49 A;  3IB1 A;  3FVN A;  2HPG A;  3H7M A;  1RYX A;  1M5F A;  1MXW A;  4ZEB A;  4AS5 A;  1NNK A;  3RLF E;  5ESY A;  4JWX A;  2FVZ A;  4TQU Q;  2PT1 A;  1ZBM A;  1USY H;  4MNP A;  3IFA A;  4P1E A;  1FPB A;  4BDN A;  4XXU A;  3K02 A;  5FHM A;  4H1X A;  4U23 A;  4JSD A;  3UP9 A;  4P9K A;  3PGF A;  2DOJ A;  4N6K A;  5KCJ B;  2X26 A;  1BP5 A;  4FEC A;  1GVC A;  4PBH A;  4LZ8 A;  5K2Y A;  1FQF A;  3A3C A;  4MH5 A;  1YYZ A;  4N15 A;  3CFX A;  1FPJ A;  2XXK A;  1ATG A;  1LBV A;  5ELV A;  3DP4 A;  1QVS A;  3TCG A;  4HTG A;  3LSL A;  3WAE A;  2Y7P A;  3KJ7 A;  1LBB A;  3T9U A;  1CE2 A;  4LQ5 A;  4JXI A;  3RPL B;  5AA4 B;  3KGC A;  4F19 A;  4HCW A;  1S50 A;  2O7I A;  3TQL A;  3IB2 A;  4F3B A;  3HV1 A;  4NMY A;  2P0S A;  5K2X A;  3TEL A;  2THI A;  4NQ8 A;  1R9L A;  1NKX A;  1FPL A;  4Z0I A;  4DIG A;  4NTL A;  1FTO A;  2E1S A;  4GWS A;  2V3U A;  3PPN A;  2Q8J A;  3H03 A;  1XI6 A;  1N3W A;  5H8H A;  4JWY A;  4N8Y A;  3PD9 A;  4IO4 A;  1R1N A;  3PU5 A;  4NF4 B;  3USD A;  2NWJ A;  2GHB A;  2XX9 A;  4BDL A;  5IZ1 A;  3MVX A;  2HHM A;  3D4G A;  3FV2 A;  4G2Z A;  5BUU A;  4RJZ A;  1B4Z A;  2R8T A;  4NF5 B;  3E78 A;  4EF2 A;  1S9T A;  2JJK A;  3FIR A;  1LST A;  4OFL A;  4GXA A;  4GF8 A;  3TYH A;  3W9W A;  4GL0 A;  3DP8 A;  1D9Q A;  4POW A;  3G3H A;  3C34 A;  4UAB A;  4JVC A;  2FHY A;  1TT1 A;  4KD5 A;  3I5O A;  3T66 A;  1N04 A;  3MP8 A;  1RDX A;  1IXI A;  4HW8 A;  4YZZ A;  3ZS6 A;  3O6H A;  3QUF A;  2QMX A;  1FPK A;  2AL4 A;  3GXA A;  1ZTY A;  1I6A A;  3HFU A;  3HHG A;  4PF6 A;  4F3S A;  3MBP A;  3RTF B;  2ESN A;  2I4B A;  3FXR A;  2VT5 A;  4HE0 A;  2XD2 A;  1LBC A;  2RC9 A;  2ZXT A;  4NN3 A;  2D5W A;  3FGS A;  1BIY A;  1UTH B;  5KDT B;  4PFT A;  4U21 A;  2XWO A;  1JEU A;  4P56 A;  1NV0 A;  2RIN A;  1EZO A;  4R6Y A;  3S9L C;  1UTH A;  1AMF A;  3OEK A;  4F39 A;  3T0J A;  1QJM A;  4GBV A;  4U4X A;  4EDP A;  1MXX A;  2F3B A;  4I62 A;  4PFR A;  4MX6 A;  3W9V A;  5TU0 A;  5I57 A;  4OZ9 A;  3VVD A;  2XXP A;  3R6U A;  1PB7 A;  4X1D A;  2HZL A;  4KCC A;  4MBP A;  3PUV E;  4Q30 B;  3FV1 A;  4RPN A;  5IZ3 A;  5EQ7 A;  2HAU A;  4XKN A;  4ESW A;  1MQJ A;  1ZLQ A;  4NF8 B;  4FE8 A;  5A5X B;  4KXP A;  2R9J