2Y5LA

Orally active aminopyridines as inhibitors of tetrameric fructose 1,6- bisphosphatase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Orally Active Aminopyridines as Inhibitors of Tetrameric Fructose-1,6-Bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
total genus 106
structure length 319
sequence length 327
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2y5lA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2y5lA02
4O7IA 3RPLA 4H45A 5EYHA 1DK4A 1NI9A 2HHMA 3QMFA 4GWWA 1RDZA 1NUXA 2FBPA 1BK4A 1FPEA 4GBVA 3RPLB 1RDXA 4HXVA 1XI6A 5J16A 4G61A 1SPIA 3FBPA 5IZ3A 1DCUA 3KC0A 1INPA 4MJOA 4IR8A 2P3VA 2OX3A 5ESYA 5FBPA 1IMDA 4GX4A 5EYGA 4GX3A 2FIEA 1LBVA 3KC1A 5DW8A 1K9YA 3LV0A 1LBXA 1FPGA 1G0IA 1YYZA 4GBWA 3BIHA 1G0HA 1KA0A 1NV5A 4I3YA 1VDWA 1AWBA 1FPDA 1FBGA 5ET6A 1FPKA 1FJ6A 4I3EA 1FSAA 4N81A 3KBZA 1FBHA 2R8TA 1LBYA 1IMFA 2OWZA 4FBPA 5EQAA 1FBCA 1EYKA 1LEVA 2VT5A 2GQ1A 3B8BA 1FJ9A 1IMCA 2Q74A 1FBPA 2WBBA 1LBWA 2FHYA 1JP4A 2QVUA 2CZKA 1FRPA 1FPJA 1FPLA 2WEFA 1IMEA 2P3NA 4HE1A 2DDKA 1NV3A 1K9ZA 3T0JA 5A5LA 1FPIA 5LDZA 5IZ1A 3A29A 5EQ7A 1DBZA 2PCRA 1YZ0A 4GWZA 1EYIA 1NUZA 1Q9DA 4GWYA 1D9QA 4H46A 3IFCA 1NV7A 1NUYA 1LBZA 3IFAA 5ET7A 1IMBA 4QXDA 4AS5A 1IMAA 2FIXA 4GX6A 4HE2A 5ET8A 1NV4A 2WBDA 2F3BA 2F3DA 1NV2A 2CZHA 5EQ9A 5I3SA 2Y5LA 1NV6A 5F24A 4AS4A 2QFLA 5ET5A 5EQ8A 1QGXA 1NUWA 2Y5KA 4I40A 3BIGA 1NV0A 2QVRA 2BJIA 2FVZA 3RYDA 1CNQA 1KZ8A 1FBFA 2CZIA 1FBEA 3LUZA 4HE0A 1EYJA 4GWXA 1RDYA 5IZ3B 3D1RA 4PTKA 1NV1A 1FPFA 1FTAA 1FBDA 5T3JA 2JJKA 2Q8MA 1FPBA 4KXPA 4GWUA 1KA1A 1YXIA 3ROJA 4GWSA 2QVVA
chains in the Genus database with same CATH superfamily
4ECFA 3PUXE 2QL3A 1SD3A 5F7VA 3ZKLA 4N07A 5DTBA 5KCJB 3CI8A 5HBCA 4NF5A 3A3CA 5ESYA 3CRBA 4LVQA 1AIVA 4QFKA 1MDQA 3EHTA 1Y4TA 1FTLA 3RT8A 3CG3A 4FE8A 1K9YA 2OLBA 1D4NA 5J1DA 2H4IA 1US5A 2H25A 3BKIB 3MUQA 3L6GA 3DELB 1IXCA 1ZBMA 2GQ1A 3RQTA 2V25A 1XOCA 4OMBA 2IEEA 2UVIA 3VVFA 4PF6A 4PFWA 1B3LA 1HSJA 4NF4A 4GL8A 1NV3A 3FXQA 2F35A 2QPQA 1YZ0A 4F3GA 5CI5A 3FVKA 2QSXA 4F1YA 2ESNA 1CE2A 2DWAA 2I4BA 4ZDMA 2NWJA 2WKYA 2HFBA 4HE2A 4FORA 2WBDA 3PTYA 3M3LA 1NV2A 3CVGA 4XKPA 3HHGA 4P0GA 4QSCA 1CNQA 3K4UA 1QW0A 2CZIA 1JETA 4G4PA 5H8SA 4HE0A 1EYJA 2H98A 1FBDA 1GGGA 5CC2A 1S9TA 4GWUA 5K2XA 3T96B 1UQWA 3TTLA 5CMMA 4N6PA 3EHUA 1RDXA 1SPIA 4QFPA 5IKBA 2DYXA 3E9XA 4KHZE 1LSTA 2P3VA 1NMUA 3LC8A 3FVOA 2V84A 2WYKA 1MQDA 1IMDA 1MXXA 2B3FA 4U4XA 1IXIA 3H3GA 2L5VA 4LZ8A 4FEBA 3D4CA 4R9FA 2REJA 4QF9A 2UYFA 1B5IA 4Q8RA 1FJ6A 3V83A 3MP6A 3U94A 1GTKA 2R8TA 2OWZA 4LA9A 2XX7A 3T66A 2HZLA 5I59A 1N3WA 1JQFA 3C34A 3DP8A 2OPDA 3TTKA 4N4UA 3R26A 4C1UA 2I49A 2ZMBA 1MY2A 4JDFA 4LQ5A 1FPIA 5LDZA 5IAIA 2PCRA 1S50A 5LTCA 4NF4B 4YB7A 5ET7A 4PFYA 1N7WA 1NH8A 4KFQA 1B3EA 1I69A 4TOZA 4LN5A 4OFLA 4F2OA 1B4HA 4NF8B 1A8FA 2QJEA 1VSOA 3BIGA 5I2KB 3RYDA 1VFEA 2F36A 4MFIA 1N0TA 1MXWA 4PETA 3GZGA 1OLCA 5JK4A 2VPNA 1DK4A 1MXYA 1SBPA 5AA4B 4DCXA 3LSWA 3TODA 3P7IA 1FTKA 3S9EA 3KN3A 1NKXA 2NUVA 1A8EA 3OOAA 4JWYA 4N91A 1O64A 3Q25A 3IOWA 3RUMA 4GX3A 1MM6A 4YB5A 3N6UA 2HEUA 4OVSA 5CM6A 2Q2CA 4JVDA 1KA0A 4ZEKA 3W9VA 5IGAA 4IO6A 1SI0A 3IJXB 1EH3A 5H8QB 2QMXA 3F11A 3IJOB 4FBPA 1IMCA 4I9DA 3N5LA 4HCYA 2O68A 3UGWA 3U92A 1NH7A 5CRYA 1MDP1 3KBRA 1Z7NE 1D9YA 4R6YA 1MPDA 2XA5A 1B0HA 2DVCA 1Y20A 4H0WA 1OMPA 1OVTA 4O3CA 4R2FA 4IGTA 1FCKA 4KCCA 1ZLQA 3DM0A 2XXIA 4I1DA 3WAEA 4THIA 4QBAA 4IO4A 2VHAA 1KWHA 2V3QA 5H8NB 3LSFB 3OO7A 2F78A 2FYIA 3K0VA 2QMWA 1MM7A 4U1OA 2ZZXA 1QUIA 4JBZA 3MJNA 5TP9B 3ZSFA 5LOMA 4LQ2A 4P47A 4Q5TA 5I56A 3V5AA 4EF1A 3N94A 5HPQA 3PUZE 3VE1B 4AB5A 1MPBA 3SEXA 2OJTA 4GXAA 2PT1A 5L9OA 1DCUA 1B1XA 2GRVA 4X8RA 4N6KA 4MH5A 1Y3NA 3NOHA 3TZAA 4FATA 4TQUQ 3QSLA 3B50A 2B3BA 4EQ7A 4DXUA 5EYGA 1GR2A 1UTHA 4TLLB 1LBVA 5DW8A 5I2NA 4NGUA 3JYRA 3SETA 4N81A 4G68B 5FHMA 1AH5A 3MZ1A 4F3BA 2DVZA 2PFYA 1MXUA 1Z7ME 3TELA 5I2NB 4EF2A 2OZZA 3FZVA 1FQEA 5I7IA 3AXFA 4YICA 3U93A 4GWZA 1IEJA 4N13A 1NUYA 2X26A 4MX6A 4N6DA 4ZE8A 1ZU0A 2HPGA 2F3BA 4RY1A 3MZBA 3HFUA 4RXLA 1IXHA 2I48A 3BBRA 3H6WA 2V3TA 4JWXA 5I56B 3PMVA 3FXBA 4PAIA 1B7UA 1LB9A 4BDRA 3QIMA 1B7HA 3MYUA 2YPNA 2B4LA 1KA1A 4M4GA 3ROJA 4R6HA 3LUYA 4POWA 3QMFA 2F8DA 1PBPA 1DMBA 4OEUA 4KD5A 4RK2A 3CSBA 1FPEA 1FQAA 1PB7A 