2Y5LA

Orally active aminopyridines as inhibitors of tetrameric fructose 1,6- bisphosphatase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
publication title Orally Active Aminopyridines as Inhibitors of Tetrameric Fructose-1,6-Bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 319
sequence length 327
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2y5lA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2y5lA02
4AS5A 5EQ7A 1SPIA 2Y5LA 1FPBA 2QFLA 5ET7A 1IMFA 4PTKA 1D9QA 2FBPA 1NUYA 4HE2A 2CZIA 3A29A 3LUZA 2DDKA 5ET6A 2QVRA 3IFAA 3ROJA 2QVUA 1NV1A 2CZHA 1LBWA 5EQ9A 4HE0A 1IMEA 4H45A 1RDYA 1NV7A 1CNQA 4GX3A 3D1RA 3BIHA 3KC0A 4HE1A 2Q8MA 3IFCA 1NUZA 1EYJA 2OX3A 2R8TA 4QXDA 1IMDA 1G0HA 2FIEA 2JJKA 1FTAA 1NV0A 1Q9DA 5ET8A 1FSAA 3B8BA 1DBZA 2WBBA 4MJOA 2F3BA 4GWZA 1EYKA 3QMFA 5ET5A 1FPJA 4GBWA 4G61A 5EYHA 1FPLA 1FPIA 5IZ3B 4IR8A 1NV4A 1DCUA 1DK4A 1KA0A 4I40A 4GBVA 1NI9A 2FHYA 1FBEA 4N81A 5EYGA 1RDXA 2FIXA 5ESYA 3RPLB 2HHMA 3BIGA 1LBZA 1FJ6A 5FBPA 4GWUA 4HXVA 1KA1A 5J16A 1XI6A 1FBGA 1FPFA 4GWSA 4GWYA 3LV0A 5A5LA 1FRPA 4O7IA 2GQ1A 1IMBA 4H46A 5T3JA 1FBDA 5EQ8A 1NV2A 1LBYA 4GWXA 1KZ8A 5I3SA 5F24A 1FPEA 2VT5A 5LDZA 1NUXA 1FJ9A 4FBPA 5EQAA 4GWWA 2WBDA 1K9ZA 1NUWA 5IZ1A 1G0IA 3T0JA 3RYDA 2Q74A 1FPGA 1FPDA 1YZ0A 1NV6A 1YXIA 3KC1A 4GX4A 3KBZA 4AS4A 2OWZA 2BJIA 2Y5KA 2PCRA 1NV3A 1FBFA 1K9YA 3FBPA 1NV5A 1INPA 1YYZA 1QGXA 1BK4A 2F3DA 5DW8A 2CZKA 2P3VA 1EYIA 2WEFA 1IMAA 1IMCA 1AWBA 5IZ3A 1LBVA 1JP4A 1FBPA 1LEVA 4I3YA 1FBCA 1RDZA 2P3NA 1VDWA 2QVVA 3RPLA 1FPKA 4KXPA 4I3EA 4GX6A 1LBXA 1FBHA 2FVZA
chains in the Genus database with same CATH superfamily
2DE4A 4JSOA 4GOTA 2QFLA 3L6HA 4N4UA 4PTKA 3RNNA 3K1PA 4F1UA 4XXUA 3FVNA 3KN7A 5EYFA 4H45A 2VHAA 3HHGA 3M3KA 4MLQA 4YAHX 2Q8MA 4FJPA 4ESWA 4MCOA 3EHSA 1B7HA 1Y4CA 3EF7A 1DBZA 3Q29A 3O29A 4ISUA 1EYKA 2ESNA 3HN0A 1OLCA 3IB2A 4H6DA 4OANA 2XXRA 2RKMA 1BTJA 5HM4B 1Z7NE 3OMBA 1QKAA 5A5XA 1Y3NA 1FJ6A 1AL3A 3U8QA 4UACA 3E78A 3KJ7A 1FBDA 5IM2A 1UQWA 5I3SA 4THIA 4JBZA 4GIZA 4PAKA 2VT5A 2F36A 2RC9A 3RY3A 4U1OA 4DIGA 4LONB 2F6PA 4NQ8A 4I1DA 1NMUA 3AXFA 1YZ0A 3FIRA 4OVJA 3OO9A 4GLIA 1NL5A 1GVCA 1N76A 1NV5A 2XXYA 3CRBA 2NXOA 3LBSA 1B6HA 1QKBA 4QSDA 4TQUQ 1TFAA 1TFDA 4EDPA 1LBXA 3H3GA 1QJMA 3SEXA 3S2VA 1FPBA 4F3PA 4R73A 1JNFA 3IR1A 3S4UA 1ZIUA 2PVUA 1MQJA 3ROJA 1Y4TA 3SDFA 3TCFA 4PE5B 1CNQA 4PGPA 4FATA 2BJJX 1NUZA 5J1DA 1B5HA 4DXCA 4MLVA 5DEXB 1I6QA 4NTLA 1FSAA 2Z8FA 3ZSFA 4DZ1A 4PFBA 5K2XA 1MM6A 1ELJA 1B0LA 4PFIA 1FPIA 4ZS9A 3FJMA 1DCUA 2GRVA 1DK4A 4PF8A 3TTNA 1CB6A 2FYIA 3LSFB 3B50A 1B4HA 4H8JA 3SERA 3MPKA 2O1LA 2I3VA 2RC8A 1H76A 3H4ZA 3Q28A 2YLNA 4WEPA 4KD5A 1ZBMA 2I0CA 3H6VA 3GXAA 1UTBA 2PFYA 3UN6A 1FPGA 3IX1A 4NN3A 3OEKA 2ZNSA 4FAJA 2DVCA 3VFJA 1LCFA 4P11A 4KCDA 4IO6A 2HZKA 5DW8A 1EZPA 2WEFA 5DTBA 4R6KA 1JP4A 1LEVA 2ZZWA 3O66A 1D3KA 2Y7KA 1B32A 4LVQA 3SETA 1P1OA 1VDWA 1M5FA 3RTFB 5ITPA 3N26A 1UTHB 3G3IA 4QFLA 2QMWA 4AS5A 2DVZA 2G29A 2I4CA 4LA9A 5H8NB 3OXNA 4F2QA 1NNFA 4PFYA 1SVXB 3TQWA 4JWXA 1MM7A 3M8UA 1H3DA 4MNCA 4H5GA 1BIYA 1IMEA 2MKZA 3R26A 3UK4A 3FXQA 1A8FA 2Y7WA 2XWKA 2NWJA 2QS2A 4AB5A 3CI8A 3O9PA 5EHSA 4YICA 3OENA 2E1SA 3QMFA 4ND9A 3LSXA 1ZMGA 4NWCA 5FHMA 4IR8A 1XC1A 4OERA 4YB7A 1FQCA 4N13A 3DLNA 4QBAA 1MXUA 3BKIB 1FPFA 4YMBA 4GWYA 3TTKA 2HCAA 3G3GA 4H46A 3G3HA 4BDNA 3C31A 1LBYA 1MG1A 3CFLA 1LBBA 2D21A 1MXVA 2FA7A 3K1NA 5EQAA 3MVXA 1NUWA 4H0WA 1P1NA 2XD2A 3RYDA 4U2RA 3SKPA 1VR5A 3GYYA 3KC1A 1M5EA 1Y1MA 3T93B 3T9XB 5I2NA 5L8DA 4YKIA 1K9YA 3FBPA 2V93A 1QGXA 2XXUA 3OO8A 2XXTA 5TP9A 4YZZA 1Q1KA 2HFBA 4OXVA 2A5SA 5A5XB 3N6TA 3FZVA 1B51A 1OIBA 2FBPA 3P7IA 2CZIA 2QRYA 3O2AA 5DT6A 2QVRA 3DP4A 2ANJA 2CZHA 1PC3A 1NH8A 3MYUA 1RDYA 1LFHA 4HE1A 4JB7A 3ZKLA 4JVIA 2DWAA 3PPRA 4MHFA 3FJ7A 2CZLA 1B40A 4BDOA 4GFRA 1ANFA 2PX1A 4GD5A 4MJOA 3C35A 4XKNA 3PPPA 4I40A 5ICQA 4I8CA 1SW5A 3G7WA 4ZE8A 2E0SA 1IXGA 1QUIA 2XX7A 5I84A 2OBGA 4O7IA 3HHFA 2I3WA 5L9SA 4DLDA 2UVIA 3RGYA 2F7CA 2DSFA 3VV5A 3LSWA 4XIGQ 1G0IA 3I3VA 4PP0A 3UP9A 5LOMA 4P1LA 3HSTA 2H4IA 2I58A 3SEWA 1DTGA 1DTZA 3CVGA 4YKPA 1B1XA 2KQZA 4F19A 3S9EA 1AWBA 1TXFA 1DOTA 4ZECA 1IIWA 3VLVA 1FPKA 4KXPA 3C36A 2CEYA 3UA8A 4PBQA 1USYE 2D3IA 2Y7RA 4IO4A 4U4XA 2Y7PA 3TKDA 3A3CA 1Y1ZA 2Q89A 