A;  3G3F A;  4H5F A;  4OEV A;  3BIG A;  5I2K B;  2OZZ A;  4C1T A;  5TP9 B;  1POT A;  3O2A A;  3ZKL A;  1RYO A;  4HE2 A;  1SD3 A;  3EN3 A;  4G68 C;  5EQ8 A;  3C32 A;  4U1O A;  5I2N A;  4G8M A;  3TQW A;  4MNC A;  4XF5 A;  3VVE A;  3VDF A;  4GLI A;  1FTK A;  3SEV A;  3LV0 A;  1D9V A;  3DM0 A;  5DVI A;  3FUZ A;  5ET6 A;  1UIV A;  3D1R A;  4I9D A;  1XHY A;  2GFE A;  5ET8 A;  2I3W A;  3LC8 A;  4H67 A;  3BFU A;  1URG A;  1P1U A;  1A55 A;  3RQT A;  2P3N A;  3MPK A;  1JNF A;  2Q8M A;  3PMW A;  4XIG Q;  1IIT A;  4GWU A;  2L5V A;  4ELQ A;  3KN8 A;  4ZS9 A;  3E9X A;  4NF6 A;  4EXL A;  4N17 A;  2HZK A;  3OO9 A;  1DMB A;  3G3J A;  2W7Y A;  5I57 B;  5IAI A;  4LN5 A;  5IKB A;  2DYX A;  4OET A;  3GZG A;  1PC3 A;  4EQ7 A;  5EQA A;  1IXC A;  4F2Q A;  2XX7 A;  3MP6 A;  4G77 A;  4PF8 A;  4TLM B;  4L17 A;  1IUD A;  3P7I A;  4OES A;  3U92 A;  4GX4 A;  2RF1 A;  1SI0 A;  5I59 A;  3GBA A;  4O3C A;  1URS A;  1NFT A;  3G3G A;  3DP6 A;  4I3E A;  1MDP 1;  2R6G E;  2H99 A;  4JDF A;  1VE4 A;  2F36 A;  2ZZV A;  3SDF A;  2PCR A;  2ZNS A;  1MXV A;  1TXF A;  1A54 A;  3KC1 A;  1JQF A;  2UVH A;  1IMD A;  3F11 A;  2LAO A;  2V3T A;  3UIF A;  3DEL B;  4O3A A;  3TFL A;  3NOH A;  1LLS A;  1MG1 A;  4NWC A;  2HXR A;  2OCU A;  4KCD A;  1MY2 A;  1NNP A;  4DDD A;  4F1Y A;  4F1U A;  4ISU A;  1B3E A;  3JV9 A;  3UK4 A;  2VD3 A;  1B05 A;  2WBB A;  2NXO A;  4JB7 A;  1Q1K A;  4GBW A;  2A5T B;  5LOM A;  2CZH A;  4DCX A;  4ZEF A;  5AE4 A;  3IOU A;  2XXH A;  1B7U A;  3PUZ E;  1HSJ A;  1II5 A;  1Z7N E;  4QXD A;  3DLN A;  1LCT A;  4XKR A;  4YMA A;  1PEB A;  5ISU A;  4N91 A;  3KN3 A;  4GD5 A;  3PTY A;  4QBA A;  1NV1 A;  4OVR A;  5CM6 A;  1MM7 A;  3KBZ A;  2F35 A;  4PFB A;  2FIE A;  1MY4 A;  1DBZ A;  4PAI A;  2XXW A;  3M3L A;  2I4C A;  4NAP A;  2H9B A;  1H76 A;  3AXF A;  4PE5 B;  5EHS A;  2ZZW A;  1EYK A;  1N84 A;  1NUW A;  1LCF A;  3BIH A;  4U1Z A;  2HQ0 A;  4OXV A;  4E0W A;  3HO7 A;  5ICT A;  1FSA A;  1AH5 A;  1EZ9 A;  4O7M A;  4N07 A;  4F31 B;  3IJX B;  4KFQ A;  2Y7K A;  4RXL A;  2Z8E A;  4ZEK A;  1IME A;  3T22 A;  1IQ7 A;  3MW0 A;  3L6H A;  3TOD A;  1WOD A;  1YXI A;  5A5L A;  2UYE A;  3IK6 B;  3MUQ A;  3CG1 A;  1FQB A;  5CMB A;  