3A3UA 2WX9A 3H7MA 3QK6A 3TKDA 1IQ7A 4GX4A 1IITA 3B7DA 1A55A 1N7XA 4YAHX 4QSEA 3KN8A 1VDWA 2RINA 1UTBB 4O3AA 4OENA 3Q27A 3KBZA 3I5OA 4G68C 4DDDA 1SQYA 2F7BA 3RGYA 4ZZAA 2Q74A 4P1LA 4PE5B 4KQPA 1LBWA 2FHYA 3MW0A 3TPAA 1AL3A 3OD7A 3PPNA 3TQLA 1XHYA 4ESWA 5DYHA 3MP8A 3C32A 5EQ7A 1MPCA 4YKJA 4YU0A 5H8FB 5H8FA 4OWDA 2CEXA 2I6EA 3TTRA 3FATA 1NV4A 2P1SA 3H06B 3VDFA 1NV6A 3KOTA 4ELPA 5KDTA 5ET5A 2BJIA 4OVTA 4C1TA 2RC8A 2ALUA 3GLBA 1B9JA 5EHMA 2H9BA 1HSEA 3OSQA 4IGRA 2Q8MA 5CMCA 4PFUA 1AOVA 3SEVA 4G2ZA 3K1NA 4PDHA 1NI9A 4PFBA 2I58A 2Y7WA 4NF8A 4NX1A 3GBAA 2PT2A 4QFOA 1SW2A 2ZZWA 3K00A 5FTIA 1FTJA 4R73A 1OLAA 2ONKE 2R6GE 4ONYA 1Q1KA 1TWYA 2AL5A 1G0HA 4I3YA 2RF1A 3IK6B 1NFTA 3B6TA 5I59B 3K02A 1FTOA 1FBCA 2DSFA 3VLWA 1Y1MA 3CFXA 4KPTA 4F1VA 3G3KA 2DWJA 3U65A 3TUSA 2V93A 2V4CA 1P1UA 4OESA 3KN7A 5A5XA 3VVEA 3O6GA 1Y3PA 4RPNA 1DPPA 4GLIA 5ICTA 4F3PA 4MNIA 4GVOA 4P9KA 1MQGA 2A5TA 4P8BA 4POXA 4I62A 2UXAA 2PBWA 2LAOA 2FVZA 1FBFA 4DIGA 3VXBA 4G68A 1GVCA 3FXRA 4KXPA 4OXVA 1Y4CA 2HCAA 4ZEBA 1DPEA 4PFIA 3B6QA 2BJJX 1PC3A 3FVGA 4MLQA 2Y7IA 5FHOA 1BK4A 5JTYA 3FJ7A 1A54A 3LSLA 1R6ZA 4FEDA 1LAHE 4F31B 2Q88A 3O6IA 3PPPA 1N3XA 4PF8A 3U1OA 4NF6A 3G3GA 3IOTA 3KC1A 3FXUA 4N17A 1G0IA 3MSTA 3MBPA 1B32A 4U1ZA 4MNCA 3UORA 5EQAA 5JEIA 3RNNA 1XT8A 5ITOA 1QULA 2ZYOA 4ZEFA 2XXRA 3UK4A 1B4ZA 4DE8A 2QVUA 2XWIA 2CZKA 4PAFA 1FRPA 1H76A 1IXGA 2DDKA 3T93B 3IB0A 4YKIA 3TYHA 2QS4A 3TTNA 3G3FA 2CEYA 4UACA 3H6VA 1P1NA 4KR5A 4NF5B 4H46A 1OIBA 1LBZA 2HAVA 1O7TA 4F2QA 4FJPA 4LP2B 5EQ9A 2X7PA 4F22A 1FTMA 3OMBA 4XFEA 3IOVA 1TT1A 2HQ0A 2QS2A 1FTAA 5DVJA 2JJKA 1EZ9A 2THIA 4LZ7A 2AL4A 3MPLA 2D21A 3Q28A 2XXPA 5EYHA 2AIXA 4YB6A 1VE4A 3FV2A 3FJGA 2ABHA 4NMYA 1B6HA 1SYHA 4OA4A 2Z22A 1INPA 1SI1A 3KGCA 3OELA 3QAXA 4PBHA 2XXUA 5CBRA 4RJZA 1N84A 2FIEA 4O3BA 3IOUA 3TCGA 2V3UA 2ZNTA 4H8IA 1RYOA 2WYPA 4K3FA 1FBHA 1LEVA 1MG1A 2XWVA 3RT6B 3HHFA 1H3DA 4NAPA 1M5EA 3MVWA 1IUDA 4PBQA 1XVXA 1K9ZA 3FGSA 4Q0CA 3T0JA 4PGPA 3C4MA 5TU0A 1R9LA 3VFJA 1Q9DA 1NUZA 2ZYNA 2OWSA 1D9QA 1NV7A 1UTBA 1B3HA 1T0KA 1QUKA 2F3DA 1JW1A 2O51A 4X9TA 3SEUA 3S9LC 1BP5A 4I40A 2Y5KA 1NV0A 1CB6A 3PUVE 4YKPA 2YLNA 4XKNA 3SEYA 3E4RA 2P2AA 4U21A 2O6AA 3E79A 5ICQA 4MHFA 4ELOA 3RY3A 2RC7A 4OYVA 3ECRA 1LCFA 2MKZA 4ZECA 3SEWA 3PMWA 3PUYE 4F39A 2XD3A 3KJ7A 4O8MA 1JW4A 4H5GA 1B46A 2HXRA 4P0IA 1RYXA 1PEBA 3E78A 2F7AA 5FTHA 3MPKA 3FUZA 4YMBA 2H5YA 2Z8FA 1MXZA 1DSNA 2DQVA 3IB1A 1B51A 4AQ4A 1NV5A 3PV0E 5ET6A 3KZGA 4H8JA 5JTYB 1OQGA 4GQOA 3DP6A 3ZKKA 4OVJA 3C9HA 3HCQA 1BIYA 2ZXTA 4R9GA 1ZJLA 1LFIA 2CMOA 4OERA 4ND9A 2P3NA 4HCWA 3BFUA 1YCJA 2IA4A 1XS5A 1N04A 1Y3QA 1GV8A 3RTWB 1QVSA 5ITPA 3VXCA 4PQJA 2ONRA 2E1SA 4TLMB 1MY4A 4GX6A 2XXHA 1D9VA 1UTHB 2Y5LA 1BLFA 4YKKA 2QFLA 3WAFA 4YMAA 3IAZA 3L6HA 4U22A 2M8CA 1B1HA 2VD2A 3V89B 1A7LA 4MAGA 3TEPA 1MY0A 4PTKA 1FPFA 3KSXA 5T3JA 1IIWA 2Y7PA 3K1PA 3EQ1A 3IO6A 3IORA 3MC2A 4PFTA 4N15A 4GD5A 4JXIA 3OEKA 2OPEA 3KJTA 5DVIA 4YZZA 4OVRA 2FBPA 3H6UA 4KCDA 4UABA 1EZPA 5ELVA 4WXJA 1WVJA 3RPLB 3N6TA 3PU5A 5J16A 4G61A 3VLVA 3I3VA 4NEDA 5I57A 4P56A 3PMXA 4OZ9A 2OX3A 1QKAA 4LATA 3T9XB 3MWBA 2B65A 1ELJA 2HXWA 1FPGA 4NG7A 4U4SA 3M3FA 3HSTA 4EUOA 1LAGE 2XX9A 1FBGA 3CG1A 4GXSB 4XXUA 5AA2B 3O28A 4QRZA 5I58A 1EYKA 1TFAA 3UP9A 4BDOA 4JSDA 3T22A 4JVIA 2WBBA 4X1DA 1JW5A 4MNPA 3C31A 2XXVA 3C35A 4HE1A 4OANA 1LBBA 4QSDA 4F29A 1R9QA 1SYIA 3A29A 2PMSA 4U2RA 1II5A 3VV5A 3MZ9A 5I58B 5KDTB 4KI0E 1IMBA 2VP1A 2FIXA 3PPOA 1QJMA 1BTJA 5ET8A 1Q35A 4H5FA 4MLVA 5I3SA 3E13X 2ZYKA 1EZOA 1S7YA 3EPEA 3QXMA 3OXNA 2Y7RA 1WDNA 5EHSA 1MQIA 4NN3A 1NL5A 3SKPA 4NF0A 5CMBA 2KR0A 3MQ9A 3G3IA 4PCDA 2QVVA 2F6PA 3RPLA 1FQDA 4PAKA 4GWWA 2F6GA 4KYSA 4IY6A 1QUJA 5I5PA 2XXYA 5H8HA 1N76A 2F5XA 4P3LA 3FIRA 2DOJA 2R9JA 1B5HA 4IR8A 4F18A 3UIFA 1NNPA 2FNCA 5DEXB 4ISUA 2XXKA 1POTA 1US4A 2KQZA 3OO9A 4E0XA 2Q2AA 3K1MA 4UA8A 4JWOA 4Z0IA 1FSAA 4NF6B 4XEQA 1MH3A 1FJ9A 4F1UA 3RPWA 5DT6A 1TFDA 2NVUB 4HS7A 1DTZA 1FPJA 4R74A 1FPLA 2XWKA 1XC1A 4QFNA 1XVYA 4RA1A 2ZNSA 1LAFE 3O97A 5IZ1A 2YJPA 2O7UA 1EYIA 2NOOA 2O1MA 3K6XA 4OVPA 4ELQA 3IFCA 4MIJA 3OO6A 1MY1A 2RKMA 1R1NA 1M5FA 1SDXA 1M5BA 2W7YA 4OHNA 2XXWA 1B52A 3FASA 3RLFE 3DP4A 1KZ8A 1URDA 1NNFA 3UN6A 4KYDA 1RKMA 2G93A 3HN0A 4IY5A 2XXTA 3W15C 1DOTA 1PBQA 