3T96B 1B3FA 5DVFA 1PDAA 1MH4A 4RK2A 2GHBA 2UVGA 1HSLA 5IZZA 5KDTA 1FTAA 5TU0A 5BUUA 3ILUB 4ZEBA 1I6BA 1AIVA 2XXKA 2H98A 3JV9A 4F3GA 2A5TA 3VVDA 3TFLA 4E0XA 1QVSA 4JXIA 3MP1A 3FJGA 3KEIA 3MP6A 1PBQA 2XXHA 1WVJA 4N8YA 1URSA 1OQHA 4KHZE 2PMSA 2R6GE 3C4MA 2HPGA 1B5IA 4RPOA 1S50A 3TQLA 2LAOA 3U94A 1P1WA 4EXLA 4ZE9A 4K3FA 2PCRA 3EQ1A 4R2FA 5DVJA 1NNPA 1FTJA 4Q8RA 1EYIA 3MP8A 4ELOA 1J1NA 4R6HA 1LB8A 3MVWA 3ONMA 1XVXA 1XOCA 4NE4A 3MZBA 2ZZXA 2QVVA 2DWIA 4YKJA 1B9JA 4NF8B 3Q25A 4FE8A 2CEXA 1NNKA 4HE2A 1KWHA 5FHNA 1JETA 5F1QA 2HQ0A 3VVEA 4KFQA 4XTCQ 3IOUA 3MC2A 4X04A 1LAFE 2UXAA 3O97A 1GGGA 2UVJA 4YB5A 4ZEIA 2Q8JA 3ILTB 1YTVA 3BIHA 2F35A 3VXBA 5IGAA 3KN3A 4FIMA 2HAUA 4P0IA 4BLAA 1A55A 4FORA 5I2NB 3E9XA 4EQ7A 4GL8A 4G8MA 2REGA 2XXVA 4TOZA 4GVOA 2REJA 3QUFA 1N3WA 5EYHA 2XX9A 2V25A 5TP9B 5CI5A 2IEEA 2H99A 4OENA 4NMYA 5IKBA 2FIXA 3JZJA 3I5OA 2H25A 4KPTA 2O51A 1RKMA 4ELRA 5A5LA 2RC7A 2NOOA 1SQYA 3QSLA 1NNTA 2V3QA 1NV2A 4PAFA 5ITOA 5I5PA 1MRPA 2O69A 2XD3A 4R72A 3LUYA 3HPIA 3PTYA 2THIA 2DE2A 5H8FA 1YXIA 4AS4A 1GV8A 3TAJA 4G77A 1LBVA 1FBPA 3TPAA 5B7DA 1B7ZA 1YAEA 3OEMA 5EHMA 4YKKA 3A3UA 4GX6A 5B70A 3JYRA 4LZ7A 4QFOA 2WKYA 1O64A 5I59A 1D9QA 4U4SA 2DDKA 4IO2A 1Y3QA 3K6UA 2UYFA 4KI0E 3SESA 1MXYA 4NG7A 2R8TA 1II5A 5LTCA 4LN5A 3U1OA 2B65A 1SW2A 2DP8A 2QJEA 1LFIA 1EZOA 3IOWA 5ET5A 2XXPA 4G61A 2PT1A 2F34A 3HCQA 1B0HA 3FVGA 1KA0A 1QW0A 4NF0A 4F29A 1IITA 4OVQA 3MZ9A 2F6GA 3BIGA 2XXIA 3TDJA 1KA1A 4O94A 1XI6A 2Y7IA 4LQ2A 2X26A 3KOTA 3K0VA 4WKMA 2ONKE 3MW0A 2FNCA 4E0WA 2WYPA 1A99A 1M5CA 2ZXTA 3E13X 4DXBA 1YCJA 5I2KA 1UIVA 3MUQA 5H8SA 3GBBA 5JTYA 3QXMA 5KDTB 4OYVA 4OZ9A 1LGBC 3VVFA 2Y5KA 4AB6A 5K2YA 5CRYA 2NVUB 2UVHA 4Q30B 3UGWA 4NGUA 4OETA 4DXUA 5IZ3A 2O7UA 2QMXA 2A5TB 4QHQA 4P8BA 3B6WA 3IOTA 4F3BA 5CMCA 1FCKA 3T0JA 1IXIA 1P1UA 4OVSA 4N17A 3D4CA 2XWIA 3U65A 4BDMA 3CR9A 2QVUA 2Q2AA 3CFZA 1NV1A 3VXCA 2DE3A 5KCJA 1SYIA 4G2ZA 5CC2A 1YPNA 3ECRA 2DOJA 4XF5A 4OFJA 4ONYA 1Q9DA 4IY5A 4YMAA 4MBPA 4R6YA 3PUXE 3MPLA 3FVOA 4LP2B 4XEQA 2XWOA 1LBCA 2FHYA 3MAMA 1H43A 3DP6A 4X9TA 3RTWB 2QSXA 2WX9A 5FBPA 4O7MA 4HXVA 1JW5A 3T9VA 1JEVA 3LV0A 1LAGE 4OFOA 1P99A 3V5AA 1TT1A 2HXWA 4PDHA 4LZ8A 1PEBA 2V3TA 3PMXA 2F8DA 3PV0E 3VLWA 5CBSA 3KBZA 4NF8A 1XS5A 4U22A 3Q26A 3ZS6A 3PUWE 2DYXA 4N8GA 4AQ4A 4F2OA 4F31B 3IORA 4G68C 1HSJA 4EXKA 4I62A 1CE2A 3KOSA 4QFPA 3BFTA 3RT8A 5HBCA 2OWSA 1I69A 4ZDMA 4IO5A 1NH7A 4Q0CA 4H1XA 4DI4B 4IY6A 2P0SA 1MPDA 3K2DA 4GRKA 3V8XB 2ABHA 3MSTA 1SD3A 4NF4A 4PQJA 2R9JA 1PB7A 1N3XA 4QXDA 4OFLA 3KFMA 4IO7A 5H8FB 3B7DA 4O3BA 5FHOA 3TTMA 3RUMA 1PB8A 2F5XA 4KCCA 4Q5TA 1NV4A 3WAEA 4N81A 1P1QA 3VLUA 3IO6A 2HHMA 2ZMBA 4EF1A 1A8EA 3QIMA 1EH3A 4R74A 5I59B 4F39A 3TTLA 4LATA 3PUYE 4MH5A 2OJTA 1USYH 2VOZA 4NAPA 1MY4A 4QSCA 4EF2A 2GH9A 1FPDA 4BDLA 1VFDA 3QUJA 2B3FA 5JK4A 1H45A 4O3CA 4P9KA 4RK9A 4O8MA 2XXXA 3C34A 1BK4A 1N7XA 4POXA 3EHTA 2ZYNA 1OQGA 4MEVA 4L17A 4WXJA 1IMCA 1FTOA 4I3YA 1QUJA 4N6DA 4ELPA 1IUDA 3CFXA 3PPQA 3IAZA 4ESXA 1ATGA 3M3FA 1QUKA 3W15C 1RYXA 5AA4A 4P0GA 3GBAA 2QS3A 4EQBA 4MX6A 2UYEA 3RT6B 4OESA 2QPQA 4NEDA 2XXWA 4G8HA 1NV7A 4RNSA 3D1RA 4PFTA 2OX3A 5I2KB 4NF5A 2OLBA 2FIEA 3O6HA 4P3LA 4U23A 5JTYB 2XX8A 2DWJA 4JWOA 1T0KA 5ET8A 3KBRA 3B8BA 4TLLB 1BLFA 1LLSA 4GWZA 4YU0A 5AA2D 4OA4A 3CHGA 5IZ3B 2HZLA 1DMBA 3BFUA 5EYGA 1FBEA 4G8NA 1RDXA 1MQGA 3IO4A 1ZJLA 3MWBA 4OVRA 5CMMA 5HPQA 5J16A 2D5WA 4TLMB 1IMBA 5EQ8A 3OOAA 1OVBA 3C33A 3G3JA 2CMOA 4MIJA 5KCJB 2QS1A 2OZZA 1B3EA 1N84A 3DP8A 3FXBA 4OTEA 1LAXA 3TUSA 3GZGA 3T22A 1FTLA 3L6GA 3EPEA 1URDA 4OHNA 2OWZA 4ZEFA 1Y9UA 5H8HA 4GXSB 2I0BA 3SEUA 3C32A 2GHAA 1DSNA 2P1SA 3K6VA 3TZAA 3G3FA 4N07A 4N91A 5CMKA 3MZ1A 3D4GA 3RPLA 4KQPA 5L9MA 1FBHA 3THIA 1LFGA 1FTMA 1FQAA 2Y5LA 3FGSA 4X48A 1A40A 4IGTA 3UIFA 3MVYA 3KSXA 3KZGA 3O6GA 1B7UA 2I49A 4QSEA 3Q27A 3I6VA 1O7TA 2WYKA 1M5DA 1VE4A 3EHUA 2Z8DA 3KC0A 1XT8A 3IFCA 1LCTA 2PFZA 4PC9A 3M3LA 1IMDA 1NV0A 3K6WA 3OO7A 2I48A 2VPOA 5CMBA 1A54A 2F3BA 4POWA 2DWHA 3OSQA 3RN8A 4XKRA 1FPLA 2B3BA 4Z7EA 2P2AA 2AL4A 2OCUA 4X8RA 3O28A 3HO7A 2F97A 4OMBA 2Q2CA 2YJPA 1S7YA 4GWUA 3MQ9A 2VD3A 3E79A 5ELVA 3HFUA 3PPNA 1JVYA 3PU5A 4H8IA 3V89B 2QS4A 1FPEA 1GTKA 5LDZA 4G4PA 1B52A 4FBPA 1XHYA 5TPAA 5I57A 4NF4B 3N6UA 4OVPA 4U21A 4NF6A 1IQ7A 