3QMF A;  4R75 A;  2DE3 A;  4GL8 A;  5FTH A;  3L6G A;  3FZV A;  4NGU A;  2HFB A;  2ALU A;  4FED A;  2V93 A;  3OEN A;  1FW0 A;  2DWI A;  1ZIU A;  1B1H A;  3OSQ A;  1NNF A;  2FNC A;  5F24 A;  3PV0 E;  1YZ0 A;  3N6T A;  3T9X B;  1MRP A;  2ANJ A;  2XWK A;  1KA1 A;  1ZKB A;  3IOT A;  3PD8 A;  5IZ3 B;  1QUK A;  1H45 A;  1OQH A;  4DLD A;  1QKB A;  3R26 A;  1FQA A;  1Q9D A;  4TLL B;  4NF4 A;  2X7Q A;  4PFW A;  4JVD A;  3CFZ A;  3SEY A;  4N13 A;  1EZP A;  1M5D A;  1LAF E;  5EHM A;  3V5A A;  2P2A A;  3PUX E;  1DTG A;  1YTV A;  3RY3 A;  1WVJ A;  3G7W A;  3MYU A;  1EYI A;  3KZG A;  1Q35 A;  1UIU A;  2B4L A;  1IXH A;  4QFN A;  1EYJ A;  3CSG A;  2QPQ A;  4FJP A;  1IIW A;  2QS1 A;  1N7W A;  5TPA A;  4H8J A;  5CMM A;  4UAC A;  3SEU A;  1P1W A;  4MEV A;  3EF7 A;  3RPL A;  5AA4 A;  5EYF A;  1FPI A;  1GR2 A;  4DI4 B;  4KI0 E;  1UQW A;  3MJN A;  1GTK A;  2I48 A;  3KC0 A;  4MFI A;  2NVU B;  5KDT A;  3IO4 A;  3EHU A;  2KLF A;  3A09 A;  1OVT A;  3KN7 A;  2Q2C A;  3PUY E;  4XEQ A;  3M3K A;  2XXY A;  4P1L A;  1EH3 A;  1I6Q A;  1A40 A;  1O64 A;  3K6W A;  2DWA A;  1VFD A;  4YKJ A;  5H8F A;  2F78 A;  3HST A;  4GFR A;  1B52 A;  4NWD A;  2OWZ A;  4ZEI A;  4U2R A;  1A99 A;  1S7Y A;  4P3L A;  3B6Q A;  3Q28 A;  4IY6 A;  3PPP A;  3KSJ A;  1IMB A;  2GQ1 A;  1NUZ A;  4RPO A;  4O7I A;  4IO2 A;  2V25 A;  5AA1 A;  4OHN A;  1B0H A;  1MS7 A;  2UXA A;  4PCD A;  1DPE A;  3FJM A;  4WED A;  2XXI A;  5H8N A;  1A7L A;  3VXB A;  3BKI B;  1OLC A;  1URD A;  3GBB A;  3K0V A;  4IB2 A;  3CHG A;  4EQ9 A;  1B51 A;  3U8Q A;  3EHS A;  2O51 A;  3GLB A;  2QVR A;  2RKM A;  1N3X A;  2E0S A;  1PBP A;  4JSO A;  1O7T A;  4R9F A;  3HN0 A;  5H8F B;  3A29 A;  3OEM A;  4BDM A;  3A3U A;  4GWW A;  5DW8 A;  4YAH X;  3LSX A;  2WX9 A;  2B4M A;  2Z8F A;  3PPO A;  1VDW A;  1Y4T A;  1FBE A;  1BK4 A;  5I56 A;  2UYF A;  4OMB A;  3C33 A;  4F1V A;  2XXT A;  4HCY A;  3CRB A;  5L9S A;  5DYH A;  1TWY A;  4P0G A;  3MZ9 A;  2AYS A;  2BJI A;  1DCU A;  3U94 A;  2KQZ A;  1Y1Z A;  3QYT A;  3IOW A;  1NMU A;  3QAX A;  5JEI A;  4GVO A;  3ODB A;  1SI1 A;  1OMP A;  4IO5 A;  3R7X A;  1NV7 A;  3B6W A;  2H25 A;  1KA0 A;  3O6G A;  3IJO B;  5L9O A;  2ZZX A;  1LFH A;  