5AA3A 1H44A 3UA8A 4H45A 4MMPA 4QFLA 4X04A 2AYSA 2O7IA 2UYEA 4OVQA 1BKAA 2XWOA 2QS1A 1B3GA 3U8QA 4DXBA 4JB7A 3SERA 5FHNA 4GRKA 4G8MA 3CHGA 1P1WA 3ILTB 5BUUA 2DE4A 4HTGA 4IB2A 2CZLA 5IZZA 1FQFA 1NNTA 2Q9TA 1MXVA 4OFJA 1YPNA 3O9PA 3TTMA 1UIVA 5AA2A 4BDQA 3A09A 1MQJA 1FPDA 1A40A 1B58A 3QUJA 3W9WA 3PD9A 1JEVA 3IO4A 1OQHA 4JVCA 2VT5A 2HAUA 3V8XB 3ISPA 4DI4B 1VFDA 3D4GA 3CFZA 3S2VA 1I6QA 4XKRA 2G29A 2D3IA 2E0SA 2O84X 4O94A 1MH4A 3TCFA 5A5LA 3T9VA 4H1XA 1SW5A 3R6UA 4H6DA 3I6VA 4X1BA 3H6TA 1B40A 2Z8EA 1B05A 3IFAA 4AS5A 3G3JA 4FAJA 3MVXA 4RYAA 3C36A 4WEPA 5L9MA 3C33A 4FECA 2I3VA 4RNSA 3K2DA 1UIUA 1P1OA 3LUZA 2PVUA 2ONSA 4N8YA 3LR1A 5KCJA 1NV1A 1POY1 3HO7A 3KG2A 2VOZA 3PPQA 2R71A 3SESA 1SW1A 1B3FA 2HHMA 4L17A 4R72A 2XXQA 2RCBA 5F1QA 3IX1A 3KSJA 4DI3D 4HXVA 1P99A 3LBSA 4G77A 3FBPA 4PP0A 1YTVA 4NQ8A 2Z8DA 2F97A 3SZPA 1YAEA 4XF5A 3CSGA 5FBPA 1ZKBA 3Q29A 4H65A 3ZS6A 2GHAA 2OBGA 1JVXA 4M1VA 4MCOA 3R7XA 4E0WA 4MEVA 4MF3A 1LGBC 1AWBA 4X48A 3T1BA 1FPKA 3TMGA 3EF7A 3BFTA 4EQBA 2H99A 2ANJA 2DS9A 5AA4A 1LAXA 3O6HA 2DE3A 4ESXA 5A5XB 2DXYA 1LFGA 4P1EA 1LBCA 4QHQA 5L9SA 4RPOA 1SVXB 1PB9A 4EXKA 4R75A 4OTEA 5H8HB 1IMAA 5AA1A 3H03A 1USYE 5EQ8A 1QGXA 5BWJA 4GL0A 3M3KA 4EXLA 5IM2A 1ANFA 1ZMGA 3JV9A 1FPBA 2XXXA 4ZEIA 3HPIA 2OWTA 2ZYMA 4WEDA 1I6AA 4GWSA 3OO8A 4EDPA 2PYYA 5EYFA 2D5WA 1NUXA 2NXOA 4GBVA 4Z7EA 1P1QA 1XI6A 1O63A 5AA2D 5IZ3A 1FQCA 2VGQA 2O1LA 4MJOA 2B4MA 2X7QA 1JEUA 4DZ1A 1D3KA 3GXAA 2PX1A 5B7DA 1B0LA 2Y84A 1YYZA 4GBWA 3K6WA 4EQ9A 2F34A 1MRPA 3EHSA 2VPOA 3MVYA 2I3WA 1H45A 1QKBA 3IB2A 2XD2A 5KZTA 2DWIA 4GF8A 1M5CA 1HSLA 3PPRA 1SW4A 5ISUA 1LB8A 2P0SA 4MBPA 3ODBA 3FD3A 4OFOA 1EU8A 5CBSA 4I8CA 5I57B 4ZS9A 4Q30B 5TP9A 4JSOA 4R2BA 4DXCA 1TXFA 4AS4A 4GFRA 2GH9A 3PGFA 2PFZA 5CMKA 5H8NA 4DCYA 1URGA 3SDFA 3THIA 3QYTA 1FW0A 2QS3A 3MVZA 4AB6A 1YXIA 4NWCA 1ZTYA 1J1NA 4O7IA 4KYEA 4IO3A 3ILUB 3OEMA 4PDDA 3CIJA 3IR1A 2I0BA 1RDZA 2QRYA 4F3SA 3S9NC 4IO7A 2UVGA 4BDLA 3T9UA 1LFHA 2DXRA 3JZJA 4G8NA 2I4CA 3KC0A 3USDA 4XTCQ 2Q8JA 5DVFA 3B6WA 2FA7A 4LZ5A 1Y9UA 2REGA 3Q26A 5AE4A 1MY3A 3CR9A 3TCHA 2O69A 5H8QA 4OEVA 1MS7A 3QUFA 4NHBA 2F7CA 3LV0A 1LBXA 4HW8A 5B70A 3S9MC 3BIHA 1VR5A 3EKIA 3FJMA 3GBBA 4I3EA 4NTLA 1IMFA 4DLDA 4ELRA 2A5SA 3DLNA 3B8BA 1A99A 4O7MA 4BDMA 1FBPA 2DP8A 4NWDA 1JP4A 1ATGA 4F19A 2WEFA 3K6VA 4OQOA 1B5JA 3CFLA 2I0CA 2DWHA 1DBZA 3G3HA 2RCAA 4GWYA 1DTGA 3VVDA 4ZE9A 4GWOA 4PGNA 1L5TA 3TFLA 4IO5A 2Y7KA 1IZ1A 3RN8A 4LONB 4OETA 3TQWA 3RTFB 4U23A 5F24A 5TPAA 4NE4A 4XIGQ 5I2KA 4H67A 4PFRA 4RK9A 1I6BA 2Q89A 1ZIUA 3K01A 2Z23A 1B7ZA 4GWXA 5IZ3B 2A5TB 3D1RA 1PDAA 2HZKA 4BDNA 1JNFA 4XKQA 2UVHA 3OENA 4G8HA 3O66A 3H4ZA 3HV1A 1NNKA 3KFMA 3N26A 3MP1A 1M5DA 3O29A 2UVJA 3G7WA 5DEXA 2GFEA 2OCUA 3FVNA 4C0RA 1F9BA 3KEIA 3S4UA 4GOTA 2ZZVA 3ONMA 3VLUA 3LSXA 1WODA 3MAMA 3KOSA 3GYYA 1B2HA 3IL1B 2OK2A 4GIZA 4ZZEA 3FV1A 3E3KA 2DE2A 5L8DA 1LBYA 3TAJA 3K6UA 1FQBA 3T9HB 5K2YA 3OSRA 2VD3A 1LLSA 3O2AA 4PC9A 4R6KA 1URSA 1JVYA 4LUBA 4WKMA 3PD8A 1IMEA 3PUWE 1MQHA 1LCTA 1PB8A 4PE3A 3TDJA 2RC9A 4N8GA 5I84A 4IO2A 5TPAB 3M8UA 1AMFA 4QXDA 2GHBA 1OVBA 4BLAA 2CZHA 2XX8A 1NUWA 2QVRA 1USYH 2ZNUA 2KLFA 1FBEA 3EN3A 1Y1ZA 1RDYA 1H43A 2XHDA 4ZEDA 5M2VA 5HM4B 4FIMA 4P11A 3U72A
chains in the Genus database with same CATH topology
4O7IA 4N15A 3RPLA 2VPNA 4H45A 4MMPA 5EYHA 1DK4A 1NI9A 2HHMA 3QMFA 4GWWA 4PAKA 4PDHA 4PFBA 4PFIA 4PDDA 4O8MA 4OVQA 4YZZA 4NX1A 4OVRA 1RDZA 2XWOA 1NUXA 2FBPA 4UABA 1BK4A 1FPEA 2HXRA 4GBVA 3RPLB 4DI3D 1RDXA 4HXVA 3CHGA 1XI6A 5I5PA 2ZZWA 5J16A 4G61A 1SPIA 3FBPA 2F5XA 4OA4A 4P3LA 3E78A 5IZ3A 1DCUA 3KC0A 4X8RA 1INPA 4MJOA 2DE4A 4N6KA 4IR8A 2B4MA 2P3VA 2WX9A 3NOHA 4NQ8A 2ZZVA 4P56A 3SZPA 2OX3A 5ESYA 4F18A 5IZZA 4PBHA 4XF5A 5FBPA 4N91A 3B50A 2WYKA 1IMDA 2XXKA 4GX4A 4PCDA 5EYGA 2Q9TA 3GYYA 4PF8A 4GX3A 2FIEA 2KQZA 1LBVA 3KC1A 5DW8A 2L5VA 4M1VA 4MCOA 4NHBA 1K9YA 4MEVA 3LV0A 1LBXA 4N17A 4OVSA 1FPGA 4NG7A 1G0IA 5CM6A 1YYZA 4JVDA 5J1DA 4GBWA 3BIHA 1G0HA 1KA0A 1NV5A 4I3YA 1VDWA 3EKIA 3MSTA 4NGUA 3W9VA 1AWBA 1FPDA 1FBGA 5ET6A 3T1BA 5IGAA 1FPKA 2DE2A 1FJ6A 4I3EA 3W9WA 4MNCA 1FSAA 4N81A 2VPOA 4XEQA 3KBZA 2WYPA 1FBHA 2R8TA 1LBYA 1IMFA 2OWZA 4FBPA 5EQAA 1FBCA 4JVCA 1EYKA 1LEVA 2VT5A 2GQ1A 3B8BA 1FJ9A 4X04A 3ISPA 4DI4B 4O7MA 