2RCAA 1MY2A 3PMVA 2AIXA 3KN8A 1SW4A 4PE3A 1FBFA 3CG3A 2F3DA 4OEUA 2R71A 3TCGA 4HTGA 2OK2A 1SDXA 3SEVA 5DYHA 1FW0A 1JW4A 3F11A 4HW8A 4PFRA 4WEDA 1B2HA 3G3KA 1ZLQA 3LUZA 1MY3A 2X7PA 1L5TA 2VD2A 2O6AA 4F18A 5ET6A 1BKAA 3KSJA 5EQ9A 3T9HB 4JWYA 1FQBA 1EYJA 3IOVA 4P47A 1AMFA 4UABA 4GQOA 4F1YA 4YB6A 1MQDA 4ZEKA 3MVZA 2VGQA 3IJXB 4PCDA 1SYHA 3KGCA 1Y20A 5ICTA 4GBWA 4RA1A 1TWYA 4PDDA 1R9QA 5I7IA 3U93A 5ESYA 3HV1A 2HEUA 4QF9A 5AA4B 3H7MA 3S9LC 2DQVA 1B05A 4GWXA 1SI0A 1B58A 1JW1A 4PFUA 3VE1B 1S9TA 3FUZA 3S9MC 4NHBA 4C1TA 1MH3A 3ZKKA 5H8QA 1AOVA 1SI1A 4NF5B 3H6UA 1NV6A 4PAIA 2W7YA 2HXRA 2GFEA 3MJNA 4MMPA 1O63A 4GL0A 4XFEA 4NWDA 3OELA 3ISPA 3H06B 3CSBA 1FBCA 1RDZA 4DCYA 1FQEA 4RXLA 1GR2A 4KYSA 2OWTA 4KYEA 3RLFE 1FQFA 4Z0IA 3C9HA 1NKXA 2FVZA 4N6PA 4UA8A 3LSLA 1IMFA 5L9OA 4OVTA 3R7XA 4JDFA 3IFAA 1ZTYA 2VP1A 1ZKBA 1MS7A 3UORA 3PMWA 1H44A 3IK6B 5AA2A 4MNPA 2ONRA 2ZZVA 2ONSA 2XHDA 2I4BA 1R9LA 4JVCA 1MDP1 3SEYA 1F9BA 5DVIA 5H8HB 4F1VA 4H67A 1DPEA 1M5BA 2V84A 1ZU0A 3TYHA 3GLBA 4QFKA 1IXHA 3K4UA 4P56A 3RPLB 3SZPA 2QL3A 2AYSA 1JQFA 4BDQA 5I56A 1FRPA 2ZNTA 3OSRA 5T3JA 3FATA 2V3UA 2H9BA 4R9GA 1FTKA 4RJZA 4R75A 1K9ZA 2PBWA 2YPNA 4FEBA 4DI3D 5JEIA 1I6AA 1N7WA 1MY0A 3K02A 3U92A 1NV3A 1B1HA 4IO3A 3B6QA 3K1MA 1LSTA 3W9WA 1Q35A 4GWOA 1EU8A 4H5FA 4OQOA 5BWJA 3PGFA 2HAVA 3ODBA 3PD8A 2V4CA 2M8CA 4I3EA 4N6KA 1RYOA 3CG1A 4C0RA 3IL1B 4DCXA 1MQIA 4MF3A 3E4RA 5FTIA 4RY1A 1MXZA 3TODA 5I58A 5AA1A 5AA3A 5TPAB 5I57B 2G93A 2L5VA 4ZZEA 4M1VA 4NF6B 2I6EA 2JJKA 3BBRA 5M2VA 1MY1A 1MXWA 1FQDA 3CIJA 4PGNA 3OO6A 5CBRA 5CM6A 4G68A 4XKPA 1FPJA 2ZYOA 4QRZA 1Y3PA 1MPCA 1NFTA 1JVXA 1NI9A 3FV2A 3IJOB 1LBZA 4X1DA 3KG2A 3QYTA 1B46A 3RPWA 1D4NA 3QAXA 1FBGA 4GF8A 4NX1A 4H65A 1EZ9A 3H6WA 2B4LA 5KZTA 4X1BA 1LAHE 4C1UA 2F7BA 2Q88A 4OWDA 4QFNA 4GWWA 5ISUA 2O1MA 1MQHA 2PT2A 4HCYA 3DELB 1Z7ME 1IEJA 4HS7A 4M4GA 2Y84A 1INPA 4DDDA 2X7QA 3K00A 2CZKA 4XKQA 3S9NC 2P3NA 2O84X 3DM0A 2XXQA 4IB2A 3T1BA 4GBVA 4HCWA 5EQ7A 1SPIA 2Z8EA 4LQ5A 5FTHA 3IB0A 1MXXA 5ET7A 4MNIA 4F3SA 3A29A 3FVKA 2KLFA 2NUVA 3FV1A 2ZYKA 3PUZE 3FASA 4GXAA 1LB9A 1LBWA 4IGRA 1N0TA 3T66A 2ZNUA 5H8QB 1OVTA 3LC8A 2RF1A 1B5JA 4LZ5A 3WAFA 4KYDA 1JEUA 2Z23A 2WBBA 3N5LA 2OPEA 4PBHA 3VDFA 1D9YA 4OEVA 3KJTA 1IXCA 3TELA 2ZYMA 4EQ9A 2O68A 2ALUA 4PF6A 4PETA 2XA5A 2F78A 2OPDA 3USDA 2Z22A 2GQ1A 5IAIA 1SW1A 3R6UA 3RQTA 4ZEDA 1POY1 4F22A 1PB9A 2WBDA 4ELQA 1B3HA 5AA2B 3OD7A 4LUBA 2DS9A 2XWVA 2KR0A 2VPNA 4R9FA 5DEXA 3TTRA 4I9DA 4PFWA 2BJIA 2DXYA 3TCHA 3TEPA 1YYZA 1B3GA 2P3VA 1IMAA 1UTBB 3CSGA 3EKIA 3IB1A 3H6TA 1URGA 1N04A 3FXUA 3W9VA 4U1ZA 4RYAA 3E3KA 4RPNA 5I56B 3B6TA 4DE8A 1NUYA 3NOHA 4FEDA 4MFIA 3N94A 3MBPA 4EUOA 4HE0A 2H5YA 3FD3A 1POTA 4GX3A 1WODA 4N15A 1MDQA 1R6ZA 3LR1A 4ZZAA 1G0HA 1QULA 3TMGA 4BDRA 1BP5A 3T9UA 3PPOA 1AH5A 3QK6A 2Q9TA 1OLAA 1UTHA 1VSOA 1MPBA 3A09A 3U72A 2B4MA 4JVDA 5H8NA 4GWSA 2O7IA 1UIUA 1A7LA 1HSEA 4O3AA 1B4ZA 1KZ8A 2DXRA 3PD9A 5F24A 2PYYA 3K6XA 3FXRA 1PBPA 5F7VA 1NUXA 1FJ9A 5I58B 4ECFA 5IZ1A 1R1NA 3O6IA 2IA4A 2Q74A 4P1EA 1US5A 3EN3A 4GX4A 5AE4A 1D9VA 1DPPA 4MAGA 2F7AA 3K01A 1OMPA 3H03A 4G68B 4R2BA 2RCBA 1IZ1A 1SBPA 1B3LA 3PUVE 4FECA 1VFEA 1XVYA 1WDNA 3V83A 2RINA 1US4A 2AL5A 4KR5A 4JSDA
chains in the Genus database with same CATH topology
2CEYA 2DE4A 4PBQA 4DI4B 2QFLA 4N4UA 1IMFA 4PTKA 4OVTA 4F1UA 3IFAA 4H45A 3MSTA 2Q8MA 4MNPA 4MCOA 5IZZA 4QXDA 2ZZVA 1FTAA 4JVCA 1DBZA 2XXKA 1EYKA 4F1VA 4OANA 2F5XA 1NV4A 4N81A 4P56A 3RPLB 3SZPA 2HHMA 1FJ6A 3E78A 1FRPA 5T3JA 1FBDA 5IM2A 4N8YA 5I3SA 4PAKA 2VT5A 4NAPA 2HPGA 1K9ZA 4NQ8A 4DI3D 1FPDA 1YZ0A 5JK4A 2PCRA 1NV3A 4P9KA 4O8MA 1NV5A 1BK4A 1EYIA 3W9WA 4MEVA 1IMCA 4I3YA 4N6DA 2ZZXA 2QVVA 2V4CA 4I3EA 4N6KA 1LBXA 1FPBA 2CEXA 4MX6A 4HE2A 2QPQA 3ROJA 4X04A 1NV7A 1CNQA 4PGPA 3D1RA 2L5VA 3BIHA 1NUZA 5IGAA 4M1VA 5J1DA 2OX3A 2JJKA 2FIEA 4P3LA 5ET8A 1FSAA 3B8BA 4PGNA 4GWZA 5CM6A 4PFBA 4OA4A 1FPJA 3CHGA 5EYHA 4PFIA 1FPIA 5IZ3B 2HZLA 1DCUA 1DK4A 1NI9A 4PF8A 5EYGA 1FBEA 1RDXA 2FIXA 3B50A 1LBZA 4OVRA 5J16A 1FBGA 5A5LA 4NX1A 1IMBA 2V3QA 5EQ8A 1NV2A 4PAFA 5I5PA 2B4LA 4MIJA 4GWWA 2PFYA 3FXBA 4HCYA 3PTYA 1FPGA 2DE2A 1YXIA 4AS4A 2OWZA 4NN3A 1INPA 2HZKA 5DW8A 2CZKA 2WEFA 1LBVA 1JP4A 1FBPA 1LEVA 2ZZWA 4N91A 2P3NA 1VDWA 3RPLA 3T1BA 4GX6A 