2Y64A

Xylopentaose binding mutated (x-2 l110f) cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
167
structure length
167
Chain Sequence
b'MLVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSFDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
total genus 41
structure length 167
sequence length 167
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y64A00
4AG4A 4XZUG 2C26A 3WNPA 1EUTA 3I2IA 4UI9L 3P6BA 2CDPA 2BZDA 2W1WA 5HPOA 2WQ8A 3JXSA 3W5MA 3IAQA 4QX2A 2W95A 2VMFA 1PMHX 3SKJE 2W5FA 2C4XA 1ULPA 2JKXA 3THCA 4DUXA 1TG7A 5DPNA 3I3EA 3CQOA 3WF4A 1CIYA 3EB7A 4CU8A 2EIEA 1XPWA 5G04L 1WKYA 4TTGA 1NUKA 3HJRA 1SHWB 4KI5M 4DEQA 2J1RA 2CDOA 4YPJA 3A23A 4ET7A 1PX3A 4LPLA 1K42A 1JHJA 3CMGA 3I3DA 2VZOA 5JXJA 3HNYM 5JMOA 2WYSA 5LCWL 5IJRA 1GQPA 4E8DA 2BERA 1LNSA 1JZ5A 1JU3A 1PX4A 2X09A 4BJ0A 1CX1A 2Y8KA 2QQOA 3VD9A 4A41A 1L7QA 2X05A 5A1AA 4MADA 1OF4A 2VZTA 1JZ8A 4QDSA 5C7GA 1I5PA 2W92A 1CZSA 3WNKA 2HLEA 2W46A 2XHNA 2VL4A 3HNMA 3ABZA 3IAPA 4XUOA 3MUY1 1ULOA 2VQTA 4TXWA 4XURA 4BDVB 1T2XA 5IHRA 2ORXA 4QB6A 3BGAA 4D8MA 1JYXA 5JXGA 1D7PM 1JYVA 1PMJX 3VDCA 1UY0A 4GWIA 4JKMA 2Y6GA 1RYYA 1US3A 1US2A 2VZSA 4ZZ8A 1UZ0A 3NJXA 2W87A 3WNNA 5LA0A 2DCJA 4DXTA 2J22A 3T08A 3CIHA 3HOBA 1NX9A 5F7UA 5FUIA 2Y64A 1GOHA 2J1SA 1O59A 2ZXQA 1JZ4A 2E31A 2XQXA 2B9VA 4BXSV 3DYOA 3I3BA 2Y6KA 2OKXA 2W91A 3VD7A 3HN3A 3T0BA 3K75B 3A7QA 1IQDC 3ECQA 4ARYA 1OF3A 3WF3A 4LQRA 4P5YA 4A4AA 3CDZB 1UY4A 3IDAA 4QDQA 3UESA 1F4HA 1UYXA 2VZVA 2WN3A 3OG2A 4OMCA 5HXMA 3VD5A 3NQHA 3K77A 1J83A 4OYUA 1XC6A 3VDBA 4QB1A 3ACFA 4W50A 2J1AA 2VC9A 3WF2A 1JZ6A 4CVUA 2B4KA 4JKLA 5LA2A 5LA1A 5JXIA 2QBXA 1GOGA 2WZ8A 4P02B 1JI6A 1GMMA 2VOTA 2ZEXA 5JUVA 1W0NA 4RYDA 4AAXA 3AC0A 2C9KA 2JD9A 3FN9A 3T0AA 1W8OA 4OZOA 3W5NA 5C70A 1WCQA 1K3IA 4UAPA 4ZZ5A 3CZJA 4W4ZA 4CUBA 2V4VA 2Y6HA 3OGVA 1OH4A 4KMQA 1J84A 5JR2A 2YFUA 3ACGA 2WABA 3OB8A 3LE0A 3OBAA 3P1IA 2W47A 2WO3A 2KD7A 3D3AA 3ETPA 3MBWA 3EYPA 2QQKA 3C7OA 3NJVA 3C7EA 3GDBA 5B4XA 2VZQA 1UY3A 1TVGA 2WO2A 3IIIA 1CZVA 3FHQA 5IYYA 3PUIA 4A45A 4QB2A 2V5DA 1K12A 1JYNA 3T2OA 3I2HA 5CYYA 2VCAA 2Y6JA 3NRUA 1F4AA 4CU7A 2WAOA 2VM9A 2PQSA 1YQ2A 2ZEZA 1UXZA 3C7GA 2YG0A 3WNMA 1W9TA 2QQLA 2XOMA 1W9SA 5JXHA 3WF0A 2VO5A 3MO4A 2QQIA 4DUVA 3K4ZA 2QQMA 2RJ2A 1P8JA 4QPWA 2EIDA 4QDRA 4GZ9A 4XVHA 2XONA 3A22A 3OEAA 2W1QA 2ZEYA 3I97A 2W1SA 3LEGA 4E8CA 1UMHA 2VMCA 4PQQA 5C71A 2J1TA 3K4AA 3LQCA 2LW8A 4A44A 3UETA 4CU6A 1JZ7A 3OEBA 5DQ0A 3LEKA 4M4RA 1SG3A 3ACHA 4L0PA 3WQBA 3DYMA 1O8PA 1UMIA 4FI9A 3F2ZA 3WF1A 1NAEA 4DUWA 2HYXA 4P00B 1K45A 2JE8A 1HN1A 2V72A 4MGQA 3MV01 1UWWA 3HPNA 4LHSA 3T2PA 2VQUA 5CZKA 3MUZ1 3THDA 4W8JA 5EJZB 3J7HA 1OT5A 2VCBA 2VJXA 3DYPA 3FL7A 3UNPA 4QX0A 2VCCA 5EIYB 4RN5A 4IUGA 2BGPA 4CU9A 4HG6B 1W99A 1CZTA 1UX7A 1JU4A 1BHGA 2J1VA 4XUTA 2WDBA 2YC4A 3A21A 1JZ3A 4PT6A 1GUIA 5I0DA 1DYOA 2EIBA 3IB3A 3K46A 1GOFA 2VZRA 3HNBM 3I2GA 1UXXX 2VMDA 4BK4A 4D0QA 4Z2AA 1UY1A 4JHZA 4XUNA 1GU3A 2J1EA 1H6XA 3T09A 2QQJA 4QAWA 2YFZA 3WNOA 4DEVA 3SKVA 3I2JA 1H6YA 2QQNA 3VDAA 1SDDB 1UYYA 3BN6A 3WNLA 4GWJA 3GXUA 2Z4FA 3CZUA 4OUEA 4BK5A 3WEZA 4MGSA 4A42A 2ID4A 2VR4A 3FHAA 2VZPA 3HEIA 2W94A 2VZ3A 3T2QA 2DDUA 5J1XA 2LS6A 2RVAA 4ARXA 3C8XA 1UYZA 1JYWA 1DLCA 4XUPA 4M4PA 5DMYA 4JX0A 3PUHA 3K4DA 3OGRA 2VZ1A 2W1UA 4KWUA 3VD3A 3GGLA 2Y6LA 4MOAA 2X10A 1DP0A 4PF1A 2RV9A 2L9LA 3ACIA 1JZ2A 5EJ1B 3GM8A 4DXSA 3OGSA 2YB7A 5B4NA 2W3JA 1MPXA 2WN2A 3MV11 1KEXA 2WZEA 3I2KA 3SEPA 2J1UA 1EUUA 2YC2A 3CKHA 1W8NA 4QX3A 2ORZA 1OD3A 2W9XA 2WO1A 3SEEA 1UY2A 2E26A 1L7RA 4CUAA 2VMEA 2ZEWA 2DCKA 3C7FA 1XNTA 3WSOA 1R64A 4LKSA 3LEIA 2BBAA 2WAAA 4CUCA 4XUQA 5IFTA 3VD4A 2E32A 2BGOA 4ZY9A 1NKGA 2J7MA 4UOJA 4DXRA 1XNAA 1GNYA 1W9WA 5IFPA 3I2FA 2VZUA 3C7HA 3T0DA 2WBKA 2JDAA 5DN2A 2VTFA 4P08A 1O8SA 3E1F1 2EICA 2WUHA 3NNGA 3LPFA 4A6OA 3U37A 3LPGA 4OMDA 2R7EB 3ZM8A 4QX1A 2E33A 5G05L 1KGYA 4ZXEA 4MO3M 3DECA 4A3ZA 4JKKA
chains in the Genus database with same CATH superfamily
3AB0A 1YRZA 1N1TA 4XZUG 3ZIWA 2C26A 3M1HA 5C3QA 3WNPA 2FDIA 1N3QA 5HI0A 5BPXA 1WCKA 2DUOA 5FY9A 3RSJA 3VDDA 3JXSA 1PGW1 2JG9C 3D6EA 3OY8A 2A70A 2W95A 3DUIA 1DLLA 1PMHX 1UPSA 3USUA 2SBAA 4LBKA 1GZWA 1VMFA 2C4XA 5HV4A 1ULPA 5JAXA 3MIHA 4HVRA 4XXPA 3THCA 1W8UA 2GSYA 3H1YA 1TG7A 4JHTA 2P34A 2P1BA 5JOZA 4B7KA 2RS31 5EJ3A 2D6KA 4HL0A 5KXEA 1XPWA 1W2UA 5E6HA 3KV9A 4PHZA 3ZFFC 1WKYA 2JDKA 3HJRA 1SHWB 1V9U1 2D43A 4KI5M 1ZA4A 3TWIA 4DEQA 1SCSA 2OA2A 1W6QA 1PK6C 4FPEA 1FOD3 2XUEA 4B7EA 1LGCA 2VNGA 4QM9A 5LY1A 3N7JA 3TBDA 1LOFA 2VBBA 3HR9A 4LPLA 2W0XA 1K42A 3I3DA 4XJZA 4BPZA 5JXJA 3M2MA 4HPKB 3WINE 2JENA 4KWKA 5JMOA 5DZFA 3H50A 5IJRA 3RYKA 2A6YA 3VBUC 1PX4A 4QQLA 5JOXA 4Q4V3 4QXKA 2NN8A 4KG8A 5C9AB 3DXUA 1LOFC 2R063 4HETA 4OI1A 5FPLA 4FPKA 3VD9A 2P3JA 1LOAA 4A41A 2Z42A 2JKBA 1L7QA 5CAZA 1C8M3 1YIPA 5DG1A 3ZFGB 1SLIA 2ZACA 2A5ZA 3I8TA 1YQCA 1JZ8A 4RHV2 5JLVA 5C7GA 1WA6X 1I5PA 4YZ1A 3MGUA 3ITQA 5I0UA 1O3TA 5I0RA 2YU2A 2ZGQA 4YGCA 1AR62 1K5MB 2ILMA 4EJRA 3ABZA 1VRBA 2GH2A 4XUOA 3J8F1 4HN1A 3MUY1 4RGAA 1ULOA 3ZXAC 3K2OA 3PJYA 3PDQA 4TXWA 3BPSA 4AI1A 4XABA 4AI2A 5BNQA 1YC61 1OLME 4N43A 1ZZ8A 1I1EA 2ORXA 3RZGA 3BGAA 3JBG2 2XJTA 4PBPA 1JYXA 4CCEA 1KJRA 4FOQA 1QNWA 1OC1A 4RS5A 1UY0A 5EFUA 1HIXA 2YXSA 2WR9A 2JDHA 1EAH1 4AHXA 1I5ZA 4QHBA 5DAPA 2UURA 4BIFA 1IOAA 3ZN6A 2HKXA 4XJWA 3PU8A 3PL0A 1RYYA 1US2A 2VZSA 2ZGMA 4LOSA 4NUBA 4QX5A 2WO7A 4IV1B 5GLZA 1UZ0A 3FLTA 1JOJA 1W28A 3M3EA 3J9SA 4MGKE 1QJFA 5I8YA 2W52A 4LJHA 4V1PA 3AZWA 1CWPA 4UT5A 2XR4A 4URAA 3ZSMA 4XF1A 3J8F2 4C91A 3WG1A 1GP6A 1W6PA 4QPIC 5FUIA 3DGTA 1R1A1 3WX5A 1AJKA 2Y64A 1VBA3 2RDQA 1OMIA 3POJA 