4F1UA 1IMCA 4HCYA 2HZLA 4PC9A 2Q74A 2XWVA 4JVIA 4P1LA 1FBPA 2DVZA 4F1VA 2PFYA 2WBBA 2DE3A 1LBWA 2FHYA 1JP4A 2QVUA 4MNPA 2XWIA 4N4UA 2CZKA 4PAFA 1FRPA 4NAPA 4PF6A 1FPJA 4F19A 1FPLA 2WEFA 3U65A 1IMEA 2P3NA 4HE1A 2XWKA 4HCWA 2DDKA 5I7IA 2XA5A 4OANA 4PBQA 1NV3A 1K9ZA 4O94A 3T0JA 5A5LA 4P1EA 1FPIA 5LDZA 4PGPA 4PE3A 2V4CA 5IZ1A 3A29A 5EQ7A 1DBZA 2PCRA 2CEYA 4N8GA 2QPQA 4YICA 1YZ0A 4GWZA 1EYIA 1NUZA 1Q9DA 5LTCA 4GWYA 4OVPA 1D9QA 4H46A 3IFCA 1NV7A 1NUYA 4MIJA 4PGNA 1LBZA 3IFAA 5ET7A 2CEXA 1IMBA 4QXDA 4AS5A 1IMAA 2FIXA 4MNIA 4GX6A 4MX6A 4N6DA 4P9KA 4HE2A 5ET8A 4QBAA 1NV4A 4LN5A 2WBDA 2HPGA 3PTYA 2F3BA 2F3DA 1NV2A 2CZHA 5EQ9A 5I3SA 2Y5LA 1NV6A 5F24A 4AS4A 4P8BA 2QFLA 4X9TA 4XFEA 5ET5A 5EQ8A 3HFUA 2PFZA 1QGXA 1NUWA 2Y5KA 4I40A 3BIGA 2V3QA 1NV0A 2QVRA 4PFRA 2BJIA 2FVZA 4OVTA 3RYDA 1CNQA 1KZ8A 1FBFA 2CZIA 1FBEA 3FXBA 3LUZA 4MAGA 4PAIA 4HE0A 1EYJA 4GWXA 1RDYA 5IZ3B 4NN3A 4N8YA 3D1RA 4NF0A 2HZKA 4PTKA 3E79A 1NV1A 2ZZXA 1FPFA 1FTAA 1FBDA 5T3JA 4MHFA 5IM2A 2JJKA 2Q8MA 1FPBA 3MYUA 4KXPA 4GWUA 2B4LA 1KA1A 1YXIA 2KR0A 3ROJA 4PETA 4GWSA 2MKZA 4P47A 5JK4A 2QVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7I A;  3RPL A;  4H45 A;  5EYH A;  1DK4 A;  1NI9 A;  2HHM A;  3QMF A;  4GWW A;  1RDZ A;  1NUX A;  2FBP A;  1BK4 A;  1FPE A;  4GBV A;  3RPL B;  1RDX A;  4HXV A;  1XI6 A;  5J16 A;  4G61 A;  1SPI A;  3FBP A;  5IZ3 A;  1DCU A;  3KC0 A;  1INP A;  4MJO A;  4IR8 A;  2P3V A;  2OX3 A;  5ESY A;  5FBP A;  1IMD A;  4GX4 A;  5EYG A;  4GX3 A;  2FIE A;  1LBV A;  3KC1 A;  5DW8 A;  1K9Y A;  3LV0 A;  1LBX A;  1FPG A;  1G0I A;  1YYZ A;  4GBW A;  3BIH A;  1G0H A;  1KA0 A;  1NV5 A;  4I3Y A;  1VDW A;  1AWB A;  1FPD A;  1FBG A;  5ET6 A;  1FPK A;  1FJ6 A;  4I3E A;  1FSA A;  4N81 A;  3KBZ A;  1FBH A;  2R8T A;  1LBY A;  1IMF A;  2OWZ A;  4FBP A;  5EQA A;  1FBC A;  1EYK A;  1LEV A;  2VT5 A;  2GQ1 A;  3B8B A;  1FJ9 A;  1IMC A;  2Q74 A;  1FBP A;  2WBB A;  1LBW A;  2FHY A;  1JP4 A;  2QVU A;  2CZK A;  1FRP A;  1FPJ A;  1FPL A;  2WEF A;  1IME A;  2P3N A;  4HE1 A;  2DDK A;  1NV3 A;  1K9Z A;  3T0J A;  5A5L A;  1FPI A;  5LDZ A;  5IZ1 A;  3A29 A;  5EQ7 A;  1DBZ A;  2PCR A;  1YZ0 A;  4GWZ A;  1EYI A;  1NUZ A;  1Q9D A;  4GWY A;  1D9Q A;  4H46 A;  3IFC A;  1NV7 A;  1NUY A;  1LBZ A;  3IFA A;  5ET7 A;  1IMB A;  4QXD A;  4AS5 A;  1IMA A;  2FIX A;  4GX6 A;  4HE2 A;  5ET8 A;  1NV4 A;  2WBD A;  2F3B A;  2F3D A;  1NV2 A;  2CZH A;  5EQ9 A;  5I3S A;  2Y5L A;  1NV6 A;  5F24 A;  4AS4 A;  2QFL A;  5ET5 A;  5EQ8 A;  1QGX A;  1NUW A;  2Y5K A;  4I40 A;  3BIG A;  1NV0 A;  2QVR A;  2BJI A;  2FVZ A;  3RYD A;  1CNQ A;  1KZ8 A;  1FBF A;  2CZI A;  1FBE A;  3LUZ A;  4HE0 A;  1EYJ A;  4GWX A;  1RDY A;  5IZ3 B;  3D1R A;  4PTK A;  1NV1 A;  1FPF A;  1FTA A;  1FBD A;  5T3J A;  2JJK A;  2Q8M A;  1FPB A;  4KXP A;  4GWU A;  1KA1 A;  1YXI A;  3ROJ A;  4GWS A;  2QVV A; 
#chains in the Genus database with same CATH topology
 4ECF A;  3PUX E;  2QL3 A;  1SD3 A;  5F7V A;  3ZKL A;  4N07 A;  5DTB A;  5KCJ B;  3CI8 A;  5HBC A;  4NF5 A;  3A3C A;  5ESY A;  3CRB A;  4LVQ A;  1AIV A;  4QFK A;  1MDQ A;  3EHT A;  1Y4T A;  1FTL A;  3RT8 A;  3CG3 A;  4FE8 A;  1K9Y A;  2OLB A;  1D4N A;  5J1D A;  2H4I A;  1US5 A;  2H25 A;  3BKI B;  3MUQ A;  3L6G A;  3DEL B;  1IXC A;  1ZBM A;  2GQ1 A;  3RQT A;  2V25 A;  1XOC A;  4OMB A;  2IEE A;  2UVI A;  3VVF A;  4PF6 A;  4PFW A;  1B3L A;  1HSJ A;  4NF4 A;  4GL8 A;  1NV3 A;  3FXQ A;  2F35 A;  2QPQ A;  1YZ0 A;  4F3G A;  5CI5 A;  3FVK A;  2QSX A;  4F1Y A;  2ESN A;  1CE2 A;  2DWA A;  2I4B A;  4ZDM A;  2NWJ A;  2WKY A;  2HFB A;  4HE2 A;  4FOR A;  2WBD A;  3PTY A;  3M3L A;  1NV2 A;  3CVG A;  4XKP A;  3HHG A;  4P0G A;  4QSC A;  1CNQ A;  3K4U A;  1QW0 A;  2CZI A;  1JET A;  4G4P A;  5H8S A;  4HE0 A;  1EYJ A;  2H98 A;  1FBD A;  1GGG A;  5CC2 A;  1S9T A;  4GWU A;  5K2X A;  3T96 B;  1UQW A;  3TTL A;  5CMM A;  4N6P A;  3EHU A;  1RDX A;  1SPI A;  4QFP A;  5IKB A;  2DYX A;  3E9X A;  4KHZ E;  1LST A;  2P3V A;  1NMU A;  3LC8 A;  3FVO A;  2V84 A;  2WYK A;  1MQD A;  1IMD A;  1MXX A;  2B3F A;  4U4X A;  1IXI A;  3H3G A;  2L5V A;  4LZ8 A;  4FEB A;  3D4C A;  4R9F A;  2REJ A;  4QF9 A;  2UYF A;  1B5I A;  4Q8R A;  1FJ6 A;  3V83 A;  3MP6 A;  3U94 