2Y5LA

Orally active aminopyridines as inhibitors of tetrameric fructose 1,6- bisphosphatase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
publication title Orally Active Aminopyridines as Inhibitors of Tetrameric Fructose-1,6-Bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 319
sequence length 327
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2y5lA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2y5lA02
4IR8A 2F3DA 2WBBA 1IMAA 1NV5A 4FBPA 3RPLA 1FSAA 1K9ZA 5IZ3B 4AS4A 3IFCA 1KA1A 5ESYA 5I3SA 2OWZA 4G61A 4GWUA 1FBHA 4H46A 2FIXA 5T3JA 5J16A 5IZ1A 4KXPA 2Y5LA 4O7IA 1FPGA 2WEFA 4HXVA 1NUXA 1DK4A 5LDZA 1FBEA 1CNQA 4I3EA 4GWXA 2WBDA 3FBPA 1NV2A 1YYZA 5EQ7A 1FTAA 4N81A 1NUZA 1FPLA 5EQ9A 4PTKA 4HE1A 4QXDA 1NV6A 3ROJA 3T0JA 2QVUA 4GWSA 1FBDA 1FJ6A 1NV4A 2DDKA 4AS5A 1FPKA 1Q9DA 1AWBA 2CZKA 2HHMA 1FBFA 1KZ8A 2OX3A 3KBZA 3D1RA 1RDZA 1LBWA 3BIGA 3KC0A 1IMBA 1EYIA 4GBVA 3IFAA 5EQAA 4GWYA 1FPDA 4GWWA 1NI9A 3RPLB 1NUYA 1FBPA 5EQ8A 4H45A 2QVRA 4GX3A 5DW8A 1SPIA 2FBPA 2PCRA 1FPJA 3QMFA 1YZ0A 1FBCA 2P3VA 1IMCA 1KA0A 5ET7A 4HE2A 3RYDA 2BJIA 1D9QA 5FBPA 3LV0A 1NV1A 2FIEA 4I40A 3B8BA 1IMEA 2R8TA 4I3YA 3A29A 1IMDA 1FPIA 1FBGA 4GBWA 2QFLA 5IZ3A 1LBZA 2P3NA 1FPEA 2VT5A 1XI6A 4GWZA 5EYGA 1DBZA 3KC1A 5EYHA 1NUWA 5ET5A 2Q74A 1K9YA 1BK4A 4HE0A 5F24A 1IMFA 1NV0A 1LEVA 1NV7A 1FJ9A 3LUZA 5ET6A 4GX4A 5ET8A 1NV3A 1YXIA 1FPFA 2FVZA 2CZHA 1LBYA 1G0HA 1QGXA 1FRPA 1VDWA 2Q8MA 5A5LA 4GX6A 1EYKA 2CZIA 1RDYA 1JP4A 2QVVA 1INPA 2FHYA 4MJOA 1RDXA 2Y5KA 2JJKA 1FPBA 1G0IA 1LBXA 1LBVA 3BIHA 1DCUA 2GQ1A 2F3BA 1EYJA
chains in the Genus database with same CATH superfamily
3I6VA 3TYHA 2I4CA 4UABA 1K9ZA 1XVXA 3LSFB 3NOHA 3SKPA 1DSNA 4NGUA 2FA7A 5DVJA 4P11A 4I62A 1B40A 5EQ7A 3N5LA 1DTZA 2DE2A 4HS7A 2QSXA 3CSBA 4YB5A 5F1QA 2XXYA 4Q8RA 1LB8A 3H4ZA 5L9SA 1MQHA 3IK6B 4MCOA 5I58B 5ELVA 4MAGA 4AB5A 3ZSFA 1OVTA 1EH3A 1UIVA 2R71A 1MY4A 4GFRA 4GXAA 2HPGA 1LAFE 2VPNA 3TCHA 3SDFA 4FORA 5I56A 3TAJA 1B0HA 3EHSA 3HCQA 4F3BA 1FBGA 3MVWA 2DWAA 4FJPA 4H8IA 2ZZWA 2V84A 5CMBA 3O66A 1ZU0A 4XF5A 5I5PA 2Z8FA 3QXMA 4IGRA 1QUJA 4G8MA 2PYYA 1IQ7A 3MW0A 2BJJX 3VV5A 2OZZA 3GXAA 1Y1ZA 4YU0A 1B7ZA 3SEVA 2DXYA 2I58A 4NMYA 3WAFA 4YKKA 4BLAA 1EYKA 3K1NA 5HPQA 3PTYA 4H5FA 4PAIA 4PGPA 4PE5B 1LB9A 3MVXA 1IMAA 2XXVA 2YPNA 1PBQA 1MXUA 1H76A 5L8DA 5I2NA 3GBBA 2CZLA 2FIXA 5J16A 2I0BA 4N13A 2Y5LA 3L6HA 1OQGA 3BFTA 1NUXA 2X7PA 1DK4A 1UQWA 3T1BA 4DCYA 5ISUA 4ZS9A 1LFGA 4OEUA 4GWOA 5H8HB 1NL5A 3T9XB 3OO9A 3RNNA 3D1RA 5FTHA 5DVFA 3MP1A 3O28A 2PT1A 3OOAA 5DEXB 1IEJA 5J1DA 4KQPA 4H45A 2NUVA 4IO4A 5DVIA 5FTIA 3TEPA 2XX9A 5AA4B 3MQ9A 3PPNA 1DOTA 1B7UA 2ESNA 3PGFA 2XX8A 4F31B 1MQGA 4JVCA 4I9DA 2OLBA 5ET5A 3T9HB 1NV7A 3HV1A 1N7WA 3H6VA 1YXIA 1QGXA 2XXTA 3H03A 5A5LA 2PX1A 4H65A 2G29A 4GF8A 2Y5KA 4BDOA 5CMMA 4XIGQ 4QFLA 4OFJA 5CRYA 3H7MA 3IO4A 4DDDA 2ZNSA 2Q2CA 4OZ9A 4FAJA 1SW1A 2F5XA 4R73A 1QW0A 5DYHA 1US4A 4G68A 1AIVA 3MPLA 3IO6A 2ONRA 5TPAB 1WDNA 4RK9A 4NX1A 4ELQA 5LDZA 1B58A 1R9LA 5AA2D 4UACA 1S9TA 5I2KB 4MF3A 2Z8EA 1QKAA 1IXCA 4G8HA 1JQFA 3FVGA 3FVKA 1FBFA 2A5SA 4NF0A 2IA4A 4KHZE 2ANJA 3KN3A 5IAIA 3T66A 3T9VA 1B1HA 4JB7A 1B3FA 5CC2A 4C1UA 3Q25A 2ZXTA 1B5IA 4ONYA 3IAZA 3SEXA 1FCKA 3HHGA 3PD8A 2CEYA 4FEBA 1MXZA 3VVFA 2H5YA 1LLSA 3K6VA 1R9QA 2UVJA 2OWTA 1Z7NE 3LUZA 4ZE9A 3RTFB 1G0HA 4IO5A 1RDYA 1IXIA 5L9MA 3QK6A 4H1XA 4EF2A 1PB8A 5H8NB 1B05A 3E13X 4LA9A 2D21A 4JSOA 1JVXA 3RY3A 2VGQA 3A09A 2AIXA 3TQLA 5ESYA 2OCUA 4G61A 5KDTA 3RQTA 5T3JA 2HZLA 1SW2A 3FASA 4HXVA 4AB6A 2P2AA 2RCBA 2ZYKA 2I48A 2Q88A 1PB9A 1XC1A 1URDA 4MNCA 4NWCA 4TOZA 4OERA 2XWVA 4I1DA 2DOJA 1NKXA 2DDKA 1AWBA 2B4LA 4R9FA 3KC0A 4DXBA 3EF7A 2Q2AA 4GBVA 4BDMA 4OMBA 5EQ8A 1USYH 1FQEA 4OESA 1B5JA 2O69A 3V8XB 4OVPA 4H5GA 4GD5A 2E0SA 2HCAA 4OFOA 4PAFA 4HW8A 2UVHA 3IOWA 3ZKKA 1NV1A 2FNCA 1FTLA 3W15C 3SEYA 3N26A 3CI8A 1LAXA 3IJXB 1AMFA 1RKMA 3ODBA 3DP8A 4LN5A 4MBPA 3TZAA 4EF1A 5F24A 2V3TA 3MYUA 4PFUA 4G77A 3MZ1A 5ITPA 4GQOA 1ANFA 1VDWA 2F34A 4M4GA 4OHNA 1NNPA 3OXNA 1FPBA 4OVQA 5EYFA 5FHMA 3BIHA 1JETA 1BIYA 1M5BA 1EYJA 1JVYA 1N76A 4PP0A 3RPLA 4KFQA 5IZ3B 1XHYA 3BKIB 3C32A 2WX9A 4ESWA 3BBRA 1B2HA 3CFZA 2CMOA 3OELA 3RT8A 3JZJA 3RUMA 3PD9A 1Y4CA 4MLVA 3KZGA 4Z0IA 1SDXA 3RPWA 1LBCA 