3TEP A;  4G4P A;  5I3S A;  3K1P A;  3RT6 B;  3FXU A;  3K6U A;  5HBC A;  3BFT A;  3FJ7 A;  4KHZ E;  1AL3 A;  4ZDM A;  2DWH A;  5M2V A;  2QJE A;  1FRP A;  4LON B;  1B1X A;  2DDK A;  1LB9 A;  5I2N B;  3KG2 A;  1XC1 A;  3OO7 A;  3C35 A;  4PTK A;  4X48 A;  1B46 A;  1DSN A;  1SW4 A;  2Q88 A;  1N76 A;  1B5I A;  2PFZ A;  4OVT A;  3C4M A;  1LAG E;  4OER A;  1FTM A;  2G93 A;  1MXZ A;  4C1U A;  2V3Q A;  3SEW A;  3B8B A;  5B70 A;  3H6T A;  4M4G A;  4IO3 A;  2YPN A;  3RTW B;  2NUV A;  4QFK A;  2B3B A;  1B32 A;  4R2B A;  5EYG A;  4U22 A;  4KYD A;  2F34 A;  2PT2 A;  2Y5L A;  2UVG A;  1FTJ A;  4PAK A;  4G61 A;  1N0T A;  1PB9 A;  1M5C A;  1UTB B;  3H6W A;  4ZE8 A;  3OMB A;  3MZ1 A;  3N26 A;  1FTA A;  2GHA A;  4H46 A;  5I84 A;  4ELR A;  1JET A;  5I59 B;  1JEV A;  3RN8 A;  5FHN A;  4FBP A;  3S4U A;  1B4H A;  5AA2 D;  4EQB A;  4I1D A;  4YB6 A;  4BDR A;  3MC2 A;  1LFG A;  1I69 A;  2X7P A;  5DVJ A;  2RC7 A;  4AB6 A;  1FQC A;  5KCJ A;  4N6D A;  4X9T A;  2F8D A;  1D4N A;  2ZYM A;  3S9E A;  2UVI A;  1JW4 A;  2XXU A;  1FBG A;  3MVZ A;  5DTB A;  3K00 A;  2PMS A;  5DT6 A;  4JVI A;  4LQ2 A;  1J1N A;  3U72 A;  2AIX A;  4U4S A;  4OQO A;  2F6G A;  3HHF A;  1NL5 A;  4F22 A;  2CEY A;  1LAH E;  4ZE9 A;  1LBW A;  1MQD A;  2QSX A;  4MIJ A;  1CB6 A;  2DVC A;  4KQP A;  1YPN A;  3I3V A;  2DSF A;  1H44 A;  2HEU A;  2Z8D A;  2O69 A;  1TFA A;  2CEX A;  4MHF A;  1LB8 A;  3MP1 A;  1MY0 A;  1UTB A;  4Q0C A;  2B65 A;  2A5T A;  5CRY A;  3BBR A;  3FD3 A;  4PP0 A;  1BKA A;  4PFI A;  4LAT A;  1WDN A;  4NED A;  3C9H A;  3PPR A;  1SYH A;  4NG7 A;  4ECF A;  4PET A;  1DTZ A;  2WYK A;  2Y5K A;  3VLW A;  2I3V A;  5EYH A;  3TMG A;  5ET7 A;  2H98 A;  4RK9 A;  4P0I A;  1MXY A;  3O66 A;  3PMV A;  4R73 A;  2QFL A;  1USY E;  1GV8 A;  4QSE A;  1NH7 A;  4MNI A;  3SER A;  4OEN A;  3CSB A;  4K3F A;  1JP4 A;  4XTC Q;  4I40 A;  1LBX A;  4YB7 A;  1A8E A;  3FJG A;  4PQJ A;  1Y4C A;  4LVQ A;  4AQ4 A;  4OFJ A;  1Y3P A;  3M3F A;  3KOS A;  3FVO A;  3T9V A;  1TFD A;  3M8U A;  2PYY A;  3E3K A;  2XX8 A;  1FBF A;  1B7H A;  3KSX A;  2Y7W A;  3B7D A;  5L9M A;  2Q9T A;  2M8C A;  1XS5 A;  2OLB A;  4LA9 A;  1MY1 A;  3WAF A;  3IO6 A;  3Q25 A;  4ZZE A;  3ILU