2Y5TA

Crystal structure of the pathogenic autoantibody ciic1 in complex with the triple-helical c1 peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
222
Chain Sequence
QVQLQQPGADLVRPGVSVKLSCKASGYTFTSYWMNWVKQRPGQGLEWIGMIHPSDSETRLSQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCARLKPGGTWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CIIC1 FAB FRAGMENT HEAVY CHAIN
publication title Crystal Structure of an Arthritogenic Anticollagen Immune Complex.
pubmed doi rcsb
total genus 47
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2011-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2y5tA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2y5tA02
4OF6A 1QSEE 5TE7L 3HPLB 5I8CB 5C0FB 4LMQE 1I3GL 5FUOL 4PRBB 5C0DB 1C12A 4PRNA 2MQCA 3DMMC 5DXWA 3D3VE 4O02H 3C8DA 3D6GA 1LEKA 1EEYA 3SE9L 4QCIB 1B2WH 1YNTB 1FSKB 2J8UB 5T1DH 4E0RA 4M3KB 3BGFB 4O2FA 4XBEL 3FT2B 3MUGA 1F4AA 3F7QA 2Y7QA 1SEQL 2XKNB 1GXEA 1K4CB 4KTEL 3NZHL 4GLRI 4PJFA 4CRPA 1H8SA 4PR5B 1NUFA 4OV6F 3IDXH 1NBQA 1IZJA 1E6JL 5IWLC 1JE6A 3FAWA 4IOSD 2DBLH 4F37K 1P4IL 3O2VH 4JFHD 4Z77B 3C6LA 1Q72H 1ROWA 4PLJD 5GIRB 4LNRB 5BJTB 4P46D 4HUVB 4Q0XH 3MJGX 4R7NA 3T2OA 1FNFA 2Q20A 1G7JB 3MNZB 1UYWL 3S5LA 5B39A 4WI6A 5LQBL 5I1IH 4XH2A 1P6FA 4DZ8B 3JUZA 1PG7W 3V52H 1URLA 3IJSB 4NRXA 1WTLA 1XF1A 1PKQE 4QRTB 3THML 2QJDA 3KPSA 4HC1L 2F58L 3KLDA 1W8OA 4PB0H 1GSMA 1GRWA 3VGDA 4X4YB 3S8WA 4L5FL 4CAGA 3MACL 3KLSA 4OZFH 4NGHL 3FQXB 1AKJA 1PW3A 4OGYL 1CGUA 1Q9OA 4FNLH 4BSVA 1EK3A 3JV0A 4JQXC 3LKRB 3B9KB 4HZAA 1NDMA 2HKFL 2VZSA 3H9SB 4JB9L 5F97E 4HH8A 1R5WB 4LHJB 3SJVD 3ARGD 3OG6B 4F3FB 1SEBA 1MFBL 2DAVA 5EC1A 5EU7E 5D5MB 4DUXA 2Y6SD 1QFUH 3BH8A 3F65A 4YHPA 4OM1L 4RISH 1JCKA 2ATKB 4HIIA 4LEXH 1N7ML 4Z7NF 3O81A 1UKQA 4PJEB 4NQDD 4D0BA 4LHUA 5EOQH 2ZZUT 1HHKB 3DX6B 5FGRA 1H8NA 2Q8AH 4HEME 2QSCH 4AEEA 2IPUG 1GPOH 4YR6B 5ADOH 5J4MA 3EOTL 1TITA 1HOCB 4HUUB 1I7UB 4I13B 4UIMB 4ZYKA 1I9JL 5CSGA 5E03A 1T5WB 3VCLA 2OK0L 3T0EB 4J3UA 1PYWA 1CL7H 5KAQG 1SBBA 4JY4A 5B22A 3FQNA 3V8CA 1A6AB 4ODWB 5GRJL 5JR1H 1DQMH 1LEGA 5HDQH 3S4SG 1JWMA 1NFKA 2A2QT 2J88H 1KIQA 2P45B 4RNRA 4ODVH 1GJIA 4LSVH 1SYVA 3BRDA 5EORH 3VFUB 3SOBL 1ZLVH 3B6SB 1R3LB 3UTSE 5LXGH 3PJSA 1N4XL 5DRNB 5JHDE 1A6ZB 3GMLA 3MNVA 3MGTB 3JVGA 4Y4KA 3ALPA 3C6SB 5D70H 3F7RA 3L6FA 3UJIH 3NZ8B 4S1DC 3WKMH 5JZ7C 5I1EL 3P0VL 1L9NA 3BWAB 5I1LB 4RQQA 1YDPA 3KYAA 3QHFL 2W0KA 1OPGL 3TBWB 3KLHD 1NL0L 4PGJA 5DO2C 4RZCB 2Q7YB 3NCJL 4OZFA 1DQJB 4MVBC 4PJFF 2DMBA 3M1BB 2G9HA 1PQZB 3ARYA 4BFEA 1LE5A 1I9RL 4KZEH 1LK2A 5C08D 1MCDA 1N6UA 3PWPE 4LSSL 5DI8A 4AEIL 5EBWA 4KHTH 1DQDL 2ICES 4D9LH 4CW1B 1MI5E 3C60A 5FA3A 1WAAA 5IHLB 4Q9QH 1FVEA 3BN9C 3TPKA 3S36X 2GY7B 2F19H 3VGAC 5GGRA 2AEIT 4MXVF 5ISZA 1XR8A 3A6OA 4K3JL 3RPIA 1LE9B 3ZMRA 1RZIB 1B88A 2E7BA 1E27B 2WBJD 4OLVL 2CMRL 2R9HC 1XGYH 2WBJC 3RU8L 3EO0B 1AD0A 4Q7DA 4Z7WE 2F74A 4DOHB 3MLTA 4MA7L 1FYTB 4HZLA 1C08B 1T7WA 2E7CA 1OGAB 3EIFA 5JDSA 4E42B 1KCKA 4JFOA 4P4RB 5FYJH 3RKDC 1G9NC 3S3PA 2W0LA 4L4TA 2VQUA 5J9PB 4WUUE 2MSPA 4QXGH 3MV8A 3DURB 4MHHG 3VXPB 4G8GA 1A7NH 3T3ME 3W81A 1XF4A 3CFKB 4XCCL 2JJUA 2J1KA 4DK3A 3Q1SH 3O4LA 1HE7A 3MLUH 3ZKMD 2P5WB 2XN9A 3OF6A 3LDBB 3KGRA 4NFCA 4WFHD 3NFPB 4L3CA 5D1ZA 4JFXA 2BNUA 1MFEH 3ZKMC 3C5ZD 4IOIA 5HGBA 4OJFL 5HHMB 5CS7A 2C1PA 3REVA 4F58L 3EDFA 1PY9A 1YYLH 5F7YC 4XB7A 1YC8A 3MRRA 3KLAA 5EDXA 2Z31A 3MV11 2ITCA 3O3UN 4CVZA 4MAYA 3LEYL 4NWUH 2H8PB 2NW3B 3S96A 5D1XA 4RX4A 5IW6B 3QNYB 4TRPH 1HILB 1YNKH 4PGCB 5IHUH 4OCRL 5BZDA 2E9BA 3S36L 5CD5C 4DKAA 1GH7A 3A67L 3B5GA 3DVGA 1AGDB 1KJVB 3KPOB 2V9TA 5E5MB 3TA3C 3V6ZB 3BRGC 4DVRH 4MJ5A 1G9MC 5DK2B 2IAMB 1I7RA 4MDJB 4MD0A 2R0WL 4KJQD 2VLRD 5JOPD 2ADIB 2GW5A 4JRYA 3SE8L 4KJQC 3IDIA 3U7YH 5CEXA 1V3MA 4HG4J 4S1RL 4FQJL 5GZOD 5IB4A 5D7IE 4LP5A 4I3SH 1I3UA 15C8L 1OARH 1WWCA 1BEYL 3TZVB 4TPRH 3V0VB 3HZYA 1DQQA 2Z8VC 4H8WH 3O6LH 1LP9A 2XTJC 4KJWC 4J12A 4CKVX 5SV4A 1SJXA 1A22B 1NCCL 1MVFA 2HJKA 2VXUH 4TVSa 2PKDA 3GSQB 3D85A 3IXAB 1SY6L 5GHWL 4JM2B 2GI7A 1IM3A 4M61B 1F4WH 1FLTX 3QDGA 3IS1X 2LU4A 3CXHK 5C0IA 2HFGL 4I4WB 4PTUA 3LPGA 3E6HA 4EJ1C 5KJRL 1O5DT 2FYYB 4LDOB 2W9DL 4RFEB 3IAQA 2VN7A 3PV7A 2ZCLL 1MUJA 1QSEA 4HULB 1X5KA 3G6AA 3SDAB 1HDMA 3MLYL 2A6DB 2WWKO 3C2AL 5CFHA 1F6LL 2HJLA 3D3VA 5DMYA 5IFJB 4QRPE 1KFAL 4PJ9C 2YD5A 3RBSA 4KUZH 5C0JB 1YQVH 2XA3A 3VRLF 2JLLA 1RMFH 3H0TA 5C2BL 1QRNB 3CH8A 4N1HB 3QIUB 1IGMH 2NXYB 3LCYA 4C4KO 2AQ2A 1X7QA 5DD6B 3L3GB 5E1HB 4OTXL 3QQ3A 3RA7L 3L3HB 1T1YB 1E28A 1P9MC 4HSQA 4Z0XB 3TN0B 2NY7L 2E8ZA 5FK9A 2V2TA 2R2CA 1GZQB 4LCCA 1IGCH 4G6JL 3DVNB 4U1IB 3QAZB 5I1CL 1UH2A 1ZT7B 4XAWL 1UCBL 3DI3B 4FQ2H 4XC1L 4Y5YC 1F2QA 5JW4N 4DW2H 1EDQA 4NNXB 2BVQB 3BE1H 3KPTA 3K8KA 2B5IB 1E4JA 4JFFD 4PJDE 2E9JA 3CVHB 3HR5B 2PW1A 3OXSB 3WNOA 1HZHL 4G9DA 4JN1H 5HHOA 1RIVL 1JHLH 3GM8A 1MF2H 1FGVL 4K7PH 3UTTE 3T77A 4NNPH 1QFPA 5K9OA 2YRPA 4ZUTA 4OLYH 2IPUK 2C3VB 4HQQL 4OIBA 2DQJL 1WF5A 4UTAH 4G8EA 2EYRA 2DLIA 3OHXB 5EBMA 4YXHH 4R4FH 2J8UE 3MUY1 3IDGA 1I75A 2I9LB 1V7NL 5HGHA 1QSFD 4X7TB 1U8QB 5T1KA 2NZ9D 2X4OB 3OXRA 3IB4A 1XZ0A 2X4TA 3P4OA 