2Y7RA 4ZE8A 1NUZA 1FQCA 1A7LA 2NOOA 4H8JA 2QRYA 1FW0A 1NNTA 4F1YA 1WODA 2I3VA 1BKAA 4OWDA 4ND9A 3OSRA 2QVRA 1JW1A 1NFTA 3U92A 5DW8A 1SPIA 2Y7WA 3PV0E 3PUVE 4U4XA 2OJTA 2X7QA 2XXXA 3FUZA 2P1SA 2DWIA 1EZPA 4FIMA 1LBZA 1A99A 3TUSA 4R6KA 1MXWA 3EQ1A 2HZKA 1IZ1A 1JW5A 3U93A 2H4IA 2IEEA 5CI5A 4PE3A 4TLLB 1I6AA 4R6HA 3C36A 4ZEKA 4MH5A 3E4RA 1D9VA 1B1XA 5IZZA 1URSA 4MX6A 3FIRA 3SZPA 4FEDA 3UK4A 2FHYA 3IJOB 5EHMA 2Q8JA 3A3UA 4YB7A 5I56B 3FXRA 4Q30B 4ZZEA 3ILUB 4P1LA 4K3FA 4N15A 3TTKA 4QSDA 4PCDA 3QAXA 4TQUQ 4X9TA 1M5CA 2XXHA 4OEVA 1JEUA 2GHBA 1UTHA 3IB1A 3KN7A 2F7AA 4XKPA 1OMPA 2FYIA 3HSTA 5EQ9A 1GTKA 5CMKA 4AS5A 4XFEA 3KBRA 5F7VA 2I4BA 4KCCA 1N3XA 4R6YA 1ZBMA 2DE4A 4M1VA 4TLMB 1N7XA 5I2NB 4WKMA 1A8EA 4QHQA 1VE4A 2PCRA 1N0TA 3USDA 3Q29A 1NNFA 1B9JA 5FBPA 3HN0A 3LV0A 3TTNA 4QFOA 1IMEA 4I3YA 2GFEA 4DLDA 4OENA 1A55A 4JVIA 2ONSA 2RCAA 3KC1A 3B6TA 3MZ9A 1VSOA 1NUWA 5IM2A 4FATA 4OQOA 2I0CA 4NE4A 2F78A 3VE1B 3TCGA 5FHNA 1B5HA 4YZZA 5FHOA 5ET8A 2NXOA 2DVCA 1FPFA 2FVZA 4KYEA 1MDP1 2OBGA 3PUYE 4PFBA 2Q8MA 3FD3A 2RF1A 1JP4A 1PC3A 4GVOA 4L17A 4U1OA 2O51A 3SEWA 4X1BA 3S9NC 1DCUA 5CBRA 2Y7PA 3OO8A 2F3DA 2WBBA 4GXSB 4KCDA 1FSAA 4NTLA 1N04A 4NF6A 4EQ9A 1FQDA 4YB6A 1LCTA 2HEUA 2HXWA 1A54A 1FBEA 3K0VA 1B7HA 3BFUA 5A5XB 3GYYA 5I7IA 3LSLA 3FXBA 2XXRA 4O3BA 3O29A 3KG2A 3C33A 2O68A 3S9MC 5TU0A 1OLAA 4EXKA 3KBZA 1FQAA 4U21A 3T22A 2VD2A 2ZYNA 2B65A 2KQZA 3VXCA 4NHBA 5EQAA 4OFLA 3CIJA 1NI9A 2F6GA 5I59A 1S50A 1GVCA 3CVGA 3RLFE 4KPTA 5CBSA 3VLUA 4EUOA 1KA0A 1JW4A 2F35A 2DWJA 4P1EA 4GLIA 1B0LA 1USYE 2QS3A 1FPEA 2THIA 3V89B 4I8CA 3MVYA 4AQ4A 3MP6A 2QMXA 3TTRA 3FVNA 1AH5A 3KFMA 2D3IA 2G93A 2NWJA 4R72A 3G3FA 4LONB 4U2RA 3RGYA 4PQJA 4LP2B 3KJTA 3MSTA 2GH9A 1M5FA 1INPA 5M2VA 2HAVA 1R1NA 4G8NA 4NG7A 3UIFA 1MDQA 5JK4A 2Q9TA 2Q89A 5AA2A 1MQJA 1QVSA 4LATA 5IZ1A 4KXPA 4EXLA 4NF5A 4EDPA 1H3DA 3G3HA 3OEMA 1QJMA 3I5OA 3K1PA 3KJ7A 4GRKA 4GWSA 3KSJA 4RPNA 1FJ6A 1ELJA 1Y4TA 1Q9DA 2NVUB 1RDZA 1LBWA 2O6AA 2LAOA 2RC9A 4PBHA 1DPPA 4PAKA 1MPBA 3WAEA 4X04A 4GWWA 2I3WA 3OD7A 2QJEA 1FTMA 3FVOA 5BUUA 2FBPA 4IB2A 5B7DA 3QMFA 1O63A 1YZ0A 3TCFA 1MG1A 1D9QA 2VD3A 4ZEDA 4N8YA 2VHAA 3V5AA 3CR9A 3QIMA 2QS1A 4XKRA 5AA3A 5EYHA 2ZYOA 5LOMA 1TFDA 1IMFA 1B46A 3UN6A 5H8FA 2H99A 4IY5A 1P1UA 2B4MA 1P99A 4C1TA 1KWHA 2XXUA 3M3KA 4KD5A 1SQYA 3JYRA 3TTMA 2QVVA 2WYKA 2X26A 4MJOA 1TFAA 3OO7A 2UYFA 2UVGA 2HFBA 2HXRA 2OPDA 5L9OA 3S4UA 2PT2A 4F3GA 1KA1A 2R9JA 4H46A 4QF9A 4NF8A 4IO7A 4MNPA 3ZS6A 3LR1A 1D4NA 3QUJA 2A5TA 3TKDA 2E1SA 3FJ7A 1B4ZA 2ZNTA 3UA8A 1H43A 2GHAA 1LFHA 3CSGA 2VP1A 1NH8A 1BLFA 5I57B 4F1VA 1OVBA 4OVSA 2CZKA 1KZ8A 1US5A 1H44A 3BIGA 1AL3A 4NQ8A 4PF6A 4LUBA 3A3CA 3KEIA 1B32A 3RPLB 1OQHA 3D4GA 5IKBA 3EN3A 4QBAA 1LBBA 1MPDA 1R6ZA 2V3UA 4OA4A 2XHDA 4DI4B 2P3VA 2BJIA 4BDNA 3IX1A 1GV8A 4JSDA 4YMAA 3IOTA 5BWJA 4GL0A 4DXUA 1IITA 1IMDA 4ZDMA 5ITOA 1SW5A 4R74A 4YAHX 2AL4A 5ICTA 1DBZA 3R6UA 3D4CA 1MS7A 4HE0A 3GZGA 4O8MA 3IR1A 1OIBA 3K4UA 1NV0A 4E0WA 1N3WA 3MZBA 3UP9A 2L5VA 3Q27A 2DWHA 3OEKA 4IO2A 5IGAA 4X8RA 3GBAA 1NV3A 3JV9A 4OVRA 1F9BA 4F2QA 1B51A 1HSLA 1RYXA 1Y1MA 1G0IA 1LBXA 1Q35A 3PMXA 1ZIUA 1RYOA 4F3SA 2ZZXA 1NV5A 4H6DA 4N91A 3UGWA 3UORA 3KOTA 4AS4A 4KYDA 1FQBA 5I3SA 3EHTA 2QMWA 4QRZA 4P0GA 4O7IA 3L6GA 1D3KA 3DELB 3Q28A 4RNSA 3FBPA 2RC7A 2PVUA 3VLVA 4PF8A 1MY0A 2XA5A 4NF4A 1MQDA 4XXUA 4QXDA 2DS9A 4ZEFA 1ZKBA 2HHMA 4MHFA 2B3BA 4JVDA 4NEDA 2RKMA 1WVJA 2XXPA 3PU5A 4LQ5A 3PUZE 4BDQA 5DT6A 1MH3A 3MJNA 3B50A 4DE8A 1CB6A 1PEBA 2ABHA 4YKIA 3K6WA 1O7TA 5H8SA 1UTHB 3U1OA 1Y20A 3OO6A 5TP9A 1MM6A 5KCJA 4RXLA 1HSJA 4WXJA 2R6GE 3N94A 3A29A 1MM7A 1FPIA 4GBWA 1YCJA 5H8QA 3W9WA 4GWZA 3GLBA 3K1MA 2XD2A 3N6UA 3QYTA 4ESXA 1XT8A 1SYHA 2PBWA 3R26A 2REGA 1S7YA 2V3QA 4U22A 3VDFA 2CZHA 4YICA 2KLFA 4LZ7A 3B6QA 1CE2A 2PMSA 4Q5TA 1DMBA 3FV2A 1Y3NA 2D5WA 4RYAA 2HQ0A 2OWZA 4F3PA 1II5A 2Z22A 5ICQA 1FPGA 1NH7A 3IOVA 3O6IA 3FGSA 2OWSA 3ECRA 3VFJA 1NV2A 3ILTB 4XKNA 3B7DA 3CRBA 4N81A 4C0RA 1FTKA 3H6WA 4ZEIA 2H25A 1FBDA 2F36A 4H67A 3RTWB 4BDLA 3E79A 3O97A 4ELPA 4JWXA 4F22A 4GIZA 3C9HA 1A40A 4NF6B 1B52A 4GX3A 1PBPA 2B3FA 1MXYA 3E78A 4N8GA 4QFKA 3CFXA 1SVXB 2V25A 5ET7A 2V93A 4DCXA 1QULA 1P1WA 5CMCA 4P56A 4G4PA 2DE3A 3MC2A 3SEUA 5K2YA 1MQIA 4JDFA 1OLCA 1K9YA 4MIJA 