B;  3K6X A;  4H5G A;  3IL1 B;  4HS7 A;  1SW2 A;  2O6A A;  4KPT A;  5IZZ A;  1BLF A;  2I0C A;  4NF0 A;  1FBD A;  4PFU A;  3MPL A;  4PDH A;  2I6E A;  4PAF A;  2WBD A;  1I6B A;  3ZKK A;  1AOV A;  4GX6 A;  2OBG A;  4I8C A;  1MXU A;  1PDA A;  4Q8R A;  2Q2A A;  4G8N A;  1NNT A;  1QW0 A;  4NE4 A;  2F6P A;  4IO6 A;  1IMA A;  3U65 A;  4ZEC A;  5IGA A;  4IGR A;  1ZU0 A;  3MZB A;  4PGN A;  4EUO A;  1FTL A;  2VPN A;  2ZNT A;  1DPP A;  1N7X A;  1Y3Q A;  4PBQ A;  2R71 A;  5H8N B;  3S2V A;  1DOT A;  1PBQ A;  4LZ7 A;  3OD7 A;  2REG A;  3QK6 A;  4KR5 A;  1MQH A;  4QRZ A;  2D21 A;  4BLA A;  3PPQ A;  4FOR A;  2NOO A;  1CNQ A;  3SES A;  5KZT A;  1Y20 A;  1KWH A;  2XWV A;  4H6D A;  5A5X A;  2QRY A;  1SW1 A;  4GRK A;  2WYP A;  3TAJ A;  4WEP A;  4GXS B;  2OJT A;  4DI3 D;  3KBR A;  1XOC A;  3K1N A;  1FCK A;  3OO8 A;  2VGQ A;  3O28 A;  3TTK A;  3CI8 A;  3IX1 A;  2XXV A;  4E0X A;  3KOT A;  5CI5 A;  3ISP A;  1R6Z A;  4X1B A;  2XXR A;  4O3B A;  4PE3 A;  2OPD A;  4DCY A;  4FAT A;  3EHT A;  1M5E A;  4XKP A;  2D3I A;  2I58 A;  4FAJ A;  5B7D A;  3LBS A;  4OVJ A;  5FBP A;  2RC8 A;  4IY5 A;  3Q26 A;  3QSL A;  1H43 A;  3VXC A;  3K4U A;  1MH3 A;  2OPE A;  3O97 A;  1FPG A;  1SQY A;  2V84 A;  2H4I A;  3SEX A;  3S9M C;  2ZYO A;  3HPI A;  5TPA B;  3RNN A;  3LSF B;  1AWB A;  1B7Z A;  3B6T A;  5F1Q A;  3GYY A;  3UOR A;  2ZNU A;  4GWZ A;  3MAM A;  1NV3 A;  1QUI A;  3FVG A;  1KZ8 A;  4RY1 A;  2DP8 A;  5I5P A;  2Q89 A;  4O8M A;  1LBZ A;  4AB5 A;  2ZYK A;  1SPI A;  2AL5 A;  5I56 B;  4R6K A;  4H8I A;  2Q74 A;  4AS4 A;  4YKI A;  4OEU A;  1P1O A;  4GWO A;  4KYE A;  3EKI A;  1RDY A;  4YIC A;  4N6P A;  1P99 A;  4HXV A;  5J16 A;  5CC2 A;  3TTL A;  3LUY A;  3VV5 A;  1JW1 A;  1NUY A;  3C31 A;  3U93 A;  3E79 A;  4UA8 A;  2F97 A;  3EPE A;  3QXM A;  1RKM A;  3H3G A;  4QF9 A;  2BJJ X;  4OVQ A;  1XVX A;  1IMC A;  4H65 A;  4HE1 A;  1XT8 A;  4FEB A;  3G3I A;  1NV2 A;  5JK4 A;  3PMX A;  2XA5 A;  5I2K A;  1LBY A;  2F3D A;  1P1N A;  1P1Q A;  3H4Z A;  2DS9 A;  1K9Y A;  2OK2 A;  3JYR A;  2ONS A;  2RCB A;  2F7B A;  1ELJ A;  3G3K A;  4OYV A;  2O1M A;  4DE8 A;  3SKP A;  3H6V A;  4PC9 A;  4F2O A;  4O94 A;  2QS3 A;  1ZMG A;  2XD3 A;  2QL3 A;  