3BALA 4IL7A 1E5IA 1QQP2 3ZPOA 4BQ1A 2G9GA 2RMU2 1JOBA 2XQXA 4Z8BA 3DKWA 2AUYA 4LBMA 4ORFA 4BXSV 1S0EA 1OD5A 2Y6KA 1CPNA 5JOWA 1UKRA 1W8TA 2HWB2 5GZCA 5FOJB 1N3PA 1RUE2 1DQ1A 2ZHLA 4Y5SA 1RUF1 2CL2A 4I0BA 1IS5A 5JIAA 4BQWA 4F3JA 3UYJA 2P4EA 5AVAA 3WF3A 1PM7A 1CGPA 1H4HA 2D44A 3WNXA 4QDQA 3ZMNA 3IDBB 3UESA 1F4HA 1UYXA 2VZVA 4OMCA 4OCTA 3POIA 2CWMA 3HQRA 1TMF3 1Q43A 3NQHA 4FOYA 3W21A 5AC92 5K7PA 2F17A 4K6BA 4K1ZA 2XJVA 4QQOA 4L97A 2DUPA 4OYUA 3MW4A 5H9PA 2E7AA 4LE3A 1SLLA 3SC7X 3I54A 4QB1A 4NIAA 3U14A 2YHJA 1CJDA 5CEHA 2VC9A 3BODA 3RYPA 1LULA 5IVEA 2VUAA 2YBKA 2DFCA 4FPCA 4LKFA 4INDA 1JZ6A 3KS7A 4CVUA 4FP2A 4JKLA 5BNOC 4GALA 5JXIA 5FZ1A 2VOTA 1ZZ6A 1OURA 1V6OA 4PJYA 4AHZA 1XSRA 2GDFA 2Y0OA 3C2UA 4JQTA 1Y7BA 4CTEA 1FI2A 1YI9A 3LFIA 1YQ8A 2OVUA 3AC0A 3LZZA 2YGLA 2EXHA 4Q1RA 4OZOA 4ASLA 2NYYA 1WCQA 2R073 5DDJ1 3VDDB 4ZZ5A 3O1RA 5D21A 3OY8B 3LA7A 3ZSEA 5IAXA 1U5ZA 2BUKA 1OH4A 3IWZA 1NXMA 1TE1B 3NJZA 5JR2A 2OYZA 1OI6A 4ZS3A 2P3YA 1QY4A 1NA1B 2WABA 3QOPA 4FT8A 2CHHA 1F5FA 3LE0A 4LK7A 4L92A 4YLZA 2AZ5A 2VVEA 4X6QB 4XBNA 4E4HA 5LBEA 2HEVF 2PMWB 4HANA 5E89A 3PIGA 4PLOA 4BXFA 4EN8B 5JSRA 1Q3EA 1E57A 1YCIA 4OVEA 5CFCC 4LT5A 3PNAA 1BVP1 4BZ4A 2IUWA 5EHDA 2KD7A 4YW6A 3ETPA 3EYPA 2RM21 2PLV1 1W6QB 2QQKA 3E97A 2XVKA 3HWJA 4I30A 5B4XA 2TBVA 1GKBA 1ASJ3 3IIIA 2GU9A 1LGBA 3FHQA 5IYYA 3LGRA 2WZR3 2PAKA 1UZZA 1JYNA 5IK8A 3RZJA 3T2OA 5CYYA 1UU6A 3ZN5A 2Y6JA 3NRUA 2FDJA 3WUDA 1B35A 2GP3A 1VBD2 4HLTA 1W6MA 1WMXA 2PQSA 4UFIA 5IVVA 5FWJA 3MYXA 3F95A 1ZZCA 3KLSA 4ZXKA 2HEWF 1OA4A 4COYA 5BNPC 3KB5A 3G7DA 1XYOA 1XBFA 5DUXA 1H4GA 1X7NA 5JZGC 3JB4C 3WV6A 5FYTA 2B5HA 4AEDA 4Z92B 4Q4V2 3UT0A 2QQMA 2PHUA 2RJ2A 4MGZE 2A3XA 2OIIA 1W05A 2D5HA 5FPAA 4QPWA 1ZZ7A 2EIDA 2ZBJA 2HWF3 3LIHA 4QDRA 3ZX7A 1Z7S2 2A1XA 4KWJA 1ZRCA 1WCUA 1ZVFA 5KHHA 1MS3A 1JUIA 1UZVA 5J98B 1QH7A 1KITA 3OPTA 5FMCA 3TN93 1JYTA 4B3NA 1U12A 2YY1A 1VPHA 5HBAA 5L19A 2RS52 2WNUA 1JS9A 1L7LA 3LEGA 4GH4C 2Y6FA 4PQQA 3BCWA 4AGRA 1ZBA2 4FPHA 4NPMA 4N43B 2XDVA 4NWVA 4NROA 4YYOA 4XTMA 5BNNC 1JZ7A 3ILRA 3LKJA 1RUH1 5DQ0A 3LEKA 4OI2A 4M4RA 1SG3A 1WW7A 2ZX4A 1AF9A 1YFUA 4L0PA 4RS5B 3NSTA 5IK7A 1FNZA 1O8PA 2DBIA 4FI9A 4ZKTB 1SBDA 2HH9A 2JE9A 1QU0A 1NLSA 2C0ZA 2JG8A 3F2ZA 1NZIA 3PTYA 1PIV1 2R32A 4F83A 1Z0HA 3KF3A 1VAVA 4DUWA 4E27A 3WW1A 5EWSA 4BQ3A 1K45A 2WT0A 4ES8A 4TWTA 3NW4A 1MS1A 4N7UA 4XIKA 4Y20A 2VE1A 3GCXA 4FAHA 4I09A 2ZGUA 1AR72 3FLRA 4LK6A 4CDUC 4QGMA 3P3NA 4MXVA 1WA4A 2VBPA 4R4ZA 2JG8C 1AYN3 4XILA 4JRAA 3POSA 4NAOA 1QEXA 4YGBA 4QX0A 2VCCA 3ZXKA 4CP0A 4FBFA 2Z5WA 1Y9QA 1E5RA 5EIYB 4H7LA 2HWC3 4IUGA 1GP4A 4BISA 2LM3A 3OSDA 3WR0A 1QJZA 2J1VA 3OGGA 4ASKA 4CDQC 3NAPA 1XOYA 2YC4A 2RS11 2VXRA 5DUVA 4X6RB 1JZ3A 1PIV2 1GUIA 4UF0A 5I0DA 1DYOA 3EHKA 5DUWA 3VKMA 4XFIA 1ZRIA 3K46A 4RFT0 2KXLA 3VV1A 1GOFA 1VRH3 2VZRA 3AZVA 4QXCA 1W0PA 4IW3A 1Q5OA 1W0OA 2SLIA 4XJ8A 4IESA 4BK4A 3SH5A 4Z2AA 5L9RA 1UY1A 4XUNA 3MF6A 5DXDA 5H9RA 5C33A 1ND3C 2EAKA 3VHNA 3H3LA 1EYBA 2EA7A 1AR93 1FPN2 3V0AB 1W8FA 1POV0 1R081 3CJIA 3VZNA 1HJGA 2XKOA 2HWD2 1H6YA 1LHVA 2ET7A 3MPBA 5K0UC 3WW4A 4UFLA 3ZSLA 2QQNA 5F1RA 5L9BA 3VDAA 1XNBA 2QNKA 4IE5A 3UK9A 3BN6A 2WC2A 3POEA 4QPYA 4O9EA 1RTVA 3TRSB 4ZU7A 2YPJA 1NE6A 1XYNA 3AM2A 2Y34A 1S0CA 2BP6A 3NJYA 2X5IC 5FO7B 1TME3 1S0BA 1WW5A 5FBZA 1IPJA 4WVWA 4MGSA 2YYOA 1RL3A 4A42A 1VAMA 5EV7A 2VR4A 3DV8A 1AHSA 3AMQA 4XJUA 2VZPA 4NE9A 4CCDA 4R9DA 4DIQA 4GD4A 3VZKA 2ADEA 4AL9A 1LEMA 2HWE3 3ZR5A 5CU1A 4YARA 3OCPA 4ARXA 1F9KA 3C8XA 2CTVA 4Q29A 1ZBE2 2P37A 4UFJA 1JTZX 1RINA 5IVJA 4FPLA 2XQRA 3N9PA 1QJX2 2VMHA 4FOWA 1LGNA 4I3PA 5A3PA 1NLQA 5APAA 5LBBA 3WDUA 4YFZA 3WG2A 2ARBA 1X82A 4KWUA 1CX4A 3GGLA 2VECA 3VD3A 4XPVA 4YVWC 3W20A 4CE8A 2X10A 4Q4W3 4N9IA 4PF1A 4IEYA 5FZMA 3S0MA 3OTFA 2L9LA 4N8MA 1PVC1 4AFDA 5C4WA 3O12A 4JQRA 3W59A 1CESA 5F6LB 3CBNA 4BU2A 3SCFA 1S2EA 1AZDA 1HRV2 1VMJA 3GM8A 3OD0A 3OGSA 1WD3A 4HT1T 5A33A 2HYKA 4L2NA 3PVBB 4AHYA 1F31A 2IXKA 4IGPA 5FXWA 2QQVA 4CP2A 4XYXA 1EV11 4OHVA 4GJZA 2WRAA 5GLVA 1FMD3 2D98A 3HT1A 2YC2A 4BLIA 1H2KA 2VBDA 2OT7A 5CB7A 1W8NA 3CKHA 5ACA1 1OQDA 1V6JA 1Q8PA 3Q9OA 3WLUA 1B35B 4IV3B 3NWKA 5D2AA 2MNGA 2Q30A 1LHUA 2Q4SA 3RQ0A 2WZR2 3SEEA 2YROA 1O4ZA 1TEIA 2PHXA 2O0OA 2NLRA 5SV5A 3KHCA 1X8EA 4CUAA 4AVTA 2BBVA 5FDBA 2ZEWA 4GIQA 3WHTA 3EQEA 3WSOA 1WMDA 2P3KA 1OFNA 1PVC2 3JU9A 5FZCA 1C28A 4HMZA 1IHMA 1U0AA 1OKOA 4WVVA 3EXUA 4QPGA 3DEMA 3KMHA 2TUNA 4NIDA 2PQQA 1HRI2 5FZLA 4CEYC 2E32A 2BGOA 2WSVA 1NKGA 1SBEA 1U5IA 3JQXA 4XCBA 5FZAA 5LRSA 4FFGA 5LB6A 3WD5A 1GNYA 1W9WA 4M3CE 3WCRA 5IFPA 3I2FA 5FOBB 1XNKA 4C0HA 5ACA2 4BQXA 1COV1 4DRVA 2W08A 1POV1 4QX8A 3GJAA 4B1LA 1O8SA 4MH0E 1IG3A 4C8DA 3E1F1 2MEV1 3NNGA 3BB6A 4A6OA 2V4AA 3OUHA 4Y4YA 4DFSA 5A1FA 1MVEA 3LAGA 3IT8A 2R7EB 3ZM8A 5ISLA 2W2IA 5GLUA 1J59A 2E33A 1RJ8A 4MV2A 1LOEA 3BTAA 4MO3M 4NIIA 1O3SA 3THTA 1LHWA 4ASMB 1RUD3 2UWBA 2WKKA 2BPA2 4S2GA 4A3ZA 3L2YA 4HSLA 1POQA 3ZYJB 5IVFA 4AG4A 1OPMA 2LUWA 4DMIA 5A6YA 1EPWA 4OI0A 2A7AA 3RZHA 2H0VA 3D0SA 4XMIA 3JB8A 2CDPA 2W1WA 1X9PA 3VBFA 1G9BA 1WGPA 1QDCA 1BBT1 1AYM2 2DCTA 1DGRA 4CCMA 3O0WA 1W6OA 1ND2C 4GAZA 4CPBA 2VMFA 3LF7A 3MLLA 2ZKLA 4IGQA 5LATA 1IKQA 2JICA 2P17A 4HN0A 3ILFA 1W6NA 1TQ5A 3AMMA 4PDWB 1Y43B 1VMHA 4CDWB 1C1LA 3M4FA 2RS33 3POFA 4YG3A 4AVVA 5C8CC 2HBTA 4YFWA 3SCGA 4EN7B 3WF4A 1QJY1 4CU8A 1CQ9A 1M4WA 2D6PA 4CZSA 4RHV3 3T4VA 1WLWA 1S4CA 5G04L 3I4IA 3PU3A 4WM7A 1NCRA 2P5BA 3ES1A 4HKOA 1DU3D 2J1RA 2CDOA 2DTWA 2WT2A 2G19A 2JD4A 4AVAA 1JHJA 3CMGA 4EN9B 4DO0A 1RUI1 2JWPA 4OZXA 1CIWA 1PVXA 3PVEA 2WYSA 5A3TA 3U4SA 2MPFA 2DU0A 3VBRA 4MX3A 4QQ2A 3JBG3 3VBSA 1RXGA 4AAPA 1RUC1 1D2SA 