4JZOA 1KSRA 2GCYA 4OM0L 3WHE0 4WHDA 4WUKL 2AJZB 3TYFA 1U8NA 5B38B 4U6HB 4ACPA 5FKAA 2ZP0T 1KPRB 1OGTB 3BJ91 5DJCB 5DRXB 4BH7B 4RWHA 4WWKB 3WL9A 2CD0A 4MNGB 5HYJA 1DJSA 3F6LA 1LMKA 4LLWB 3DVFA 3HFML 5C0RH 2JK5A 1V7ML 1FNHA 3TIEA 1N59A 4ZUSB 2AI0L 3C6LD 1F4HA 4X7SL 3WLBB 1SMOA 1S8DB 1NBZA 1LP9F 3DXAB 1MJUL 4HIXL 3U7AA 1XCQA 2WSKA 4LIQH 1BAFH 1JTTA 5DR5L 4YK4C 1S7UB 3RAJH 1N0LA 5F9OL 3MCLL 3WIIL 5IBLD 2PO6B 5E6ZA 3O3DA 3KPSD 2CKNA 4JKWA 3OJDA 4UT9H 2AERT 2FHBA 3H9SE 2X4RA 5D4QA 4I9WD 5AZEH 4OZIB 3LMJL 3DV6B 1NBYA 1F3DJ 1U58B 3PWNA 1AR1C 1QFWH 1CFTB 2AK4B 1UH3A 2OL3H 4XPGL 1UWXK 1PDKA 2ZNWA 1YEKL 4PRPA 2AJXL 5EULV 3BH9B 3P30L 4YFLI 1CD0A 1P7QB 5HVFB 1JZ3A 3CDCA 3NN8B 2QQNH 1FQ9C 4TYUA 5EOCJ 3I50L 1PX3A 1ZGLM 2EXYD 4H26A 4HMCA 2ZG3A 3VXMD 2AK1H 3LIZH 3T0EE 4KU1A 3LPWA 4LHUD 3TT1L 5IOPA 5I8EA 3DNKA 4JRXD 1VADA 4RIRA 3PWPA 4X0KB 5DMJB 2AJUL 4I18B 5FDYA 2GTZA 3QO1B 7CGTA 3OR6B 5IROA 5GJSL 3GKZA 2HKHH 3ZKXC 2FLBT 3A6CL 3ARBA 1I8MA 2VLMD 1INDL 2UVEA 1X5JA 4NYLB 2ATPA 5BOPA 4I5BA 3VWJA 1U0QA 5F3HB 5L9DH 1CG9A 4G6MH 3OGCB 5J6HA 1EJOL 3MCKB 3K2UL 3TNMB 4OAWB 3PWVA 3WJLC 1DBKH 5CEZL 1HHIB 2N4IA 1PG7H 2H3NA 2DLEA 1MFCL 4ZPTB 4ZAKC 4NP4L 2AQ3A 3QIBD 1E4KA 4BFIB 3QRFM 4G6FB 4P23C 4A6YB 3PGFL 4ZUWB 5C0AA 3SKMB 4NOBA 2I25N 2J4WH 2EDHA 3AMLA 4YE4L 4R90L 1L0XA 4YDLC 4QHNA 1YY8A 2YEZA 1T04A 4WV1A 4Y4FC 5CSZA 2DQIL 1K4DB 2UZXB 1KN4H 4ETQB 4Y4KD 1CTNA 3G6DL 5HYFA 1CE6B 1DBMH 4WUUA 3S97C 5KN5A 2VDMH 4LPYA 4XVUD 1GVIA 5F44A 4Y4KC 4S1QH 1GOGA 2IF7A 2XWBB 1F3JB 5DD5L 3MRGA 4XVUC 5F89B 3QR2A 5C0BA 5AAMA 3FN9A 1BJ1H 1J8HD 4G5ZL 5T3ZH 1MOEA 3QO0A 3MRNB 2CLRB 1RK0A 5F93C 4HJ0D 4AENB 2JJSC 1T89A 4F9PA 3ULUL 3OZ9L 5DEGB 1A7OH 3MMEB 3VXUB 2Q7NA 1CZ8H 4QLRA 3R0MA 3E8UL 4GBXC 2R2EB 3K74B 1CXHA 4JDZA 2OL3A 5GGSY 3FB8B 3EYOB 4NHUA 1CE1L 3P9WB 5FKPA 2XYCA 2RIKA 3NFSH 5CZXC 2NY2B 3VMNA 3VDAA 4QTIL 2Z92B 4P3CH 1TQCB 4HBQA 3C60D 3QNXB 4RBPK 2ZUTA 4Y1AB 4YQXL 5IMKA 3BIKB 3G5ZA 2O5YH 1OGAE 3FFCD 2W60A 1A6TB 1WTGT 4LLDA 2ZWLT 3TO2B 4OLXH 4RDQG 1TJGH 3CFJA 2ADFH 1FN4B 3WO4C 4I2XA 5FGBA 3FZUD 4I8DA 3N06B 3IAPA 5D7SL 2ICWJ 1A02N 5ID1B 1KIUA 3PWUB 5CJQH 5DK0A 3IDYB 1MCSA 5F3BB 4G8FB 4UAOC 5SWQA 5D7IA 1AXTH 1AGEB 4GG8A 5H8DA 1TJHL 3BKMH 3BOVA 3OKOB 5CKAA 4Y2OA 3N85L 1IEBA 3PWLB 4WEBL 3U9PL 1J0KA 5E2TH 1KJ3L 1KJ2A 4H1LG 4K3GA 4AMKL 4CMHC 2CK0L 2P5WE 3V8OA 1AP2B 5HBBA 1MIML 4IS6A 2F53A 4FOMA 4P4KB 3K80A 5MHSE 4G8GD 5TDNB 5HHME 3WD5H 3E6FB 1TTGA 3MLSH 3P9MB 3Q6FA 2BOCA 1UZ8B 4R2GD 4CADA 4LAJH 3PF2A 3INUH 4YHLL 1T3FB 3BZ4B 5I66A 3CC5B 3DPBA 2XN9D 1CR9H 1MREH 2VABA 1EO8H 2E27H 5D1ZD 1QR4A 4M02A 1A2YA 1A3RL 4PREA 4LNVA 1MPAL 3SKNB 1Q9WB 2CK2A 5IFHH 5ID0A 3QQ9D 2WUCL 2NNAA 5GRYA 1YNLL 1KCUL 1T22A 4HWEL 2XZCL 4QRPA 2QQQA 3BPNC 3ZYOA 1G7QA 2PYEB 1LD9A 3S6CA 3DARA 5D1XD 3GGWA 4RX4D 1EEZB 3TLRA 2Z31C 4K23H 1KYOK 4MAYC 3F6IA 1T6VN 3HUJB 1IMHC 5BO1L 3BDYH 1I1RA 2Z4QA 4EI5C 3MX0A 5T5NG 3VFGL 2HRPL 5AZ2L 3N9GL 3P2TA 5EPMB 4BZ1L 4ZFZB 4JEGB 3RWDA 3M45A 4OLUL 1CIUA 4J1UB 4JRYD 3BD3A 5ESVA 3IXTB 3HNVL 2X4SA 2Q86B 3KR3H 4YXLL 3QUXB 4TTDC 3UMTA 1A14L 1B0RA 1CDGA 4XI5D 3FKUS 3DLQR 4G6AD 5JIKA 5IV2A 1XH3A 3RTQB 4K2UH 2PTTA 3ARUA 1DVFA 3K1DA 5FCUL 4NQVA 4XTRD 3MR9A 5CEYB 3X3GH 2IPKB 4K3HA 1JL8A 3EFFA 2WQ8A 4LAQH 4PS4L 3I6GB 2CDFB 3IKCA 4LARH 1AIFA 3D85D 4B53A 3MV9A 3HPLA 5I8CA 5C0FA 3OMZA 3ZO0A 5HVWA 1KCSL 1U8KB 4JFPA 1R0AH 3QDGD 1EHXA 4QXUL 1I1AB 3VFSB 3O6FD 5I30L 4X7FC 2PW2A 5DT1H 5FYJD 4GRWE 5HYSB 1LDPL 1U6AL 4YGAB 1T1ZB 4JGUA 4L8BB 1CXLA 1QSED 4JVWA 4OZGB 5F6IC 4HPYH 1QRNE 3MXVH 3UZQA 3TYGH 4JO1L 2AXGB 1B0GB 3D3VD 2YXMA 1XGPB 2EE2A 1LDSA 3I75A 4ONGL 2XKNA 1NMBL 4XP4H 1K4CA 2WWKT 4QWWD 4PR5A 1D5BB 3HE6D 4L3AA 4YXKL 3OJVC 3VD3A 5I73C 3R8QA 4Z7VE 3RHWK 3FFDB 5GS0H 4AK1A 4QWWC 4QRUB 5DJ2A 3VD9A 4MA8L 4WW2B 2WIIA 4YDKL 5BQ7B 2Y9RT 1VEOA 5BJTA 4ZSOE 4HUVA 2BNQA 2GSGB 2P24B 2DQHL 5IBTL 4L8CB 3U1SL 5JQ6H 1KNOB 2AJSH 1XF2A 4MNQB 1G7JA 3MNZA 3MJ6A 2NR6D 5DVKA 5D7IF 4XVTH 4C4KT 1A7RH 4GAGL 4ZTOH 4KQ4H 1NCBH 1VACB 3F5WB 2R0KH 1N6VA 3ZE2E 5IVXB 5I8KL 2HT3D 1A64A 1WZ1L 4IJ3C 3IFOA 2BSRA 5GGTH 3IJSA 2P5EA 2R0LH 5T1MA 4LCCC 3TH4T 5C3TA 1WCBB 1HH9B 4PJ5B 4UTBH 4QOKE 32C2B 1C5DA 4OLEA 4KJYB 3OB0H 3SDXA 5I71C 2ENSA 3LKSB 2CJUH 2QEJA 1JNHB 3CFEB 4PJ7B 4TOYL 1U8HB 2MKLC 3GHEL 3KWWB 3CXHJ 3V6OE 2XWTA 3PQYB 3UBXG 3WKNA 3NCYS 3ULVE 4PV9A 3LKRA 4J3XA 1FO0L 1YEFL 3QH3A 4HCRL 3H9SA 5DJZB 4MXQC 3C8HA 4L4VE 1BJ8A 4X6CA 3GRWA 3FHAA 3LB6C 1VFBA 4HIHA 1FGNH 3X13B 5D5MA 3CU7A 4H8WC 1QUNA 3O2DH 1YA5A 2GQHA 5D71H 2ATKA 2VDRL 1D9KD 3QUZC 3S37L 4PJEA 3TCLB 5HHVL 4MNGE 1HHKA 5T1KD 3DX6A 1P7KA 1LO3L 2A83A 4Z76B 3NA9L 5EUOA 1CDBA 2GAZB 4YR6A 2MHAB 1HOCA 1AC6A 4HUUA 4JANB 1I7UA 4UIMA 4OCXH 3UYPA 3EJYD 1T5WA 1EPFA 1P4LB 1A6UH 3DXAE 2FBJL 3WFZA 4ZOAA 3UBXI 1Q0XH 5HYJD 4U1HA 1A6AA 2MCPL 2E7LC 2D9QB 1OAXL 2R1WB 2AXFA 3VG9C 2OR9L 4W81A 5GGVH 4YEFA 3KYOB 5EWIH 3UC0L 4FFWD 3HI6H 4KK5D 5IJKA 4HFUH 3X14B 1B4JH 4Y8AA 1JFQH 2VZVA 4NN6C 4P2RA 4NOFA 3VFUA 3MBXL 8FABA 1XF3A 1F8TH 3JSSA 2C3HA 3ARVA 4RAVB 3B6SA 1R3LA 5SX4I 3P73B 4PBVC 1INEH 1KPVB 2HTKD 4MJ2A 4ZUUB 