A;  1GTK A;  2R8T A;  2OWZ A;  4LA9 A;  2XX7 A;  3T66 A;  2HZL A;  5I59 A;  1N3W A;  1JQF A;  3C34 A;  3DP8 A;  2OPD A;  3TTK A;  4N4U A;  3R26 A;  4C1U A;  2I49 A;  2ZMB A;  1MY2 A;  4JDF A;  4LQ5 A;  1FPI A;  5LDZ A;  5IAI A;  2PCR A;  1S50 A;  5LTC A;  4NF4 B;  4YB7 A;  5ET7 A;  4PFY A;  1N7W A;  1NH8 A;  4KFQ A;  1B3E A;  1I69 A;  4TOZ A;  4LN5 A;  4OFL A;  4F2O A;  1B4H A;  4NF8 B;  1A8F A;  2QJE A;  1VSO A;  3BIG A;  5I2K B;  3RYD A;  1VFE A;  2F36 A;  4MFI A;  1N0T A;  1MXW A;  4PET A;  3GZG A;  1OLC A;  5JK4 A;  2VPN A;  1DK4 A;  1MXY A;  1SBP A;  5AA4 B;  4DCX A;  3LSW A;  3TOD A;  3P7I A;  1FTK A;  3S9E A;  3KN3 A;  1NKX A;  2NUV A;  1A8E A;  3OOA A;  4JWY A;  4N91 A;  1O64 A;  3Q25 A;  3IOW A;  3RUM A;  4GX3 A;  1MM6 A;  4YB5 A;  3N6U A;  2HEU A;  4OVS A;  5CM6 A;  2Q2C A;  4JVD A;  1KA0 A;  4ZEK A;  3W9V A;  5IGA A;  4IO6 A;  1SI0 A;  3IJX B;  1EH3 A;  5H8Q B;  2QMX A;  3F11 A;  3IJO B;  4FBP A;  1IMC A;  4I9D A;  3N5L A;  4HCY A;  2O68 A;  3UGW A;  3U92 A;  1NH7 A;  5CRY A;  1MDP 1;  3KBR A;  1Z7N E;  1D9Y A;  4R6Y A;  1MPD A;  2XA5 A;  1B0H A;  2DVC A;  1Y20 A;  4H0W A;  1OMP A;  1OVT A;  4O3C A;  4R2F A;  4IGT A;  1FCK A;  4KCC A;  1ZLQ A;  3DM0 A;  2XXI A;  4I1D A;  3WAE A;  4THI A;  4QBA A;  4IO4 A;  2VHA A;  1KWH A;  2V3Q A;  5H8N B;  3LSF B;  3OO7 A;  2F78 A;  2FYI A;  3K0V A;  2QMW A;  1MM7 A;  4U1O A;  2ZZX A;  1QUI A;  4JBZ A;  3MJN A;  5TP9 B;  3ZSF A;  5LOM A;  4LQ2 A;  4P47 A;  4Q5T A;  5I56 A;  3V5A A;  4EF1 A;  3N94 A;  5HPQ A;  3PUZ E;  3VE1 B;  4AB5 A;  1MPB A;  3SEX A;  2OJT A;  4GXA A;  2PT1 A;  5L9O A;  1DCU A;  1B1X A;  2GRV A;  4X8R A;  4N6K A;  4MH5 A;  1Y3N A;  3NOH A;  3TZA A;  4FAT A;  4TQU Q;  3QSL A;  3B50 A;  2B3B A;  4EQ7 A;  4DXU A;  5EYG A;  1GR2 A;  1UTH A;  4TLL B;  1LBV A;  5DW8 A;  5I2N A;  4NGU A;  3JYR A;  3SET A;  4N81 A;  4G68 B;  5FHM A;  1AH5 A;  3MZ1 A;  4F3B A;  2DVZ A;  2PFY A;  1MXU A;  1Z7M E;  3TEL A;  5I2N B;  4EF2 A;  2OZZ A;  3FZV A;  1FQE A;  5I7I A;  3AXF A;  4YIC A;  3U93 A;  4GWZ A;  1IEJ A;  4N13 A;  1NUY A;  2X26 A;  4MX6 A;  4N6D A;  4ZE8 A;  1ZU0 A;  2HPG A;  2F3B A;  4RY1 A;  3MZB A;  3HFU A;  4RXL A;  1IXH A;  2I48 A;  3BBR A;  3H6W A;  2V3T A;  4JWX A;  5I56 B;  3PMV A;  3FXB A;  4PAI A;  1B7U A;  1LB9 A;  4BDR A;  3QIM A;  1B7H A;  3MYU A;  2YPN A;  2B4L A;  1KA1 A;  4M4G A;  3ROJ A;  4R6H A;  3LUY A;  4POW A;  3QMF A;  2F8D A;  1PBP A;  1DMB A;  4OEU A;  4KD5 A;  4RK2 A;  3CSB A;  1FPE A;  1FQA A;  1PB7 A;  3A3U A;  2WX9 A;  3H7M A;  3QK6 A;  3TKD A;  1IQ7 A;  4GX4 A;  1IIT A;  3B7D A;  1A55 A;  1N7X A;  4YAH X;  4QSE A;  3KN8 A;  1VDW A;  2RIN A;  1UTB B;  4O3A A;  4OEN A;  3Q27 A;  3KBZ A;  3I5O A;  4G68 C;  4DDD A;  1SQY A;  2F7B A;  3RGY A;  4ZZA A;  2Q74 A;  4P1L A;  4PE5 B;  4KQP A;  1LBW A;  2FHY A;  3MW0 A;  3TPA A;  1AL3 A;  3OD7 A;  3PPN A;  3TQL A;  1XHY A;  4ESW A;  5DYH A;  3MP8 A;  3C32 A;  5EQ7 A;  1MPC A;  4YKJ A;  4YU0 A;  5H8F B;  5H8F A;  4OWD A;  2CEX A;  2I6E A;  3TTR A;  3FAT A;  1NV4 A;  2P1S A;  3H06 B;  3VDF A;  1NV6 A;  3KOT A;  4ELP A;  5KDT A;  5ET5 A;  2BJI A;  4OVT A;  4C1T A;  2RC8 A;  2ALU A;  3GLB A;  1B9J A;  5EHM A;  2H9B A;  1HSE A;  3OSQ A;  4IGR A;  2Q8M A;  5CMC A;  4PFU A;  1AOV A;  3SEV A;  4G2Z A;  3K1N A;  4PDH A;  1NI9 A;  4PFB A;  2I58 A;  2Y7W A;  4NF8 A;  4NX1 A;  3GBA A;  2PT2 A;  4QFO A;  1SW2 A;  2ZZW A;  3K00 A;  5FTI A;  1FTJ A;  4R73 A;  1OLA A;  2ONK E;  2R6G E;  4ONY A;  1Q1K A;  1TWY A;  2AL5 A;  1G0H A;  4I3Y A;  2RF1 A;  3IK6 B;  1NFT A;  3B6T A;  5I59 B;  3K02 A;  1FTO A;  1FBC A;  2DSF A;  3VLW A;  1Y1M A;  3CFX A;  4KPT A;  4F1V A;  3G3K A;  2DWJ A;  3U65 A;  3TUS A;  2V93 A;  2V4C A;  1P1U A;  4OES A;  3KN7 A;  5A5X A;  3VVE A;  3O6G A;  1Y3P A;  4RPN A;  1DPP A;  4GLI A;  5ICT A;  4F3P A;  4MNI A;  4GVO A;  4P9K A;  1MQG A;  2A5T A;  4P8B A;  4POX A;  4I62 A;  2UXA A;  2PBW A;  2LAO A;  2FVZ A;  1FBF A;  4DIG A;  3VXB A;  4G68 A;  1GVC A;  3FXR A;  4KXP A;  4OXV A;  1Y4C A;  2HCA A;  4ZEB A;  1DPE A;  4PFI A;  3B6Q A;  2BJJ X;  1PC3 A;  3FVG A;  4MLQ A;  2Y7I A;  5FHO A;  1BK4 A;  5JTY A;  3FJ7 A;  1A54 A;  3LSL A;  