2X09A 2HBUA 1VBB2 1DGWX 1JUHA 2ZZJA 2WS91 5DZEA 3PUAA 1CX1A 3UV9A 1EP0A 1AR92 3WP5A 4NIHA 5ANNA 1A8DA 3ON7A 1R091 1NCQA 3VBOB 5EZWA 3AK0A 3K48A 2X05A 3WZ1A 2R041 2XMLA 4FFHA 4MADA 4CXWA 2D6OX 1OF4A 2DBNA 2H6CA 4JC1A 1V00A 3VBHA 3OD4A 1S0IA 1CAUB 4QDSA 1C3HA 4WBBA 4K20A 4YNIA 5FRAA 2W92A 5KBFA 3RYRA 3ZYFA 5CNAA 1S1AA 1WWYA 3J8F3 2QUOA 1JBCA 1RUI2 1W03A 5EP9A 3IAPA 2XVGA 4XF9A 3J7LA 1QQP3 4K9SA 1AL21 3WP4A 3B9IA 1RB8G 1GNHA 4FTEA 4BDVB 4RQPB 1W04A 5IHRA 1LENA 3AMHA 4IEQA 1TNFA 1RJ7A 2B39A 3FJSA 3IDEA 4AYUA 1RUE3 1EAH3 2EXKA 3CF6E 1PMJX 1KDMA 4CUBA 3VDCA 5LEJA 2W39A 5C4WB 3GZTB 1I3HA 1NY72 1IS4A 3E6BA 4JGYC 4COZA 4D7YA 5A7WA 4JKMA 4OQ9A 3ZYRA 4KBZA 4Q4W2 4CEWB 2Y60A 1XRUA 4XAAA 5EXOA 4BCUA 5IATA 1BCXA 4LBQA 4UFMA 1W8WA 4GMP3 4QXHA 4FQZA 3WNNA 2H0BA 3FLPA 1QOOA 5FP8A 1XJAA 4OLLA 1W06A 4DXTA 3FFQA 2FDFA 4KU7A 1MQTB 3T08A 2IXJA 1R1A3 1YHFA 1MVQA 4GB31 3H1WA 4EYUA 1QOSA 4AQSA 1WMFA 2EALA 1H8TA 2YBSA 1QNYA 3M7AA 1O59A 1FYUA 5FY7A 4AEJA 4P9YA 1JZ4A 2CGPA 2E31A 2GN7A 4N53C 5GLWA 2ERFA 4FSJA 2BQPA 2B9UA 3AYCA 3I3BA 3UKVA 3VL8A 5JVVA 2OKXA 2UWAA 1RUF3 1LR5A 2GMEA 3GZAA 4Q4X1 2DVAA 3V64A 3A7QA 2JG9A 5FY8A 1LESA 5C3SA 5KXDA 5FP4A 4LQRA 4AE2A 4P5YA 1H8TC 4LIVA 1CONA 4Q0SA 4XFFA 5AFEA 5CFDC 3IDAA 3N35A 3W58A 1A78A 4FXGB 1LHOA 1DGWA 2UYBA 4ZS2A 1C4RA 3VL9A 3CHXA 4Z2WA 5FR3A 1CAXA 1QKQA 2A3WA 2F4PA 4CXYA 2YBPA 1GZTA 5L7OC 3ZYGA 2ARAA 1ULGA 3ZFFA 3FUQA 1IPSA 4FPJA 4FP3A 2BVBA 3VHOA 3ACFA 2PYTA 4W50A 5T52A 4Q0PA 3URFA 1PK6A 2BU9A 4HXCA 4K7JA 1QDOA 2IXHA 3PLQA 2QZ3A 2WWJA 3B93A 3RG0A 3UJOA 4YZ2A 1ZNPA 4L8QA 5LA2A 5LA1A 3LEMA 4P02B 1GMMA 1W90A 4PIXA 2ZEXA 1RMU2 3ZXJA 3ZN4A 1BKZA 1BZWA 1YYNA 2OQ7A 1PGSA 4NVPA 2GNDA 2QVSB 5JI9A 1LOBA 1S2KA 1URXA 4LHKA 4WV8A 4JTNA 4P14A 5FQ0A 4LMFA 1RUD2 5DDJ3 3VBUA 1NYWA 5D8AB 3SLIA 3ZYHA 4AR2A 3VBFB 1K3IA 1O4TA 1UQXA 1GP5A 1REDA 5A3NA 2ZHKA 5JI7A 3CZJA 2VXJA 2NM1A 4W4ZA 5GZEA 1W6OB 1U5YA 2V4VA 2Y6HA 3KCCA 3LDBA 1VBD3 3OBZA 1I9RA 2KM2A 1J84A 2WSUA 2YFUA 1I6XA 5FBJA 1WLCA 1OPOA 5KHIA 1PGW2 3OB8A 2R0HA 2YZ4A 3B94A 1SPPB 3AXDA 4V2WA 2GH8A 3A4UA 4NN0A 4O65A 2ZGNA 4S2DA 3OBAA 3H1MA 3LSDA 3M3OA 3HVDA 4BIOA 3JCIA 3AZXA 4BOWA 2ZGLA 1W2NA 4R9BA 1NA1C 3FBMA 5EYXA 3W9AA 4COWA 3RZMA 1LAJA 2R1BA 1WD4A 3D3AA 4LBJA 1Z7S3 1NCRB 2A73B 2FBEA 2RS32 3J4UH 4COUA 3N4MA 3SQOA 3O1TA 2PHFA 3C7OA 1QXPA 1MR5A 4JGZB 1V9U2 2JEMA 3C7EA 4H2AA 5FYZA 1KXGA 2AREA 2Q1MA 2QQWA 3RS6A 1UO9A 1UY3A 1TVGA 3T30A 2B7YA 3ZDVA 2QDRA 2RS53 4MZUA 3KF5A 5JIUA 3PUIA 4K8FA 4QB2A 1ZBA3 2ATFA 1K12A 2V5DA 4LO8A 4M3CF 4AGVA 3DN7A 2VCAA 1R1ZA 4CU7A 3VBSB 2VM9A 4UXAA 4R9AA 1YQ2A 2TNFA 3CNAA 2IFWA 1UXZA 3C7GA 2YG0A 3DPRB 3M3IA 4K21A 1ULEA 1XNCA 4IE0A 3RI9A 1E5HA 1NCQB 1CPMA 2WINB 1PO11 3H9AA 2XOMA 4QKFA 1W9SA 5FZ7A 3MO4A 3K4ZA 5IT6A 1ENSA 1VJ2A 2Z79A 3VBHB 4AXOA 2RR11 3HIFA 3WXPA 2BWAA 3H7YA 5AC91 5FPVA 4XCAA 4CP9A 1RC6A 4QPIA 5FP9A 5FP3A 1AR73 4YZ4A 1AX0A 2BDRA 4I0AA 1QXRA 4I3GA 4FCAA 4B4RA 4UW3A 5C5TA 3KT4A 2Y33A 4LIUA 2O8OA 2RHPA 3UGHA 4GWNA 1GZ9A 2BOIA 3FUOA 4E8CA 5T55A 1YEWA 2JDYA 3GBGA 5I0TA 3RPQA 4AF9A 4RR3C 1BEV1 2ZGTA 3NV1A 4Q8LA 2BVVA 2ZABA 4Q5OA 3TNQA 5FXXA 3BPZA 4GQ7A 1QJU1 2ARXA 2WNVB 3Q8EA 2FMDA 4XJAA 5CVRA 4CDXB 5ABJB 2NMNA 4NIGA 4WVZA 2OXBA 3KV4A 3KZ4C 4GXLA 1PIV3 1OVSA 3DYMA 1PO12 4BM8A 5A7WB 3ROUA 2PHTA 4C90A 1S0JA 3S30A 3RZLA 4DQAA 5KC5A 3ZXEA 5KXCA 1EAH2 1ENXA 5FPUA 2JE8A 2FHRA 2JDNA 2V72A 4LBQB 4NRQA 3TEXA 3ZFEB 1W39A 1GICA 1N1SA 1MS5A 3MV01 1UWWA 4LHSA 4EZHA 2VQUA 5CZKA 2WIIB 2ETEA 1FPN3 5EJZB 1GQGA 2VJXA 3HQXA 4Y1VA 5BNOA 4QWNA 2HWD3 5LBCA 3MLKA 3GHNA 1SLTA 3VHPA 1BEV2 2I74A 4AFBA 2PHWA 4WVMA 3BTXA 2B45X 4LO7A 5F3GA 1IQAA 1QJU2 1R1A2 2D6NA 3AZZA 5JWPA 4HG6B 4BQ2A 5FLHA 3X29B 1JU4A 4XUTA 5FLJA 3Q8CA 2NP0A 3TYJA 2WDBA 3GYDA 1WBLA 2JG9B 2WJSA 1GANA 2ARCA 5A3OA 2VY0A 4FPOB 3R6SA 4AQ6A 4NHYA 2EIBA 4LLOA 4NJ4A 3AYDA 3CU7A 1RUF2 1QHDA 3IMNA 1PM4A 1JXNA 2D7FA 2VNOA 3I2GA 3AMNA 1ZBE3 2I2SA 1UZYA 1CN1A 4X8PA 1PO21 1QJX3 2XLAA 1GR3A 5CFCA 3NNJA 1T6GC 4KG0A 3PVOA 4HSJA 2D40A 3TAYA 3USUB 5FYVA 1Q8VA 4QAWA 3WP6A 1GZWB 4DEVA 4FVVA 3SKVA 2VVDA 1VB2A 3GF6A 1PK6B 3VKFC 2IWGB 1SDDB 3SMHA 1UYYA 1BJQA 5IW0A 3GBWA 1O3RA 3VN4A 3WNLA 3FE5A 1UIJA 4XZPA 3IBMA 1IPKA 1HRV3 5GJ6A 2YPDA 1OQEA 4AI3A 5C6CA 5CG8A 1RUOA 3KCYA 3CZUA 5EQUA 2VOWA 4BK5A 1B09A 5FYIA 5BYNA 2ZAAA 1DQ2A 3VBUB 1DIWA 4NRMA 1C8NA 3HEIA 4P9GA 3M70A 4E9KA 5BNPA 2KA3A 2LS6A 2RVAA 3AFKA 1O3QA 4HFSA 1H0BA 1PO22 5DDJ2 3GBFA 5JZGA 2WWUA 3WQ1A 3WT3A 4M4PA 2DCZA 5FYBA 2LALA 1JYWA 3QD6A 5DABA 4OHWA 4EN6B 2OW4A 1LJ7A 3K4DA 4XE9A 2X29A 4XTPA 3OJBA 2Q1ZB 4DB5A 5JMCA 5HCHA 1QJEA 1HB4A 4I02A 3A0NA 4LHLA 3KSCA 1LU1A 5T3NA 2R061 1PVC3 5F2SA 1DP0A 2UY8A 2RV9A 5KWRA 3WG3A 3JD71 4AWDA 4XF0A 2JDMA 3PUQA 4PLMA 4RL7A 4Z1VA 1QGLA 1HRI3 1JZ2A 1C8M1 2PTMA 3V56A 2XPJA 2VW2A 4LO4B 2JB8A 4JDNA 4GH4A 2XUMA 1HQLA 5FZBA 1DGLA 2BJSA 3LD8A 5B4NA 2W3JA 2JE7A 1EV13 2RM22 2PLV2 4NAMA 1JOPA 4LBNA 5BNNA 3POBA 5GKAC 2AEZA 2R0FA 3I2KA 2XBO1 5E1RA 3SEPA 5ACA3 4XFGA 2J1UA 1EUUA 4BE3A 4QHOA 5LW9A 4RD7A 1DBNA 2ZX2A 3I2DA 4LULA 3ZIXA 4J6GA 5FZ3A 3PJQA 2W9XA 1AXYA 3N7MA 3NKGA 1FV2A 4IEOA 4LO5B 2DVDA 5FUPA 5FZOA 2JXAA 2YU1A 1SQ4A 3P3PA 1SFNA 3BOPA 4XQDA 2RJLA 4IEUA 1SBFA 2B8MA 2VMEA 1O6UA 2VOKA 4M00A 5F3IA 1R64A 4FAGA 1G86A 1N1VA 4FFIA 4CDUA 2BW8A 4CCNA 4UFKA 3AL5A 4IE4A 3LEIA 4E2SA 2BBAA 4CP9B 4CCCA 1WLDA 3BU7A 4XUQA 3ZN6B 5IFTA 2OZ6A 3HMYA 5FY0A 3IZOA 2PAMA 4H3WA 1S0FA 2CAVA 1AYM3 2J7MA 4UOJA 4A7ZA 1VLNA 1WCDJ 2QTWB 1VE0A 2VQ0A 5HCFA 4U36A 1MS9A 2WBKA 5DN2A 5IWFA 3N9NA 5GLTA 1H30A 4CDQA 4ISQA 3O1PA 1VBE1 1O5UA 1ST8A 1W6PB 2AENA 2EICA 3U78A 5F5CA 