3DV4A 5DRNA 1FNEA 4IRJA 1TLKA 2IBZX 4JDVA 4HKJB 3MGTA 2WWMC 1L0QA 5DDHA 2J5LB 1TZIA 1K6QH 4OF8A 3STLB 5BVPH 3HB3D 2GSIA 1NBVL 5GGTA 5C0CA 4XP6L 4MA3B 2HMID 3DUHA 3EGSA 1LILA 3EZ8A 1DQTA 3UTSD 5L7XH 3QG6B 5C0ND 4K8RL 2QQKL 5JHLH 3CXDH 5HI4D 3TBWA 3DI2B 1MHHB 3DYPA 4MQXC 3S4SB 5C0NC 4XP5H 3MUZ1 4RZCA 2X4UA 5F88B 2Q7YA 2WAHA 2YA2A 1DQJA 4PRPD 1OL0A 5DA4A 2Q76B 2IQ9H 4P57B 4Q6YA 1PQZA 3RI5F 4LCIH 2ADGB 4FFVC 2WV3A 4MNHB 2ARJA 3RGVD 3GO1L 3BX7C 5HTSA 4XNMA 1IT9L 3SCMD 4GS7B 9CGTA 3N1PC 4RRPA 4BUGA 4APQC 3TPUB 1OT1A 4PJ8B 1UT9A 4PV8A 3O3EB 2VUOA 1KCRH 1RZIA 4DKFL 3O2DA 3MZTA 3CDGB 1VDGA 3PWPD 2GY5A 1A3LL 4U1MA 1ITCA 2IQAB 4F8TA 2GJJA 4RAHA 3LKQB 2FX9H 1TCRB 4DKEH 5IW1A 1TETL 2W0PA 3ARBD 4WY7L 2FR4B 1YEHL 3OKDB 5IROC 4WHTB 2NY0B 1BP3B 1FYTA 1C08A 3BHBB 5IK3A 3VWJD 3ARBC 2ZJSH 2IANB 1GAFH 2VDQL 4J3TA 3LZFH 5KVDL 1DDHA 4GMTH 4WU7B 4DWHA 4QHMA 4U3XA 4NNYB 2X4PA 1J7VR 1EAPA 4WU5B 1S3KH 3DHMA 4P2OA 4W6YB 4LVEA 3QCUL 5J7CC 2BXZA 3IJHB 3TVMA 2FO1A 2G5BB 1S5HB 5LKNA 3QDMB 3QXUA 1VPOL 3AY4A 2O5XH 3CFKA 4KK9D 4PG9A 3RJQB 1IAOA 5I1HL 1ED3B 3S3SA 5D5MF 2P5WA 3V79C 5JA9A 4R97C 5DA0B 3VXUE 3ZE0E 2FBOJ 4WUUD 3NFPA 3WDJA 4PJEF 4O5LL 4HS3A 2AXJA 5IMOA 2FB4H 1FNLA 4B7IA 3A6BL 3L5WA 5C0BD 1T1WB 3ZLQC 4PRAB 4ONHB 5EA0L 5AUMB 5E2UL 1NCDL 1M71B 3WCYA 1DBJL 2H8PA 2NW3A 4MMZC 3HRPA 4Y1AE 3QNYA 5IW6A 1HILA 5I1JL 5FOJA 3UPRA 2C4FU 4F9PC 3W2DH 2LFGA 1PX4A 1FZMB 1L7IH 1UWGH 5FO8B 2XNAB 3IDJB 3KPOA 5E5MA 1YEJH 4LEOA 4OCYL 3E2HB 1AI1H 3V6ZA 1BQHG 2WK2A 4YHZL 4ZNEA 1S7XA 3LRGA 2NY6D 3UYRH 3KJ4B 5I16B 2NY3B 2ADIA 3BP5B 1UACH 3CD4A 5SX5K 4N0FB 4OCWH 4EDWH 2EDWA 2I60L 4F80A 2RGSA 1NMCC 3RFZC 1FFPA 5DD1H 4RGMB 3SKUD 3BAEH 2VSDA 3TZVA 3GKWH 2CQVA 2FEEI 3WFCH 1KTLB 3FRPG 1JK8A 3L5XL 1QEWB 5B21A 3NVQA 3RL2A 5C6TL 1EO7A 1RI8A 5J11B 1T2QH 3BEWA 3GSQA 1X5IA 4F9LC 4JM2A 4M61A 4K9EH 4EDXB 5ENWA 4TQEH 1GHFH 2FHCA 2YOCA 4NSKA 4RCAA 4U7KA 2PNDA 2NYYC 1NLBH 4NKIH 2LQRA 2FYYA 3K7UA 4ZDHA 3OG4B 2F53D 3T0BA 3D48R 2G60H 1HI6A 5L6YL 3BKCL 3K46A 1KPUA 5GPRA 1U3HB 2WBWB 2VLKA 3SDAA 1HINL 2A6DA 1FIGH 2ED7A 1R5IB 5B4MD 4N68A 1ZSDB 5SWSB 4H0IA 2HVKB 5J1SC 3F58H 1QBMH 1GL4B 4Y2DA 3RWFB 5B4MC 5JPMA 3BPOC 4NM4H 1PZUB 4XCYB 4DAGH 3AREB 5F7FA 2B4CH 4JGMA 2CGRL 3IGAA 4JZJB 5AYUL 3FT4B 3HUJE 4WO4D 1HH6B 1N2RA 1QRNA 5HPMB 1OTSD 3QIUA 1FRGL 3IFPA 4NT6B 4QRPD 3VXRB 1OTSC 3V5KB 1I1YB 1LEIB 3QUYA 1ZLWK 3BD5A 4M5ZL 2J2ZA 1KCVL 1FV1B 1CLZL 2Z8RA 3DVNA 1GC1L 4U1IA 5DQJB 5DFTA 1F3DH 1OB1B 3IJYB 4JFDA 3D9AH 1TQBC 4EUPG 4GAFB 5JOFB 5C3LD 5SWZA 3PGDA 4N9OB 3ULSA 2BVQA 3WBDA 3GI9L 3HR5A 3OXSA 4JR9H 4HPOH 4NO0D 4JG1H 3ES6A 4KROD 4FQLH 4BYHA 1EA9C 5EOCH 1GGBH 4ODSH 1WIOA 4MX7B 2F8OA 3V95A 4XWGH 2C3VA 3VMOA 3QT2A 1DVFC 2JIXB 5GXBB 4G3YH 2NW2B 4NC1C 3BZFB 3RDTB 3BZDA 1F6AA 4OZGE 1P84K 3OHXA 4EBQH 1QPPA 1YN6B 2EE6A 4JLRA 1ORSB 4JO3L 3CMOL 2J8OA 3RWJB 4IDJL 4PIRF 4NQCB 3ARTA 4X7TA 1JGLH 1IC7L 3FN3A 5BS0B 4ZOCA 1ADQL 1U8QA 1I8KB 2JB5H 2X4OA 4JO2L 4KZDH 4XB8A 5HDBF 1UXSB 3LS5H 3UJJH 4M7LL 3OTTA 2DYPB 4H0GA 2CUHA 4PTTB 4U6HA 5ANMA 1X9QA 4WFGE 1KPRA 1KYOJ 5DJCA 1OT2A 4KTDH 4MNGA 2XWJB 4MNQE 3DO7B 2EH8H 3IAGC 5ELIA 2W65B 5DC4B 4G43A 1NAKL 3QFJA 5IVXE 1J5OL 4QRRB 2R69H 3OX8B 4ZUSA 4XNQB 3QXVA 1U8JB 4XPBL 3CLFL 3CZJA 3HZVB 4X6EB 3AM8A 3WLBA 3NIGE 2XQBL 4PJ5E 2AKRB 1PY4A 3WFDL 3I2CH 4NBYB 4PJ7E 5ITFA 4DGYL 4JM2F 2BC4A 5D2NB 2VDLH 4YBQC 3SDYL 1UWEL 2V9QA 3MV7B 4ZFGH 3PQYE 2PO6A 1BQLL 3EOBB 1CDYA 1JWSB 4J8RA 1A9BB 4KI1A 1R5VA 2ADJB 2D7QA 2YD8A 4HDIB 5LGHH 1FL5B 4JY5L 1HXMB 3I3DA 3M07A 3JV4A 1U8IB 4OZIA 3DV6A 1MCPH 5KVFH 3D39B 4FZ8H 3H9HB 1U58A 3JV6B 1VFMA 1ZT1A 5JLZB 1CFTA 1J1PH 3GBLA 5K9KB 3U0WH 2AK4A 3G9AB 3Q5TA 4BM7A 2FJFB 2YKLL 1JUFA 1TPXC 3MO1A 3B9KD 3O8XA 1EUUA 1UVQB 3RPKA 2ZG1A 3H9SD 2KPNA 5IKCA 5EBGA 1P7QA 4YFDB 1GGUA 1CLOL 1YECH 3H6JA 3NN8A 1ZA3B 2UY7A 1HNGA 5D1QC 2KZ1B 3EJZC 4FXKB 1A1NB 1IC4H 1FVDB 3LD8B 2VLLB 3O2WH 1OCWL 1NGQL 3RUGB 3L5JA 1RUKH 5DVOA 1I85A 2H9GA 3GB7B 3AXLA 4P9HL 1PZ5B 2OYPA 1II4E 1TNMA 3X12B 1DEDA 1FPTH 3L3OA 3D18B 3P0YL 4X0KA 4I18A 1T03H 1ORQB 3UJTH 3QO1A 1JZ4A 4PLOB 1AGFB 3OR6A 3WS6A 4DZBA 5E6IC 2W38A 5F70A 5D7JC 4KVNH 4NYLA 4TNVK 3T0ED 5MENB 4NRZB 4X7CC 1BWWA 2VR9A 5F3HA 4WJ5B 4PJIA 3WDIA 5HD8C 2GEEA 2HH0L 2YZ8A 3HCVB 3FB7A 3MCKA 3ZE2F 3OKMB 1RIHL 1CVRA 4ODBD 4W68A 4OAWA 1PLGL 4AL8L 4DQOH 1HHIA 5IB1B 3GSOA 1NFIB 2EDQA 2APTA 5IGXL 2PXYB 3EYSH 2YRZA 5GISL 4LCWB 4LSPH 4MB4A 4ODUB 1V8HA 5IJKC 4ZUWA 2R4RL 5GS0C 1N7MH 2AP2A 2DJSA 2YMXH 4XXDB 2XZQH 1S7SB 4UU9B 3MREA 4ETQA 3RZCB 5L88L 3W9DA 4FZEL 3ULVF 4M7KL 5D7KD 4MAUH 4IRJC 1CE6A 2YD2A 4LDEB 5JIIA 4Q6IB 3ZSSA 3OPZH 4ZD3L 2W07A 4M7ZB 1HXYB 1QQDB 3D5OF 5F89A 2HLFC 2EDDA 3ABZA 4M8QA 3U30B 4GJTB 5KSBB 5DTFB 3RY5A 5C07A 4AENA 1X5GA 3HHRB 3IYLW 4UILH 3MMEA 1EBAA 4QHLB 5F7LB 1DL7L 2X70B 4TSAL 12E8H 4J4PA 2OTWA 5EIVA 2NCMA 1EO5A 4YDJB 3MYZA 2FX7L 3FB8A 2VISB 3QUML 4D3CH 4OQ1A 5F1KC 5IG7B 5F9JB 4X5LA 5EB9A 1RJYB 2Z92A 5T3XL 1HYSC 4RFOL 4IRZL 2FSEA 3G04B 3QNXA 1S7QB 43CAB 2Y1VA 1EHLH 3PGCA 4AH2B 4FFYH 2IANE 4N90D 4P5MB 5DFVD 4MSWB 2OR8A 3TO2A 1ULVA 4PLKD 2GITB 4XHJD 3QEQA 5E5UB 