1IEJ A;  4ONY A;  1A8F A;  2CZK A;  5DEX A;  4OVS A;  4BDO A;  3FAT A;  1Y9U A;  5HPQ A;  4N4U A;  4P8B A;  1B2H A;  3SET A;  4ELO A;  3CFL A;  3Q27 A;  5H8Q A;  5ET5 A;  4C0R A;  2ZMB A;  1IMF A;  1B0L A;  2O1L A;  4LP2 B;  4M1V A;  5L8D A;  2QVV A;  3E4R A;  2VHA A;  2CMO A;  4EXK A;  3IFC A;  4OVP A;  1R9Q A;  1B6H A;  3OEL A;  2WKY A;  1F9B A;  3LUZ A;  3I6V A;  4FIM A;  2H5Y A;  4YKP A;  4X04 A;  4KYS A;  3MWB A;  3IB0 A;  4OA4 A;  2PBW A;  5FHO A;  1H3D A;  3T96 B;  2VD2 A;  1VFE A;  4RA1 A;  5ICQ A;  2PVU A;  3N5L A;  4QFO A;  1MPD A;  5CBS A;  1QGX A;  3HCQ A;  4JBZ A;  4Q5T A;  2F5X A;  4LUB A;  5JTY A;  4F18 A;  1US4 A;  4OTE A;  3TUS A;  3QUJ A;  2FIX A;  3FXB A;  1BTJ A;  4R72 A;  1HSE A;  1ANF A;  1LAX A;  4GQO A;  3N6U A;  3FAS A;  1FJ6 A;  1NV6 A;  3OOA A;  5HM4 B;  4ZED A;  2YLN A;  4THI A;  1LEV A;  1NV4 A;  3N94 A;  4NX1 A;  1PB8 A;  1FJ9 A;  1VR5 A;  2ZYN A;  2DQV A;  2RCA A;  3EQ1 A;  4BDQ A;  4POX A;  3D4C A;  3FVK A;  3O9P A;  1M5B A;  4X8R A;  1DK4 A;  1US5 A;  2OWS A;  4R6H A;  1HSL A;  3H6U A;  3JZJ A;  3K1M A;  1D3K A;  1B9J A;  1FBP A;  3LR1 A;  1B5H A;  4H45 A;  2VPO A;  3IOV A;  1JVX A;  1MPC A;  3T93 B; 
#chains in the Genus database with same CATH homology
 2OX3 A;  3BIH A;  4HXV A;  5ESY A;  2B4L A;  1FBG A;  5IZ1 A;  1EYJ A;  4GX4 A;  4N8G A;  5J16 A;  2DDK A;  2Q9T A;  2FVZ A;  4I3Y A;  2HHM A;  2DVZ A;  2PFY A;  4JVI A;  4PCD A;  4X04 A;  4PTK A;  2QPQ A;  3ISP A;  1G0I A;  2HZL A;  2FBP A;  1FSA A;  3SZP A;  4PDD A;  1NUY A;  1FPE A;  4MNP A;  4O7M A;  4PE3 A;  3IFA A;  5IZ3 A;  4P1E A;  3E79 A;  1FPB A;  2R8T A;  4I3E A;  5EQ7 A;  5IZZ A;  4OA4 A;  2MKZ A;  4MEV A;  2ZZV A;  2CEY A;  3CHG A;  4NF0 A;  1FBD A;  2PCR A;  2QVU A;  4GX3 A;  2PFZ A;  4OVT A;  4PDH A;  3E78 A;  4KXP A;  3RPL A;  3RYD A;  1LBW A;  1QGX A;  2JJK A;  1IME A;  1FPD A;  4PAF A;  2WBD A;  2QVR A;  3BIG A;  4GWX A;  4OVQ A;  2V3Q A;  3KC1 A;  4MIJ A;  1IMC A;  1FPI A;  4HE1 A;  3B8B A;  3ROJ A;  4P9K A;  3W9W A;  4GX6 A;  1YXI A;  4DI4 B;  1IMD A;  2F5X A;  1D9Q A;  1NV2 A;  4N6K A;  5JK4 A;  5A5L A;  3A29 A;  4NHB A;  4F18 A;  4PBH A;  4HE2 A;  2XA5 A;  4UAB A;  