1LEVA 4N07A 3G7WA 5JTYA 3DP6A 3T96B 4EQBA 1BP5A 5I59B 1ZMGA 1IXGA 4JXIA 1UTBA 2CZIA 3KSXA 3SETA 4G68C 2ZMBA 3SESA 4F29A 3S2VA 3PPRA 3MPKA 4P47A 4GL8A 2Z23A 2H98A 1XS5A 2WEFA 3TPAA 3OMBA 4QSCA 1CNQA 2WBDA 1M5EA 4F1UA 3QUFA 1FPLA 4PTKA 4F2OA 3T0JA 1A8FA 4DI3D 4WEPA 1NV4A 1MY1A 1PB7A 4P8BA 2O1LA 1MXVA 2XD3A 2REJA 1FPDA 1FBPA 2QPQA 4GOTA 2XWKA 5AA2B 4LQ2A 1POY1 1FBCA 2OPEA 1GR2A 4NF5B 1P1OA 4PFRA 1Y3PA 3I3VA 1Y9UA 4P3LA 3B8BA 2P0SA 1FTOA 1XI6A 5CM6A 1MH4A 1JEVA 4G68B 2Q74A 3HHFA 4DZ1A 3N6TA 3DLNA 3G3KA 4XKQA 3AXFA 2XXWA 1I6QA 3EHUA 2F7BA 4RK2A 3M8UA 2DQVA 3DP4A 4XEQA 4IO3A 3H3GA 2XWOA 2JJKA 1LBVA 3PPPA 5I58A 1BTJA 4FBPA 2UYEA 3LSXA 1L5TA 2ZNUA 1ZTYA 4F19A 2I6EA 1Q1KA 3CG1A 4KR5A 3T9UA 1ZJLA 4PFYA 5H8FB 3FJGA 1UIUA 1TXFA 4HCYA 4O94A 3E3KA 3THIA 3EKIA 4OXVA 3P7IA 1I6BA 4HTGA 3H06B 2QL3A 4OETA 2DP8A 2VPOA 4H0WA 3ONMA 3MP8A 2DXRA 2MKZA 1XVYA 4JWOA 4PFIA 3T93B 4U1ZA 3M3LA 1EYIA 3IFAA 3LC8A 4R2FA 4FECA 3K02A 4N6KA 1QUIA 1YAEA 3PUWE 5A5XA 2GRVA 4NF8B 5HM4B 1Z7ME 1MRPA 4QFPA 3OSQA 4MNIA 1TT1A 1HSEA 2F97A 2ONKE 3VVEA 2A5TB 4N4UA 2DYXA 3PPQA 5LTCA 3ZKLA 5KZTA 4LZ5A 2VT5A 4LVQA 1O64A 1SW4A 1LSTA 1B3GA 5K2XA 1BK4A 4MLQA 5KDTB 4IY6A 1FTJA 3K6XA 1H45A 5ET6A 3G3IA 2XWIA 1QUKA 5H8HA 1LAHE 4YMBA 4GX6A 1XOCA 1RDXA 3C31A 4NN3A 3S9LC 2GQ1A 4NAPA 2HAUA 5DEXA 4QSEA 4PGNA 4IGTA 2Y7IA 3IORA 5AE4A 3KOSA 1FQFA 3DM0A 5DTBA 3TFLA 4BDRA 4ELRA 5AA4A 4O3AA 4GWXA 2F7CA 2ALUA 3U8QA 1YYZA 4ECFA 1ATGA 3VLWA 1B3EA 2YLNA 4PC9A 4R2BA 4NWDA 4HE1A 4PFWA 1YPNA 2QVUA 1EU8A 3Q26A 4MEVA 4P0IA 2Y84A 2OX3A 3O2AA 3B6WA 3G3GA 3R7XA 3MUQA 4N17A 4E0XA 4OYVA 4OVTA 4RY1A 3PMWA 1VR5A 4XTCQ 4GWYA 1DPEA 1NUYA 3PPOA 3IB2A 2WKYA 1FPJA 4WEDA 3KGCA 4HE2A 3HFUA 1DTGA 3U72A 2DVZA 5AA1A 4THIA 4I40A 1SYIA 4NF4B 1SI1A 1ZLQA 4ZZAA 3CFLA 2P3NA 1B6HA 5EYGA 4PFTA 1YTVA 5TPAA 3HPIA 3TELA 3FJMA 2Z8DA 3E9XA 4RA1A 2XX7A 5I2KA 3TTLA 3KN8A 3FATA 4Z7EA 1N84A 1LBYA 1D9YA 1QKBA 3C4MA 1FRPA 4MMPA 3TMGA 4ISUA 2XXKA 4MFIA 1MPCA 5TP9B 2F3BA 3H6UA 3IL1B 5KCJB 4O3CA 3EPEA 4IR8A 1SD3A 2PFZA 3IFCA 3O9PA 5H8QB 3FXUA 3QSLA 4GWUA 2YJPA 2XXQA 1I69A 3RN8A 3O6HA 4OANA 1MXXA 2Y7KA 1VFDA 3SERA 4PDDA 1FTAA 1B3HA 3K6UA 3FZVA 1LAGE 3VVDA 1FPKA 2O7UA 1NMUA 3FXQA 4EQ7A 4POWA 5B70A 1IMBA 3MWBA 1IXHA 4UA8A 2UVIA 3U65A 1Y3QA 2RINA 3TQWA 4F18A 2RC8A 1SI0A 3C34A 2O84X 1IMCA 4U23A 3RYDA 3O6GA 5H8NA 4PDHA 3IOUA 2FIEA 2OK2A 5I57A 1B3LA 4JWYA 1TWYA 4R9GA 2KR0A 2AYSA 4Q0CA 2UXAA 3LSWA 4PBQA 1SBPA 1MY2A 3F11A 2H9BA 1LFIA 1FJ9A 3IB0A 1PDAA 4GX4A 3CHGA 4PETA 1URGA 4P9KA 1B4HA 2DSFA 3C35A 3HO7A 3K2DA 4X1DA 3H6TA 4LZ8A 4DXCA 2I49A 5I84A 3MVZA 1JNFA 4FE8A 2XXIA 4OTEA 1IUDA 4G2ZA 4ZEBA 2F6PA 2CEXA 2ZYMA 4QFNA 2QS4A 3CG3A 4RPOA 1FBHA 3U94A 4N6PA 4X48A 4RJZA 1MY3A 4IO6A 4I3EA 4KYSA 3S9EA 2O7IA 5JTYB 2QS2A 2VOZA 4U4SA 2PFYA 3MAMA 1IIWA 1NV6A 3G3JA 3ROJA 1UTBB 3PMVA 1LCFA 1M5DA 4YKJA 1GGGA 4O7MA 4F39A 3OENA 3LUYA 2AL5A 4R75A 4JBZA 4OVJA 1P1QA 4POXA 4YKPA 2F8DA 1LGBC 3V83A 4N6DA 2WYPA 3ISPA 5EHSA 5JEIA 1EZ9A 3K00A 3FV1A 3VXBA 3M3FA 2W7YA 4DIGA 2R8TA 3K01A 3LBSA 2QFLA 5IZ3A 1VFEA 1P1NA 4KI0E 1POTA 5HBCA 2ZZVA 3RT6B 3TDJA 1T0KA 1EZOA 2V4CA 3PUXE 4ELOA 4ZECA 4HCWA 3W9VA 1AOVA 2M8CA 1NNKA 3MBPA 3TODA 1J1NA 2O1MA
chains in the Genus database with same CATH topology
4FBPA 4UABA 3RPLA 1K9ZA 5IZ3B 2WX9A 3NOHA 1KA1A 4F19A 4H46A 4MNPA 4NGUA 4HCYA 4O94A 5EQ7A 3EKIA 2DE2A 1NUZA 4F1VA 4OVSA 2VPOA 2CZKA 1KZ8A 3BIGA 4NQ8A 2MKZA 4PF6A 4PFIA 4MCOA 1EYIA 3IFAA 4MAGA 3RPLB 2QVRA 4QBAA 2HPGA 4N6KA 4OA4A 2VPNA 5DW8A 1SPIA 4DI4B 4MNIA 2P3VA 2BJIA 4N4UA 1IMDA 1FBGA 5LTCA 1LBZA 2VT5A 1DBZA 2HZKA 4HE0A 1BK4A 4O8MA 2ZZWA 1NV0A 4XF5A 5I5PA 2L5VA 4PE3A 5ET6A 5IGAA 4X8RA 1NV3A 2XWIA 5IZZA 4OVRA 4MX6A 4GX6A 1EYKA 3SZPA 3PTYA 2FHYA 1RDXA 4PAIA 4PGPA 1G0IA 1LBXA 4NN3A 2GQ1A 4NAPA 2ZZXA 1IMAA 1NV5A 4N91A 4P1LA 4AS4A 4N15A 4PGNA 5I3SA 4PCDA 2FIXA 5J16A 2Y5LA 4O7IA 4X9TA 1NUXA 1DK4A 3T1BA 4GWXA 3FBPA 1YYZA 4PF8A 2XA5A 4PC9A 5EQ9A 4HE1A 4QXDA 2QVUA 4MEVA 4AS5A 4XFEA 2OX3A 2HHMA 4MHFA 3D1RA 4JVDA 4N17A 4OVTA 4GWYA 2DE4A 1NUYA 5J1DA 4H45A 4M1VA 3B50A 2PCRA 1FPJA 4HE2A 3HFUA 5FBPA 2DVZA 3LV0A 4I40A 1IMEA 4I3YA 3A29A 1FPIA 4GBWA 4JVIA 2P3NA 3W9WA 4GWZA 5EYGA 4JVCA 3KC1A 1NUWA 5IM2A 5ET5A 1NV7A 4YZZA 2V3QA 5ET8A 