5IHBA 3RWHB 5DUPH 1ETZB 5JXEA 4TVPL 2VDKL 4PLKC 2ICWA 4XHJC 4JKLA 4G9FB 3SDCA 5ID1A 1CGXA 1SQ2N 3NH7L 1MEXH 3PWUA 2FIKA 1FYTD 5C09B 1H8OA 1QR1B 1CXFA 1OGAD 4L9DA 4LF3B 4OZIF 3QDME 2X44D 3U4EB 1AGEA 2ZUXA 1AE6H 3FQUB 3OKOA 3GHBH 3PWLA 1WISA 2ITDB 1NC2A 3NGBB 1A4JB 3DGCR 3KJ6L 1QBBA 3GDBA 3QUKA 1FO0B 2VH5L 4D0CA 4ONFL 2V7NB 3B2UD 5F1NA 1Z3GL 3W82A 3ULUC 4DUVA 4NFDA 4JQVC 5HVHB 4P4KA 2YPKA 3QFDB 4P2OC 4NO5B 1NAMH 1MJ8H 2DKSA 3E6FA 2H1PL 3TVMC 1OAKH 5EO0A 1A6PA 1UB5B 2ILLA 1CGVA 4EIGB 5CZVL 4HLZH 2EEAA 3CC5A 1ACYH 5H35A 2P5WD 4OLVH 1MIEH 3WJJA 4KK8C 4U1GC 1CFNB 5E2VL 4F37F 5HHMD 3SKNA 5E99L 4Z7QF 1HWHB 1TVDA 1FL6B 4UT6H 1E6OL 3PXHA 4D2NA 4HV8B 1Q9WA 3VWKA 3F12B 3ZL4H 1CD8A 1LNUB 4OZHA 5IVZB 3V4VH 3MODH 3RWIB 3LRHA 3R1GL 5KS9B 5TPWL 3ZYIA 4YHIB 4ENED 3ZDZE 2PYEA 5J3HD 1QYGH 4H1LB 5FF6B 5CLTA 1BGXH 1J87A 3ZSTA 1CD1A 4M1CD 2DTML 5HYEA 3U0TB 2DQEH 4BFBD 4JJ5B 4OB5H 4M1CC 2NX5B 2IAMD 4F33B 3KHOA 3M8OH 2OQJA 5ALCL 4ZQKB 5D2LB 4EN3C 1CICA 2W91A 4J1UA 3JV5A 3QEHA 2FEDC 4GW4B 2Q86A 2LABA 3ARDB 3LQMA 4AT6A 1OTTC 4OJFH 5CBAB 2E9IA 4M62L 3QPQC 1W72L 3TZVD 4AJ0A 2VQTA 2IADB 3JTTB 3BGMB 3FB6B 4ORGB 3SN6N 3DIFB 4M3JA 1QRKA 1NEZG 3I6GA 5I75B 2CDFA 1EFXA 4D9QE 1UXWB 4JM2D 1ZEAL 4JHAH 4N0CD 1U8KA 1TTUA 2CRMA 3O9WB 4JREC 4PJHA 3SO3C 3T1FB 4F7MB 3FOLB 3VFSA 3MRPB 5T33H 4N0YH 3LH2H 6FABH 3G9VA 4N0CC 1AHWB 4NZRL 4TUKL 1HCFX 2VXSL 2YWYA 3VXNB 4JHZA 1NGXB 1T1ZA 5TQ0H 7FABL 4IIQC 1FNSL 4NQSB 4OZGA 4LLQA 2VLKD 3SDAD 5DGQA 4S1SH 4F7CB 4RMUA 2ZOKB 3LKNB 2BDNL 5CJXC 1NAMA 1B0GA 3KXFB 4JFYA 1BOYA 4N0UA 2EXWC 4TULH 4X5WB 3VFPB 4X7DC 1KEMH 3WN5B 4L8SB 3KPRB 4Y2DC 3PIQA 2QQLL 4KMTL 4HIEB 1MLBB 1D5BA 1MCWW 3MLPA 1A0QL 5DC0A 3T3PE 1QRND 3FFDA 1ZTXH 4U3CA 3KPPB 5CEZE 2EICA 2XFXA 2EH7L 3QDJB 3QIUD 4PGBA 4KI5C 1G7MB 2NXYD 1OF2B 2YD1A 2EC9T 3SKOA 4HK3N 3QIUC 3KYMA 4LHQB 3GMMB 1TZGH 2P24A 4OLWL 4L8CA 2M2DA 1KNOA 4OKVB 4JQIH 2DD8L 4GXVL 4QHUA 2CO6B 2A6JB 2B1AL 3F5WA 1JGUL 2VLJB 3QUYC 3E1F1 5DUBB 1WWWX 2ZUUA 3OKKB 4IRSB 5GRUH 4XX1G 3MJ7B 3BQUB 1C1EH 3C5JA 4WI9A 1E0OB 1WCBA 3UTPE 5C71A 3L3DB 4JVUA 2XZAH 1QLEH 32C2A 3LAFA 4KJYA 4M6AA 3P0GB 1AQDA 5MEOB 1QTYT 3LHPL 3PDGA 1U8HA 1BLNB 1H3VA 1CXEA 3SQBA 4ODTH 1CVSC 2D7TH 3PQYA 3ULUE 1PVHA 4NN7B 4OQTL 5JOEA 4JFZL 2WUBL 5FYLH 2IFFH 2M8XA 1TVHB 5BS0E 3QQNA 5JMOC 2CIKB 1FAIL 4MZ2A 1FORH 3DSFL 4YBLB 1HKLL 4OZHF 5A16A 2PETA 4WI3A 4HMEA 4HUNB 3ZDYF 3MCG1 4POZD 4LVOB 4BK4A 3ULVD 1UM6L 3RP1A 5CINH 4PRIB 4POZC 3WLWC 2K1MA 3HUJF 5IESL 5DYOB 4K9EC 2VDNH 3CK0H 3WIHH 4WNQB 1UCBH 4NQEA 2MHAA 4JDTL 4O2EB 4QRRE 4OUOA 4JANA 4O4YL 1UA6H 1WWBX 1P4LA 5HHNA 3PV6A 4G7YH 3UTQB 5C92A 3UBXB 1RIVH 5IB3B 3ELAT 4WWKD 4DN4L 2OMBA 1ZK9A 4QYOB 5D96C 3MFFB 4I0KA 2YD4A 3D2UB 4FG6C 5DGRA 1VFAB 3WHE1 1TENA 3KYOA 3DX7A 4YC2B 5F9DC 1BIHA 4V1DA 2B4CC 4Z95H 5AAWA 3BSZH 3DXAD 1I8IA 4FQ1L 1BD2A 3AM8C 1JMZA 4F57H 4RAVA 4XNZB 3HAEB 3P73A 4F8QA 1KPVA 2RFXB 4GAJH 3LS4L 3PDOA 1BFTA 5EIQA 5IQ9A 4PJHF 4HKJA 2PO6D 1O0VA 1T83A 2J7LA 3QXTA 5CGYD 4ZOEA 3STLA 4LP4A 4MZ3A 4W4OC 2F5BL 4I0PC 4MA3A 1P84J 5TGBB 5JTWA 5E08H 4OZGF 1SJEA 3QG6A 4RMQA 1MJJB 4ALAL 5ACZB 3EYFA 4UNVA 4JG0L 5B8CA 2LVCA 1H3GA 1KT2A 3I9GL 4WCYH 2AK4D 1Z2KA 2OP4H 4JZNA 4NCDA 1MFDH 4U6XB 1JRHH 3FMGL 2HFTA 4O00A 3O0RH 3O8XD 5HHXL 1EZVY 4R96A 2Q76A 3GI8L 3T2QA 1LO0H 4P57A 2ADGA 1F4YH 1P7QD 2OZ4H 3W0WB 3O8XC 1MRCL 4G7VH 4MNHA 1CD9B 4HIXH 1CK0L 1G6RB 2QV2A 5LJYH 4NKDB 4WW2F 2E8YA 1WUNT 3TPUA 2VDOH 4C54A 4PJ8A 2JELL 3GBNH 2CLZA 2DMCA 4ZTPH 1WEJH 3C87A 5MENE 5K9QI 3O3EA 3PWJB 4MJ6B 1I85C 2YPLA 1FCGA 4EOWL 1WBYB 5E5RB 1UB6B 3WFBH 5KG9A 2VERN 2BRQA 3FOMB 3V4PL 3HE7A 5BRZB 1T7ZA 1TCRA 1J18A 1FLRH 2QSTA 4X8XA 5E6YA 5ACMA 5KW9L 3O11B 1ZV5A 1BFVH 4WHTA 3NIGF 5LCVH 3WIHA 1PFCA 2K9UA 4EEEA 3WS6C 1G9EA 1T0NB 2G2RA 4LOUD 3QXAB 2R4SL 4WU7A 5DWUL 1F90H 1YEKH 2VL5B 1M05A 1KTDA 4XP1H 4NNYA 2CR6A 5DRWB 2Y5TA 1NGPL 2A9MH 5TE4H 4WU5A 1WBZB 3CUPB 1N64H 3GJEB 4XPTH 1KIRB 1D5MA 4G6FD 1NMAH 1S5HA 3ARFB 3QDMA 2GT9B 4HKBB 1WLHA 1S78D 1ED3A 3I02B 4GO6B 5KSBE 3U83A 4AQOA 1UG9A 3JUYA 1A1MA 1BF8A 3VA2C 3CDFA 3W9EB 2PR4L 4XC3H 2EDKA 4QRQB 4LSQL 2UZIL 3DX9A 2EKSB 1C5CH 3LN9A 4W6XB 4PRAA 4DTGH 1VA9A 4ONHA 1BM3L 2X9XA 5AUMA 3QPXH 5D9SB 1M71A 1T20B 3VFNA 4Z0BL 4UDUA 3VXUD 1H3PH 3EOAB 1DUZB 4JKKA 2MKWA 2NLJB 3QHTC 2FZ3B 2VUYA 3QXDA 5EZIL 5J1AB 2CDEA 2XNAA 5FYKL 1S7VB 3TO4B 5FOBB 1NQBA 3ZYZA 4J4PC 1JGVH 5DSCB 4C56A 1IRAY 4HLJA 2NY2D 1NANH 2OZ4A 4G9FE 4L1DA 1ZLUH 2Y07H 4Y1AD 4FMKA 1MCIA 1T5XA 5C09E 3KDMB 2V5SA 4X7EC 3T0DA 2ZUQC 2I26N 1MHPH 1UQSB 4YHMH 5TE6L 1U8PB 3HNSH 4ZOBA 5F7HA 1T4KB 4YHNB 2D7MA 5IR1B 1NCWL 2R29L 4XPFH 2F54A 3GSWB 3LEXA 1D5XA 1G9NL 4LRIA 4LSUL 5JXED 3H3PL 2D03L 1WFNA 3MBEC 1KTLA 2YUWA 4OFPA 3NPSB 5E8NA 1QEWA 2IH1B 1PEWA 4WTZG 3QIWA 2FL5B 3SDCC 3OZ9H 4JJHA 1KXTB 5ITBH 4HUXB 5KAQF 4HF5H 1RHHA 5J13B 4EDXA 3HZMB 3IETA 4HAGA 3SBWA 2OJZL 2Y23A 3OKNA 1OTUD 1CWVA 1AO7E 4OUUB 4WW1B 4X6DB 1MNUL 2WQRA 5ADPL 4TUOB 5EU6B 1QG3A 4P4KD 4I48B 4LQFL 4M43H 3CFCH 1U3HA 1GIGL 4P4KC 4PJCB 4E41B 1XF5A 1R5IA 1RIUL 2V5TA 1DR9A 1CF8L 5SWSA 3SE4A 4Y89A 1P7HL 3K8MA 4J3OC 4XCYA 