1R6Z A;  4FED A;  1LAH E;  4F31 B;  2Q88 A;  3O6I A;  3PPP A;  1N3X A;  4PF8 A;  3U1O A;  4NF6 A;  3G3G A;  3IOT A;  3KC1 A;  3FXU A;  4N17 A;  1G0I A;  3MST A;  3MBP A;  1B32 A;  4U1Z A;  4MNC A;  3UOR A;  5EQA A;  5JEI A;  3RNN A;  1XT8 A;  5ITO A;  1QUL A;  2ZYO A;  4ZEF A;  2XXR A;  3UK4 A;  1B4Z A;  4DE8 A;  2QVU A;  2XWI A;  2CZK A;  4PAF A;  1FRP A;  1H76 A;  1IXG A;  2DDK A;  3T93 B;  3IB0 A;  4YKI A;  3TYH A;  2QS4 A;  3TTN A;  3G3F A;  2CEY A;  4UAC A;  3H6V A;  1P1N A;  4KR5 A;  4NF5 B;  4H46 A;  1OIB A;  1LBZ A;  2HAV A;  1O7T A;  4F2Q A;  4FJP A;  4LP2 B;  5EQ9 A;  2X7P A;  4F22 A;  1FTM A;  3OMB A;  4XFE A;  3IOV A;  1TT1 A;  2HQ0 A;  2QS2 A;  1FTA A;  5DVJ A;  2JJK A;  1EZ9 A;  2THI A;  4LZ7 A;  2AL4 A;  3MPL A;  2D21 A;  3Q28 A;  2XXP A;  5EYH A;  2AIX A;  4YB6 A;  1VE4 A;  3FV2 A;  3FJG A;  2ABH A;  4NMY A;  1B6H A;  1SYH A;  4OA4 A;  2Z22 A;  1INP A;  1SI1 A;  3KGC A;  3OEL A;  3QAX A;  4PBH A;  2XXU A;  5CBR A;  4RJZ A;  1N84 A;  2FIE A;  4O3B A;  3IOU A;  3TCG A;  2V3U A;  2ZNT A;  4H8I A;  1RYO A;  2WYP A;  4K3F A;  1FBH A;  1LEV A;  1MG1 A;  2XWV A;  3RT6 B;  3HHF A;  1H3D A;  4NAP A;  1M5E A;  3MVW A;  1IUD A;  4PBQ A;  1XVX A;  1K9Z A;  3FGS A;  4Q0C A;  3T0J A;  4PGP A;  3C4M A;  5TU0 A;  1R9L A;  3VFJ A;  1Q9D A;  1NUZ A;  2ZYN A;  2OWS A;  1D9Q A;  1NV7 A;  1UTB A;  1B3H A;  1T0K A;  1QUK A;  2F3D A;  1JW1 A;  2O51 A;  4X9T A;  3SEU A;  3S9L C;  1BP5 A;  4I40 A;  2Y5K A;  1NV0 A;  1CB6 A;  3PUV E;  4YKP A;  2YLN A;  4XKN A;  3SEY A;  3E4R A;  2P2A A;  4U21 A;  2O6A A;  3E79 A;  5ICQ A;  4MHF A;  4ELO A;  3RY3 A;  2RC7 A;  4OYV A;  3ECR A;  1LCF A;  2MKZ A;  4ZEC A;  3SEW A;  3PMW A;  3PUY E;  4F39 A;  2XD3 A;  3KJ7 A;  4O8M A;  1JW4 A;  4H5G A;  1B46 A;  2HXR A;  4P0I A;  1RYX A;  1PEB A;  3E78 A;  2F7A A;  5FTH A;  3MPK A;  3FUZ A;  4YMB A;  2H5Y A;  2Z8F A;  1MXZ A;  1DSN A;  2DQV A;  3IB1 A;  1B51 A;  4AQ4 A;  1NV5 A;  3PV0 E;  5ET6 A;  3KZG A;  4H8J A;  5JTY B;  1OQG A;  4GQO A;  3DP6 A;  3ZKK A;  4OVJ A;  3C9H A;  3HCQ A;  1BIY A;  2ZXT A;  4R9G A;  1ZJL A;  1LFI A;  2CMO A;  4OER A;  4ND9 A;  2P3N A;  4HCW A;  3BFU A;  1YCJ A;  2IA4 A;  1XS5 A;  1N04 A;  1Y3Q A;  1GV8 A;  3RTW B;  1QVS A;  5ITP A;  3VXC A;  4PQJ A;  2ONR A;  2E1S A;  4TLM B;  1MY4 A;  4GX6 A;  2XXH A;  1D9V A;  1UTH B;  2Y5L A;  1BLF A;  4YKK A;  2QFL A;  3WAF A;  4YMA A;  3IAZ A;  3L6H A;  4U22 A;  2M8C A;  1B1H A;  2VD2 A;  3V89 B;  1A7L A;  4MAG A;  3TEP A;  1MY0 A;  4PTK A;  1FPF A;  3KSX A;  5T3J A;  1IIW A;  2Y7P A;  3K1P A;  3EQ1 A;  3IO6 A;  3IOR A;  3MC2 A;  4PFT A;  4N15 A;  4GD5 A;  4JXI A;  3OEK A;  2OPE A;  3KJT A;  5DVI A;  4YZZ A;  4OVR A;  2FBP A;  3H6U A;  4KCD A;  4UAB A;  1EZP A;  5ELV A;  4WXJ A;  1WVJ A;  3RPL B;  3N6T A;  3PU5 A;  5J16 A;  4G61 A;  3VLV A;  3I3V A;  4NED A;  5I57 A;  4P56 A;  3PMX A;  4OZ9 A;  2OX3 A;  1QKA A;  4LAT A;  3T9X B;  3MWB A;  2B65 A;  1ELJ A;  2HXW A;  1FPG A;  4NG7 A;  4U4S A;  3M3F A;  3HST A;  4EUO A;  1LAG E;  2XX9 A;  1FBG A;  3CG1 A;  4GXS B;  4XXU A;  5AA2 B;  3O28 A;  4QRZ A;  5I58 A;  1EYK A;  1TFA A;  3UP9 A;  4BDO A;  4JSD A;  3T22 A;  4JVI A;  2WBB A;  4X1D A;  1JW5 A;  4MNP A;  3C31 A;  2XXV A;  3C35 A;  4HE1 A;  4OAN A;  1LBB A;  4QSD A;  4F29 A;  1R9Q A;  1SYI A;  3A29 A;  2PMS A;  4U2R A;  1II5 A;  3VV5 A;  3MZ9 A;  5I58 B;  5KDT B;  4KI0 E;  1IMB A;  2VP1 A;  2FIX A;  3PPO A;  1QJM A;  1BTJ A;  5ET8 A;  1Q35 A;  4H5F A;  4MLV A;  5I3S A;  3E13 X;  2ZYK A;  1EZO A;  1S7Y A;  3EPE A;  3QXM A;  3OXN A;  2Y7R A;  1WDN A;  5EHS A;  1MQI A;  4NN3 A;  1NL5 A;  3SKP A;  4NF0 A;  5CMB A;  2KR0 A;  3MQ9 A;  3G3I A;  4PCD A;  2QVV A;  2F6P A;  3RPL A;  1FQD A;  4PAK A;  4GWW A;  2F6G A;  4KYS A;  4IY6 A;  1QUJ A;  5I5P A;  2XXY A;  5H8H A;  1N76 A;  2F5X A;  4P3L A;  3FIR A;  2DOJ A;  2R9J A;  1B5H A;  4IR8 A;  4F18 A;  3UIF A;  1NNP A;  2FNC A;  5DEX B;  4ISU A;  2XXK A;  1POT A;  1US4 A;  2KQZ A;  3OO9 A;  4E0X A;  2Q2A A;  3K1M A;  4UA8 A;  4JWO A;  4Z0I A;  1FSA A;  4NF6 B;  4XEQ A;  1MH3 A;  1FJ9 A;  4F1U A;  3RPW A;  5DT6 A;  1TFD A;  2NVU B;  4HS7 A;  1DTZ A;  1FPJ A;  4R74 A;  1FPL A;  2XWK