1YXIA 1FPFA 2FVZA 2CZHA 1LBYA 1QGXA 1FRPA 4PFBA 2Q8MA 5A5LA 4MMPA 4YICA 1JP4A 2Y5KA 2XXKA 1DCUA 2F3BA 4IR8A 2F3DA 2WBBA 2F5XA 1FSAA 2PFZA 3IFCA 2OWZA 4GWUA 1FPGA 4NX1A 4OANA 5LDZA 1FBEA 1NV2A 3GYYA 4PDDA 1FTAA 5I7IA 3FXBA 4N81A 1FBDA 1FPKA 3KBZA 1FBFA 4NF0A 1IMBA 2KQZA 3E79A 4NHBA 5EQAA 3U65A 1NI9A 4F18A 4GX3A 3E78A 4N8GA 1IMCA 1KA0A 5ET7A 3RYDA 4PDHA 2FIEA 4P1EA 2CEYA 4P56A 2DE3A 1FPEA 2KR0A 4MIJA 1K9YA 4PBQA 1LEVA 1FJ9A 3LUZA 4GX4A 3CHGA 4PETA 4P9KA 1G0HA 2CZIA 1RDYA 3MSTA 1INPA 4NG7A 2CEXA 5JK4A 2Q9TA 4P47A 5ESYA 4G61A 1FBHA 5T3JA 5IZ1A 4KXPA 2HZLA 2WEFA 4HXVA 1CNQA 4I3EA 2WBDA 4F1UA 1FPLA 2PFYA 4PTKA 1NV6A 4MNCA 3ROJA 3T0JA 4DI3D 4GWSA 2XWVA 1FJ6A 1NV4A 2DDKA 1Q9DA 1AWBA 4O7MA 2B4LA 1RDZA 1LBWA 4P8BA 3KC0A 4PBHA 4PAKA 4GBVA 1FPDA 4X04A 4GWWA 1FBPA 5EQ8A 2QPQA 2XWKA 2FBPA 4N6DA 2WYPA 3ISPA 4OVPA 3QMFA 1YZ0A 1FBCA 4PAFA 4PFRA 1D9QA 4P3LA 1NV1A 4N8YA 3B8BA 2R8TA 2QFLA 5IZ3A 1XI6A 5CM6A 5EYHA 4LN5A 2ZZVA 2Q74A 5F24A 1IMFA 3MYUA 2B4MA 2V4CA 4HCWA 3W9VA 4XEQA 1VDWA 2XWOA 2QVVA 2WYKA 4MJOA 2JJKA 1FPBA 4OVQA 1LBVA 3BIHA 2HXRA 1EYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IR8 A;  2F3D A;  2WBB A;  1IMA A;  1NV5 A;  4FBP A;  3RPL A;  1FSA A;  1K9Z A;  5IZ3 B;  4AS4 A;  3IFC A;  1KA1 A;  5ESY A;  5I3S A;  2OWZ A;  4G61 A;  4GWU A;  1FBH A;  4H46 A;  2FIX A;  5T3J A;  5J16 A;  5IZ1 A;  4KXP A;  2Y5L A;  4O7I A;  1FPG A;  2WEF A;  4HXV A;  1NUX A;  1DK4 A;  5LDZ A;  1FBE A;  1CNQ A;  4I3E A;  4GWX A;  2WBD A;  3FBP A;  1NV2 A;  1YYZ A;  5EQ7 A;  1FTA A;  4N81 A;  1NUZ A;  1FPL A;  5EQ9 A;  4PTK A;  4HE1 A;  4QXD A;  1NV6 A;  3ROJ A;  3T0J A;  2QVU A;  4GWS A;  1FBD A;  1FJ6 A;  1NV4 A;  2DDK A;  4AS5 A;  1FPK A;  1Q9D A;  1AWB A;  2CZK A;  2HHM A;  1FBF A;  1KZ8 A;  2OX3 A;  3KBZ A;  3D1R A;  1RDZ A;  1LBW A;  3BIG A;  3KC0 A;  1IMB A;  1EYI A;  4GBV A;  3IFA A;  5EQA A;  4GWY A;  1FPD A;  4GWW A;  1NI9 A;  3RPL B;  1NUY A;  1FBP A;  5EQ8 A;  4H45 A;  2QVR A;  4GX3 A;  5DW8 A;  1SPI A;  2FBP A;  2PCR A;  1FPJ A;  3QMF A;  1YZ0 A;  1FBC A;  2P3V A;  1IMC A;  1KA0 A;  5ET7 A;  4HE2 A;  3RYD A;  2BJI A;  1D9Q A;  5FBP A;  3LV0 A;  1NV1 A;  2FIE A;  4I40 A;  3B8B A;  1IME A;  2R8T A;  4I3Y A;  3A29 A;  1IMD A;  1FPI A;  1FBG A;  4GBW A;  2QFL A;  5IZ3 A;  1LBZ A;  2P3N A;  1FPE A;  2VT5 A;  1XI6 A;  4GWZ A;  5EYG A;  1DBZ A;  3KC1 A;  5EYH A;  1NUW A;  5ET5 A;  2Q74 A;  1K9Y A;  1BK4 A;  4HE0 A;  5F24 A;  1IMF A;  1NV0 A;  1LEV A;  1NV7 A;  1FJ9 A;  3LUZ A;  5ET6 A;  4GX4 A;  5ET8 A;  1NV3 A;  1YXI A;  1FPF A;  2FVZ A;  2CZH A;  1LBY A;  1G0H A;  1QGX A;  1FRP A;  1VDW A;  2Q8M A;  5A5L A;  4GX6 A;  1EYK A;  2CZI A;  1RDY A;  1JP4 A;  2QVV A;  1INP A;  2FHY A;  4MJO A;  1RDX A;  2Y5K A;  2JJK A;  1FPB A;  1G0I A;  1LBX A;  1LBV A;  3BIH A;  1DCU A;  2GQ1 A;  2F3B A;  1EYJ A; 
#chains in the Genus database with same CATH topology
 3I6V A;  3TYH A;  2I4C A;  4UAB A;  1K9Z A;  1XVX A;  3LSF B;  3NOH A;  3SKP A;  1DSN A;  4NGU A;  2FA7 A;  5DVJ A;  4P11 A;  4I62 A;  1B40 A;  5EQ7 A;  3N5L A;  1DTZ A;  2DE2 A;  4HS7 A;  2QSX A;  3CSB A;  4YB5 A;  5F1Q A;  2XXY A;  4Q8R A;  1LB8 A;  3H4Z A;  5L9S A;  1MQH A;  3IK6 B;  4MCO A;  5I58 B;  5ELV A;  4MAG A;  4AB5 A;  3ZSF A;  1OVT A;  1EH3 A;  1UIV A;  2R71 A;  1MY4 A;  4GFR A;  4GXA A;  2HPG A;  1LAF E;  2VPN A;  3TCH A;  3SDF A;  4FOR A;  5I56 A;  3TAJ A;  1B0H A;  3EHS A;  3HCQ A;  4F3B A;  1FBG A;  3MVW A;  2DWA A;  4FJP A;  4H8I A;  2ZZW A;  2V84 A;  5CMB A;  3O66 A;  1ZU0 A;  4XF5 A;  5I5P A;  2Z8F A;  3QXM A;  4IGR A;  1QUJ A;  4G8M A;  2PYY A;  1IQ7 A;  3MW0 A;  2BJJ X;  3VV5 A;  2OZZ A;  3GXA A;  1Y1Z A;  4YU0 A;  1B7Z A;  3SEV A;  2DXY A;  2I58 A;  4NMY A;  3WAF A;  4YKK A;  4BLA A;  1EYK A;  3K1N A;  5HPQ A;  3PTY A;  4H5F A;  4PAI A;  4PGP A;  4PE5 B;  1LB9 A;  3MVX A;  1IMA A;  2XXV A;  2YPN A;  1PBQ A;  1MXU A;  1H76 A;  5L8D A;  5I2N A;  3GBB A;  2CZL A;  2FIX A;  5J16 A;  2I0B A;  4N13 A;  2Y5L A;  3L6H A;  1OQG A;  3BFT A;  1NUX A;  2X7P A;  1DK4 A;  1UQW A;  3T1B A;  4DCY A;  5ISU A;  4ZS9 A;  1LFG A;  4OEU A;  4GWO A;  5H8H B;  1NL5 A;  3T9X B;  3OO9 A;  3RNN A;  3D1R A;  5FTH A;  5DVF A;  3MP1 