1OSPH 3AREA 4XVSH 2HN7B 3L95B 3T0WA 3FT4A 2NY1C 1KBGL 1IM9A 3AS1A 2H32H 1JPFB 4L9LC 3VWKD 1VGEL 3BXNB 1K8DB 5BZWA 5INCB 4LCUB 1G9ML 3FRUB 4NT6A 2NX5E 5IUSA 2JTDA 3VWKC 3VXRA 2Z8SA 5GZND 2ZCHH 4GW1A 4UV7L 2PYED 4XWOC 5KVEL 5DHXB 1I1YA 3MJ9H 1G1YA 2I24N 3SE3A 4Y16C 3HMXH 4PUBH 3ETBF 5D7LB 4XZUA 1FV1A 4JCLA 4YHYC 3GEWB 1FIEA 4UB0H 5DZOA 3UDWA 3GBML 5GGQL 2IEPA 4HWBH 4XCFH 5DQJA 4QRSB 3Q0HA 1OB1A 5DMIL 2QHRL 3F7YB 1CICD 3IVKB 4NWTL 5JOFA 1RZ7H 4KDWA 5CMAB 1HHHA 1S9WA 1CICC 3QUXD 4X80L 1AFVH 1KLUB 4XAKE 1A4KB 4KY1L 3WFEL 1KG0B 2R0ZH 4I0CC 1MPAH 4ZS7L 1UJTA 5MEPB 5IW3A 3RTQD 2B39A 3T4YB 4GRLB 5CILH 3NFNB 5JUEH 4LLVB 4D94A 3PABA 1YNLH 5JW3L 1S7TB 3L7EB 4H5SB 1C8PA 2JIXA 3O6KH 1CFSA 3PHOA 1DEEB 2HTLD 4ZS6C 3BZFA 3RDTA 4J23A 5E9DE 3O45B 4BQ9A 2BVOB 1YN6A 3KG5A 2HTLC 2RJMA 1ORSA 4YWGL 4Y4HA 3RWJA 3MRBB 1I1AD 4NQCA 5C7XL 1JIBA 3L5IA 3IU4L 2Y06L 2VL4A 4OV5B 1CLYL 1XR9B 5GS1B 4XCEB 1IFHH 2FGWL 2YC1B 4H88H 3KPRE 2XRAH 1LHZA 4EUPB 1JHKH 3NMEA 1H9VA 1UXSA 1RZGB 4PGDB 2VYRE 3UTZB 2DYPA 2OM5A 4YXLH 2CLVB 1ZLSH 4AM0B 5KSUB 4QF1B 3ZDZF 3P77B 3PL6C 4RGNB 4DEPB 1RZFL 3S88L 1DN2A 3I6LE 4ODHL 2R8SH 3DROB 3QQ4A 4KVCH 2EO1A 4PRDA 2XWJA 5FECB 2EYSB 4MCYA 5L8JB 3HC3L 2DS4A 2VLJE 3EDEA 1UENA 3G5VA 4XP9L 3OX8A 3SGKA 1U8JA 1CU4H 3QJFA 3HKFA 4KTYA 4NRYB 2H32A 4WFGD 4X6EA 3KYKL 4Y5XA 5IM7B 3TNNB 2WIMA 3IFNL 2B2XH 2V5RA 3IDNB 1PSKL 1P1ZA 5CKGA 4YBHA 4WI2A 4NKOB 3WXWH 5D2NA 3O3BB 5J6GA 3MJ9A 4NBXB 2JCCE 2EIEA 3MV7A 3C5SA 3HMXA 5DD0L 3Q5OA 1T0MB 1CFQB 1A9BA 3MLVL 4LLMB 3X17A 3WNPA 4HDIA 4PJ5D 2Z93B 3KPMB 1FL5A 3R0NA 4JPWH 4HWBA 4P3WA 4ONGH 3E3QC 1EIBA 1WIPA 2H2SC 3ESVF 3D39A 1ZHBB 3T0VA 3VXOB 3MLXH 3PQYD 2FJFA 5D93B 1RVFL 2ICEB 1SJHB 4P46A 4IHOB 5GJTH 2AJ3A 1MH5B 2X4QB 5E7BA 2DQHH 5I74B 1ZA3A 5HHQA 3BEVB 2BSED 3I3BA 3MC0A 2LU7A 1RJZB 3RIAK 2ZPKL 4FXKA 5TF1H 1A1NA 1FVDA 4NO3A 1BIIB 4XBPB 4PJBA 1NLDH 3CLEL 5CP7B 3BP6B 1A7QH 1F00I 3RUGA 5MP6L 1C5BH 5J1TC 3GB7A 3WDHA 2AEPH 1PZ5A 5F7WC 3X12A 4M1DL 1FBIH 2IC2A 1NGYB 2B7DT 3TBYB 1ORQA 3GMNB 1QKZH 3LQAH 5IEKB 4NO2B 4RA3A 1ZA6A 2EIZA 5B38G 3HI5H 3IFLL 1I9IL 1LO4H 1UJ3B 4GG6A 1TNNA 4N8VG 4LKXB 4NRZA 4G80A 5D6DC 1TJIL 4M6NL 1WZMA 4YIQB 3HCVA 1DSFL 4Y19B 3IKKA 5CLWA 4HEPG 4L8DB 1W72B 4U0RC 3ECBB 2CSPA 4FQHB 5IB1A 1JNLL 1NFIA 3GJFK 2C1OB 1CL7I 1FP5A 1J88A 4R26L 2W9EL 5C6PB 1N8ZB 4LCWA 4BQCA 3NAAH 1BD2D 4ODUA 2D7NA 4OCMC 2EDYA 1MAJA 3MRIB 2FNBA 3TIDB 4OCSL 3S37H 4XMPL 3TV3L 2FHFA 4LVHB 4XXDA 3VFWB 1S7SA 2KZWA 3PP3K 4M6ML 4FP8L 3HMWH 4MDIB 4UU9A 1RUPL 3RZCA 1KENL 2FRGP 1IKNA 4ZFFB 4XMKH 5FO9B 4DUWA 3ZTNH 1U9KA 2AW2A 5BMFL 1NGZA 4Q6IA 3VFRA 1AXSB 5EG6C 1RZJH 4NZTL 1NCUA 4GOSA 4MQSB 3W0WE 1HXYA 3TH3T 2YN5A 2AJVH 1CFBA 4H1LH 3O6MH 4M1GH 3WS3B 1ES0A 4UI2A 2NY4B 2A73B 5DTFA 2Z0BA 3VGFA 5B8CC 4N8CL 3QCTL 2Q8BL 1IAIH 5F71A 4F2MA 1JF6A 4EXKA 3GMRB 4OI9A 4G42B 4S11A 4YDJA 2VISA 5CP3A 4XRCB 1A6VH 4P59H 4HK3J 2Q6WB 1CBVH 2D31A 2FLRT 3E0GA 4O02L 4ESKA 1YEGH 2I07A 3SDDC 1N5AA 2EC8A 4OLZH 4PJ8D 5FIEA 1YY9C 1MCWM 3OKLB 3DUUA 43CAA 5F1IB 4Q9CA 1B2WL 2ED8A 1IAMA 3SKJH 5I9QC 2ZCKH 5FEBA 3BDBA 5T1DL 2XA8H 4MSWA 1IGYA 3FN0H 3V0WH 2V6HA 2X41A 2O5ZH 1ETZA 2EO9A 4RFNB 4K8RH 1PJ9A 5EBLA 3HE7C 5DMGD 2NY0D 1QR1A 3REWB 2IAND 3L7FA 1OAZH 5I18H 3IDXL 1KELL 4MCZB 5CIPH 5DMGC 2NY0C 3U4EA 5F72S 2DBLL 1J05B 3O2VL 3FQUA 5C08A 1Q72L 3K81A 2XXCB 3DMMB 1FDLH 2VAAB 1PBYA 1ZGLP 1I1CA 1Y0LB 4Q0XL 3MNWA 5C0EA 3RY6C 1BZ7A 1YEEH 1A7BA 4FQXC 1BMGA 4P99A 2FD6H 3QFDA 3WSQH 5A3ID 2NY5H 3QDMD 4LKCB 5A2KH 4YUEH 5CJBA 4Z7UE 5DJ0A 5LG1A 5I1IL 2ORBL 1UB5A 3V52L 1KB5H 4MJIB 3RUGF 4MLSA 1MI5B 3G5YA 3R8BB 3SGDH 5I17B 4PB0L 1ZGLB 4OGAC 5IIEB 5TDPB 3RHWF 4PJAA 3MRMB 1A6WH 2G5RA 5CJOH 1FL6A 5SX5H 4HV8A 5J57B 3D0VA 1UZ6E 4FNLL 2P43B 1G7PB 5KS9A 1CXKA 1G7HB 4YHIA 1XGQB 1YUHA 4MWFB 5I76A 5DLMH 4H1LA 5GS2H 3IT8D 3V6FB 1FZJB 4Z7WB 3EYQD 2MMXA 1NKRA 5KANG 1XT5A 4OZ4B 4TN9A 4UBDC 2EYTB 3QCUH 2OJEB 4PGZA 1ZT4B 3EYQC 2OCFD 1XGRA 4MQ7B 5FO7A 3UXFA 1QFUL 3C08H 4RISL 3V5HA 4Z18A 4HWUA 2NX5A 4XPHH 4LEXL 3LSOB 2HT4D 4ZQKA 3WUZA 2D0HA 4LRNH 4MD4A 5D2LA 5L0QC 4R3SB 1JZ7A 2NY3D 5ESAB 5FYKU 4GAYB 2UY6A 5HDLA 1RJLB 5GGSA 2Q8AL 2QSCL 1K8IB 4GW4A 3VXSA 4K94H 1WCQA 4A2LA 4O51A 1GPOL 5ADOL 3C5ZA 5KVGL 3ARDA 4K07A 3AFLA 1AY1H 4KQ3H 2F54D 5I1GL 2BHZA 2CUMA 5CBAA 4K7PY 4NN5C 3H42H 1CL7L 2IADA 4X6DE 3JTTA 3BGMA 5HGDA 4IEFB 4LRIC 3FB6A 4JFEE 3DVIA 4ORGA 5IT2H 2YUXA 3QIWD 1ZVYA 4KH2A 4P5TC 5IMMB 1DQML 3RNKB 5HDQL 2QKIB 1NUGA 1KEGH 5C2UB 3QIWC 4R8WH 1UXWA 1GCFA 3PNWB 3VFTB 4XBGA 4ODVL 4E41E 5KSBF 5KANI 3DUSA 2FX8H 3VD4A 4LSVL 3O9WA 4F7MA 3T1FA 3FOLA 5CIPA 3MRPA 1T6WA 2OSLB 5EORL 5HHPA 3SBWC 1AHWA 4OCYH 3EO1B 5CCKH 4KRMB 4CVUA 4D9QD 1U3HD 4NQSA 1WFOA 2BRRH 2VZUA 4HKXB 5D70L 1JZ2A 4BQ8A 4F7CA 2DL9A 2P46B 2ZOKA 3LKNA 3UJIL 5SWSD 4CGTA 5B3NA 3O41B 1JWUA 3FO1A 2OI9C 3KXFA 1MJ7H 1DANU 1PGRB 4GKSB 3ARED 2BNRE 3RX5A 3S35H 3WN5A 4L8SA 2C3XA 5ICZB 1SVZA 4HIEA 1KB5A 1MLBA 3GFUA 3VRJA 1S9VB 2NXZC 3AREC 5D7LE 1NEZB 3MTRA 1KGCE 3DOSA 3QDJA 1G7MA 4OF5A 3M17B 2DQUH 3MROA 3VXRD 2UV3A 1M6OA 3B2VH 3GMMA 1NCTA 2FH6A 4KZEL 2IPTH 3OKEB 2APFA 4KHTL 2A6JA 