3LPFA 1VBA1 2ZGOA 1D0GA 5JSPA 3ZYIB 4OMDA 1MEC1 1RUH2 1WCSA 4RGGA 3D8CA 1KRIA 4ZXEA 3HAGA 1MS4A 3PHMA 1LODA 1Y9GA 2FCUA 1GV9A 4FPGA 3WDVA 1ND3A 3ZXGA 3D82A 3MF9A 4JKKA 5FZIA 1IGOA 4PLNA 1UOGA 1LB2A 1T6BX 3SNMA 5FY1A 4GKYA 2VMIA 1EUTA 2BRTA 5ERLA 1HQNA 2B46X 3INAA 5K0UA 2BZDA 1NG0A 3J26N 4BQYA 3TEZA 1XE7A 4WM8C 1GLHA 4JZRA 1RUG1 1REEA 5FYHA 3IAQA 4QX2A 4CP1A 5I0SA 3SKJE 5F5QA 1LCLA 1UU5A 2EF6A 3MFAA 4MG2A 3AP9A 1VBB3 2CNAA 3NMBA 3NNLA 4ONUA 2X5IA 2JKXA 5FUNA 4DUXA 5CBLA 1FT9A 3I3EA 1QJY3 1GBGA 2GMMA 2WA3A 3S7IA 2QFEA 5FCCA 1L3JA 2ADDA 3WW3A 3EB7A 1V6MA 3LB9A 4D6QA 4FPYA 3BU0A 4PDWC 4TTGA 1X8MA 1NUKA 4CDWC 4LBQD 1WLTA 2IFRA 2RS12 2ZMLA 3PMSA 1VIWB 2GZWA 2BOJA 4YPJA 3A23A 5DAXA 1LKNA 1RUI3 3B9CA 2G4IA 4AVBA 3ZSJA 1HKDA 1OSGA 1BQPA 1UF2C 1W3XA 2R071 1JN2P 2VZOA 4QU2A 5FMBA 4DXZA 4YVWA 5CA6A 4EE2A 1DYKA 4GULA 3ZSKA 1HV0A 1Q8QA 3NNFA 3GALA 2WQ4A 5CKNA 2G9ZA 4HOOA 5A7OA 1CAVA 1GQPA 5FKCA 3VZMA 1LNSA 1JZ5A 1LOGA 1W3VA 1R082 2WFF1 4N9HA 4XFCA 1BLZA 2QQOA 2Y8KA 2DF7A 2R043 4D69A 1YNAA 1GQHA 1HQWA 2ENRA 3PMEA 4Y24A 5A1AA 4XIOA 3IMMA 2VZTA 1O91A 4IQPA 3SITA 3T1LA 1G9AA 3BI3A 2D6MA 1MS0A 1ONAA 2R16A 1OOPC 2XG3A 3NNMA 5IK4A 2C1FA 1ZREA 2D5FA 1O4YA 1CZSA 3TOJA 5FXZA 2DVBA 1ASJ1 3WNKA 2DYCA 4JDOA 2W46A 2XHNA 3ZR6A 5A1LA 2VL4A 3HNMA 3VZJA 3RDIA 5A3WA 3NKTA 5JZGB 1MZFA 3S5AA 1AL23 4FTBA 5F32A 1AR81 2VQTA 2VG9A 4FXKB 5FZ9A 2WZPP 4AFAA 3N3HA 3GZUC 4XURA 1RVF1 1W6MB 1T2XA 4YVSC 5FYCA 1UCXA 1DQ4A 4LOTA 4QB6A 4D8MA 1OXCA 1M06G 4CEYA 2A6XA 2E63A 5JXGA 2R1DA 3KVBA 4LUKA 2XJRA 5BXXA 4TZDA 1QMJA 5LRRA 2ZJCA 3J7NA 4GWIA 3HN1A 4DPNA 3PIJA 4AEDB 4AW7A 2OPKA 4RQPC 3WDTA 3B7MA 2CY6A 5LEKA 2I07B 1US3A 2HWF1 2FQPA 3RFRA 3M8LA 5BNNB 2VNVA 1GWMA 4CCKA 2VU9A 3RRDA 3B69A 2D6LX 3J7MA 1OA3A 4IGOA 5LA0A 1S55A 2RDSA 4LR4A 3D4KA 2J22A 3JZVA 2OUHA 2QZ2A 1EV12 1BYHA 3CIHA 4CEWC 2WNUB 5DUUA 3HOBA 2WWSA 3MZHA 3AP5A 4Y3OA 4A7KA 3TEWA 3QH7A 1GOHA 1DZRA 4EWAA 2ZXQA 1RVF2 3O7OA 3OPZA 4XFAA 2XWBB 5L9VA 3U4XA 3O1SA 1HX6A 4IXLA 2IXLA 5F8PA 1MQTC 4EZ4A 1FXZA 4FFFA 3T4HB 1RMU3 3BVCA 5A32A 2W91A 2EVXA 4CDUB 2FCVA 4X8NA 3U75A 1H1IA 4QT6A 5I8TA 1X36A 3T1MA 3T0BA 3ASIA 2JG8B 1SZBA 2VGDA 3VGIA 3ECQA 4ARYA 1ND2A 2VOXA 2P2KA 3HT2A 4XFHA 5T5LA 5FP7A 2ZPXA 3RZZA 4MVTA 1V70A 3U11A 4P5HA 1HXS1 4Y20B 1OFSA 2OZJA 3DXTA 3OG2A 3S5QA 1DZTA 1VBC1 5C8CA 3FFZA 4GWMA 4CDQB 1CVNA 3C3VA 5J48A 1AYN1 1LRHA 2RE9A 1J83A 1WUVA 3P5BA 5CIRA 1DHKB 3E6CC 1XC6A 3DF0A 4LA2A 1UN1A 4NHLA 2PN5A 3OGVA 3FWEA 3LCPA 1COV2 1ZZ9A 4IEVA 5FY4A 1PGL1 4OI4A 2ZGKA 1PNFA 1V6IA 2C24A 2G1MA 2J1AA 2MEV2 2HWC1 2FDHA 5LA9A 1YWKA 3WF2A 2E51A 2YUEA 1YJLA 1VALA 2B4KA 2VTXJ 2JB4A 3O1VA 2A3YA 2QBXA 1GOGA 4AEMA 4UWDA 1JI6A 3NAPB 1ND3B 3Q8FA 4N90A 4MLOA 2C9AA 1V9U3 1W0NA 3BYWA 3CEWA 4NPRA 4RYDA 4AAXA 4UF0B 3I3MA 4LTAA 1SLBA 3E5UA 4UW4A 1VRH1 2C9KA 2YV8A 4OFGA 5HXVA 1UW8A 2EXJA 3FN9A 1W8OA 5LY2A 3UGFA 4NMIA 3W5NA 2XB6C 3O0VA 4IE6A 4Q4Y1 4XC9A 4HPKA 3AFGA 3CO2A 1VB4A 2BNNA 4RSUA 4AFCA 4AQTA 4KMQA 5H9QA 3AKRA 3AP4A 5CKQA 4YW1A 1BBT2 3ACGA 3SHRA 4C1WA 1W9FA 4XJ9A 5D8AC 4YG6A 1ODNA 3CJIB 4O7XA 4DY5A 1KJLA 4OULA 2GNTA 3WW2A 4YM1A 3R4UA 2E9QA 1ENRA 4CCJA 3T2TA 1OLMA 5KXBA 3P1IA 2W47A 4NWWA 1ZX5A 3NVCA 1AX1A 3GZEA 1MZ6A 2WO3A 1AX2A 3IN9A 3MBWA 1QJY2 4D3WA 1TME1 2EIGA 1ODMA 4ZHNA 4MSVA 3NJVA 4YGDA 3VZLA 1STMA 5T54A 2A6WA 5A3UA 2VCMA 3GDBA 5C9AC 5GM0A 3QBQA 5DAQA 5F39A 1LECA 4U2AA 1CZVA 1K5MA 1S2BA 3CJXA 5DG2A 4YVWB 2HWE1 2YDEA 4XEZA 4QX7A 5SV8A 5FAXA 5FZDA 5FPZA 1KFUL 3WDXA 5F37A 3ZFGC 2EXIA 1CAVB 4JGZC 4E2GA 3LIGA 4J1WA 4CCOA 1KD7A 1KS4A 2Q5TA 4EN0A 4JGYA 5FZ6A 3QH6A 1ALYA 3BOWA 4XHBA 3ZKUA 5FLIA 1PO13 3WNMA 3FC0A 2AEYA 1W9TA 1K5MC 1RUC2 5IVYA 2QQLA 2XJSA 2FDGA 2WS92 4QGNA 5HCBA 4F7ZA 4EV0A 4AOCA 5JXHA 1BMV1 3ENRA 1IG0A 1RITA 1QWRA 2QQIA 1BXHA 1R092 3E5XA 5T5OA 1P8JA 5L36A 3E5QA 4OUSA 3DPRC 2R042 4A2UA 2A75A 4GZ9A 3KWVA 2DV9A 1VAKA 4XVHA 3VBRC 1UOFA 3UKTA 5A33B 4NPLA 4HONA 3EBRA 4QKDA 3SH3A 2IZWA 3OEAA 4XOGA 2VUCA 1AXKA 2BYVE 4N53A 4RGKA 1W2AX 3I97A 1BEV3 3BUCA 2GN3A 2W1SA 1UMHA 2GNMA 1AVBA 2CGOA 2P6HA 1DQ6A 1QJU3 1RHI1 3PVNA 5C71A 2J1TA 3OYWA 3LQCA 1BVVA 1XXNA 2LW8A 4IV1C 4WZCA 3QACA 4A44A 4D6SA 4CU6A 3ZKYA 5B2GB 1AL22 2GNBA 4W6YA 5C3OA 3T3YA 4AQ2A 2ZX0A 4P9XA 3R05A 1OQ1A 3K51A 3AKQA 5CFDA 1RUJ1 3LFMA 2X8KA 1AUYA 3ZPYA 5F2WA 5FFOC 1NAEA 1GFF2 3R4DB 4CDXC 1G9CA 2HYXA 5L7OA 3BTYA 4QPGB 1UX6A 1D4M1 1HN1A 5FZ0A 2CGNA 5FYUA 4CYDA 1CD3G 3AKSA 4XF4A 1D2QA 3V0BA 4MGTA 3HPNA 2V5YA 2XL7A 4CRQA 1G9DA 3MUZ1 4I0WB 5FJKA 3THDA 4W8JA 1H1AA 4F8AA 4LITA 3ZO0B 2RDNA 5FREA 4D94A 2GC0A 2K46A 4XXAA 1SFYA 2R30A 4GB32 1N47A 5FO8B 2ZOEB 3WY6A 4OHZA 3HQUA 4RN5A 4D7TA 2FD8A 1OLQA 1W99A 2IC1A 3L2HA 1CZTA 1UX7A 2R49A 4NR1A 4R52A 4YW2A 1Y3TA 5TSWA 4OHYA 4XQWA 4MUVA 4COVA 3BKZA 1G6NA 1ND2B 4L11A 4PT6A 4DINB 3H8UA 3PUSA 5L73A 3OF1A 4Q4X2 3DCQA 4AHWA 3I3QA 3IB3A 4MYEA 1D4M2 1GZCA 2ZGSA 1JMUB 5K9YA 3KQ4B 4LEJA 4QKBA 5CISA 4GMP0 2GAUA 1UXXX 1PO23 5C8CB 4UW5A 4D0QA 4G4FA 3JQWA 4DRRA 3MLJA 2NZ9A 1UAIA 4IEZA 1JHNA 2XLGA 1NA1A 3DKQA 4K8RB 2ZX1A 5LZ6A 2LTNA 4MXWA 1IS3A 1DF0A 3USSA 1UPIA 2YFZA 3WNOA 5FZHA 3OOXA 3AX4A 3I2JA 1W6NB 4LKEA 5C8WA 2DFBA 3H8RA 3VDDC 4O9GA 1UNBA 4O61A 3VLBB 3GXUA 3G6JB 4RHV1 2Z4FA 5FZFA 1V0AA 4Y5TA 3B02A 4OUEA 3MIDA 2RM23 2PLV3 5DAVA 3B5LB 4A3XA 4WM7B 3WEZA 3WP3A 5GZGA 3AP7A 4K40A 4XF3A 1AR61 2ID4A 2JX9A 3FHAA 2BNOA 1XU1A 3RJ2X 4Y5Z0 4JDMA 2VZ3A 1A34A 2DDUA 3KCXA 4JRLA 5EPAA 5J1XA 3KVAA 1QH6A 5A70A 3AYAA 1QF3A 3R4SA 1G9FA 1XYPA 2V73A 1UYZA 1DLCA 5DMYA 4LO6B 3VKLA 1ULCA 3JBG1 2PFWA 3LA2A 3VBRB 1JH5A 3KGZA 4KH9A 4AI0A 5J36A 3O1UA 3OGRA 2F6BA 5BY5A 2DURA 