A;  3O28 A;  2PT1 A;  3OOA A;  5DEX B;  1IEJ A;  5J1D A;  4KQP A;  4H45 A;  2NUV A;  4IO4 A;  5DVI A;  5FTI A;  3TEP A;  2XX9 A;  5AA4 B;  3MQ9 A;  3PPN A;  1DOT A;  1B7U A;  2ESN A;  3PGF A;  2XX8 A;  4F31 B;  1MQG A;  4JVC A;  4I9D A;  2OLB A;  5ET5 A;  3T9H B;  1NV7 A;  3HV1 A;  1N7W A;  3H6V A;  1YXI A;  1QGX A;  2XXT A;  3H03 A;  5A5L A;  2PX1 A;  4H65 A;  2G29 A;  4GF8 A;  2Y5K A;  4BDO A;  5CMM A;  4XIG Q;  4QFL A;  4OFJ A;  5CRY A;  3H7M A;  3IO4 A;  4DDD A;  2ZNS A;  2Q2C A;  4OZ9 A;  4FAJ A;  1SW1 A;  2F5X A;  4R73 A;  1QW0 A;  5DYH A;  1US4 A;  4G68 A;  1AIV A;  3MPL A;  3IO6 A;  2ONR A;  5TPA B;  1WDN A;  4RK9 A;  4NX1 A;  4ELQ A;  5LDZ A;  1B58 A;  1R9L A;  5AA2 D;  4UAC A;  1S9T A;  5I2K B;  4MF3 A;  2Z8E A;  1QKA A;  1IXC A;  4G8H A;  1JQF A;  3FVG A;  3FVK A;  1FBF A;  2A5S A;  4NF0 A;  2IA4 A;  4KHZ E;  2ANJ A;  3KN3 A;  5IAI A;  3T66 A;  3T9V A;  1B1H A;  4JB7 A;  1B3F A;  5CC2 A;  4C1U A;  3Q25 A;  2ZXT A;  1B5I A;  4ONY A;  3IAZ A;  3SEX A;  1FCK A;  3HHG A;  3PD8 A;  2CEY A;  4FEB A;  1MXZ A;  3VVF A;  2H5Y A;  1LLS A;  3K6V A;  1R9Q A;  2UVJ A;  2OWT A;  1Z7N E;  3LUZ A;  4ZE9 A;  3RTF B;  1G0H A;  4IO5 A;  1RDY A;  1IXI A;  5L9M A;  3QK6 A;  4H1X A;  4EF2 A;  1PB8 A;  5H8N B;  1B05 A;  3E13 X;  4LA9 A;  2D21 A;  4JSO A;  1JVX A;  3RY3 A;  2VGQ A;  3A09 A;  2AIX A;  3TQL A;  5ESY A;  2OCU A;  4G61 A;  5KDT A;  3RQT A;  5T3J A;  2HZL A;  1SW2 A;  3FAS A;  4HXV A;  4AB6 A;  2P2A A;  2RCB A;  2ZYK A;  2I48 A;  2Q88 A;  1PB9 A;  1XC1 A;  1URD A;  4MNC A;  4NWC A;  4TOZ A;  4OER A;  2XWV A;  4I1D A;  2DOJ A;  1NKX A;  2DDK A;  1AWB A;  2B4L A;  4R9F A;  3KC0 A;  4DXB A;  3EF7 A;  2Q2A A;  4GBV A;  4BDM A;  4OMB A;  5EQ8 A;  1USY H;  1FQE A;  4OES A;  1B5J A;  2O69 A;  3V8X B;  4OVP A;  4H5G A;  4GD5 A;  2E0S A;  2HCA A;  4OFO A;  4PAF A;  4HW8 A;  2UVH A;  3IOW A;  3ZKK A;  1NV1 A;  2FNC A;  1FTL A;  3W15 C;  3SEY A;  3N26 A;  3CI8 A;  1LAX A;  3IJX B;  1AMF A;  1RKM A;  3ODB A;  3DP8 A;  4LN5 A;  4MBP A;  3TZA A;  4EF1 A;  5F24 A;  2V3T A;  3MYU A;  4PFU A;  4G77 A;  3MZ1 A;  5ITP A;  4GQO A;  1ANF A;  1VDW A;  2F34 A;  4M4G A;  4OHN A;  1NNP A;  3OXN A;  1FPB A;  4OVQ A;  5EYF A;  5FHM A;  3BIH A;  1JET A;  1BIY A;  1M5B A;  1EYJ A;  1JVY A;  1N76 A;  4PP0 A;  3RPL A;  4KFQ A;  5IZ3 B;  1XHY A;  3BKI B;  3C32 A;  2WX9 A;  4ESW A;  3BBR A;  1B2H A;  3CFZ A;  2CMO A;  3OEL A;  3RT8 A;  3JZJ A;  3RUM A;  3PD9 A;  1Y4C A;  4MLV A;  3KZG A;  4Z0I A;  1SDX A;  3RPW A;  1LBC A;  2Y7R A;  4ZE8 A;  1NUZ A;  1FQC A;  1A7L A;  2NOO A;  4H8J A;  2QRY A;  1FW0 A;  1NNT A;  4F1Y A;  1WOD A;  2I3V A;  1BKA A;  4OWD A;  4ND9 A;  3OSR A;  2QVR A;  1JW1 A;  1NFT A;  3U92 A;  5DW8 A;  1SPI A;  2Y7W A;  3PV0 E;  3PUV E;  4U4X A;  2OJT A;  2X7Q A;  2XXX A;  3FUZ A;  2P1S A;  2DWI A;  1EZP A;  4FIM A;  1LBZ A;  1A99 A;  3TUS A;  4R6K A;  1MXW A;  3EQ1 A;  2HZK A;  1IZ1 A;  1JW5 A;  3U93 A;  2H4I A;  2IEE A;  5CI5 A;  4PE3 A;  4TLL B;  1I6A A;  4R6H A;  3C36 A;  4ZEK A;  4MH5 A;  3E4R A;  1D9V A;  1B1X A;  5IZZ A;  1URS A;  4MX6 A;  3FIR A;  3SZP A;  4FED A;  3UK4 A;  2FHY A;  3IJO B;  5EHM A;  2Q8J A;  3A3U A;  4YB7 A;  5I56 B;  3FXR A;  4Q30 B;  4ZZE A;  3ILU B;  4P1L A;  4K3F A;  4N15 A;  3TTK A;  4QSD A;  4PCD A;  3QAX A;  4TQU Q;  4X9T A;  1M5C A;  2XXH A;  4OEV A;  1JEU A;  2GHB A;  1UTH A;  3IB1 A;  3KN7 A;  2F7A A;  4XKP A;  1OMP A;  2FYI A;  3HST A;  5EQ9 A;  1GTK A;  5CMK A;  4AS5 A;  4XFE A;  3KBR A;  5F7V A;  2I4B A;  4KCC A;  1N3X A;  4R6Y A;  1ZBM A;  2DE4 A;  4M1V A;  4TLM B;  1N7X A;  5I2N B;  4WKM A;  1A8E A;  4QHQ A;  1VE4 A;  2PCR A;  1N0T A;  3USD A;  3Q29 A;  1NNF A;  1B9J A;  5FBP A;  3HN0 A;  3LV0 A;  3TTN A;  4QFO A;  1IME A;  4I3Y A;  2GFE A;  4DLD A;  4OEN A;  1A55 A;  4JVI A;  2ONS A;  2RCA A;  3KC1 A;  3B6T A;  3MZ9 A;  1VSO A;  1NUW A;  5IM2 A;  4FAT A;  4OQO A;  2I0C A;  4NE4 A;  2F78 A;  3VE1 B;  3TCG A;  5FHN A;  1B5H A;  4YZZ A;  5FHO A;  5ET8 A;  2NXO A;  2DVC A;  1FPF A;  2FVZ A;  4KYE A;  1MDP 1;  2OBG A;  3PUY E;  4PFB A;  2Q8M A;  3FD3 A;  2RF1 A;  1JP4 A;  1PC3 A;  4GVO A;  4L17 A;  4U1O A;  2O51 A;  3SEW A;  4X1B A;  