4D9LL 4ISVB 5CEZD 4FXGB 3NIDE 4M93B 1WGOA 4Q9QL 4PJGA 5DUBA 5JXAL 1I3RB 4IRSA 2F19L 3S34H 1YJDH 3MJ7A 1BPVA 3BQUA 2DLFH 1BFOA 1OW0A 3PHQB 3NOIA 1NDGA 1FG2B 2DKMA 1DN0B 5E8OA 5GSVA 3X11B 1CFVH 2VITA 1XGYL 2A77H 1NFDA 3ZKNC 2FJHB 4AIZA 1EFQA 4NCC2 4RDQF 1NGWB 4C55A 3KPNB 1I8LA 4PJAF 1P4BH 5F8QC 5FUZL 2YN3A 1G6RH 1BVKB 1TVHA 4EXPX 4HUMB 4V2BA 5DHYA 3PDDA 4L4JA 1ZLVK 2JIXD 4H25A 3BP7A 4KRPC 5FYJL 3RDTD 5T3XE 1MVUB 5KS9F 3RDTC 3QEGH 2EDRA 4RGNE 5EOTB 5C70A 4QXGL 2D0FA 4NQCD 3ARQA 5EZOH 5HI5C 1A7NL 4PRIA 4Y4HC 3B8YA 5IBUG 1AD9A 5HYSG 1OP3H 5BV7B 4CN1A 2DWEB 2HT2C 3HS0B 4UDTB 1ONQB 1OAQH 3Q1SL 1CQYA 2WBJB 4WNQA 4TVPE 2DYPD 2P4AB 4N1CA 4U1JB 5E8DH 3QDAA 4O2EA 1U93B 4JFFA 1HSBA 5D2LF 5IB2B 1INQB 1LO5A 2DWDB 1MFEL 5D72H 1IQWH 3P4LA 2K3TA 3U2SA 3V6BR 4PP1D 3UTQA 3SHSA 1OAUH 2KH2B 5IB3A 5JORB 4U1KB 4OD1H 3MFFA 1YYLL 4YX2H 4CJ0A 1RZ8B 4NC2B 3ESUF 3D2UA 3KHQA 2K7QA 1MLCB 4QRRD 1VFAA 4NWUL 4KKCD 5L2KB 1X5HA 4PJDB 1BBDH 3WEXB 1YNKL 3TFKD 5IHUL 3P11H 3UTTB 3SGKC 1EGJH 4NKMA 1QSFA 3LKOB 3RX7A 4KAQH 4Y5XC 5F96H 3VRIB 4X9IA 3QCVH 2GJZB 1A47A 4BKLB 4DVRL 5ACLA 2AABH 5JPNA 3MV7D 1MRFH 1ZOXA 5T5NF 3GSVA 35C8H 1J11A 2ZSVB 3U7YL 1H3XA 1RUAH 4UMGA 3HNTH 1YEDB 5J89A 3VFMB 4I3SL 4DCQA 1OARL 1QP1A 2LE9A 1X5FA 1LO2H 4ZFOA 3EOYG 3C8KB 3D39D 2F8VA 3RNQA 1FH5H 4TPRL 2AJYH 2R56H 3WXVL 4H8WL 4XNYH 2FH8A 2C4XA 3BJLA 3O6LL 1JGEB 3MLZH 3VD5A 3HG1B 2IALB 2VXUL 5CGMA 4WTXA 4WFED 2WMPA 4K7PX 1F4WL 4PLJC 2MFNA 3TA3B 1QFWI 3BZEB 1IGTA 4U1SB 4P46C 1JNNH 1G6RA 3UEZA 2VR5A 3CPLB 2MOVA 4L3EB 4TUJA 4P49A 3EYVB 2EIDA 1Q9KB 2EIBA 4ELKA 1AJ7H 1MFNA 4OFYA 4MJ6A 5MEQA 3ZHDA 5BVJB 5HJ3B 4Y19E 3TWCH 1B4RA 1WBYA 1DQLL 5IQ7H 2L0DA 4PB9L 4WENB 3H2WA 4PJGF 5E8EB 5BRZA 4R0LC 3QP3A 1U3ZA 1RQ5A 1B0WA 1IC1A 4ZODA 1QO3B 4X99A 1U8LB 4N0RA 2XTJB 3MRDB 2BVUA 1QFHA 5MEND 5F21B 4KUZL 1N0XL 4M5YH 5JNYB 1T0NA 1YQVL 2ERJC 2MQ3A 3QXAA 1KOAA 1RMFL 3DYOA 4WHCA 1HQRA 2VL5A 1IGML 1CT8B 1NFDF 4KGJA 1R3IH 1VSCA 3BUYB 2YK1H 1WBZA 1FNGB 3CUPA 5I1KH 1JP5A 1MCFA 2MNUA 3ARGC 4LCWD 2APXA 3VXMA 4GW5B 1BBJB 1YPZB 3GK8H 4OGZA 2Y6SC 1IGCL 5GQBA 2A9NH 4YDIH 5DD3H 1ZHLB 1EGJA 1WZLA 4JRXA 5DJ8B 1YN7B 3VFOA 1DLFH 3I02A 5TDOA 5IMLA 4PJ9B 3RZCD 1U8MB 5C9JB 5ERWB 4LPCA 4FQ2L 1MAMH 3RZCC 3CSPA 1IC5H 4DW2L 3UO1H 2Y25A 1WT5C 3BE1L 2IG2H 2OBGA 4ZNCD 2FO4B 1KJMB 2CKBB 5GGUB 3ZKSD 4POUB 4FHBD 1UCTA 2EKSA 4JN1L 1OAYH 1JHLL 1LK3H 1MF2L 4K7PL 4GKZB 3OAZH 3TCXA 4NNPL 2EDBA 5D9SA 1T20A 4UOJA 1I7TB 1EAJA 3FO2B 3U7WH 4OLYL 5SV3A 3EOAA 1IAKA 1DUZA 4UTAL 3DRTB 5LGJA 1OP5K 2RAMA 2NLJA 2FZ3A 3QIBA 3UX9B 5J1AA 1OP9A 4YXHL 3MXWH 5ETUB 3VI3F 4W70A 3TO4A 5DHVB 2VXTH 3VXQB 4NUJB 3QJHB 4N9GB 5DSCA 1K85A 1XIWA 2AV7B 5LWYH 2ESVE 1JZ8A 1JYVA 2J3SA 3CCHB 3KDMA 4Y5YB 5TQ2H 3MGOA 4B0MM 5E95B 2QSQA 1UQSA 1T4KA 4YHNA 1MFAH 3GJFB 1OM3H 5HYQB 3G6JB 1A9EB 3GSWA 1RUQH 1A5FH 5T5FH 1J8HA 4X8JB 4EVNB 4G9FD 3WHXB 2VJXA 3KLHC 2IH1A 4UZGA 5H37G 2FL5A 4LSTH 1MHEB 1ZVSB 5FB8B 4J6RH 5JDJA 4NJAH 5C0RL 4HUXA 3LQAC 3BKYH 3BVNB 2VE6B 1R3KA 1T2JA 5MERB 1HEZB 2B0SH 3FT3B 4MJIE 1C12B 1ND0B 2ZKHH 1BQHA 3DGGA 4LIQL 4JKPH 1BAFL 4TUOA 1YEIH 5EU6A 1T0PB 1PG7X 1AQKH 3RAJL 1Z6JT 5A2FA 2AGJH 2BFVL 3FFCA 4PJCA 1AC0A 3BD4A 4M4RA 3D69B 1S9XA 5I6XB 2PN5A 4QT5A 3FQWA 1R3JA 3NACH 4XT1C 4UT9L 4HS8H 4YEEA 3ISWA 3C9NA 4LGRB 5BW7A 5AZEL 2Y7QB 3L95A 1IQDA 3V4UH 3FRPA 1JZ5A 1WK0A 1NC4A 4PJFB 5CWSB 1JPFA 1WFTA 1QFWL 2Y36H 1IGIH 4OT1H 4YHKH 2I9TA 1D6EB 3DBXA 3BXNA 1K8DA 1ZE3C 2OL3L 1IGJB 5INCA 3EDKA 4LCUA 3FRUA 2F9BT 1G0DA 2YSSA 3HLAB 5I1DB 1WBXA 4YDVA 1P69B 1RZJC 3QB7C 1MWAH 4YK4B 3RY4A 5ALBH 4R7NB 3CVIH 4RMVA 3WUWG 1DBAH 4P2YA 1I4FA 1QVOA 1D6VH 4LPTA 5I19H 2AK1L 2NX5D 3LIZL 4QRSA 2A0LD 4K71C 5CUSH 4ZO6A 4EIZC 4KUCF 3IVKA 4WI7A 2JB6A 1H15B 5JW5A 3KPSB 4RWYH 3VXSD 2CO7B 1KLUA 3ARDD 1A4KA 1KG0A 1ZS8B 2HKHL 2EDXA 1KC5H 2NZIA 5E2VH 3LN4B 5E99H 3C5ZC 2XT1B 1MCRA 5MEPA 1AKJB 2UWEB 2UVFA 4GRLA 1JPTH 5L9DL 3K0WA 1NSNH 3NFNA 3U9UB 2K7PA 4LLVA 3EHBD 1S7TA 5TPWH 4H5SA 5INDB 4K8RD 1NDMB 4NQDE 1DEEA 5F7UA 1DBKL 3O45A 2HLAB 2BVOA 1QFOA 3ZDXE 3O9WD 3MRBA 4UIKH 5EC1B 3BH8B 4WRLA 1CDCA 4OV5A 1XR9A 4HIIB 4CDHA 4KXZH 3BI9X 2YC1A 2VQ1A 4EUPA 4D0BB 4LHUB 3DSNA 3VG0H 1RZGA 4PGDA 4JKMA 1UZ6F 4LLYA 4TNVF 1KN4L 3UTZA 3ZKXB 1RULH 1Y6NR 1X6LA 1J1XH 5KSUA 4YZFE 1VGKA 3P77A 1DBML 2VDML 4RGOH 1W2KT 5GZOC 3KXFD 4MYWB 4ZYKB 3BYTA 4S1QL 1XCTB 1G1CA 1RD6A 3VCLB 2NY5C 3DROA 1PYWB 5ESQB 1SM3H 5T3ZL 1J8KA 3SPVB 4JY4B 3FQNB 1BECA 2CIIA 3QDJD 4Z5RB 3B9AA 1A7OL 4ZAKB 1CZ8L 5MI0C 4RNRB 4P23B 3O6FA 3I6LD 3TNNA 1SYVB 4KV5E 5DRZB 1KIPA 3QG7H 4YDLB 3NFSL 4NKOA 4Y4FB 1QBAA 5GS2D 2VLJD 4O58H 4P3CL 1MCLA 3GSNH 4CBPA 4HWZA 2EDLA 2HJFA 4IRSD 1MWAA 4X6DF 3BQUD 1E4XH 2O5YL 1CFQA 4HUWB 4QNPE 4LLMA 3L6FB 4NJ9H 4IRSC 1PD6A 3L9RA 4GRWB 4OLXL 1OW0C 1X5ZA 1C16A 2H2PD 1TJGL 2DQDH 1YDPB 4WHYG 2ADFL 4PJCF 1ZHBA 1ZWIB 3HE6A 2H2PC 4OD2B 5CD3B 4DFHA 4OGXH 5FUCC 4U1NB 1TZHB 1VESA 5CJQL 2P8PA 4GBXB 3QRGH 4CJ1A 4K3EL 1U36A 4XX1E 5HYIA 3PP4H 3NCCB 4IHOA 1AXTL 5FYKE 1I8LC 1MH5A 2G9HB 3BKML 2X4QA 3LV3B 1LE5B 1RJZA 1G0XA 4PY7A 5DI8B 4Z7VB 2V2WA 1BIIA 4XBPA 5CP7A 5EU5B 3BP6A 5FYJU 