A;  1XC1 A;  4QFN A;  1XVY A;  4RA1 A;  2ZNS A;  1LAF E;  3O97 A;  5IZ1 A;  2YJP A;  2O7U A;  1EYI A;  2NOO A;  2O1M A;  3K6X A;  4OVP A;  4ELQ A;  3IFC A;  4MIJ A;  3OO6 A;  1MY1 A;  2RKM A;  1R1N A;  1M5F A;  1SDX A;  1M5B A;  2W7Y A;  4OHN A;  2XXW A;  1B52 A;  3FAS A;  3RLF E;  3DP4 A;  1KZ8 A;  1URD A;  1NNF A;  3UN6 A;  4KYD A;  1RKM A;  2G93 A;  3HN0 A;  4IY5 A;  2XXT A;  3W15 C;  1DOT A;  1PBQ A;  5AA3 A;  1H44 A;  3UA8 A;  4H45 A;  4MMP A;  4QFL A;  4X04 A;  2AYS A;  2O7I A;  2UYE A;  4OVQ A;  1BKA A;  2XWO A;  2QS1 A;  1B3G A;  3U8Q A;  4DXB A;  4JB7 A;  3SER A;  5FHN A;  4GRK A;  4G8M A;  3CHG A;  1P1W A;  3ILT B;  5BUU A;  2DE4 A;  4HTG A;  4IB2 A;  2CZL A;  5IZZ A;  1FQF A;  1NNT A;  2Q9T A;  1MXV A;  4OFJ A;  1YPN A;  3O9P A;  3TTM A;  1UIV A;  5AA2 A;  4BDQ A;  3A09 A;  1MQJ A;  1FPD A;  1A40 A;  1B58 A;  3QUJ A;  3W9W A;  3PD9 A;  1JEV A;  3IO4 A;  1OQH A;  4JVC A;  2VT5 A;  2HAU A;  3V8X B;  3ISP A;  4DI4 B;  1VFD A;  3D4G A;  3CFZ A;  3S2V A;  1I6Q A;  4XKR A;  2G29 A;  2D3I A;  2E0S A;  2O84 X;  4O94 A;  1MH4 A;  3TCF A;  5A5L A;  3T9V A;  4H1X A;  1SW5 A;  3R6U A;  4H6D A;  3I6V A;  4X1B A;  3H6T A;  1B40 A;  2Z8E A;  1B05 A;  3IFA A;  4AS5 A;  3G3J A;  4FAJ A;  3MVX A;  4RYA A;  3C36 A;  4WEP A;  5L9M A;  3C33 A;  4FEC A;  2I3V A;  4RNS A;  3K2D A;  1UIU A;  1P1O A;  3LUZ A;  2PVU A;  2ONS A;  4N8Y A;  3LR1 A;  5KCJ A;  1NV1 A;  1POY 1;  3HO7 A;  3KG2 A;  2VOZ A;  3PPQ A;  2R71 A;  3SES A;  1SW1 A;  1B3F A;  2HHM A;  4L17 A;  4R72 A;  2XXQ A;  2RCB A;  5F1Q A;  3IX1 A;  3KSJ A;  4DI3 D;  4HXV A;  1P99 A;  3LBS A;  4G77 A;  3FBP A;  4PP0 A;  1YTV A;  4NQ8 A;  2Z8D A;  2F97 A;  3SZP A;  1YAE A;  4XF5 A;  3CSG A;  5FBP A;  1ZKB A;  3Q29 A;  4H65 A;  3ZS6 A;  2GHA A;  2OBG A;  1JVX A;  4M1V A;  4MCO A;  3R7X A;  4E0W A;  4MEV A;  4MF3 A;  1LGB C;  1AWB A;  4X48 A;  3T1B A;  1FPK A;  3TMG A;  3EF7 A;  3BFT A;  4EQB A;  2H99 A;  2ANJ A;  2DS9 A;  5AA4 A;  1LAX A;  3O6H A;  2DE3 A;  4ESX A;  5A5X B;  2DXY A;  1LFG A;  4P1E A;  1LBC A;  4QHQ A;  5L9S A;  4RPO A;  1SVX B;  1PB9 A;  4EXK A;  4R75 A;  4OTE A;  5H8H B;  1IMA A;  5AA1 A;  3H03 A;  1USY E;  5EQ8 A;  1QGX A;  5BWJ A;  4GL0 A;  3M3K A;  4EXL A;  5IM2 A;  1ANF A;  1ZMG A;  3JV9 A;  1FPB A;  2XXX A;  4ZEI A;  3HPI A;  2OWT A;  2ZYM A;  4WED A;  1I6A A;  4GWS A;  3OO8 A;  4EDP A;  2PYY A;  5EYF A;  2D5W A;  1NUX A;  2NXO A;  4GBV A;  4Z7E A;  1P1Q A;  1XI6 A;  1O63 A;  5AA2 D;  5IZ3 A;  1FQC A;  2VGQ A;  2O1L A;  4MJO A;  2B4M A;  2X7Q A;  1JEU A;  4DZ1 A;  1D3K A;  3GXA A;  2PX1 A;  5B7D A;  1B0L A;  2Y84 A;  1YYZ A;  4GBW A;  3K6W A;  4EQ9 A;  2F34 A;  1MRP A;  3EHS A;  2VPO A;  3MVY A;  2I3W A;  1H45 A;  1QKB A;  3IB2 A;  2XD2 A;  5KZT A;  2DWI A;  4GF8 A;  1M5C A;  1HSL A;  3PPR A;  1SW4 A;  5ISU A;  1LB8 A;  2P0S A;  4MBP A;  3ODB A;  3FD3 A;  4OFO A;  1EU8 A;  5CBS A;  4I8C A;  5I57 B;  4ZS9 A;  4Q30 B;  5TP9 A;  4JSO A;  4R2B A;  4DXC A;  1TXF A;  4AS4 A;  4GFR A;  2GH9 A;  3PGF A;  2PFZ A;  5CMK A;  5H8N A;  4DCY A;  1URG A;  3SDF A;  3THI A;  3QYT A;  1FW0 A;  2QS3 A;  3MVZ A;  4AB6 A;  1YXI A;  4NWC A;  1ZTY A;  1J1N A;  4O7I A;  4KYE A;  4IO3 A;  3ILU B;  3OEM A;  4PDD A;  3CIJ A;  3IR1 A;  2I0B A;  1RDZ A;  2QRY A;  4F3S A;  3S9N C;  4IO7 A;  2UVG A;  4BDL A;  3T9U A;  1LFH A;  2DXR A;  3JZJ A;  4G8N A;  2I4C A;  3KC0 A;  3USD A;  4XTC Q;  2Q8J A;  5DVF A;  3B6W A;  2FA7 A;  4LZ5 A;  1Y9U A;  2REG A;  3Q26 A;  5AE4 A;  1MY3 A;  3CR9 A;  3TCH A;  2O69 A;  5H8Q A;  4OEV A;  1MS7 A;  3QUF A;  4NHB A;  2F7C A;  3LV0 A;  1LBX A;  4HW8 A;  5B70 A;  3S9M C;  3BIH A;  1VR5 A;  3EKI A;  3FJM A;  3GBB A;  4I3E A;  4NTL A;  1IMF A;  4DLD A;  4ELR A;  2A5S A;  3DLN A;  3B8B A;  1A99 A;  4O7M A;  4BDM A;  1FBP A;  2DP8 A;  4NWD A;  1JP4 A;  1ATG A;  4F19 A;  2WEF A;  3K6V A;  4OQO A;  1B5J A;  3CFL A;  2I0C A;  2DWH A;  1DBZ A;  3G3H A;  2RCA A;  4GWY A;  1DTG A;  3VVD A;  4ZE9 A;  4GWO A;  4PGN A;  1L5T A;  3TFL A;  4IO5 A;  2Y7K A;  1IZ1 A;  3RN8 A;  4LON B;  4OET A;  3TQW A;  3RTF B;  4U23 A;  5F24 A;  5TPA A;  4NE4 A;  4XIG Q;  5I2K A;  4H67 A;  4PFR A;  4RK9 A;  1I6B A;  2Q89 A;  