3S9N C;  1DCU A;  5CBR A;  2Y7P A;  3OO8 A;  2F3D A;  2WBB A;  4GXS B;  4KCD A;  1FSA A;  4NTL A;  1N04 A;  4NF6 A;  4EQ9 A;  1FQD A;  4YB6 A;  1LCT A;  2HEU A;  2HXW A;  1A54 A;  1FBE A;  3K0V A;  1B7H A;  3BFU A;  5A5X B;  3GYY A;  5I7I A;  3LSL A;  3FXB A;  2XXR A;  4O3B A;  3O29 A;  3KG2 A;  3C33 A;  2O68 A;  3S9M C;  5TU0 A;  1OLA A;  4EXK A;  3KBZ A;  1FQA A;  4U21 A;  3T22 A;  2VD2 A;  2ZYN A;  2B65 A;  2KQZ A;  3VXC A;  4NHB A;  5EQA A;  4OFL A;  3CIJ A;  1NI9 A;  2F6G A;  5I59 A;  1S50 A;  1GVC A;  3CVG A;  3RLF E;  4KPT A;  5CBS A;  3VLU A;  4EUO A;  1KA0 A;  1JW4 A;  2F35 A;  2DWJ A;  4P1E A;  4GLI A;  1B0L A;  1USY E;  2QS3 A;  1FPE A;  2THI A;  3V89 B;  4I8C A;  3MVY A;  4AQ4 A;  3MP6 A;  2QMX A;  3TTR A;  3FVN A;  1AH5 A;  3KFM A;  2D3I A;  2G93 A;  2NWJ A;  4R72 A;  3G3F A;  4LON B;  4U2R A;  3RGY A;  4PQJ A;  4LP2 B;  3KJT A;  3MST A;  2GH9 A;  1M5F A;  1INP A;  5M2V A;  2HAV A;  1R1N A;  4G8N A;  4NG7 A;  3UIF A;  1MDQ A;  5JK4 A;  2Q9T A;  2Q89 A;  5AA2 A;  1MQJ A;  1QVS A;  4LAT A;  5IZ1 A;  4KXP A;  4EXL A;  4NF5 A;  4EDP A;  1H3D A;  3G3H A;  3OEM A;  1QJM A;  3I5O A;  3K1P A;  3KJ7 A;  4GRK A;  4GWS A;  3KSJ A;  4RPN A;  1FJ6 A;  1ELJ A;  1Y4T A;  1Q9D A;  2NVU B;  1RDZ A;  1LBW A;  2O6A A;  2LAO A;  2RC9 A;  4PBH A;  1DPP A;  4PAK A;  1MPB A;  3WAE A;  4X04 A;  4GWW A;  2I3W A;  3OD7 A;  2QJE A;  1FTM A;  3FVO A;  5BUU A;  2FBP A;  4IB2 A;  5B7D A;  3QMF A;  1O63 A;  1YZ0 A;  3TCF A;  1MG1 A;  1D9Q A;  2VD3 A;  4ZED A;  4N8Y A;  2VHA A;  3V5A A;  3CR9 A;  3QIM A;  2QS1 A;  4XKR A;  5AA3 A;  5EYH A;  2ZYO A;  5LOM A;  1TFD A;  1IMF A;  1B46 A;  3UN6 A;  5H8F A;  2H99 A;  4IY5 A;  1P1U A;  2B4M A;  1P99 A;  4C1T A;  1KWH A;  2XXU A;  3M3K A;  4KD5 A;  1SQY A;  3JYR A;  3TTM A;  2QVV A;  2WYK A;  2X26 A;  4MJO A;  1TFA A;  3OO7 A;  2UYF A;  2UVG A;  2HFB A;  2HXR A;  2OPD A;  5L9O A;  3S4U A;  2PT2 A;  4F3G A;  1KA1 A;  2R9J A;  4H46 A;  4QF9 A;  4NF8 A;  4IO7 A;  4MNP A;  3ZS6 A;  3LR1 A;  1D4N A;  3QUJ A;  2A5T A;  3TKD A;  2E1S A;  3FJ7 A;  1B4Z A;  2ZNT A;  3UA8 A;  1H43 A;  2GHA A;  1LFH A;  3CSG A;  2VP1 A;  1NH8 A;  1BLF A;  5I57 B;  4F1V A;  1OVB A;  4OVS A;  2CZK A;  1KZ8 A;  1US5 A;  1H44 A;  3BIG A;  1AL3 A;  4NQ8 A;  4PF6 A;  4LUB A;  3A3C A;  3KEI A;  1B32 A;  3RPL B;  1OQH A;  3D4G A;  5IKB A;  3EN3 A;  4QBA A;  1LBB A;  1MPD A;  1R6Z A;  2V3U A;  4OA4 A;  2XHD A;  4DI4 B;  2P3V A;  2BJI A;  4BDN A;  3IX1 A;  1GV8 A;  4JSD A;  4YMA A;  3IOT A;  5BWJ A;  4GL0 A;  4DXU A;  1IIT A;  1IMD A;  4ZDM A;  5ITO A;  1SW5 A;  4R74 A;  4YAH X;  2AL4 A;  5ICT A;  1DBZ A;  3R6U A;  3D4C A;  1MS7 A;  4HE0 A;  3GZG A;  4O8M A;  3IR1 A;  1OIB A;  3K4U A;  1NV0 A;  4E0W A;  1N3W A;  3MZB A;  3UP9 A;  2L5V A;  3Q27 A;  2DWH A;  3OEK A;  4IO2 A;  5IGA A;  4X8R A;  3GBA A;  1NV3 A;  3JV9 A;  4OVR A;  1F9B A;  4F2Q A;  1B51 A;  1HSL A;  1RYX A;  1Y1M A;  1G0I A;  1LBX A;  1Q35 A;  3PMX A;  1ZIU A;  1RYO A;  4F3S A;  2ZZX A;  1NV5 A;  4H6D A;  4N91 A;  3UGW A;  3UOR A;  3KOT A;  4AS4 A;  4KYD A;  1FQB A;  5I3S A;  3EHT A;  2QMW A;  4QRZ A;  4P0G A;  4O7I A;  3L6G A;  1D3K A;  3DEL B;  3Q28 A;  4RNS A;  3FBP A;  2RC7 A;  2PVU A;  3VLV A;  4PF8 A;  1MY0 A;  2XA5 A;  4NF4 A;  1MQD A;  4XXU A;  4QXD A;  2DS9 A;  4ZEF A;  1ZKB A;  2HHM A;  4MHF A;  2B3B A;  4JVD A;  4NED A;  2RKM A;  1WVJ A;  2XXP A;  3PU5 A;  4LQ5 A;  3PUZ E;  4BDQ A;  5DT6 A;  1MH3 A;  3MJN A;  3B50 A;  4DE8 A;  1CB6 A;  1PEB A;  2ABH A;  4YKI A;  3K6W A;  1O7T A;  5H8S A;  1UTH B;  3U1O A;  1Y20 A;  3OO6 A;  5TP9 A;  1MM6 A;  5KCJ A;  4RXL A;  1HSJ A;  4WXJ A;  2R6G E;  3N94 A;  3A29 A;  1MM7 A;  1FPI A;  4GBW A;  1YCJ A;  5H8Q A;  3W9W A;  4GWZ A;  3GLB A;  3K1M A;  2XD2 A;  3N6U A;  3QYT A;  4ESX A;  1XT8 A;  1SYH A;  2PBW A;  3R26 A;  2REG A;  1S7Y A;  2V3Q A;  4U22 A;  3VDF A;  2CZH A;  4YIC A;  2KLF A;  4LZ7 A;  3B6Q A;  1CE2 A;  2PMS A;  4Q5T A;  1DMB A;  3FV2 A;  1Y3N A;  2D5W A;  4RYA A;  2HQ0 A;  2OWZ A;  4F3P A;  1II5 A;  2Z22 A;  5ICQ A;  1FPG A;  1NH7 A;  3IOV A;  3O6I A;  3FGS A;  2OWS A;  3ECR A;  3VFJ A;  1NV2 A;  3ILT B;  4XKN A;  3B7D A;  3CRB A;  4N81 A;  