5ILTH 4PRID 3WD5L 4ZSOB 2LVEA 3MLSL 5ISZB 1XR8B 3UROR 3QWRD 3INUL 1NGYA 3TBYA 2J6EH 2R2HA 2XOTA 3GMNA 1KXQE 3WO4B 2AV1A 3UCRA 5IEKA 4NO2A 3LN5B 1CR9L 1MREL 2YWZA 2E27L 5L2KE 1MCKA 4F7EA 1Y6KR 2XPGA 4YHOH 1G7IB 3MRKB 1IBGH 2GFBA 4K55A 1AD0B 4LKXA 3NABH 1PKQA 4F7TB 4HZLB 2JJTA 4QOKB 5IFHL 4L8DA 2DDQL 3D2UD 4M8VA 5JDSB 1W72A 3SGEH 3ECBA 2AS5M 4CMHB 4FQHA 4JFOB 1GGIH 4CUCA 4KJPD 4YNYB 4GSDH 1JYNA 2C1OA 5H2BA 4J3SA 4K23L 4WTWA 3G08A 1TIUA 4L4TB 4YJZL 3BDYL 4PRHB 1D9KA 3MV8B 3O4OC 1CGSH 2SEBB 3TIDA 3UTOA 3H7LA 4YFEA 4L4VB 2JJVA 1QLRB 3VFWA 1IGFH 3IRPX 4OFVA 3BYYA 2NZ9C 4AZ8A 3O4LB 5FO9A 3ILPB 1M4KA 4MJ4A 3HG1E 3KR3L 3T2NL 1AXSA 1R6VA 3GSNA 1HQ4A 1CCZA 4JFXB 1P53A 2BNUB 4N8VB 5HGBB 4DGVL 2C1PB 4DN4H 2BVYA 3WS3A 5FHAH 1YJDC 4MGXA 4K2UL 2V17H 3BIBX 2A73A 3BPNB 4QO1A 4L3EE 5IJVB 4HXAH 3X3GL 4JAMB 4J2XA 2Z31B 4Y8DC 4MAYB 4LAQL 3S96B 4HW6A 4LARL 5JOPE 2NPLX 3D0LA 4G42A 3W0WD 5BZDB 5FM5M 3C6LC 4EI5B 3TBSA 1R0AL 4XRCA 1HSAA 2Q6WA 4PPTA 2H45A 2A1WH 5DT1L 5D8JH 3HC4H 3RI5K 4MJ5B 1BVLA 2XTJE 1EXUA 2HYMA 4OFYD 2UYLA 2ZOLB 5EN2B 4JRYB 4P9MH 4HPYL 5IBLC 5J8OA 3RVVD 1BOGB 2C4FT 3IDIB 4NZJA 5K9JH 1KUMA 2BJMH 1I7ZB 3DX8A 3MXVL 3QISA 5JO5A 2OTUB 4AIOA 2XY2A 3UTSA 3TYGL 1FE8H 3JWOH 5BRZD 1HCVA 1H5BA 4ALAH 5JHDA 5F7DA 3STZB 4XP4L 1JF1B 1K3ZA 2J6EA 3HZYB 4AG4H 1DQQB 5I15H 3STBA 3UPCA 3VI4E 2D7PA 1LP9B 1YPZE 3U6RB 4MCZA 5GS0L 4OSUH 3QA3B 2IMMA 2W9LA 4X4XB 3QXWA 3HPJB 2WBKA 1RK1B 1J05A 3MJ8B 5C8JB 1X5XA 2DRUA 3GNML 4HAFA 1IM3B 3DMMA 2XKUA 4OQTA 3RGVA 1G7LB 3ZYJA 3SCMA 3SEPA 5JQ6L 4HIJB 5DMKA 5FFLA 2AJSL 4KUCD 4PTUB 4XVTL 3E6HB 1A7RL 1DFBH 5DC9B 4ZTOL 4KQ4L 1NCBL 5F6IB 2R0KL 4EI6B 2EXYC 4WDIB 5GGTL 1L0YA 3NBNA 1QBLH 1A7PH 1M7IB 2R0LL 3KAAA 1HDMB 5J12C 1F4XH 4MJIA 4UTBL 2FATH 1MI5A 3CDYA 2HJLB 1ZGLA 1CTOA 2CJUL 2CDGA 3NCMA 4DVBA 4FMFA 5I73B 3TJHD 4QY8B 3DETD 1KJ2H 4WFFE 4N5ED 3TJHC 3EFDH 1Q0YH 3VE0A 3NCEB 1FFOA 1Z0MA 1U42A 3IDMA 4MWFA 4JY6B 3V6FA 1FZJA 4Z7WA 5KTEH 3QQ3B 1VB9A 2EYTA 3FONA 2OJEA 3K4AA 1OLZA 1ZT4A 2XV6B 4IJ3B 4MQ7A 1FGNL 3TO4D 3QIBC 3G6JE 5FK9B 2V2TB 1CDUA 4O9HH 1ITBB 2VMFA 3O2DL 4LCCB 1XIWD 5D71L 1F11A 2W0FB 4DKDC 4R3SA 3AC0A 5I71B 1HHJB 3H7BB 5ESAA 1XIWC 2QR0B 4GAYA 3IS0X 2OTPA 1K8IA 2VWEC 3JVGC 4KWUA 3HC0B 3ROOB 4OCXL 4JO4H 4L1HA 3K2MC 4JQXA 1A6UL 5HHOB 3VFVA 3I6KA 1B6DA 2DQCH 3BPLC 1Q0XL 2C7UB 1BF2A 3W11D 3FB5B 5IMMA 5K9OB 4Z0BH 2E7HA 1UM4H 1JHTA 4ZUTB 3QI9B 4HJ0C 4MXWH 4YO0B 4Z6AT 3DRQB 4RAUB 3W11C 4BFGA 2EYRB 5GGVL 4OD3H 4HK0A 5EWIL 3HI6L 4HFUL 5BV7H 1KN2L 2VIRA 1B4JL 3IDGB 1JI2A 1JFQL 5BOZG 1KV3A 2RBLA 3QUZB 3EO1A 1F8TL 3RL1A 4NM8H 3MA9H 1BQSA 3OB0K 4NHCH 5EU6D 2ARJQ 1INEL 1QZ1A 5C0GA 1P2CA 2C3GA 3MLRL 3C60C 4PJFE 3CFBB 5C1MB 4HKXA 1XZ0B 2X4TB 3P4OB 4E41D 4JZOB 3GSXB 1IL1B 5AWNH 5J56B 3O41A 1K6QL 5BVPL 3TYFB 3FQRA 4GKSA 5JIPA 1S9KC 5L7XL 2EEBA 3VJ6A 5ICZA 3WL9B 5JHLL 3FZUC 1NC4D 2ZG2A 2P44B 3CXDL 5DJYA 5BW7C 3KPLB 5E7FA 4X5XA 1NEZA 1Z9OA 4XP5L 3VG9B 1P5UA 2P7TA 2JK5B 3M17A 5CSBA 1N59B 4K3DH 3FO0L 2IQ9L 4JM4H 4NN6B 1GZPA 4LCIL 1OVZA 2ZUWA 3OKEA 3EW3B 2V7HA 3KPSE 1XCQB 1TMCB 2DMKA 5ADPH 5F7MC 4FFZH 4ISVA 5D7LD 2X9YA 1KGCD 1T21A 4FXGA 1HYRC 2ICCA 2JE8A 3B5HA 3N1QC 5E56A 1U3YA 2PCPA 3GMPA 5DJXB 4I3RH 3QHZH 5E0QA 4B41A 2UWEE 1KCRL 1Q1JH 3PHQA 4QGYA 1CF8H 4R2GC 3UAJD 5JQHC 3NTCH 3O3DB 3OR7B 3C09C 4I77H 3BP4B 4ZXBB 3X11A 4PLNC 1KLGA 3CJJA 4KKNA 4D8PA 4NZUH 3FTGA 2FX9L 4DKEL 5D1ZC 4FN0A 4WO4A 4AEFA 2X2YA 3PWNB 2MTPA 5EZLB 2ZJSL 4GRLD 1ZHKA 3KPNA 4IM8A 1GAFL 3MRFA 3LZFL 2AEQH 2VNCA 4GMTL 1EERB 1E4WH 1BVKA 3QQ9C 1W0WB 4X98A 2IBZY 4NKQB 3V7AE 5A2JH 5D1XC 1S3KL 4APQB 1MVUA 3HN3A 4UT7L 3GMQA 4XNUH 5EOTA 4H20H 3DHJA 4Z7WF 5GGQH 4NUGH 3MOBH 2O5XL 2XACC 1FC2D 3NIFE 2DWEA 3HS0A 1XGUA 1K5NB 1KXVC 4G6KH 1ONQA 4N5UA 5I8EB 5IOPB 2X6MA 1VADB 5IVNA 3CSBA 5T3XD 2GTZB 4O2CA 4GKNB 2BVPA 4RGND 3RVWD 3C2SA 1XEDA 3ARBB 1I8MB 4XI5C 4NO0A 4GMSH 2KQNA 4ZS7H 1U92B 1OD7A 2ATPB 2FB4L 3SQOH 3U79A 4G6AC 4Y5VA 4XVJH 3KS0J 3GRWH 4QTHB 1RZ8A 3Q6GH 3T3MF 2E3VA 5J6HB 2N1KA 4JHWH 4XTRC 4ELMB 1MLCA 3SY0B 3VW3H 4PJDA 3PWVB 3HA0A 3K8LA 3WEXA 2EDTA 2H3NB 3ZHLA 4PRBA 4Z9KB 5C0DA 3UTTA 3W2DL 1OQXA 1L7IL 1UWGL 3AUVA 3L1OH 5LBSH 4LVNC 5C0AB 5IBUB 3O6FC 4QCIA 4X83A 1YEJL 1AI1L 2GJZA 4BKLA 1NUDA 1YNTA 5LVEA 4R97B 5FGCE 3UYRL 4QHNB 2YEZB 3VA6A 2J8UA 5CSZB 1YYMH 2CKBH 1UACL 4BH8B 2VZOA 3JWDH 3FT2A 4LLUB 3U4BH 1I1FB 3VFMA 5KN5B 4OCWL 4EDWL 5JMRA 2BY2A 4HXBH 5DD1L 3S88H 1WQVT 3BAEL 4KC3B 4ODHH 1A3QA 3MRGB 3C8KA 3WNLA 3ZDXF 2NTSP 3GKWL 3WYRA 3WFCL 3QO0B 2R15A 4U2ZA 2IGFH 1CDJA 1RK0B 3HE6C 2PTUA 1JGEA 2DQTH 4Z77A 3HG1A 1WAAE 2VR4A 5GIRA 4LNRA 2W59A 1T2QL 4ZMAT 3RJDA 5ISZE 1SBSH 4K9EL 2W92A 1RY7B 4JDZB 4TQEL 4U1SA 1GHFL 3BO8B 3MOAH 3VRLE 4NHUB 5FKPB 1NLBL 4NKIL 2NR6C 3EYVA 1DP0A 4DZ8A 2G60L 2HT3C 3RVTD 4QRTA 5IMKB 4UINH 2PUQT 3G5ZB 1FG9C 2H6PB 3U4AA 5HJ3A 1NMCB 3EDJA 3GIZH 5E70A 1RV6X 1FIGL 1QACA 4X4YA 2UZYB 2R1YB 3F58L 1QBML 4WI8A 2XICA 3CFJB 3FQXA 4NM4L 4I2XB 4DAGL 2B4CL 3MRDA 2F5AH 4M7JH 4KV5F 2DI8A 5JNYA 4L4TE 1QNZH 2ICWI 1NCAH 3B9KA 4TSCH 4HGKC 4PRHE 3MV8E 4Y19D 3CX5K 4KMLB 4JN2B 3G5XB 2QL1A 3EYUH 4I1NB 