1ZIU A;  3K01 A;  2Z23 A;  1B7Z A;  4GWX A;  5IZ3 B;  2A5T B;  3D1R A;  1PDA A;  2HZK A;  4BDN A;  1JNF A;  4XKQ A;  2UVH A;  3OEN A;  4G8H A;  3O66 A;  3H4Z A;  3HV1 A;  1NNK A;  3KFM A;  3N26 A;  3MP1 A;  1M5D A;  3O29 A;  2UVJ A;  3G7W A;  5DEX A;  2GFE A;  2OCU A;  3FVN A;  4C0R A;  1F9B A;  3KEI A;  3S4U A;  4GOT A;  2ZZV A;  3ONM A;  3VLU A;  3LSX A;  1WOD A;  3MAM A;  3KOS A;  3GYY A;  1B2H A;  3IL1 B;  2OK2 A;  4GIZ A;  4ZZE A;  3FV1 A;  3E3K A;  2DE2 A;  5L8D A;  1LBY A;  3TAJ A;  3K6U A;  1FQB A;  3T9H B;  5K2Y A;  3OSR A;  2VD3 A;  1LLS A;  3O2A A;  4PC9 A;  4R6K A;  1URS A;  1JVY A;  4LUB A;  4WKM A;  3PD8 A;  1IME A;  3PUW E;  1MQH A;  1LCT A;  1PB8 A;  4PE3 A;  3TDJ A;  2RC9 A;  4N8G A;  5I84 A;  4IO2 A;  5TPA B;  3M8U A;  1AMF A;  4QXD A;  2GHB A;  1OVB A;  4BLA A;  2CZH A;  2XX8 A;  1NUW A;  2QVR A;  1USY H;  2ZNU A;  2KLF A;  1FBE A;  3EN3 A;  1Y1Z A;  1RDY A;  1H43 A;  2XHD A;  4ZED A;  5M2V A;  5HM4 B;  4FIM A;  4P11 A;  3U72 A; 
#chains in the Genus database with same CATH homology
 4O7I A;  4N15 A;  3RPL A;  2VPN A;  4H45 A;  4MMP A;  5EYH A;  1DK4 A;  1NI9 A;  2HHM A;  3QMF A;  4GWW A;  4PAK A;  4PDH A;  4PFB A;  4PFI A;  4PDD A;  4O8M A;  4OVQ A;  4YZZ A;  4NX1 A;  4OVR A;  1RDZ A;  2XWO A;  1NUX A;  2FBP A;  4UAB A;  1BK4 A;  1FPE A;  2HXR A;  4GBV A;  3RPL B;  4DI3 D;  1RDX A;  4HXV A;  3CHG A;  1XI6 A;  5I5P A;  2ZZW A;  5J16 A;  4G61 A;  1SPI A;  3FBP A;  2F5X A;  4OA4 A;  4P3L A;  3E78 A;  5IZ3 A;  1DCU A;  3KC0 A;  4X8R A;  1INP A;  4MJO A;  2DE4 A;  4N6K A;  4IR8 A;  2B4M A;  2P3V A;  2WX9 A;  3NOH A;  4NQ8 A;  2ZZV A;  4P56 A;  3SZP A;  2OX3 A;  5ESY A;  4F18 A;  5IZZ A;  4PBH A;  4XF5 A;  5FBP A;  4N91 A;  3B50 A;  2WYK A;  1IMD A;  2XXK A;  4GX4 A;  4PCD A;  5EYG A;  2Q9T A;  3GYY A;  4PF8 A;  4GX3 A;  2FIE A;  2KQZ A;  1LBV A;  3KC1 A;  5DW8 A;  2L5V A;  4M1V A;  4MCO A;  4NHB A;  1K9Y A;  4MEV A;  3LV0 A;  1LBX A;  4N17 A;  4OVS A;  1FPG A;  4NG7 A;  1G0I A;  5CM6 A;  1YYZ A;  4JVD A;  5J1D A;  4GBW A;  3BIH A;  1G0H A;  1KA0 A;  1NV5 A;  4I3Y A;  1VDW A;  3EKI A;  3MST A;  4NGU A;  3W9V A;  1AWB A;  1FPD A;  1FBG A;  5ET6 A;  3T1B A;  5IGA A;  1FPK A;  2DE2 A;  1FJ6 A;  4I3E A;  3W9W A;  4MNC A;  1FSA A;  4N81 A;  2VPO A;  4XEQ A;  3KBZ A;  2WYP A;  1FBH A;  2R8T A;  1LBY A;  1IMF A;  2OWZ A;  4FBP A;  5EQA A;  1FBC A;  4JVC A;  1EYK A;  1LEV A;  2VT5 A;  2GQ1 A;  3B8B A;  1FJ9 A;  4X04 A;  3ISP A;  4DI4 B;  4O7M A;  4F1U A;  1IMC A;  4HCY A;  2HZL A;  4PC9 A;  2Q74 A;  2XWV A;  4JVI A;  4P1L A;  1FBP A;  2DVZ A;  4F1V A;  2PFY A;  2WBB A;  2DE3 A;  1LBW A;  2FHY A;  1JP4 A;  2QVU A;  4MNP A;  2XWI A;  4N4U A;  2CZK A;  4PAF A;  1FRP A;  4NAP A;  4PF6 A;  1FPJ A;  4F19 A;  1FPL A;  2WEF A;  3U65 A;  1IME A;  2P3N A;  4HE1 A;  2XWK A;  4HCW A;  2DDK A;  5I7I A;  2XA5 A;  4OAN A;  4PBQ A;  1NV3 A;  1K9Z A;  4O94 A;  3T0J A;  5A5L A;  4P1E A;  1FPI A;  5LDZ A;  4PGP A;  4PE3 A;  2V4C A;  5IZ1 A;  3A29 A;  5EQ7 A;  1DBZ A;  2PCR A;  2CEY A;  4N8G A;  2QPQ A;  4YIC A;  1YZ0 A;  4GWZ A;  1EYI A;  1NUZ A;  1Q9D A;  5LTC A;  4GWY A;  4OVP A;  1D9Q A;  4H46 A;  3IFC A;  1NV7 A;  1NUY A;  4MIJ A;  4PGN A;  1LBZ A;  3IFA A;  5ET7 A;  2CEX A;  1IMB A;  4QXD A;  4AS5 A;  1IMA A;  2FIX A;  4MNI A;  4GX6 A;  4MX6 A;  4N6D A;  4P9K A;  4HE2 A;  5ET8 A;  4QBA A;  1NV4 A;  4LN5 A;  2WBD A;  2HPG A;  3PTY A;  2F3B A;  2F3D A;  1NV2 A;  2CZH A;  5EQ9 A;  5I3S A;  2Y5L A;  1NV6 A;  5F24 A;  4AS4 A;  4P8B A;  2QFL A;  4X9T A;  4XFE A;  5ET5 A;  5EQ8 A;  3HFU A;  2PFZ A;  1QGX A;  1NUW A;  2Y5K A;  4I40 A;  3BIG A;  2V3Q A;  1NV0 A;  2QVR A;  4PFR A;  2BJI A;  2FVZ A;  4OVT A;  3RYD A;  1CNQ A;  1KZ8 A;  1FBF A;  2CZI A;  1FBE A;  3FXB A;  3LUZ A;  4MAG A;  4PAI A;  4HE0 A;  1EYJ A;  4GWX A;  1RDY A;  5IZ3 B;  4NN3 A;  4N8Y A;  3D1R A;  4NF0 A;  2HZK A;  4PTK A;  3E79 A;  1NV1 A;  2ZZX A;  1FPF A;  1FTA A;  1FBD A;  5T3J A;  4MHF A;  5IM2 A;  2JJK A;  2Q8M A;  1FPB A;  3MYU A;  4KXP A;  4GWU A;  2B4L A;  1KA1 A;  1YXI A;  2KR0 A;  3ROJ A;  4PET A;  4GWS A;  2MKZ A;  4P47 A;  5JK4 A;  2QVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...