3JD73 4NHXA 5F3CA 2Y6LA 1OLRA 2PHLA 3ZMOA 5T50A 3KV6A 1X33A 1UKGA 4B4PA 3MW3A 3I2OA 4SBVA 5EJ1B 4G9SB 4YSFA 3LWCA 3RZKA 3FHIB 4RR3A 1MPXA 2XBO3 2WZEA 4PIZA 1W9YA 3IIAA 1YFXA 4Z82A 4LXLA 4LHNA 3MIBA 4R8HA 3WUCA 4D7SA 3N36A 4KQ7A 5FPXA 1H2NA 4G3YC 4GKXA 1VR3A 3M3CA 3LA3A 2UYAA 2ORZA 2DVGA 1QQP1 3L9JT 3QCWA 4JGYB 1V6NA 2RMU1 1V6LA 1YXWA 4QKNA 3ALQA 3AVSA 3MEPA 4Y26A 5A7QA 3O1MA 1Q8OA 4M0NA 1RUH3 1Q8SA 1GSLA 2WFPA 2E26A 4BH9A 2RDRA 2FCTA 2HWB1 4LE4A 1SLAA 5T5PA 5KHJA 1RUE1 4HBNA 3C7FA 1XNTA 2VTXA 4LKSA 1XNDA 4LUMA 4IEPA 4AK3A 3GJBA 3OUIA 2VVFA 1DDLA 4N43C 4DS0A 2P6CA 2BNMA 2H6BA 3VD4A 4K1YA 4HZFA 2RR12 3VHRA 4GMP1 1KDKA 4M01A 2Q0AA 1XB9A 4ZY9A 4RS5C 1NE4A 2V09A 1SEFA 4MGIE 5FXVA 4N53B 1J3RA 4D6RA 5A6ZA 3FBYA 1H8VA 1W8HA 3GCWA 3H3ZA 3KHBA 2VZUA 1VBE3 1BK0A 3C7HA 3I59A 2JDAA 4CXXA 1UIKA 2VTFA 4J25A 4YW5A 1OH3A 1OBNA 3OYWB 1MZEA 2ZS6B 1W2TA 1DQ0A 2KR2A 1YQ5A 2XWJB 1MEC3 1ACCA 1VP6A 3ME2A 3R0RA 1H8TB 4META 2A6VA 2VUDA 3LPGA 1PHMA 3RMYA 5CFDB 3E6DA 2XLFA 5CG9A 1HW5A 1YO8A 1LHNA 1KGYA 1ZZBA 4JAAA 2Q8OA 2ZHMA 4HK8A 2PHDA 3WOGA 2RS13 2GC2A 1YJKA 2UWCA 4ITCA 4NO4A 5IAVA 4OQ8A 5L7OB 1WZXA 3GNEA 1NZCA 3CL1A 1OA2A 4CSWA 5FIXA 3V0BB 1REFA 2BFUS 3I2IA 4JCKA 3P6BA 4UI9L 1APNA 1K5JA 1RUG3 4R9CA 3U10A 5KR7A 3Q8AA 3KT1A 5HPOA 2WQ8A 1WW4A 3UKNA 3W5MA 2Q1FA 3NV4A 1YQ6A 1CAXB 3FX3A 3WG4A 2W5FA 5A7NA 3V0AA 4GA9A 2WLQA 4AI8A 1R083 3ZFFB 5HV0A 1UMZA 4E4ZA 4BQ5A 3O5SA 1HB2A 1ENQA 1J3PA 5DPNA 1QXJA 2QJVA 3IPVA 1IZ3A 4Q0VA 2FZ1A 3S6PA 3KM5A 4YM0A 1C1FA 2HEYF 1HV1A 4YRDA 3CQOA 4AVCA 4AZZA 2WT1A 1CIYA 4AEKA 2EIEA 4YZ5A 2JDZA 5FTTC 4XFBA 4LLFA 5FZGA 2Y38A 4Q8KA 4PCRA 3MFCA 2ZGRA 4KGQA 1YIFA 4CA9A 1X50A 2PA7A 2Q8CA 3LOBA 3BIWE 4PQ9A 5FQ0B 1CJPA 1PX3A 1UD1A 4ET7A 1F15A 1FOD1 4HKLA 1H2MA 2VUJA 5HCAA 2XVLA 5IVBA 5DAWA 5E16A 3HNYM 5FJHA 5KHKA 5FZ4A 1VBD1 1JYIA 5DZGA 4MXWB 2E53A 1DZQA 5LCWL 1SDWA 2XL9A 4XDPA 1PMIA 1HN0A 2AACA 1H1MA 3ZXLA 4E8DA 2BERA 2WFF3 3AL6A 5FMOS 1JU3A 4Q0QA 4RA0A 4BJ0A 2AC1A 3ST7A 4I2OA 1J1LA 4NHKA 4B29A 4H14A 2CU5A 2C6SA 4Q4V1 1HB3A 1XQNA 2DVFA 1CAWA 3TEYA 3B3QE 4ES9A 3UGGA 1ZRRA 3VZOA 1F2NA 4NHMA 1Z7S1 2VW0A 3OGJA 2E6VA 2NPIA 4XMAA 4Z07A 3U07A 5FYSA 5J96B 3IDCB 3LSEA 5GALA 3PURA 2JIGA 4A6SA 5LK7B 4EWDA 3DL3A 4XHXA 2F4LA 2CV6A 2G9FA 2RS51 1FOD2 2HLEA 1U5XA 2RJKA 2VW1A 3LDRA 3OBRA 1AR83 2AR6A 5K0UB 1ZBA1 2IVIB 3O0XA 4KL1A 5KC6A 4IV3A 4CPBD 5FKBA 3H42B 5FPBA 1J1TA 1RVF3 1HLCA 4M3CA 3ZDSA 3AYEA 3WQ0A 3VKOA 5A3LA 1KFXL 4ATFA 1S0DA 4OUMA 4UBGA 1Y9MA 3ORJA 1NOVA 2WL1A 1X9TA 2JJ6A 2O14A 4KNCA 4Y4RA 1D7PM 2DTYA 3B01A 2XJUA 1JYVA 3N7KA 1D4VB 2NMOA 2FMYA 2R062 4PF5A 2WNOA 4YWAA 1B35C 4IV3C 1AL0G 1MZ5A 2DWRA 5BV6A 3JD72 5FO9B 1UYPA 1DFQA 2Y6GA 4RR3B 4ZZ8A 4XDOA 5D1IA 5LK5A 1C8M2 4P9JA 1KQRA 3NJXA 4QPIB 1AR71 2W87A 1NXD1 3SCHA 2IVJA 1C5HA 5JPNB 3AP6A 4JVAA 4AEDC 5A6XA 2DCJA 5J37A 4IETA 2FDKA 1DYPA 4H7MA 1V6KA 3AMPA 2XBO2 4UYBA 3WHUA 4PIYA 1XE0A 1COV3 2D3SA 4DOUA 3MIFA 1POV3 5F7UA 1NX9A 5F5IA 5JOYA 2Q8EA 4BQ4A 3H8OA 2MEV3 4ISRA 2J1SA 4R4XA 5JDBA 3AKPA 3ILNA 3RWKX 2C5DA 4YZ3A 2UY9A 4UFHA 4KGGA 4IERA 1HB1A 2B9VA 2VOVA 4QD2A 3DYOA 4ZONA 2ZZQA 3SXWA 4BMBA 2WNUC 1PNGA 4LORA 1WMEA 3VD7A 3HN3A 3Q8BA 4WM8A 3K75B 5LWBA 1IQDC 4MHRA 4ZPIA 1OF3A 3V65A 2ZCWA 4QQPA 5A32B 1QIQA 1HXS3 1XSQA 3ZLIA 3KT7A 4A4AA 2PELA 2K9ZA 3CDZB 4C1XA 1UY4A 4HVOA 1VBC3 1MS8A 4S2HA 3WVJA 5M0TA 4OHXA 2WN3A 2YMZA 1Y4WA 5HXMA 2K0GA 3VD5A 3I59B 1BBT3 3IKWA 2JIJA 5GZFA 1PZ9A 4B8EA 3AJYA 1FPN1 2VPVA 1SCRA 1NT0A 3K77A 4CUGA 1TMF1 1ZRFA 2HWD1 5BNOB 3VDBA 4PDWA 5A3MA 5I93A 4CDWA 1H2LA 1VBE2 4WVMB 5FMDA 3HBZA 3N9LA 4Y22A 1YFWA 1NQJA 3NV2A 4P9IA 4IEXA 1VBA2 3N9OA 1JYCA 1Q56A 4RFRB 2X53S 2UU8A 1MEC2 2WNEA 2WZ8A 1H9PA 5JUVA 4Y1YA 1OUXA 1OHFA 2YGMA 4ATEA 3AKTA 3GHMA 5C3RA 5A80A 2HJIA 4Q4Y3 2RG4A 3ACLA 3MIEA 4L9BA 2JD9A 3T0AA 2DU1A 2XKPA 5C70A 1O7FA 2GALA 5FYMA 3NAPC 2ZX3A 3KD4A 1ZBE1 4JV4A 4UAPA 2WLPA 1NLRA 1ZRDA 5K8SA 2JECA 1QJX1 3A0KA 1IS6A 4QHZA 4BLJA 1RUG2 3POGA 5CFCB 2EAAA 1TMF2 3FMGA 2J42A 5BUVA 4E4DX 2ZMKA 3KV5A 4ZU5A 4Y1UA 3ZYBA 5CADA 4GJYA 2PAEA 1YI7A 1RUC3 3IPVB 4QMAA 1OOPA 2WS93 5LBFA 3O1OA 1C5IA 1DGRN 4W6XA 4B4QA 1R093 3VBOA 5I91A 3JUUA 5E88A 3APBA 1HRV1 5GZDA 2E7TA 3POYA 3CJIC 3TNPB 3I49A 1CAUA 4KWLA 4LBOA 3MICA 4YM3A 5H9SA 2OS2A 3H8XA 2CYFA 3MHZA 3AVRA 5I8SA 3BIEA 2VZQA 2TEPA 4YVSA 5F6KA 1GNZA 2WO2A 1FATA 4IEWA 1SMVA 2OQ6A 3LOIA 3VBOC 2YC0A 4A45A 5BNPB 3LDKA 2R072 3I2HA 4URTA 1YUDA 2AYHA 4QM8A 2WZR1 1F4AA 2LRPA 1KS5A 2E7QA 2DCYA 2WAOA 4QU1A 2Y0IA 4P9WA 5FV3A 3NO8A 2PXJA 4RQPA 2ZEZA 2CSGA 3UL2A 2N7GA 1H9WA 2ZHNA 4KBBA 1DCSA 2D3PA 4J1XA 1OVPA 3K3NA 3U1XA 1CAWB 1SLCA 5C5UA 3ATGA 4DZGA 2WFF2 3OBTA 3WF0A 2VO5A 4XW3A 4PI0A 2BV4A 4DUVA 1UOJA 1N1YA 5JR7B 4E2QA 1HRI1 5ANQA 4FPFA 4CEWA 3RWNA 4AFMA 1A8MA 2CAUA 4KU8A 5J09A 4NRPA 4GH4B 1ZM1A 4L99A 3RMXA 2GC1A 2XONA 3OPWA 3A22A 1UU4A 2DUQA 3WQ7A 1MQTA 4MGYE 2W1QA 2ZEYA 4YW4A 5C4WC 3NV3A 1ASJ2 3PTRB 2CWSA 1RHI3 1C57A 2VULA 4FQ4A 1CR7A 1ZYBA 4GB33 4M3CB 4Q2FA 3TN91 3VKNA 5C3PA 4TYSA 2VMCA 1GYKA 1G8WA 1A3KA 3K4AA 5FYYA 1AR82 1LOCA 5FZOB 3UETA 1RGSA 3OEBA 4PI2A 1RUJ3 5FY5A 3S57A 3WDWA 3ACHA 2AH2A 2BEOA 1G7YA 4Y33A 3WQBA 4H55A 1UMIA 5FK7A 1DQ5A 4Q4X3 4XBLA 3S7EA 3WF1A 1D4M3 1UL9A 3ZXFA 4P00B 3N9MA 4FO9A 4EROA 5AFBA 4MGQA 2VD7A 4SLIA 2ZTNA 1D0HA 2BWCA 4YM2A 5A7SA 3MPPG 2HWF2 2JDUA 1AYM1 2ZGPA 3RI8A 3N7LA 3ES4A 2IXIA 3T2PA 1HDKA 4TN7A 4XBQA 3O14A 3THPA 2PHRA 3J7HA 1OT5A 3POWA 2VCBA 4QPGC 3ZXDA 3TN92 3DYPA 3VB9A 5AVPA 1RIRA 1F8VA 2W68A 1FV3A 3FL7A 2O1QA 4IDZA 2XJQA 3UNPA 5A7PA 4HK9A 3I7DA 1NQDA 2A71A 1EY2A 1EPZA 4A7YA 3CLPA 2BGPA 2D93A 2XGXA 4Q1PA 4CU9A 2GMPA 