4JVC A;  1IMA A;  3KC0 A;  4GWW A;  5FBP A;  1LBY A;  5DW8 A;  2F3D A;  2KR0 A;  3QMF A;  3U65 A;  2FHY A;  2FIX A;  1YYZ A;  2DE3 A;  2CEX A;  3FXB A;  3NOH A;  4MHF A;  4N15 A;  5EQ8 A;  4YIC A;  5IGA A;  2WX9 A;  2B4M A;  5EYG A;  2HXR A;  5T3J A;  1VDW A;  4F1U A;  2Y5L A;  1FPF A;  1FPJ A;  1K9Y A;  1FBE A;  4IR8 A;  1BK4 A;  2XXK A;  4PGN A;  2CZI A;  4PAK A;  1LBV A;  1FJ6 A;  2VPN A;  1FPG A;  1RDX A;  4MNC A;  4XF5 A;  4F1V A;  1NV6 A;  1RDZ A;  4G61 A;  4YZZ A;  4HCY A;  3LV0 A;  4PFI A;  4NGU A;  4XEQ A;  2DE2 A;  4N81 A;  1LEV A;  4P1L A;  5ET6 A;  4NG7 A;  3D1R A;  4PBQ A;  5J1D A;  2WBB A;  1AWB A;  1NI9 A;  4PET A;  1FPK A;  4MCO A;  1FBC A;  4P47 A;  3HFU A;  3GYY A;  1NV4 A;  2WYK A;  4GBW A;  1G0H A;  2Y5K A;  4NX1 A;  1FJ9 A;  4PC9 A;  4PF6 A;  5LDZ A;  1FTA A;  2CZH A;  4OAN A;  4GWZ A;  5ET8 A;  1NUX A;  4O94 A;  2BJI A;  5EYH A;  1DCU A;  4H46 A;  1NV3 A;  5ET7 A;  3RPL B;  2KQZ A;  4XFE A;  5F24 A;  5LTC A;  4F19 A;  4HCW A;  2VT5 A;  1YZ0 A;  4PGP A;  4HE0 A;  1KZ8 A;  1FBH A;  2QFL A;  4NN3 A;  3T1B A;  2V4C A;  2CZK A;  2P3N A;  4X8R A;  5I5P A;  4QXD A;  2XWK A;  2Q8M A;  4OVS A;  4FBP A;  1KA1 A;  1DK4 A;  4MNI A;  4O8M A;  1LBZ A;  1CNQ A;  2DE4 A;  4GWU A;  5I7I A;  2L5V A;  1NV7 A;  4N4U A;  4NQ8 A;  4N91 A;  4P8B A;  1KA0 A;  3FBP A;  4MJO A;  5IZ3 B;  2XWO A;  3PTY A;  5IM2 A;  1SPI A;  1FPL A;  1NV0 A;  4P56 A;  1JP4 A;  1NV5 A;  4QBA A;  5ET5 A;  1INP A;  1LBX A;  2OWZ A;  4I40 A;  1NV1 A;  5EQ9 A;  2XWI A;  1IMF A;  2ZZX A;  2HZK A;  4MAG A;  2XWV A;  4N17 A;  4OVR A;  5CM6 A;  4GWS A;  2P3V A;  1Q9D A;  3T0J A;  3KBZ A;  5I3S A;  4GBV A;  2WYP A;  2Q74 A;  4M1V A;  4LN5 A;  4PFB A;  4JVD A;  3B50 A;  2FIE A;  4AS4 A;  3MST A;  4MMP A;  1DBZ A;  1XI6 A;  4N6D A;  4GWY A;  4P3L A;  4PAI A;  2QVV A;  2F3B A;  4PFR A;  4N8Y A;  1FBP A;  4MX6 A;  3W9V A;  5EQA A;  2HPG A;  4NAP A;  3EKI A;  4DI3 D;  1K9Z A;  4X9T A;  3IFC A;  1IMB A;  4OVP A;  2GQ1 A;  1NUZ A;  1RDY A;  4H45 A;  2VPO A;  4O7I A;  1FBF A;  2ZZW A;  3MYU A;  4PF8 A;  1EYK A;  1EYI A;  4AS5 A;  1NUW A;  1FRP A;  2WEF A;  3LUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...