4G8GE 1R5WA 1ERNA 5DQDH 4FA8A 4GG8B 1IEBB 3AS3A 4F3FA 1FNGA 3O4LE 2ZPKH 2XN9E 2XG5A 3VU2A 1BBJA 1YPZA 4IS6B 2B1HH 1JPGB 3HAEG 5A1AA 5DJ8A 3ROLB 1D9KC 1YN7A 3Q6FB 2BOCB 3CNKA 4CADB 3D9AL 1U8MA 3BPOB 5BXFB 5C9JA 5I2IB 2YD9A 5ERWA 1WVZA 5TFSH 1SYSB 4KPHH 3T0EA 5EU7C 1A2YB 5EO1B 1U95B 3TJEH 1KJMA 2CKBA 3EJYC 4JR9L 2PYFB 4HPOL 1HWGB 1DSFH 4ODWA 3RVUD 1RURH 4JG1L 2NY4D 4FQLL 1GGBL 5FDWB 4ODSL 1I7TA 3FO2A 3RZWA 4XWGL 4X9BA 1O7SA 2FWOB 4FABL 1DCLA 3DRTA 1LD9B 4G3YL 2P48B 5E4EC 1HKFA 1BJ1J 4JRYE 4EBQL 4FFWC 3MPCA 4KK5C 4OF0A 4LQ1A 4PP2B 3K1KC 5F9AC 2Q87A 3U0PB 1WIUA 3QJHA 4N9GA 5LGKA 4PJDF 4M6OH 1JGLL 1TQBB 1A6ZA 3ILQD 5ABDE 4M6MH 2HTKC 3RWDB 3C6SA 2JB5L 2FGZA 3CCHA 4NPYB 5DZNA 4KZDL 3ILQC 1LP9E 3NZ8A 3LS5L 3UJJL 2VC2H 3BWAA 5I1LA 4FQQB 3GJFA 1B0RB 2QTEA 5HYQA 3G6JA 1A9EA 3ZTJH 1RU9H 3ZHKA 3HB3C 4FXLA 2J8UF 2HMIC 4OIAA 4X8JA 5JHDD 4EVNA 5IV2B 3QDGE 2D4DA 1JPSH 3WHXA 4KTDL 5KBNC 2PTTB 1H5BC 1BHGA 1DVFB 4ONOA 5HI4C 2EH8L 4NQVB 4DN3H 4WVRA 2P1YA 4LU5H 1MHEA 5FYJE 1FC1A 5FB8A 1X5YA 4U7SA 3EFFB 3M1BA 3BVNA 2R69L 2VE6A 3HI1B 3IKCB 4IDLA 1AIFB 2P42B 3MV9B 5MERA 1HEZA 2YZ1A 4ZPVB 3RBGA 3DMMD 1M1SA 3FT3A 3MRJB 4JFPB 4PBWD 4CW1A 4HT1H 1ND0A 4N1EA 2ZSWB 3RGVC 2PW2B 3I2CL 3SCMC 2MPAH 2Z9TA 4FQPA 4LASH 4M48H 2VDLL 1LE9A 4ZFGL 1E27A 2HFEB 2VDPH 3D69A 4MA1C 1CXIA 4J3WA 4MLIA 4PYGA 5LGHL 4PY8I 4MJID 1JF5A 4AEHH 4Z8FH 1MI5D 4GQPH 1FL3B 3MGAA 3EO0A 1F58H 2HA1A 3I75B 3N1MC 4XHQA 2EDFA 2CH8A 1MCPL 5KVFL 4FZ8L 5CWSA 2WINB 1L9MA 1OGAA 4WTZA 1J1PL 1S5IH 3U0WL 3TF7C 1YQ2A 3VWJC 1KELH 1D6EA 4UOW1 4E42A 1IGJA 3BKJH 1RFDH 5DJ2B 4P4RA 1FFQA 3HLAA 5I1DA 4UNUA 1QSVA 1IKFH 4Q9RH 2WIIB 3AB0C 5DJDB 2DJUA 1YECL 2BNQB 5J9PA 1XF2B 3DURA 1ZANH 3VXPA 1IC4L 4OIIH 3O2WL 1E4KC 5FHBL 4UQ3B 1QLFB 1RUKL 2R1XB 2ORBH 3IFOB 4GRWH 2BSRB 5HHOE 4UUJB 4KK9C 1AGBB 2P5EB 4BZ2H 5T1MB 1MCCA 3VI4F 1FPTL 3KYNB 1YPZF 1H15A 4WV1C 4KHXH 1C5DB 3SDXB 1T03L 3UJTL 4WGVB 5HGGS 1DBBH 1ZS8A 4D0DB 2BK8A 3LN4A 5FM5O 4KVNL 1TPXB 1EEQA 2UWEA 2XWTB 4XMLH 4E9LA 2KUTA 3U9UA 2LTQC 4PV9B 2YHGA 3RIAF 2X05A 3RQ3A 5INDA 2VXVH 3QH3B 5D1QB 1RZKH 2X10A 4PGCA 1T89C 3JWOC 3FO9B 4DQOL 4X6CB 2HLAA 4JPKH 1T7YA 4FQCH 1SJVA 3MLWH 2DQGH 1UM5H 1AGDA 1KJVA 3EYSL 4TSBH 1VFBB 4HIHB 3WUWB 4LSPL 3UZVB 3HRZB 5DK2A 1Q94B 2IAMA 2LAGB 1N6QH 2I5YH 4Q58C 5DK3A 4MDJA 1X3DA 1MQ8A 2X89A 5F9WC 5E4IA 3CVHH 3OAUH 2YMXL 3MUHL 2XZQL 2NY6C 1P7KB 5HYJE 1DTUA 2A83B 5L2JB 5EUOB 4IMKA 2Q3ZA 5E6IB 4MAUL 5KVGH 5D7JB 4JE4B 2HVJB 1LQSR 5I1GH 3NCBB 3OPZL 4CNIB 3V0VA 4YAQB 1XCTA 2VXQH 5ESQA 1C7SA 5FGBC 3SPVA 5E00B 2IBGA 3WJLA 4U1HB 3G6JF 2R2BB 5I8OH 4WEMB 3ULVH 3IXAA 2YA1A 4Z5RA 2AXFB 4UILL 2X1PA 1QHPA 4ZAKA 3BGAA 2WNGA 2DLHA 4P23A 3LEVH 12E8L 3CMGA 4I4WA 5DRZA 5A43C 4NFBA 4P2RB 4D3CL 4M7LT 4LFHG 8FABB 1XF3B 1V05A 4HX1B 4GXUN 4Y4FA 4RFEA 2D0GA 3CSYB 3DV4B 2RCSH 1FNEB 3EBAA 4IRJB 3T4AB 1TCMA 1EHLL 4JDVB 4S1DD 4M93C 5JZ7D 4HUWA 4FFYL 5DDHB 4POYA 2JKXA 5IFJA 1TZIB 4QXTB 4PRPE 2GSIB 5C0CB 2YRLA 5DUPL 4HBCH 3EGSB 4U6VH 3TT3H 3CH1B 3N1FC 5C0JA 1ZWIA 5DO2D 4OD2A 2JJSA 5CD3A 1ZKAA 4U1NA 1MEXL 1TZHA 2BSSB 4MVBD 4GBXA 4WO4C 1HK6A 2X4UB 5DD6A 3L3GA 4GQ9H 2PF6A 2H26B 1AE6L 4XPAH 3GHBL 3L3HA 1MCOH 1T1YA 3LV3A 3TESA 3EZJB 4Z0XA 3TN0A 2ARJB 2HP4A 4Z7VA 1S7RB 5GRXG 3BN9D 1GZQA 4XNMB 4UNTA 5EU5A 1X4YA 5GRZA 2RQ8A 5DUMH 4U6TA 5JXAH 1NAML 1L7TH 1MJ8L 1RJCA 4ZSOA 4PV8B 1ZT7A 25C8H 1OAKL 5FYKD 1JV5B 4JPVH 2R9HD 5BV7C 1ACYL 4NNXA 4U1MB 4JGJA 4ELME 3LN5A 1MIEL 3CVHA 2DICA 1G7IA 3KNBB 3MRKA 5IW1B 3T65B 5E2WH 3CIQA 4UT6L 4F7TA 5IK3B 4QOKA 3ZL4L 2GUOB 1DDHB 5C0AE 4KROC 5FUZH 3RKDD 3V4VL 3MODL 4Y5VC 4QHMB 4UV4H 1MQKH 3P40A 1U8OB 1OSZB 1UEMA 2X4PB 4ERSH 4XNXH 1W8NA 4YNYA 2UWEF 1QYGL 2C9AA 1S9YB 1EAPB 5L2KD 4PGEB 3BT2H 3V6OA 1BGXL 4LIQE 2I9LA 2Y72A 3UTTD 4P2OB 4U2YA 4PRHA 3B43A 4GRMB 3TVMB 1A21A 2DQEL 3LKPB 2SEBA 4OB5L 2CXKA 4ZUVB 4OFIA 4NBZB 4L4VA 1QLRA 4PG9B 3M8OL 3V7MA 5C0BE 1IAOB 2BOBB 1HHGB 4U1GB 3ILPA 1FSKC 2AJZA 5B38A 5DJAB 4LSRH 2EZ0D 3BGFC 1OGTA 5I1AB 5DRXA 4N8VA 4BH7A 1WITA 4WWKA 4Q97A 4HS3B 5IMOB 2EZ0C 4HD9A 4MD5B 2VTFA 3L5WB 4KDVA 4LLWA 1KTKE 4FQIH 3X3FH 5DURB 5IJVA 1N5YH 4HJJH 4LSDA 1S7WB 4BQBA 4A6YH 1N3NB 4JAMA 5HSFA 5IB5B 3HG1D 3H9ZA 4AIXA 5TE7H 1CGTA 1B9ZA 5CD5D 4OI7A 3NIFF 1S8DA 1I3GH 5FUOH 3UPRB 3DXAA 4JHAL 3UYOD 4EI5A 3TA3D 4LK4A 1MRDL 2Z91B 3AAZB 3RWGB 4QGTA 3SE9H 5T33L 1JRHI 4L3ED 3LH2L 4N0YL 1S7UA 4EN3B 6FABL 4LEOB 4MHHI 4I2XE 4UQ2B 1S7XB 2FEEL 2IJ0C 5TQ0L 2ZOLA 5EN2A 2XXMB 3OWEA 2Q1EA 4XBEH 1MCBA 1BOGA 1I7ZA 4S1SL 5EH1A 2OTUA 1QSZA 1SEQH 1CN4A 1FFPB 4KTEH 3NZHH 4TULL 3STZA 2XTJD 1JF1A 1KEML 4KJWD 3ARXA 4AY0A 1YMHB 3OKYA 1E6JH 3BDXA 3WXVH 1ZVHA 1JK8B 1VFUA 1D3CA 4GRWF 4R9HA 3U6RA 3BH9A 1P4IH 4GKOA 1ZTXL 3RL2B 2F53E 3QA3A 4X4XA 3HPJA 5KZCB 1RK1A 3BEWB 3MJ8A 3B9KC 5C8JA 5IHZB 4JREB 3SO3B 4BUHA 1TZGL 1G7LA 4OFKA 4P2QB 5ENWB 4NSKB 4LCYB 1UYWH 3WMSA 4HIJA 2QHLA 2XTLA 4JQIL 4OCLC 1T66D 1I3VA 5LQBH 4IIQB 4ZDHB 1OP5H 3RWCB 4EI6A 1EX0A 1T66C 1D5IL 4WDIA 3VGGA 1HI6B 1KPUB 3QEUB 5GRUL 3QULB 4Z7VF 3THMH 1C1EL 1M7IA 2F58H 2X1QA 2VLKB 4HC1H 4PJ9D 4JRWA 1DQLH 1WAAF 2XZAL 4PB9H 1QLEL 4L5FH 3MACH