1FBHA 4GBVA 4AS5A 4HCWA 5EQ7A 2DVZA 1SPIA 2Y5LA 5ET7A 4MNIA 1D9QA 3A29A 2DDKA 1LBWA 4MNCA 1IMEA 2WYKA 2MKZA 3KC0A 3IFCA 4NG7A 2PFZA 2XWKA 4PC9A 2R8TA 1IMDA 1NV0A 5LTCA 4LN5A 4YICA 2VPOA 2WBBA 4PBHA 2F3BA 3QMFA 5ET5A 4G61A 1FPLA 4IR8A 1KA0A 4NF0A 4X8RA 4OVQA 4PF6A 3BIGA 4PETA 2XA5A 4QBAA 4GWUA 1KA1A 3E79A 3HFUA 4O94A 1XI6A 1FPFA 4GWYA 2GQ1A 4H46A 1LBYA 1FPEA 5LDZA 2WYPA 4FBPA 5EQAA 2WBDA 1NUWA 4OVPA 3RYDA 3GYYA 2XWVA 2KR0A 3KC1A 2VPNA 2BJIA 2Y5KA 4PE3A 1FBFA 1K9YA 3FBPA 1YYZA 1QGXA 2F3DA 2P3VA 4NGUA 1IMAA 5IZ3A 4YZZA 3EKIA 4P8BA 3T0JA 3W9VA 4PFRA 4OVSA 4N17A 2FBPA 1NUYA 2CZIA 3NOHA 3LUZA 2XWIA 3U65A 4F18A 5ET6A 2QVRA 2QVUA 1NV1A 2CZHA 5EQ9A 4HE0A 3MYUA 1RDYA 2DE3A 4GX3A 4HE1A 4N15A 1EYJA 4JVIA 4P47A 1G0HA 4UABA 4XF5A 4MHFA 1Q9DA 4PCDA 4MJOA 4GBWA 4PDDA 4XEQA 2XWOA 4I40A 2FHYA 2Q9TA 5I7IA 5ESYA 2B4MA 2WX9A 5FBPA 4O7MA 4JVDA 4HXVA 4GWSA 3LV0A 4O7IA 4GWXA 1KZ8A 5F24A 4PDHA 4NHBA 1NUXA 1FJ9A 5IZ1A 1G0IA 2Q74A 4P1EA 4P1LA 1NV6A 4GX4A 4PAIA 3KBZA 2HXRA 4MMPA 4N8GA 4MAGA 2KQZA 4F19A 4XFEA 1AWBA 3ISPA 1FBCA 1RDZA 1FPKA 4KXPA 4X9TA 2FVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AS5 A;  5EQ7 A;  1SPI A;  2Y5L A;  1FPB A;  2QFL A;  5ET7 A;  1IMF A;  4PTK A;  1D9Q A;  2FBP A;  1NUY A;  4HE2 A;  2CZI A;  3A29 A;  3LUZ A;  2DDK A;  5ET6 A;  2QVR A;  3IFA A;  3ROJ A;  2QVU A;  1NV1 A;  2CZH A;  1LBW A;  5EQ9 A;  4HE0 A;  1IME A;  4H45 A;  1RDY A;  1NV7 A;  1CNQ A;  4GX3 A;  3D1R A;  3BIH A;  3KC0 A;  4HE1 A;  2Q8M A;  3IFC A;  1NUZ A;  1EYJ A;  2OX3 A;  2R8T A;  4QXD A;  1IMD A;  1G0H A;  2FIE A;  2JJK A;  1FTA A;  1NV0 A;  1Q9D A;  5ET8 A;  1FSA A;  3B8B A;  1DBZ A;  2WBB A;  4MJO A;  2F3B A;  4GWZ A;  1EYK A;  3QMF A;  5ET5 A;  1FPJ A;  4GBW A;  4G61 A;  5EYH A;  1FPL A;  1FPI A;  5IZ3 B;  4IR8 A;  1NV4 A;  1DCU A;  1DK4 A;  1KA0 A;  4I40 A;  4GBV A;  1NI9 A;  2FHY A;  1FBE A;  4N81 A;  5EYG A;  1RDX A;  2FIX A;  5ESY A;  3RPL B;  2HHM A;  3BIG A;  1LBZ A;  1FJ6 A;  5FBP A;  4GWU A;  4HXV A;  1KA1 A;  5J16 A;  1XI6 A;  1FBG A;  1FPF A;  4GWS A;  4GWY A;  3LV0 A;  5A5L A;  1FRP A;  4O7I A;  2GQ1 A;  1IMB A;  4H46 A;  5T3J A;  1FBD A;  5EQ8 A;  1NV2 A;  1LBY A;  4GWX A;  1KZ8 A;  5I3S A;  5F24 A;  1FPE A;  2VT5 A;  5LDZ A;  1NUX A;  1FJ9 A;  4FBP A;  5EQA A;  4GWW A;  2WBD A;  1K9Z A;  1NUW A;  5IZ1 A;  1G0I A;  3T0J A;  3RYD A;  2Q74 A;  1FPG A;  1FPD A;  1YZ0 A;  1NV6 A;  1YXI A;  3KC1 A;  4GX4 A;  3KBZ A;  4AS4 A;  2OWZ A;  2BJI A;  2Y5K A;  2PCR A;  1NV3 A;  1FBF A;  1K9Y A;  3FBP A;  1NV5 A;  1INP A;  1YYZ A;  1QGX A;  1BK4 A;  2F3D A;  5DW8 A;  2CZK A;  2P3V A;  1EYI A;  2WEF A;  1IMA A;  1IMC A;  1AWB A;  5IZ3 A;  1LBV A;  1JP4 A;  1FBP A;  1LEV A;  4I3Y A;  1FBC A;  1RDZ A;  2P3N A;  1VDW A;  2QVV A;  3RPL A;  1FPK A;  4KXP A;  4I3E A;  4GX6 A;  1LBX A;  1FBH A;  2FVZ A; 
#chains in the Genus database with same CATH topology
 2DE4 A;  4JSO A;  4GOT A;  2QFL A;  3L6H A;  4N4U A;  4PTK A;  3RNN A;  3K1P A;  4F1U A;  4XXU A;  3FVN A;  3KN7 A;  5EYF A;  4H45 A;  2VHA A;  3HHG A;  3M3K A;  4MLQ A;  4YAH X;  2Q8M A;  4FJP A;  4ESW A;  4MCO A;  3EHS A;  1B7H A;  1Y4C A;  3EF7 A;  1DBZ A;  3Q29 A;  3O29 A;  4ISU A;  1EYK A;  2ESN A;  3HN0 A;  1OLC A;  3IB2 A;  4H6D A;  4OAN A;  2XXR A;  2RKM A;  1BTJ A;  5HM4 B;  1Z7N E;  3OMB A;  1QKA A;  5A5X A;  1Y3N A;  1FJ6 A;  1AL3 A;  3U8Q A;  4UAC A;  3E78 A;  3KJ7 A;  1FBD A;  5IM2 A;  1UQW A;  5I3S A;  4THI A;  4JBZ A;  4GIZ A;  4PAK A;  2VT5 A;  2F36 A;  2RC9 A;  3RY3 A;  4U1O A;  4DIG A;  4LON B;  2F6P A;  4NQ8 A;  4I1D A;  1NMU A;  3AXF A;  1YZ0 A;  3FIR A;  4OVJ A;  3OO9 A;  4GLI A;  1NL5 A;  1GVC A;  1N76 A;  1NV5 A;  2XXY A;  3CRB A;  2NXO A;  3LBS A;  1B6H A;  1QKB A;  4QSD A;  4TQU Q;  1TFA A;  1TFD A;  4EDP A;  1LBX A;  3H3G A;  1QJM A;  3SEX A;  3S2V A;  1FPB A;  4F3P A;  4R73 A;  1JNF A;  3IR1 A;  3S4U A;  1ZIU A;  2PVU A;  1MQJ A;  3ROJ A;  1Y4T A;  3SDF A;  3TCF A;  4PE5 B;  1CNQ A;  4PGP A;  4FAT A;  2BJJ X;  1NUZ A;  5J1D A;  1B5H A;  4DXC A;  4MLV A;  5DEX B;  1I6Q A;  4NTL A;  1FSA A;  2Z8F A;  3ZSF A;  4DZ1 A;  4PFB A;  5K2X A;  1MM6 A;  1ELJ A;  1B0L A;  4PFI A;  1FPI A;  4ZS9 A;  3FJM A;  1DCU