5IUQA 3N9QA 1IKPA 2OPWA 4BWOA 2ZA9A 1BHGA 2A6ZA 2WA4A 4WM8B 4M0HA 5F5AA 3A21A 1YFYA 2VAUA 2BGCA 4DY3A 2XH6A 4BHPA 3H7JA 2QE3A 5D8AA 4NOTA 1JW6A 1RXFA 2GC3A 3HNBM 4C0BA 4EQVA 4TLGA 2VMDA 1W2OA 5J7MA 1GWKA 4JHZA 4W65A 1HXS2 1PZ8A 2MHFA 1BK1A 2QQUA 5JCTA 1GU3A 1VBC2 2J1EA 2ZKNA 1H6XA 3T09A 1ULDA 2QQJA 1VBB1 4QGLA 3VUOA 1SPPA 1AYN2 3EO6A 3B00A 3NL1A 2X5IB 4Y22B 1AR91 5E8AA 3ZYPA 4B1MA 3RNSA 2LROA 3VBFC 1DG6A 3ZOIA 5C9AA 1PGL2 4BA6A 2BFUL 2QQPA 1FNYA 1AXZA 1FAYA 4EWEA 2HWC2 3RJRA 4GWJA 4S2FA 4YGEA 3ZVXA 4QXBA 2AGSA 1OKQA 3ETQA 4K3UA 4Q26A 1AR63 5FZEA 3ZFGA 4JGZA 1SACA 3SH4A 2VH9A 2ET1A 1WBFA 1PZ7A 2QKDA 2K2SA 4MHUA 2W94A 3U0ZA 3T2QA 3WCSA 3KQRA 1VRH2 1FX5A 4YW3A 1LU2A 1J3QA 4Y1ZA 1W8ZA 4Q4Y2 4WM7C 1NCRC 3KGLA 1A6CA 2WQZC 1XE8A 4XUPA 2QCSB 5EYYA 4XAEA 4QQHA 4JX0A 3PUHA 1LEDA 2GP5A 1UOBA 2D97A 2VNRA 1LTEA 1OOPB 3DPRA 2VZ1A 3AZYA 2W1UA 3H0OA 2Z69A 3HD8B 1JODA 2P3IA 2XHKA 3EJKA 2Q8DA 4TSVA 3UJQA 4MOAA 1NY71 4FOVA 3MIGA 1Z78A 1SFPA 1HJFA 2ZMNA 5KHGA 2D3RA 1S0GA 2OUJA 4TLFA 4PBOA 3ACIA 2R6QA 1J58A 4Q4W1 4W6WA 3VBSC 5A6QA 3FZ3A 2RR13 5JPMB 4Y1XA 3RGBA 4DXSA 4N7IA 3HBKA 2IXCA 3K3OA 4YG0A 2YB7A 3H3UA 5F9TA 2WN2A 1TME2 1TNRA 3MV11 4YVSB 4IV1A 5FK8A 4HKWA 1KEXA 2VMGA 4ZU4A 5FMOL 1NCQC 1N3OA 5LASA 2ZAHA 4V2VA 2Y26A 4QX3A 2RMU3 1FMD1 3VBHC 1F35A 2HWE2 4IE7A 1OD3A 2VQAA 5JSOA 2NQYA 4YW7A 4I01A 4DNYA 1MACA 3WDYA 3ELNA 1ULFA 2OX0A 2WO1A 4CDXA 2WNVA 1RUNA 5ABJA 2HWB3 2QDNA 1YLLA 4UW6A 1UY2A 1L7RA 3AXEA 4CEYB 5J3UA 1AJOA 2DCKA 4E4SA 3QLQA 5F3EA 4P9LA 1UZWA 3SISA 1BMV2 2B42B 4AI9A 4BMEA 2WAAA 3RVHA 4CUCA 2Z2SB 3ZFEA 1GWLA 5FZ8A 2XJPA 1WW6A 2I45A 2WNVC 5AC93 5ABJC 5IK5A 3OUJA 4XQ4A 1XU2A 1TZOA 4DXRA 1QOTA 1XNAA 3D0JA 3EMRA 4LBLA 5IVCA 4LNVA 4UBHA 5CKMA 2FZ2A 4XDQA 3T0DA 1ZA7A 4XACA 5FZKA 2ES3A 1FMD2 1E5SA 4P08A 3MW2A 2JDPA 2BTVC 4Q0UA 5T5JA 4XETA 2WYFA 2WUHA 5K4LA 3ZFEC 1OUSA 4Q27A 3U37A 1RHI2 4WZFA 5FWEA 4AGGA 4QX1A 4CCLA 4FTSA 4LKDA 3D5OA 4HVQA 1O5LA 5G05L 1RMU1 3IM0A 2XXZA 4AVSA 3MDPA 3MI8A 4BYYA 1RUJ2 3DECA 3M3QA 2O8QA 3BTZA 4LA3A 3AJZA 1F5JA 4JTOA 3TB0A 1RUD1 4BB3A
chains in the Genus database with same CATH topology
4AG4A 4XZUG 2C26A 3WNPA 1EUTA 3I2IA 4UI9L 3P6BA 2CDPA 2BZDA 2W1WA 5HPOA 2WQ8A 3JXSA 3W5MA 3IAQA 4QX2A 2W95A 2VMFA 1PMHX 3SKJE 2W5FA 2C4XA 1ULPA 2JKXA 3THCA 4DUXA 1TG7A 5DPNA 3I3EA 3CQOA 3WF4A 1CIYA 3EB7A 4CU8A 2EIEA 1XPWA 5G04L 1WKYA 4TTGA 1NUKA 3HJRA 1SHWB 4KI5M 4DEQA 2J1RA 2CDOA 4YPJA 3A23A 4ET7A 1PX3A 4LPLA 1K42A 1JHJA 3CMGA 3I3DA 2VZOA 5JXJA 3HNYM 5JMOA 2WYSA 5LCWL 5IJRA 1GQPA 4E8DA 2BERA 1LNSA 1JZ5A 1JU3A 1PX4A 2X09A 4BJ0A 1CX1A 2Y8KA 2QQOA 3VD9A 4A41A 1L7QA 2X05A 5A1AA 4MADA 1OF4A 2VZTA 1JZ8A 4QDSA 5C7GA 1I5PA 2W92A 1CZSA 3WNKA 2HLEA 2W46A 2XHNA 2VL4A 3HNMA 3ABZA 3IAPA 4XUOA 3MUY1 1ULOA 2VQTA 4TXWA 4XURA 4BDVB 1T2XA 5IHRA 2ORXA 4QB6A 3BGAA 4D8MA 1JYXA 5JXGA 1D7PM 1JYVA 1PMJX 3VDCA 1UY0A 4GWIA 4JKMA 2Y6GA 1RYYA 1US3A 1US2A 2VZSA 4ZZ8A 1UZ0A 3NJXA 2W87A 3WNNA 5LA0A 2DCJA 4DXTA 2J22A 3T08A 3CIHA 3HOBA 1NX9A 5F7UA 5FUIA 2Y64A 1GOHA 2J1SA 1O59A 2ZXQA 1JZ4A 2E31A 2XQXA 2B9VA 4BXSV 3DYOA 3I3BA 2Y6KA 2OKXA 2W91A 3VD7A 3HN3A 3T0BA 3K75B 3A7QA 1IQDC 3ECQA 4ARYA 1OF3A 3WF3A 4LQRA 4P5YA 4A4AA 3CDZB 1UY4A 3IDAA 4QDQA 3UESA 1F4HA 1UYXA 2VZVA 2WN3A 3OG2A 4OMCA 5HXMA 3VD5A 3NQHA 3K77A 1J83A 4OYUA 1XC6A 3VDBA 4QB1A 3ACFA 4W50A 2J1AA 2VC9A 3WF2A 1JZ6A 4CVUA 2B4KA 4JKLA 5LA2A 5LA1A 5JXIA 2QBXA 1GOGA 2WZ8A 4P02B 1JI6A 1GMMA 2VOTA 2ZEXA 5JUVA 1W0NA 4RYDA 4AAXA 3AC0A 2C9KA 2JD9A 3FN9A 3T0AA 1W8OA 4OZOA 3W5NA 5C70A 1WCQA 1K3IA 4UAPA 4ZZ5A 3CZJA 4W4ZA 4CUBA 2V4VA 2Y6HA 3OGVA 1OH4A 4KMQA 1J84A 5JR2A 2YFUA 3ACGA 2WABA 3OB8A 3LE0A 3OBAA 3P1IA 2W47A 2WO3A 2KD7A 3D3AA 3ETPA 3MBWA 3EYPA 2QQKA 3C7OA 3NJVA 3C7EA 3GDBA 5B4XA 2VZQA 1UY3A 1TVGA 2WO2A 3IIIA 1CZVA 3FHQA 5IYYA 3PUIA 4A45A 4QB2A 2V5DA 1K12A 1JYNA 3T2OA 3I2HA 5CYYA 2VCAA 2Y6JA 3NRUA 1F4AA 4CU7A 2WAOA 2VM9A 2PQSA 1YQ2A 2ZEZA 1UXZA 3C7GA 2YG0A 3WNMA 1W9TA 2QQLA 2XOMA 1W9SA 5JXHA 3WF0A 2VO5A 3MO4A 2QQIA 4DUVA 3K4ZA 2QQMA 2RJ2A 1P8JA 4QPWA 2EIDA 4QDRA 4GZ9A 4XVHA 2XONA 3A22A 3OEAA 2W1QA 2ZEYA 3I97A 2W1SA 3LEGA 4E8CA 1UMHA 2VMCA 4PQQA 5C71A 2J1TA 3K4AA 3LQCA 2LW8A 4A44A 3UETA 4CU6A 1JZ7A 3OEBA 5DQ0A 3LEKA 4M4RA 1SG3A 3ACHA 4L0PA 3WQBA 3DYMA 1O8PA 1UMIA 4FI9A 3F2ZA 3WF1A 1NAEA 4DUWA 2HYXA 4P00B 1K45A 2JE8A 1HN1A 2V72A 4MGQA 3MV01 1UWWA 3HPNA 4LHSA 3T2PA 2VQUA 5CZKA 3MUZ1 3THDA 4W8JA 5EJZB 3J7HA 1OT5A 2VCBA 2VJXA 3DYPA 3FL7A 3UNPA 4QX0A 2VCCA 5EIYB 4RN5A 4IUGA 2BGPA 4CU9A 4HG6B 1W99A 1CZTA 1UX7A 1JU4A 1BHGA 2J1VA 4XUTA 2WDBA 2YC4A 3A21A 1JZ3A 4PT6A 1GUIA 5I0DA 1DYOA 2EIBA 3IB3A 3K46A 1GOFA 2VZRA 3HNBM 3I2GA 1UXXX 2VMDA 4BK4A 4D0QA 4Z2AA 1UY1A 4JHZA 4XUNA 1GU3A 2J1EA 1H6XA 3T09A 2QQJA 4QAWA 2YFZA 3WNOA 4DEVA 3SKVA 3I2JA 1H6YA 2QQNA 3VDAA 1SDDB 1UYYA 3BN6A 3WNLA 4GWJA 3GXUA 2Z4FA 3CZUA 4OUEA 4BK5A 3WEZA 4MGSA 4A42A 2ID4A 2VR4A 3FHAA 2VZPA 3HEIA 2W94A 2VZ3A 3T2QA 2DDUA 5J1XA 2LS6A 2RVAA 4ARXA 3C8XA 1UYZA 1JYWA 1DLCA 4XUPA 4M4PA 5DMYA 4JX0A 3PUHA 3K4DA 3OGRA 2VZ1A 2W1UA 4KWUA 3VD3A 3GGLA 2Y6LA 4MOAA 2X10A 1DP0A 4PF1A 2RV9A 2L9LA 3ACIA 1JZ2A 5EJ1B 3GM8A 4DXSA 3OGSA 2YB7A 5B4NA 2W3JA 1MPXA 2WN2A 3MV11 1KEXA 2WZEA 3I2KA 3SEPA 2J1UA 1EUUA 2YC2A 3CKHA 1W8NA 4QX3A 2ORZA 1OD3A 2W9XA 2WO1A 3SEEA 1UY2A 2E26A 1L7RA 4CUAA 2VMEA 2ZEWA 2DCKA 3C7FA 1XNTA 3WSOA 1R64A 4LKSA 3LEIA 2BBAA 2WAAA 4CUCA 4XUQA 5IFTA 3VD4A 2E32A 2BGOA 4ZY9A 1NKGA 2J7MA 4UOJA 4DXRA 1XNAA 1GNYA 1W9WA 5IFPA 3I2FA 2VZUA 3C7HA 3T0DA 2WBKA 2JDAA 5DN2A 2VTFA 4P08A 1O8SA 3E1F1 2EICA 2WUHA 3NNGA 3LPFA 4A6OA 3U37A 3LPGA 4OMDA 2R7EB 3ZM8A 4QX1A 2E33A 