4C0R A;  1FTK A;  3H6W A;  4ZEI A;  2H25 A;  1FBD A;  2F36 A;  4H67 A;  3RTW B;  4BDL A;  3E79 A;  3O97 A;  4ELP A;  4JWX A;  4F22 A;  4GIZ A;  3C9H A;  1A40 A;  4NF6 B;  1B52 A;  4GX3 A;  1PBP A;  2B3F A;  1MXY A;  3E78 A;  4N8G A;  4QFK A;  3CFX A;  1SVX B;  2V25 A;  5ET7 A;  2V93 A;  4DCX A;  1QUL A;  1P1W A;  5CMC A;  4P56 A;  4G4P A;  2DE3 A;  3MC2 A;  3SEU A;  5K2Y A;  1MQI A;  4JDF A;  1OLC A;  1K9Y A;  4MIJ A;  1LEV A;  4N07 A;  3G7W A;  5JTY A;  3DP6 A;  3T96 B;  4EQB A;  1BP5 A;  5I59 B;  1ZMG A;  1IXG A;  4JXI A;  1UTB A;  2CZI A;  3KSX A;  3SET A;  4G68 C;  2ZMB A;  3SES A;  4F29 A;  3S2V A;  3PPR A;  3MPK A;  4P47 A;  4GL8 A;  2Z23 A;  2H98 A;  1XS5 A;  2WEF A;  3TPA A;  3OMB A;  4QSC A;  1CNQ A;  2WBD A;  1M5E A;  4F1U A;  3QUF A;  1FPL A;  4PTK A;  4F2O A;  3T0J A;  1A8F A;  4DI3 D;  4WEP A;  1NV4 A;  1MY1 A;  1PB7 A;  4P8B A;  2O1L A;  1MXV A;  2XD3 A;  2REJ A;  1FPD A;  1FBP A;  2QPQ A;  4GOT A;  2XWK A;  5AA2 B;  4LQ2 A;  1POY 1;  1FBC A;  2OPE A;  1GR2 A;  4NF5 B;  1P1O A;  4PFR A;  1Y3P A;  3I3V A;  1Y9U A;  4P3L A;  3B8B A;  2P0S A;  1FTO A;  1XI6 A;  5CM6 A;  1MH4 A;  1JEV A;  4G68 B;  2Q74 A;  3HHF A;  4DZ1 A;  3N6T A;  3DLN A;  3G3K A;  4XKQ A;  3AXF A;  2XXW A;  1I6Q A;  3EHU A;  2F7B A;  4RK2 A;  3M8U A;  2DQV A;  3DP4 A;  4XEQ A;  4IO3 A;  3H3G A;  2XWO A;  2JJK A;  1LBV A;  3PPP A;  5I58 A;  1BTJ A;  4FBP A;  2UYE A;  3LSX A;  1L5T A;  2ZNU A;  1ZTY A;  4F19 A;  2I6E A;  1Q1K A;  3CG1 A;  4KR5 A;  3T9U A;  1ZJL A;  4PFY A;  5H8F B;  3FJG A;  1UIU A;  1TXF A;  4HCY A;  4O94 A;  3E3K A;  3THI A;  3EKI A;  4OXV A;  3P7I A;  1I6B A;  4HTG A;  3H06 B;  2QL3 A;  4OET A;  2DP8 A;  2VPO A;  4H0W A;  3ONM A;  3MP8 A;  2DXR A;  2MKZ A;  1XVY A;  4JWO A;  4PFI A;  3T93 B;  4U1Z A;  3M3L A;  1EYI A;  3IFA A;  3LC8 A;  4R2F A;  4FEC A;  3K02 A;  4N6K A;  1QUI A;  1YAE A;  3PUW E;  5A5X A;  2GRV A;  4NF8 B;  5HM4 B;  1Z7M E;  1MRP A;  4QFP A;  3OSQ A;  4MNI A;  1TT1 A;  1HSE A;  2F97 A;  2ONK E;  3VVE A;  2A5T B;  4N4U A;  2DYX A;  3PPQ A;  5LTC A;  3ZKL A;  5KZT A;  4LZ5 A;  2VT5 A;  4LVQ A;  1O64 A;  1SW4 A;  1LST A;  1B3G A;  5K2X A;  1BK4 A;  4MLQ A;  5KDT B;  4IY6 A;  1FTJ A;  3K6X A;  1H45 A;  5ET6 A;  3G3I A;  2XWI A;  1QUK A;  5H8H A;  1LAH E;  4YMB A;  4GX6 A;  1XOC A;  1RDX A;  3C31 A;  4NN3 A;  3S9L C;  2GQ1 A;  4NAP A;  2HAU A;  5DEX A;  4QSE A;  4PGN A;  4IGT A;  2Y7I A;  3IOR A;  5AE4 A;  3KOS A;  1FQF A;  3DM0 A;  5DTB A;  3TFL A;  4BDR A;  4ELR A;  5AA4 A;  4O3A A;  4GWX A;  2F7C A;  2ALU A;  3U8Q A;  1YYZ A;  4ECF A;  1ATG A;  3VLW A;  1B3E A;  2YLN A;  4PC9 A;  4R2B A;  4NWD A;  4HE1 A;  4PFW A;  1YPN A;  2QVU A;  1EU8 A;  3Q26 A;  4MEV A;  4P0I A;  2Y84 A;  2OX3 A;  3O2A A;  3B6W A;  3G3G A;  3R7X A;  3MUQ A;  4N17 A;  4E0X A;  4OYV A;  4OVT A;  4RY1 A;  3PMW A;  1VR5 A;  4XTC Q;  4GWY A;  1DPE A;  1NUY A;  3PPO A;  3IB2 A;  2WKY A;  1FPJ A;  4WED A;  3KGC A;  4HE2 A;  3HFU A;  1DTG A;  3U72 A;  2DVZ A;  5AA1 A;  4THI A;  4I40 A;  1SYI A;  4NF4 B;  1SI1 A;  1ZLQ A;  4ZZA A;  3CFL A;  2P3N A;  1B6H A;  5EYG A;  4PFT A;  1YTV A;  5TPA A;  3HPI A;  3TEL A;  3FJM A;  2Z8D A;  3E9X A;  4RA1 A;  2XX7 A;  5I2K A;  3TTL A;  3KN8 A;  3FAT A;  4Z7E A;  1N84 A;  1LBY A;  1D9Y A;  1QKB A;  3C4M A;  1FRP A;  4MMP A;  3TMG A;  4ISU A;  2XXK A;  4MFI A;  1MPC A;  5TP9 B;  2F3B A;  3H6U A;  3IL1 B;  5KCJ B;  4O3C A;  3EPE A;  4IR8 A;  1SD3 A;  2PFZ A;  3IFC A;  3O9P A;  5H8Q B;  3FXU A;  3QSL A;  4GWU A;  2YJP A;  2XXQ A;  1I69 A;  3RN8 A;  3O6H A;  4OAN A;  1MXX A;  2Y7K A;  1VFD A;  3SER A;  4PDD A;  1FTA A;  1B3H A;  3K6U A;  3FZV A;  1LAG E;  3VVD A;  1FPK A;  2O7U A;  1NMU A;  3FXQ A;  4EQ7 A;  4POW A;  5B70 A;  1IMB A;  3MWB A;  1IXH A;  4UA8 A;  2UVI A;  3U65 A;  1Y3Q A;  2RIN A;  3TQW A;  4F18 A;  2RC8 A;  1SI0 A;  3C34 A;  2O84 X;  1IMC A;  4U23 A;  3RYD A;  3O6G A;  5H8N A;  4PDH A;  3IOU A;  2FIE A;  2OK2 A;  5I57 A;  1B3L A;  4JWY A;  1TWY A;  4R9G A;  2KR0 A;  2AYS A;  4Q0C A;  2UXA A;  3LSW A;  4PBQ A;  1SBP A;  1MY2 A;  3F11 A;  2H9B A;  1LFI A;  1FJ9 A;  3IB0 A;  1PDA A;  4GX4 A;  3CHG A;  4PET A;  1URG A;  4P9K A;  1B4H