A;  2GRV A;  1DK4 A;  4PF8 A;  3TTN A;  1CB6 A;  2FYI A;  3LSF B;  3B50 A;  1B4H A;  4H8J A;  3SER A;  3MPK A;  2O1L A;  2I3V A;  2RC8 A;  1H76 A;  3H4Z A;  3Q28 A;  2YLN A;  4WEP A;  4KD5 A;  1ZBM A;  2I0C A;  3H6V A;  3GXA A;  1UTB A;  2PFY A;  3UN6 A;  1FPG A;  3IX1 A;  4NN3 A;  3OEK A;  2ZNS A;  4FAJ A;  2DVC A;  3VFJ A;  1LCF A;  4P11 A;  4KCD A;  4IO6 A;  2HZK A;  5DW8 A;  1EZP A;  2WEF A;  5DTB A;  4R6K A;  1JP4 A;  1LEV A;  2ZZW A;  3O66 A;  1D3K A;  2Y7K A;  1B32 A;  4LVQ A;  3SET A;  1P1O A;  1VDW A;  1M5F A;  3RTF B;  5ITP A;  3N26 A;  1UTH B;  3G3I A;  4QFL A;  2QMW A;  4AS5 A;  2DVZ A;  2G29 A;  2I4C A;  4LA9 A;  5H8N B;  3OXN A;  4F2Q A;  1NNF A;  4PFY A;  1SVX B;  3TQW A;  4JWX A;  1MM7 A;  3M8U A;  1H3D A;  4MNC A;  4H5G A;  1BIY A;  1IME A;  2MKZ A;  3R26 A;  3UK4 A;  3FXQ A;  1A8F A;  2Y7W A;  2XWK A;  2NWJ A;  2QS2 A;  4AB5 A;  3CI8 A;  3O9P A;  5EHS A;  4YIC A;  3OEN A;  2E1S A;  3QMF A;  4ND9 A;  3LSX A;  1ZMG A;  4NWC A;  5FHM A;  4IR8 A;  1XC1 A;  4OER A;  4YB7 A;  1FQC A;  4N13 A;  3DLN A;  4QBA A;  1MXU A;  3BKI B;  1FPF A;  4YMB A;  4GWY A;  3TTK A;  2HCA A;  3G3G A;  4H46 A;  3G3H A;  4BDN A;  3C31 A;  1LBY A;  1MG1 A;  3CFL A;  1LBB A;  2D21 A;  1MXV A;  2FA7 A;  3K1N A;  5EQA A;  3MVX A;  1NUW A;  4H0W A;  1P1N A;  2XD2 A;  3RYD A;  4U2R A;  3SKP A;  1VR5 A;  3GYY A;  3KC1 A;  1M5E A;  1Y1M A;  3T93 B;  3T9X B;  5I2N A;  5L8D A;  4YKI A;  1K9Y A;  3FBP A;  2V93 A;  1QGX A;  2XXU A;  3OO8 A;  2XXT A;  5TP9 A;  4YZZ A;  1Q1K A;  2HFB A;  4OXV A;  2A5S A;  5A5X B;  3N6T A;  3FZV A;  1B51 A;  1OIB A;  2FBP A;  3P7I A;  2CZI A;  2QRY A;  3O2A A;  5DT6 A;  2QVR A;  3DP4 A;  2ANJ A;  2CZH A;  1PC3 A;  1NH8 A;  3MYU A;  1RDY A;  1LFH A;  4HE1 A;  4JB7 A;  3ZKL A;  4JVI A;  2DWA A;  3PPR A;  4MHF A;  3FJ7 A;  2CZL A;  1B40 A;  4BDO A;  4GFR A;  1ANF A;  2PX1 A;  4GD5 A;  4MJO A;  3C35 A;  4XKN A;  3PPP A;  4I40 A;  5ICQ A;  4I8C A;  1SW5 A;  3G7W A;  4ZE8 A;  2E0S A;  1IXG A;  1QUI A;  2XX7 A;  5I84 A;  2OBG A;  4O7I A;  3HHF A;  2I3W A;  5L9S A;  4DLD A;  2UVI A;  3RGY A;  2F7C A;  2DSF A;  3VV5 A;  3LSW A;  4XIG Q;  1G0I A;  3I3V A;  4PP0 A;  3UP9 A;  5LOM A;  4P1L A;  3HST A;  2H4I A;  2I58 A;  3SEW A;  1DTG A;  1DTZ A;  3CVG A;  4YKP A;  1B1X A;  2KQZ A;  4F19 A;  3S9E A;  1AWB A;  1TXF A;  1DOT A;  4ZEC A;  1IIW A;  3VLV A;  1FPK A;  4KXP A;  3C36 A;  2CEY A;  3UA8 A;  4PBQ A;  1USY E;  2D3I A;  2Y7R A;  4IO4 A;  4U4X A;  2Y7P A;  3TKD A;  3A3C A;  1Y1Z A;  2Q89 A;  3T96 B;  1B3F A;  5DVF A;  1PDA A;  1MH4 A;  4RK2 A;  2GHB A;  2UVG A;  1HSL A;  5IZZ A;  5KDT A;  1FTA A;  5TU0 A;  5BUU A;  3ILU B;  4ZEB A;  1I6B A;  1AIV A;  2XXK A;  2H98 A;  3JV9 A;  4F3G A;  2A5T A;  3VVD A;  3TFL A;  4E0X A;  1QVS A;  4JXI A;  3MP1 A;  3FJG A;  3KEI A;  3MP6 A;  1PBQ A;  2XXH A;  1WVJ A;  4N8Y A;  1URS A;  1OQH A;  4KHZ E;  2PMS A;  2R6G E;  3C4M A;  2HPG A;  1B5I A;  4RPO A;  1S50 A;  3TQL A;  2LAO A;  3U94 A;  1P1W A;  4EXL A;  4ZE9 A;  4K3F A;  2PCR A;  3EQ1 A;  4R2F A;  5DVJ A;  1NNP A;  1FTJ A;  4Q8R A;  1EYI A;  3MP8 A;  4ELO A;  1J1N A;  4R6H A;  1LB8 A;  3MVW A;  3ONM A;  1XVX A;  1XOC A;  4NE4 A;  3MZB A;  2ZZX A;  2QVV A;  2DWI A;  4YKJ A;  1B9J A;  4NF8 B;  3Q25 A;  4FE8 A;  2CEX A;  1NNK A;  4HE2 A;  1KWH A;  5FHN A;  1JET A;  5F1Q A;  2HQ0 A;  3VVE A;  4KFQ A;  4XTC Q;  3IOU A;  3MC2 A;  4X04 A;  1LAF E;  2UXA A;  3O97 A;  1GGG A;  2UVJ A;  4YB5 A;  4ZEI A;  2Q8J A;  3ILT B;  1YTV A;  3BIH A;  2F35 A;  3VXB A;  5IGA A;  3KN3 A;  4FIM A;  2HAU A;  4P0I A;  4BLA A;  1A55 A;  4FOR A;  5I2N B;  3E9X A;  4EQ7 A;  4GL8 A;  4G8M A;  2REG A;  2XXV A;  4TOZ A;  4GVO A;  2REJ A;  3QUF A;  1N3W A;  5EYH A;  2XX9 A;  2V25 A;  5TP9 B;  5CI5 A;  2IEE A;  2H99 A;  4OEN A;  4NMY A;  5IKB A;  2FIX A;  3JZJ A;  3I5O A;  2H25 A;  4KPT A;  2O51 A;  1RKM A;  4ELR A;  5A5L A;  2RC7 A;  2NOO A;  1SQY A;  3QSL A;  1NNT A;  2V3Q A;  1NV2 A;  4PAF A;  5ITO A;  5I5P A;  1MRP A;  2O69 A;  2XD3 A;  4R72 A;  3LUY A;  3HPI A;  3PTY A;  2THI A;  2DE2 A;  5H8F A;  1YXI A;  4AS4 A;  1GV8 A;  3TAJ A;  4G77 A;  1LBV A;  1FBP A;  3TPA A;  5B7D A;  1B7Z A;  1YAE A;  