5G05L 1KGYA 4ZXEA 4MO3M 3DECA 4A3ZA 4JKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AG4 A;  4XZU G;  2C26 A;  3WNP A;  1EUT A;  3I2I A;  4UI9 L;  3P6B A;  2CDP A;  2BZD A;  2W1W A;  5HPO A;  2WQ8 A;  3JXS A;  3W5M A;  3IAQ A;  4QX2 A;  2W95 A;  2VMF A;  1PMH X;  3SKJ E;  2W5F A;  2C4X A;  1ULP A;  2JKX A;  3THC A;  4DUX A;  1TG7 A;  5DPN A;  3I3E A;  3CQO A;  3WF4 A;  1CIY A;  3EB7 A;  4CU8 A;  2EIE A;  1XPW A;  5G04 L;  1WKY A;  4TTG A;  1NUK A;  3HJR A;  1SHW B;  4KI5 M;  4DEQ A;  2J1R A;  2CDO A;  4YPJ A;  3A23 A;  4ET7 A;  1PX3 A;  4LPL A;  1K42 A;  1JHJ A;  3CMG A;  3I3D A;  2VZO A;  5JXJ A;  3HNY M;  5JMO A;  2WYS A;  5LCW L;  5IJR A;  1GQP A;  4E8D A;  2BER A;  1LNS A;  1JZ5 A;  1JU3 A;  1PX4 A;  2X09 A;  4BJ0 A;  1CX1 A;  2Y8K A;  2QQO A;  3VD9 A;  4A41 A;  1L7Q A;  2X05 A;  5A1A A;  4MAD A;  1OF4 A;  2VZT A;  1JZ8 A;  4QDS A;  5C7G A;  1I5P A;  2W92 A;  1CZS A;  3WNK A;  2HLE A;  2W46 A;  2XHN A;  2VL4 A;  3HNM A;  3ABZ A;  3IAP A;  4XUO A;  3MUY 1;  1ULO A;  2VQT A;  4TXW A;  4XUR A;  4BDV B;  1T2X A;  5IHR A;  2ORX A;  4QB6 A;  3BGA A;  4D8M A;  1JYX A;  5JXG A;  1D7P M;  1JYV A;  1PMJ X;  3VDC A;  1UY0 A;  4GWI A;  4JKM A;  2Y6G A;  1RYY A;  1US3 A;  1US2 A;  2VZS A;  4ZZ8 A;  1UZ0 A;  3NJX A;  2W87 A;  3WNN A;  5LA0 A;  2DCJ A;  4DXT A;  2J22 A;  3T08 A;  3CIH A;  3HOB A;  1NX9 A;  5F7U A;  5FUI A;  2Y64 A;  1GOH A;  2J1S A;  1O59 A;  2ZXQ A;  1JZ4 A;  2E31 A;  2XQX A;  2B9V A;  4BXS V;  3DYO A;  3I3B A;  2Y6K A;  2OKX A;  2W91 A;  3VD7 A;  3HN3 A;  3T0B A;  3K75 B;  3A7Q A;  1IQD C;  3ECQ A;  4ARY A;  1OF3 A;  3WF3 A;  4LQR A;  4P5Y A;  4A4A A;  3CDZ B;  1UY4 A;  3IDA A;  4QDQ A;  3UES A;  1F4H A;  1UYX A;  2VZV A;  2WN3 A;  3OG2 A;  4OMC A;  5HXM A;  3VD5 A;  3NQH A;  3K77 A;  1J83 A;  4OYU A;  1XC6 A;  3VDB A;  4QB1 A;  3ACF A;  4W50 A;  2J1A A;  2VC9 A;  3WF2 A;  1JZ6 A;  4CVU A;  2B4K A;  4JKL A;  5LA2 A;  5LA1 A;  5JXI A;  2QBX A;  1GOG A;  2WZ8 A;  4P02 B;  1JI6 A;  1GMM A;  2VOT A;  2ZEX A;  5JUV A;  1W0N A;  4RYD A;  4AAX A;  3AC0 A;  2C9K A;  2JD9 A;  3FN9 A;  3T0A A;  1W8O A;  4OZO A;  3W5N A;  5C70 A;  1WCQ A;  1K3I A;  4UAP A;  4ZZ5 A;  3CZJ A;  4W4Z A;  4CUB A;  2V4V A;  2Y6H A;  3OGV A;  1OH4 A;  4KMQ A;  1J84 A;  5JR2 A;  2YFU A;  3ACG A;  2WAB A;  3OB8 A;  3LE0 A;  3OBA A;  3P1I A;  2W47 A;  2WO3 A;  2KD7 A;  3D3A A;  3ETP A;  3MBW A;  3EYP A;  2QQK A;  3C7O A;  3NJV A;  3C7E A;  3GDB A;  5B4X A;  2VZQ A;  1UY3 A;  1TVG A;  2WO2 A;  3III A;  1CZV A;  3FHQ A;  5IYY A;  3PUI A;  4A45 A;  4QB2 A;  2V5D A;  1K12 A;  1JYN A;  3T2O A;  3I2H A;  5CYY A;  2VCA A;  2Y6J A;  3NRU A;  1F4A A;  4CU7 A;  2WAO A;  2VM9 A;  2PQS A;  1YQ2 A;  2ZEZ A;  1UXZ A;  3C7G A;  2YG0 A;  3WNM A;  1W9T A;  2QQL A;  2XOM A;  1W9S A;  5JXH A;  3WF0 A;  2VO5 A;  3MO4 A;  2QQI A;  4DUV A;  3K4Z A;  2QQM A;  2RJ2 A;  1P8J A;  4QPW A;  2EID A;  4QDR A;  4GZ9 A;  4XVH A;  2XON A;  3A22 A;  3OEA A;  2W1Q A;  2ZEY A;  3I97 A;  2W1S A;  3LEG A;  4E8C A;  1UMH A;  2VMC A;  4PQQ A;  5C71 A;  2J1T A;  3K4A A;  3LQC A;  2LW8 A;  4A44 A;  3UET A;  4CU6 A;  1JZ7 A;  3OEB A;  5DQ0 A;  3LEK A;  4M4R A;  1SG3 A;  3ACH A;  4L0P A;  3WQB A;  3DYM A;  1O8P A;  1UMI A;  4FI9 A;  3F2Z A;  3WF1 A;  1NAE A;  4DUW A;  2HYX A;  4P00 B;  1K45 A;  2JE8 A;  1HN1 A;  2V72 A;  4MGQ A;  3MV0 1;  1UWW A;  3HPN A;  4LHS A;  3T2P A;  2VQU A;  5CZK A;  3MUZ 1;  3THD A;  4W8J A;  5EJZ B;  3J7H A;  1OT5 A;  2VCB A;  2VJX A;  3DYP A;  3FL7 A;  3UNP A;  4QX0 A;  2VCC A;  5EIY B;  4RN5 A;  4IUG A;  2BGP A;  4CU9 A;  4HG6 B;  1W99 A;  1CZT A;  1UX7 A;  1JU4 A;  1BHG A;  2J1V A;  4XUT A;  2WDB A;  2YC4 A;  3A21 A;  1JZ3 A;  4PT6 A;  1GUI A;  5I0D A;  1DYO A;  2EIB A;  3IB3 A;  3K46 A;  1GOF A;  2VZR A;  3HNB M;  3I2G A;  1UXX X;  2VMD A;  4BK4 A;  4D0Q A;  4Z2A A;  1UY1 A;  4JHZ A;  4XUN A;  1GU3 A;  2J1E A;  1H6X A;  3T09 A;  2QQJ A;  4QAW A;  2YFZ A;  3WNO A;  4DEV A;  3SKV A;  3I2J A;  1H6Y A;  2QQN A;  3VDA A;  1SDD B;  1UYY A;  3BN6 A;  3WNL A;  4GWJ A;  3GXU A;  2Z4F A;  3CZU A;  4OUE A;  4BK5 A;  3WEZ A;  4MGS A;  4A42 A;  2ID4 A;  2VR4 A;  3FHA A;  2VZP A;  3HEI A;  2W94 A;  2VZ3 A;  3T2Q A;  2DDU A;  5J1X A;  2LS6 A;  2RVA A;  4ARX A;  3C8X A;  1UYZ A;  1JYW A;  1DLC A;  4XUP A;  4M4P A;  5DMY A;  4JX0 A;  3PUH A;  3K4D A;  3OGR A;  2VZ1 A;  2W1U A;  4KWU A;  3VD3 A;  3GGL A;  2Y6L A;  4MOA A;  2X10 A;  1DP0 A;  4PF1 A;  2RV9 A;  2L9L A;  3ACI A;  1JZ2 A;  5EJ1 B;  3GM8 A;  4DXS A;  3OGS A;  2YB7 A;  5B4N A;  2W3J A;  1MPX A;  2WN2 A;  3MV1 1;  1KEX A;  2WZE A;  3I2K A;  3SEP A;  2J1U A;  1EUU A;  2YC2 A;  3CKH A;  1W8N A;  4QX3 A;  2ORZ A;  1OD3 A;  2W9X A;  2WO1 A;  3SEE A;  1UY2 A;  2E26 A;  1L7R A;  4CUA A;  2VME A;  2ZEW A;  2DCK A;  3C7F A;  1XNT A;  3WSO A;  1R64 A;  4LKS A;  3LEI A;  2BBA A;  2WAA A;  4CUC A;  4XUQ A;  5IFT A;  3VD4 A;  2E32 A;  2BGO A;  4ZY9 A;  1NKG A;  2J7M A;  4UOJ A;  4DXR A;  1XNA A;  1GNY A;  1W9W A;  5IFP A;  3I2F A;  2VZU A;  3C7H A;  3T0D A;  2WBK A;  2JDA A;  5DN2 A;  2VTF A;  4P08 A;  1O8S A;  3E1F 1;  2EIC A;  2WUH A;  3NNG A;  3LPF A;  4A6O A;  3U37 A;  3LPG A;  4OMD A;  2R7E B;  3ZM8 A;  4QX1 A;  2E33 A;  5G05 L;  1KGY A;  4ZXE A;  4MO3 M;  3DEC A;  4A3Z A;  4JKK A; 
#chains in the Genus database with same CATH topology