A;  2DSF A;  3C35 A;  3HO7 A;  3K2D A;  4X1D A;  3H6T A;  4LZ8 A;  4DXC A;  2I49 A;  5I84 A;  3MVZ A;  1JNF A;  4FE8 A;  2XXI A;  4OTE A;  1IUD A;  4G2Z A;  4ZEB A;  2F6P A;  2CEX A;  2ZYM A;  4QFN A;  2QS4 A;  3CG3 A;  4RPO A;  1FBH A;  3U94 A;  4N6P A;  4X48 A;  4RJZ A;  1MY3 A;  4IO6 A;  4I3E A;  4KYS A;  3S9E A;  2O7I A;  5JTY B;  2QS2 A;  2VOZ A;  4U4S A;  2PFY A;  3MAM A;  1IIW A;  1NV6 A;  3G3J A;  3ROJ A;  1UTB B;  3PMV A;  1LCF A;  1M5D A;  4YKJ A;  1GGG A;  4O7M A;  4F39 A;  3OEN A;  3LUY A;  2AL5 A;  4R75 A;  4JBZ A;  4OVJ A;  1P1Q A;  4POX A;  4YKP A;  2F8D A;  1LGB C;  3V83 A;  4N6D A;  2WYP A;  3ISP A;  5EHS A;  5JEI A;  1EZ9 A;  3K00 A;  3FV1 A;  3VXB A;  3M3F A;  2W7Y A;  4DIG A;  2R8T A;  3K01 A;  3LBS A;  2QFL A;  5IZ3 A;  1VFE A;  1P1N A;  4KI0 E;  1POT A;  5HBC A;  2ZZV A;  3RT6 B;  3TDJ A;  1T0K A;  1EZO A;  2V4C A;  3PUX E;  4ELO A;  4ZEC A;  4HCW A;  3W9V A;  1AOV A;  2M8C A;  1NNK A;  3MBP A;  3TOD A;  1J1N A;  2O1M A; 
#chains in the Genus database with same CATH homology
 4FBP A;  4UAB A;  3RPL A;  1K9Z A;  5IZ3 B;  2WX9 A;  3NOH A;  1KA1 A;  4F19 A;  4H46 A;  4MNP A;  4NGU A;  4HCY A;  4O94 A;  5EQ7 A;  3EKI A;  2DE2 A;  1NUZ A;  4F1V A;  4OVS A;  2VPO A;  2CZK A;  1KZ8 A;  3BIG A;  4NQ8 A;  2MKZ A;  4PF6 A;  4PFI A;  4MCO A;  1EYI A;  3IFA A;  4MAG A;  3RPL B;  2QVR A;  4QBA A;  2HPG A;  4N6K A;  4OA4 A;  2VPN A;  5DW8 A;  1SPI A;  4DI4 B;  4MNI A;  2P3V A;  2BJI A;  4N4U A;  1IMD A;  1FBG A;  5LTC A;  1LBZ A;  2VT5 A;  1DBZ A;  2HZK A;  4HE0 A;  1BK4 A;  4O8M A;  2ZZW A;  1NV0 A;  4XF5 A;  5I5P A;  2L5V A;  4PE3 A;  5ET6 A;  5IGA A;  4X8R A;  1NV3 A;  2XWI A;  5IZZ A;  4OVR A;  4MX6 A;  4GX6 A;  1EYK A;  3SZP A;  3PTY A;  2FHY A;  1RDX A;  4PAI A;  4PGP A;  1G0I A;  1LBX A;  4NN3 A;  2GQ1 A;  4NAP A;  2ZZX A;  1IMA A;  1NV5 A;  4N91 A;  4P1L A;  4AS4 A;  4N15 A;  4PGN A;  5I3S A;  4PCD A;  2FIX A;  5J16 A;  2Y5L A;  4O7I A;  4X9T A;  1NUX A;  1DK4 A;  3T1B A;  4GWX A;  3FBP A;  1YYZ A;  4PF8 A;  2XA5 A;  4PC9 A;  5EQ9 A;  4HE1 A;  4QXD A;  2QVU A;  4MEV A;  4AS5 A;  4XFE A;  2OX3 A;  2HHM A;  4MHF A;  3D1R A;  4JVD A;  4N17 A;  4OVT A;  4GWY A;  2DE4 A;  1NUY A;  5J1D A;  4H45 A;  4M1V A;  3B50 A;  2PCR A;  1FPJ A;  4HE2 A;  3HFU A;  5FBP A;  2DVZ A;  3LV0 A;  4I40 A;  1IME A;  4I3Y A;  3A29 A;  1FPI A;  4GBW A;  4JVI A;  2P3N A;  3W9W A;  4GWZ A;  5EYG A;  4JVC A;  3KC1 A;  1NUW A;  5IM2 A;  5ET5 A;  1NV7 A;  4YZZ A;  2V3Q A;  5ET8 A;  1YXI A;  1FPF A;  2FVZ A;  2CZH A;  1LBY A;  1QGX A;  1FRP A;  4PFB A;  2Q8M A;  5A5L A;  4MMP A;  4YIC A;  1JP4 A;  2Y5K A;  2XXK A;  1DCU A;  2F3B A;  4IR8 A;  2F3D A;  2WBB A;  2F5X A;  1FSA A;  2PFZ A;  3IFC A;  2OWZ A;  4GWU A;  1FPG A;  4NX1 A;  4OAN A;  5LDZ A;  1FBE A;  1NV2 A;  3GYY A;  4PDD A;  1FTA A;  5I7I A;  3FXB A;  4N81 A;  1FBD A;  1FPK A;  3KBZ A;  1FBF A;  4NF0 A;  1IMB A;  2KQZ A;  3E79 A;  4NHB A;  5EQA A;  3U65 A;  1NI9 A;  4F18 A;  4GX3 A;  3E78 A;  4N8G A;  1IMC A;  1KA0 A;  5ET7 A;  3RYD A;  4PDH A;  2FIE A;  4P1E A;  2CEY A;  4P56 A;  2DE3 A;  1FPE A;  2KR0 A;  4MIJ A;  1K9Y A;  4PBQ A;  1LEV A;  1FJ9 A;  3LUZ A;  4GX4 A;  3CHG A;  4PET A;  4P9K A;  1G0H A;  2CZI A;  1RDY A;  3MST A;  1INP A;  4NG7 A;  2CEX A;  5JK4 A;  2Q9T A;  4P47 A;  5ESY A;  4G61 A;  1FBH A;  5T3J A;  5IZ1 A;  4KXP A;  2HZL A;  2WEF A;  4HXV A;  1CNQ A;  4I3E A;  2WBD A;  4F1U A;  1FPL A;  2PFY A;  4PTK A;  1NV6 A;  4MNC A;  3ROJ A;  3T0J A;  4DI3 D;  4GWS A;  2XWV A;  1FJ6 A;  1NV4 A;  2DDK A;  1Q9D A;  1AWB A;  4O7M A;  2B4L A;  1RDZ A;  1LBW A;  4P8B A;  3KC0 A;  4PBH A;  4PAK A;  4GBV A;  1FPD A;  4X04 A;  4GWW A;  1FBP A;  5EQ8 A;  2QPQ A;  2XWK A;  2FBP A;  4N6D A;  2WYP A;  3ISP A;  4OVP A;  3QMF A;  1YZ0 A;  1FBC A;  4PAF A;  4PFR A;  1D9Q A;  4P3L A;  1NV1 A;  4N8Y A;  3B8B A;  2R8T A;  2QFL A;  5IZ3 A;  1XI6 A;  5CM6 A;  5EYH A;  4LN5 A;  2ZZV A;  2Q74 A;  5F24 A;  1IMF A;  3MYU A;  2B4M A;  2V4C A;  4HCW A;  3W9V A;  4XEQ A;  1VDW A;  2XWO A;  2QVV A;  2WYK A;  4MJO A;  2JJK A;  1FPB A;  4OVQ A;  1LBV A;  3BIH A;  2HXR A;  1EYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...