3OEM A;  5EHM A;  4YKK A;  3A3U A;  4GX6 A;  5B70 A;  3JYR A;  4LZ7 A;  4QFO A;  2WKY A;  1O64 A;  5I59 A;  1D9Q A;  4U4S A;  2DDK A;  4IO2 A;  1Y3Q A;  3K6U A;  2UYF A;  4KI0 E;  3SES A;  1MXY A;  4NG7 A;  2R8T A;  1II5 A;  5LTC A;  4LN5 A;  3U1O A;  2B65 A;  1SW2 A;  2DP8 A;  2QJE A;  1LFI A;  1EZO A;  3IOW A;  5ET5 A;  2XXP A;  4G61 A;  2PT1 A;  2F34 A;  3HCQ A;  1B0H A;  3FVG A;  1KA0 A;  1QW0 A;  4NF0 A;  4F29 A;  1IIT A;  4OVQ A;  3MZ9 A;  2F6G A;  3BIG A;  2XXI A;  3TDJ A;  1KA1 A;  4O94 A;  1XI6 A;  2Y7I A;  4LQ2 A;  2X26 A;  3KOT A;  3K0V A;  4WKM A;  2ONK E;  3MW0 A;  2FNC A;  4E0W A;  2WYP A;  1A99 A;  1M5C A;  2ZXT A;  3E13 X;  4DXB A;  1YCJ A;  5I2K A;  1UIV A;  3MUQ A;  5H8S A;  3GBB A;  5JTY A;  3QXM A;  5KDT B;  4OYV A;  4OZ9 A;  1LGB C;  3VVF A;  2Y5K A;  4AB6 A;  5K2Y A;  5CRY A;  2NVU B;  2UVH A;  4Q30 B;  3UGW A;  4NGU A;  4OET A;  4DXU A;  5IZ3 A;  2O7U A;  2QMX A;  2A5T B;  4QHQ A;  4P8B A;  3B6W A;  3IOT A;  4F3B A;  5CMC A;  1FCK A;  3T0J A;  1IXI A;  1P1U A;  4OVS A;  4N17 A;  3D4C A;  2XWI A;  3U65 A;  4BDM A;  3CR9 A;  2QVU A;  2Q2A A;  3CFZ A;  1NV1 A;  3VXC A;  2DE3 A;  5KCJ A;  1SYI A;  4G2Z A;  5CC2 A;  1YPN A;  3ECR A;  2DOJ A;  4XF5 A;  4OFJ A;  4ONY A;  1Q9D A;  4IY5 A;  4YMA A;  4MBP A;  4R6Y A;  3PUX E;  3MPL A;  3FVO A;  4LP2 B;  4XEQ A;  2XWO A;  1LBC A;  2FHY A;  3MAM A;  1H43 A;  3DP6 A;  4X9T A;  3RTW B;  2QSX A;  2WX9 A;  5FBP A;  4O7M A;  4HXV A;  1JW5 A;  3T9V A;  1JEV A;  3LV0 A;  1LAG E;  4OFO A;  1P99 A;  3V5A A;  1TT1 A;  2HXW A;  4PDH A;  4LZ8 A;  1PEB A;  2V3T A;  3PMX A;  2F8D A;  3PV0 E;  3VLW A;  5CBS A;  3KBZ A;  4NF8 A;  1XS5 A;  4U22 A;  3Q26 A;  3ZS6 A;  3PUW E;  2DYX A;  4N8G A;  4AQ4 A;  4F2O A;  4F31 B;  3IOR A;  4G68 C;  1HSJ A;  4EXK A;  4I62 A;  1CE2 A;  3KOS A;  4QFP A;  3BFT A;  3RT8 A;  5HBC A;  2OWS A;  1I69 A;  4ZDM A;  4IO5 A;  1NH7 A;  4Q0C A;  4H1X A;  4DI4 B;  4IY6 A;  2P0S A;  1MPD A;  3K2D A;  4GRK A;  3V8X B;  2ABH A;  3MST A;  1SD3 A;  4NF4 A;  4PQJ A;  2R9J A;  1PB7 A;  1N3X A;  4QXD A;  4OFL A;  3KFM A;  4IO7 A;  5H8F B;  3B7D A;  4O3B A;  5FHO A;  3TTM A;  3RUM A;  1PB8 A;  2F5X A;  4KCC A;  4Q5T A;  1NV4 A;  3WAE A;  4N81 A;  1P1Q A;  3VLU A;  3IO6 A;  2HHM A;  2ZMB A;  4EF1 A;  1A8E A;  3QIM A;  1EH3 A;  4R74 A;  5I59 B;  4F39 A;  3TTL A;  4LAT A;  3PUY E;  4MH5 A;  2OJT A;  1USY H;  2VOZ A;  4NAP A;  1MY4 A;  4QSC A;  4EF2 A;  2GH9 A;  1FPD A;  4BDL A;  1VFD A;  3QUJ A;  2B3F A;  5JK4 A;  1H45 A;  4O3C A;  4P9K A;  4RK9 A;  4O8M A;  2XXX A;  3C34 A;  1BK4 A;  1N7X A;  4POX A;  3EHT A;  2ZYN A;  1OQG A;  4MEV A;  4L17 A;  4WXJ A;  1IMC A;  1FTO A;  4I3Y A;  1QUJ A;  4N6D A;  4ELP A;  1IUD A;  3CFX A;  3PPQ A;  3IAZ A;  4ESX A;  1ATG A;  3M3F A;  1QUK A;  3W15 C;  1RYX A;  5AA4 A;  4P0G A;  3GBA A;  2QS3 A;  4EQB A;  4MX6 A;  2UYE A;  3RT6 B;  4OES A;  2QPQ A;  4NED A;  2XXW A;  4G8H A;  1NV7 A;  4RNS A;  3D1R A;  4PFT A;  2OX3 A;  5I2K B;  4NF5 A;  2OLB A;  2FIE A;  3O6H A;  4P3L A;  4U23 A;  5JTY B;  2XX8 A;  2DWJ A;  4JWO A;  1T0K A;  5ET8 A;  3KBR A;  3B8B A;  4TLL B;  1BLF A;  1LLS A;  4GWZ A;  4YU0 A;  5AA2 D;  4OA4 A;  3CHG A;  5IZ3 B;  2HZL A;  1DMB A;  3BFU A;  5EYG A;  1FBE A;  4G8N A;  1RDX A;  1MQG A;  3IO4 A;  1ZJL A;  3MWB A;  4OVR A;  5CMM A;  5HPQ A;  5J16 A;  2D5W A;  4TLM B;  1IMB A;  5EQ8 A;  3OOA A;  1OVB A;  3C33 A;  3G3J A;  2CMO A;  4MIJ A;  5KCJ B;  2QS1 A;  2OZZ A;  1B3E A;  1N84 A;  3DP8 A;  3FXB A;  4OTE A;  1LAX A;  3TUS A;  3GZG A;  3T22 A;  1FTL A;  3L6G A;  3EPE A;  1URD A;  4OHN A;  2OWZ A;  4ZEF A;  1Y9U A;  5H8H A;  4GXS B;  2I0B A;  3SEU A;  3C32 A;  2GHA A;  1DSN A;  2P1S A;  3K6V A;  3TZA A;  3G3F A;  4N07 A;  4N91 A;  5CMK A;  3MZ1 A;  3D4G A;  3RPL A;  4KQP A;  5L9M A;  1FBH A;  3THI A;  1LFG A;  1FTM A;  1FQA A;  2Y5L A;  3FGS A;  4X48 A;  1A40 A;  4IGT A;  3UIF A;  3MVY A;  3KSX A;  3KZG A;  3O6G A;  1B7U A;  2I49 A;  4QSE A;  3Q27 A;  3I6V A;  1O7T A;  2WYK A;  1M5D A;  1VE4 A;  3EHU A;  2Z8D A;  3KC0 A;  1XT8 A;  3IFC A;  1LCT A;  2PFZ A;  4PC9 A;  3M3L A;  1IMD A;  1NV0 A;  3K6W A;  3OO7 A;  2I48 A;  2VPO A;  5CMB A;  1A54 A;  2F3B A;  4POW A;  2DWH A;  3OSQ A;  3RN8 A;  4XKR A;  1FPL A;  2B3B A;  4Z7E A;  2P2A A;  2AL4 A;  2OCU A;  4X8R A;  3O28 A;  3HO7 A;  2F97 A;  4OMB A;  2Q2C A;  2YJP A;  1S7Y A;  4GWU A;  3MQ9 A;  2VD3 A;  3E79 A;  5ELV A;  3HFU A;  3PPN A;  1JVY A;  3PU5 A;  4H8I A;  3V89 B;  2QS4 A;  1FPE A;  1GTK A;  5LDZ A;  4G4P A;  1B52 A;  4FBP A;  1XHY A;  5TPA A;  5I57 A;  4NF4 B;  3N6U A;  4OVP A;  4U21 A;  4NF6 A;  1IQ7 A;  2RCA A;  1MY2 A;  3PMV A;  2AIX A;  3KN8 A;  1SW4 A;  4PE3 A;  1FBF A;  3CG3 A;  2F3D A;  4OEU A;  2R71 A;  3TCG A;  4HTG A;  2OK2 A;  1SDX A;  3SEV A;  5DYH A;  1FW0 A;  1JW4 A;  3F11 A;  4HW8 A;  4PFR A;  4WED A;  1B2H A;  3G3K A;  1ZLQ A;  3LUZ A;  1MY3 A;  2X7P A;  1L5T A;  2VD2 A;  2O6A A;  4F18 A;  5ET6 A;  1BKA A;  3KSJ A;  5EQ9 A;  3T9H B;  4JWY A;  1FQB A;  1EYJ A;  3IOV A;  4P47 A;  1AMF A;  4UAB A;  4GQO A;  4F1Y A;  4YB6 A;  1MQD A;  4ZEK A;  3MVZ A;  2VGQ A;  3IJX B;  4PCD A;  1SYH A;  3KGC A;  1Y20 A;  5ICT A;  4GBW A;  4RA1 A;  1TWY A;  4PDD A;  1R9Q A;  5I7I A;  3U93 A;  5ESY A;  3HV1 A;  2HEU A;  4QF9 A;  5AA4 B;  3H7M A;  3S9L C;  2DQV A;  1B05 A;  4GWX A;  1SI0 A;  1B58 A;  1JW1 A;  4PFU A;  3VE1 B;  1S9T A;  3FUZ A;  3S9M C;  4NHB A;  4C1T A;  1MH3 A;  3ZKK A;  5H8Q A;  1AOV A;  1SI1 A;  4NF5 B;  3H6U A;  1NV6 A;  4PAI A;  2W7Y A;  2HXR A;  2GFE A;  3MJN A;  4MMP A;  1O63 A;  4GL0 A;  4XFE A;  4NWD A;  3OEL A;  3ISP A;  3H06 B;  3CSB A;  1FBC A;  1RDZ A;  4DCY A;  1FQE A;  4RXL A;  1GR2 A;  4KYS A;  2OWT A;  4KYE A;  3RLF E;  1FQF A;  4Z0I A;  3C9H A;  1NKX A;  2FVZ A;  4N6P A;  4UA8 A;  3LSL A;  1IMF A;  5L9O A;  4OVT A;  3R7X A;  4JDF A;  3IFA A;  1ZTY A;  2VP1 A;  1ZKB A;  1MS7 A;  3UOR A;  3PMW A;  1H44 A;  3IK6 B;  5AA2 A;  4MNP A;  2ONR A;  2ZZV A;  2ONS A;  2XHD A;  2I4B A;  1R9L A;  4JVC A;  1MDP 1;  3SEY A;  1F9B A;  5DVI A;  5H8H B;  4F1V A;  4H67 A;  1DPE A;  1M5B A;  2V84 A;  1ZU0 A;  3TYH A;  3GLB A;  4QFK A;  1IXH A;  3K4U A;  4P56 A;  3RPL B;  3SZP A;  2QL3 A;  2AYS A;  1JQF A;  4BDQ A;  5I56 A;  1FRP A;  2ZNT A;  3OSR A;  5T3J A;  3FAT A;  2V3U A;  2H9B A;  4R9G A;  1FTK A;  4RJZ A;  4R75 A;  1K9Z A;  2PBW A;  2YPN A;  4FEB A;  4DI3 D;  5JEI A;  1I6A A;  1N7W A;  1MY0 A;  3K02 A;  3U92 A;  1NV3 A;  1B1H A;  4IO3 A;  3B6Q A;  3K1M A;  1LST A;  3W9W A;  1Q35 A;  4GWO A;  1EU8 A;  4H5F A;  4OQO A;  5BWJ A;  3PGF A;  2HAV A;  3ODB A;  3PD8 A;  2V4C A;  2M8C A;  4I3E A;  4N6K A;  1RYO A;  3CG1 A;  4C0R A;  3IL1 B;  4DCX A;  1MQI A;  4MF3 A;  3E4R A;  5FTI A;  4RY1 A;  1MXZ A;  3TOD A;  5I58 A;  5AA1 A;  5AA3 A;  5TPA B;  5I57 B;  2G93 A;  2L5V A;  4ZZE A;  4M1V A;  4NF6 B;  2I6E A;  2JJK A;  3BBR A;  5M2V A;  1MY1 A;  1MXW A;  1FQD A;  3CIJ A;  4PGN A;  3OO6 A;  5CBR A;  5CM6 A;  4G68 A;  4XKP A;  1FPJ A;  2ZYO A;  4QRZ A;  1Y3P A;  1MPC A;  1NFT A;  1JVX A;  1NI9 A;  3FV2 A;  3IJO B;  1LBZ A;  4X1D A;  3KG2 A;  3QYT A;  1B46 A;  3RPW A;  1D4N A;  3QAX A;  1FBG A;  4GF8 A;  4NX1 A;  4H65 A;  1EZ9 A;  3H6W A;  2B4L A;  5KZT A;  4X1B A;  1LAH E;  4C1U A;  2F7B A;  2Q88 A;  4OWD A;  4QFN A;  4GWW A;  5ISU A;  2O1M A;  1MQH A;  2PT2 A;  4HCY A;  3DEL B;  1Z7M E;  1IEJ A;  4HS7 A;  4M4G A;  2Y84 A;  1INP A;  4DDD A;  2X7Q A;  3K00 A;  2CZK A;  4XKQ A;  3S9N C;  2P3N A;  2O84 X;  3DM0 A;  2XXQ A;  4IB2 A;  3T1B A;  4GBV A;  4HCW A;  5EQ7 A;  1SPI A;  2Z8E A;  4LQ5 A;  5FTH A;  3IB0 A;  1MXX A;  5ET7 A;  4MNI A;  4F3S A;  3A29 A;  3FVK A;  2KLF A;  2NUV A;  3FV1 A;  2ZYK A;  3PUZ E;  3FAS A;  4GXA A;  1LB9 A;  1LBW A;  4IGR A;  1N0T A;  3T66 A;  2ZNU A;  5H8Q B;  1OVT A;  3LC8 A;  2RF1 A;  1B5J A;  4LZ5 A;  3WAF A;  4KYD A;  1JEU A;  2Z23 A;  2WBB A;  3N5L A;  2OPE A;  4PBH A;  3VDF A;  1D9Y A;  4OEV A;  3KJT A;  1IXC A;  3TEL A;  2ZYM A;  4EQ9 A;  2O68 A;  2ALU A;  4PF6 A;  4PET A;  2XA5 A;  2F78 A;  2OPD A;  3USD A;  2Z22 A;  2GQ1 A;  5IAI A;  1SW1 A;  3R6U A;  3RQT A;  4ZED A;  1POY 1;  4F22 A;  1PB9 A;  2WBD A;  4ELQ A;  1B3H A;  5AA2 B;  3OD7 A;  4LUB A;  2DS9 A;  2XWV A;  2KR0 A;  2VPN A;  4R9F A;  5DEX A;  3TTR A;  4I9D A;  4PFW A;  2BJI A;  2DXY A;  3TCH A;  3TEP A;  1YYZ A;  1B3G A;  2P3V A;  1IMA A;  1UTB B;  3CSG A;  3EKI A;  3IB1 A;  3H6T A;  1URG A;  1N04 A;  3FXU A;  3W9V A;  4U1Z A;  4RYA A;  3E3K A;  4RPN A;  5I56 B;  3B6T A;  4DE8 A;  1NUY A;  3NOH A;  4FED A;  4MFI A;  3N94 A;  3MBP A;  4EUO A;  4HE0 A;  2H5Y A;  3FD3 A;  1POT A;  4GX3 A;  1WOD A;  4N15 A;  1MDQ A;  1R6Z A;  3LR1 A;  4ZZA A;  1G0H A;  1QUL A;  3TMG A;  4BDR A;  1BP5 A;  3T9U A;  3PPO A;  1AH5 A;  3QK6 A;  2Q9T A;  1OLA A;  1UTH A;  1VSO A;  1MPB A;  3A09 A;  3U72 A;  2B4M A;  4JVD A;  5H8N A;  4GWS A;  2O7I A;  1UIU A;  1A7L A;  1HSE A;  4O3A A;  1B4Z A;  1KZ8 A;  2DXR A;  3PD9 A;  5F24 A;  2PYY A;  3K6X A;  3FXR A;  1PBP A;  5F7V A;  1NUX A;  1FJ9 A;  5I58 B;  4ECF A;  5IZ1 A;  1R1N A;  3O6I A;  2IA4 A;  2Q74 A;  4P1E A;  1US5 A;  3EN3 A;  4GX4 A;  5AE4 A;  1D9V A;  1DPP A;  4MAG A;  2F7A A;  3K01 A;  1OMP A;  3H03 A;  4G68 B;  4R2B A;  2RCB A;  1IZ1 A;  1SBP A;  1B3L A;  3PUV E;  4FEC A;  1VFE A;  1XVY A;  1WDN A;  3V83 A;  2RIN A;  1US4 A;  2AL5 A;  4KR5 A;  4JSD A; 
#chains in the Genus database with same CATH homology
 2CEY A;  2DE4 A;  4PBQ A;  4DI4 B;  2QFL A;  4N4U A;  1IMF A;  4PTK A;  4OVT A;  4F1U A;  3IFA A;  4H45 A;  3MST A;  2Q8M A;  4MNP A;  4MCO A;  5IZZ A;  4QXD A;  2ZZV A;  1FTA A;  4JVC A;  1DBZ A;  2XXK A;  1EYK A;  4F1V A;  4OAN A;  2F5X A;  1NV4 A;  4N81 A;  4P56 A;  3RPL B;  3SZP A;  2HHM A;  1FJ6 A;  3E78 A;  1FRP A;  5T3J A;  1FBD A;  5IM2 A;  4N8Y A;  5I3S A;  4PAK A;  2VT5 A;  4NAP A;  2HPG A;  1K9Z A;  4NQ8 A;  4DI3 D;  1FPD A;  1YZ0 A;  5JK4 A;  2PCR A;  1NV3 A;  4P9K A;  4O8M A;  1NV5 A;  1BK4 A;  1EYI A;  3W9W A;  4MEV A;  1IMC A;  4I3Y A;  4N6D A;  2ZZX A;  2QVV A;  2V4C A;  4I3E A;  4N6K A;  1LBX A;  1FPB A;  2CEX A;  4MX6 A;  4HE2 A;  2QPQ A;  3ROJ A;  4X04 A;  1NV7 A;  1CNQ A;  4PGP A;  3D1R A;  2L5V A;  3BIH A;  1NUZ A;  5IGA A;  4M1V A;  5J1D A;  2OX3 A;  2JJK A;  2FIE A;  4P3L A;  5ET8 A;  1FSA A;  3B8B A;  4PGN A;  4GWZ A;  5CM6 A;  4PFB A;  4OA4 A;  1FPJ A;  3CHG A;  5EYH A;  4PFI A;  1FPI A;  5IZ3 B;  2HZL A;  1DCU A;  1DK4 A;  1NI9 A;  4PF8 A;  5EYG A;  1FBE A;  1RDX A;  2FIX A;  3B50 A;  1LBZ A;  4OVR A;  5J16 A;  1FBG A;  5A5L A;  4NX1 A;  1IMB A;  2V3Q A;  5EQ8 A;  1NV2 A;  4PAF A;  5I5P A;  2B4L A;  4MIJ A;  4GWW A;  2PFY A;  3FXB A;  4HCY A;  3PTY A;  1FPG A;  2DE2 A;  1YXI A;  4AS4 A;  2OWZ A;  4NN3 A;  1INP A;  2HZK A;  5DW8 A;  2CZK A;  2WEF A;  1LBV A;  1JP4 A;  1FBP A;  1LEV A;  2ZZW A;  4N91 A;  2P3N A;  1VDW A;  3RPL A;  3T1B A;  4GX6 A;  1FBH A;  4GBV A;  4AS5 A;  4HCW A;  5EQ7 A;  2DVZ A;  1SPI A;  2Y5L A;  5ET7 A;  4MNI A;  1D9Q A;  3A29 A;  2DDK A;  1LBW A;  4MNC A;  1IME A;  2WYK A;  2MKZ A;  3KC0 A;  3IFC A;  4NG7 A;  2PFZ A;  2XWK A;  4PC9 A;  2R8T A;  1IMD A;  1NV0 A;  5LTC A;  4LN5 A;  4YIC A;  2VPO A;  2WBB A;  4PBH A;  2F3B A;  3QMF A;  5ET5 A;  4G61 A;  1FPL A;  4IR8 A;  1KA0 A;  4NF0 A;  4X8R A;  4OVQ A;  4PF6 A;  3BIG A;  4PET A;  2XA5 A;  4QBA A;  4GWU A;  1KA1 A;  3E79 A;  3HFU A;  4O94 A;  1XI6 A;  1FPF A;  4GWY A;  2GQ1 A;  4H46 A;  1LBY A;  1FPE A;  5LDZ A;  2WYP A;  4FBP A;  5EQA A;  2WBD A;  1NUW A;  4OVP A;  3RYD A;  3GYY A;  2XWV A;  2KR0 A;  3KC1 A;  2VPN A;  2BJI A;  2Y5K A;  4PE3 A;  1FBF A;  1K9Y A;  3FBP A;  1YYZ A;  1QGX A;  2F3D A;  2P3V A;  4NGU A;  1IMA A;  5IZ3 A;  4YZZ A;  3EKI A;  4P8B A;  3T0J A;  3W9V A;  4PFR A;  4OVS A;  4N17 A;  2FBP A;  1NUY A;  2CZI A;  3NOH A;  3LUZ A;  2XWI A;  3U65 A;  4F18 A;  5ET6 A;  2QVR A;  2QVU A;  1NV1 A;  2CZH A;  5EQ9 A;  4HE0 A;  3MYU A;  1RDY A;  2DE3 A;  4GX3 A;  4HE1 A;  4N15 A;  1EYJ A;  4JVI A;  4P47 A;  1G0H A;  4UAB A;  4XF5 A;  4MHF A;  1Q9D A;  4PCD A;  4MJO A;  4GBW A;  4PDD A;  4XEQ A;  2XWO A;  4I40 A;  2FHY A;  2Q9T A;  5I7I A;  5ESY A;  2B4M A;  2WX9 A;  5FBP A;  4O7M A;  4JVD A;  4HXV A;  4GWS A;  3LV0 A;  4O7I A;  4GWX A;  1KZ8 A;  5F24 A;  4PDH A;  4NHB A;  1NUX A;  1FJ9 A;  5IZ1 A;  1G0I A;  2Q74 A;  4P1E A;  4P1L A;  1NV6 A;  4GX4 A;  4PAI A;  3KBZ A;  2HXR A;  4MMP A;  4N8G A;  4MAG A;  2KQZ A;  4F19 A;  4XFE A;  1AWB A;  3ISP A;  1FBC A;  1RDZ A;  1FPK A;  4KXP A;  4X9T A;  2FVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...