 3AB0 A;  1YRZ A;  1N1T A;  4XZU G;  3ZIW A;  2C26 A;  3M1H A;  5C3Q A;  3WNP A;  2FDI A;  1N3Q A;  5HI0 A;  5BPX A;  1WCK A;  2DUO A;  5FY9 A;  3RSJ A;  3VDD A;  3JXS A;  1PGW 1;  2JG9 C;  3D6E A;  3OY8 A;  2A70 A;  2W95 A;  3DUI A;  1DLL A;  1PMH X;  1UPS A;  3USU A;  2SBA A;  4LBK A;  1GZW A;  1VMF A;  2C4X A;  5HV4 A;  1ULP A;  5JAX A;  3MIH A;  4HVR A;  4XXP A;  3THC A;  1W8U A;  2GSY A;  3H1Y A;  1TG7 A;  4JHT A;  2P34 A;  2P1B A;  5JOZ A;  4B7K A;  2RS3 1;  5EJ3 A;  2D6K A;  4HL0 A;  5KXE A;  1XPW A;  1W2U A;  5E6H A;  3KV9 A;  4PHZ A;  3ZFF C;  1WKY A;  2JDK A;  3HJR A;  1SHW B;  1V9U 1;  2D43 A;  4KI5 M;  1ZA4 A;  3TWI A;  4DEQ A;  1SCS A;  2OA2 A;  1W6Q A;  1PK6 C;  4FPE A;  1FOD 3;  2XUE A;  4B7E A;  1LGC A;  2VNG A;  4QM9 A;  5LY1 A;  3N7J A;  3TBD A;  1LOF A;  2VBB A;  3HR9 A;  4LPL A;  2W0X A;  1K42 A;  3I3D A;  4XJZ A;  4BPZ A;  5JXJ A;  3M2M A;  4HPK B;  3WIN E;  2JEN A;  4KWK A;  5JMO A;  5DZF A;  3H50 A;  5IJR A;  3RYK A;  2A6Y A;  3VBU C;  1PX4 A;  4QQL A;  5JOX A;  4Q4V 3;  4QXK A;  2NN8 A;  4KG8 A;  5C9A B;  3DXU A;  1LOF C;  2R06 3;  4HET A;  4OI1 A;  5FPL A;  4FPK A;  3VD9 A;  2P3J A;  1LOA A;  4A41 A;  2Z42 A;  2JKB A;  1L7Q A;  5CAZ A;  1C8M 3;  1YIP A;  5DG1 A;  3ZFG B;  1SLI A;  2ZAC A;  2A5Z A;  3I8T A;  1YQC A;  1JZ8 A;  4RHV 2;  5JLV A;  5C7G A;  1WA6 X;  1I5P A;  4YZ1 A;  3MGU A;  3ITQ A;  5I0U A;  1O3T A;  5I0R A;  2YU2 A;  2ZGQ A;  4YGC A;  1AR6 2;  1K5M B;  2ILM A;  4EJR A;  3ABZ A;  1VRB A;  2GH2 A;  4XUO A;  3J8F 1;  4HN1 A;  3MUY 1;  4RGA A;  1ULO A;  3ZXA C;  3K2O A;  3PJY A;  3PDQ A;  4TXW A;  3BPS A;  4AI1 A;  4XAB A;  4AI2 A;  5BNQ A;  1YC6 1;  1OLM E;  4N43 A;  1ZZ8 A;  1I1E A;  2ORX A;  3RZG A;  3BGA A;  3JBG 2;  2XJT A;  4PBP A;  1JYX A;  4CCE A;  1KJR A;  4FOQ A;  1QNW A;  1OC1 A;  4RS5 A;  1UY0 A;  5EFU A;  1HIX A;  2YXS A;  2WR9 A;  2JDH A;  1EAH 1;  4AHX A;  1I5Z A;  4QHB A;  5DAP A;  2UUR A;  4BIF A;  1IOA A;  3ZN6 A;  2HKX A;  4XJW A;  3PU8 A;  3PL0 A;  1RYY A;  1US2 A;  2VZS A;  2ZGM A;  4LOS A;  4NUB A;  4QX5 A;  2WO7 A;  4IV1 B;  5GLZ A;  1UZ0 A;  3FLT A;  1JOJ A;  1W28 A;  3M3E A;  3J9S A;  4MGK E;  1QJF A;  5I8Y A;  2W52 A;  4LJH A;  4V1P A;  3AZW A;  1CWP A;  4UT5 A;  2XR4 A;  4URA A;  3ZSM A;  4XF1 A;  3J8F 2;  4C91 A;  3WG1 A;  1GP6 A;  1W6P A;  4QPI C;  5FUI A;  3DGT A;  1R1A 1;  3WX5 A;  1AJK A;  2Y64 A;  1VBA 3;  2RDQ A;  1OMI A;  3POJ A;  3BAL A;  4IL7 A;  1E5I A;  1QQP 2;  3ZPO A;  4BQ1 A;  2G9G A;  2RMU 2;  1JOB A;  2XQX A;  4Z8B A;  3DKW A;  2AUY A;  4LBM A;  4ORF A;  4BXS V;  1S0E A;  1OD5 A;  2Y6K A;  1CPN A;  5JOW A;  1UKR A;  1W8T A;  2HWB 2;  5GZC A;  5FOJ B;  1N3P A;  1RUE 2;  1DQ1 A;  2ZHL A;  4Y5S A;  1RUF 1;  2CL2 A;  4I0B A;  1IS5 A;  5JIA A;  4BQW A;  4F3J A;  3UYJ A;  2P4E A;  5AVA A;  3WF3 A;  1PM7 A;  1CGP A;  1H4H A;  2D44 A;  3WNX A;  4QDQ A;  3ZMN A;  3IDB B;  3UES A;  1F4H A;  1UYX A;  2VZV A;  4OMC A;  4OCT A;  3POI A;  2CWM A;  3HQR A;  1TMF 3;  1Q43 A;  3NQH A;  4FOY A;  3W21 A;  5AC9 2;  5K7P A;  2F17 A;  4K6B A;  4K1Z A;  2XJV A;  4QQO A;  4L97 A;  2DUP A;  4OYU A;  3MW4 A;  5H9P A;  2E7A A;  4LE3 A;  1SLL A;  3SC7 X;  3I54 A;  4QB1 A;  4NIA A;  3U14 A;  2YHJ A;  1CJD A;  5CEH A;  2VC9 A;  3BOD A;  3RYP A;  1LUL A;  5IVE A;  2VUA A;  2YBK A;  2DFC A;  4FPC A;  4LKF A;  4IND A;  1JZ6 A;  3KS7 A;  4CVU A;  4FP2 A;  4JKL A;  5BNO C;  4GAL A;  5JXI A;  5FZ1 A;  2VOT A;  1ZZ6 A;  1OUR A;  1V6O A;  4PJY A;  4AHZ A;  1XSR A;  2GDF A;  2Y0O A;  3C2U A;  4JQT A;  1Y7B A;  4CTE A;  1FI2 A;  1YI9 A;  3LFI A;  1YQ8 A;  2OVU A;  3AC0 A;  3LZZ A;  2YGL A;  2EXH A;  4Q1R A;  4OZO A;  4ASL A;  2NYY A;  1WCQ A;  2R07 3;  5DDJ 1;  3VDD B;  4ZZ5 A;  3O1R A;  5D21 A;  3OY8 B;  3LA7 A;  3ZSE A;  5IAX A;  1U5Z A;  2BUK A;  1OH4 A;  3IWZ A;  1NXM A;  1TE1 B;  3NJZ A;  5JR2 A;  2OYZ A;  1OI6 A;  4ZS3 A;  2P3Y A;  1QY4 A;  1NA1 B;  2WAB A;  3QOP A;  4FT8 A;  2CHH A;  1F5F A;  3LE0 A;  4LK7 A;  4L92 A;  4YLZ A;  2AZ5 A;  2VVE A;  4X6Q B;  4XBN A;  4E4H A;  5LBE A;  2HEV F;  2PMW B;  4HAN A;  5E89 A;  3PIG A;  4PLO A;  4BXF A;  4EN8 B;  5JSR A;  1Q3E A;  1E57 A;  1YCI A;  4OVE A;  5CFC C;  4LT5 A;  3PNA A;  1BVP 1;  4BZ4 A;  2IUW A;  5EHD A;  2KD7 A;  4YW6 A;  3ETP A;  3EYP A;  2RM2 1;  2PLV 1;  1W6Q B;  2QQK A;  3E97 A;  2XVK A;  3HWJ A;  4I30 A;  5B4X A;  2TBV A;  1GKB A;  1ASJ 3;  3III A;  2GU9 A;  1LGB A;  3FHQ A;  5IYY A;  3LGR A;  2WZR 3;  2PAK A;  1UZZ A;  1JYN A;  5IK8 A;  3RZJ A;  3T2O A;  5CYY A;  1UU6 A;  3ZN5 A;  2Y6J A;  3NRU A;  2FDJ A;  3WUD A;  1B35 A;  2GP3 A;  1VBD 2;  4HLT A;  1W6M A;  1WMX A;  2PQS A;  4UFI A;  5IVV A;  5FWJ A;  3MYX A;  3F95 A;  1ZZC A;  3KLS A;  4ZXK A;  2HEW F;  1OA4 A;  4COY A;  5BNP C;  3KB5 A;  3G7D A;  1XYO A;  1XBF A;  5DUX A;  1H4G A;  1X7N A;  5JZG C;  3JB4 C;  3WV6 A;  5FYT A;  2B5H A;  4AED A;  4Z92 B;  4Q4V 2;  3UT0 A;  2QQM A;  2PHU A;  2RJ2 A;  4MGZ E;  2A3X A;  2OII A;  1W05 A;  2D5H A;  5FPA A;  4QPW A;  1ZZ7 A;  2EID A;  2ZBJ A;  2HWF 3;  3LIH A;  4QDR A;  3ZX7 A;  1Z7S 2;  2A1X A;  4KWJ A;  1ZRC A;  1WCU A;  1ZVF A;  5KHH A;  1MS3 A;  1JUI A;  1UZV A;  5J98 B;  1QH7 A;  1KIT A;  3OPT A;  5FMC A;  3TN9 3;  1JYT A;  4B3N A;  1U12 A;  2YY1 A;  1VPH A;  5HBA A;  5L19 A;  2RS5 2;  2WNU A;  1JS9 A;  1L7L A;  3LEG A;  4GH4 C;  2Y6F A;  4PQQ A;  3BCW A;  4AGR A;  1ZBA 2;  4FPH A;  4NPM A;  4N43 B;  2XDV A;  4NWV A;  4NRO A;  4YYO A;  4XTM A;  5BNN C;  1JZ7 A;  3ILR A;  3LKJ A;  1RUH 1;  5DQ0 A;  3LEK A;  4OI2 A;  4M4R A;  1SG3 A;  1WW7 A;  2ZX4 A;  1AF9 A;  1YFU A;  4L0P A;  4RS5 B;  3NST A;  5IK7 A;  1FNZ A;  1O8P A;  2DBI A;  4FI9 A;  4ZKT B;  1SBD A;  2HH9 A;  2JE9 A;  1QU0 A;  1NLS A;  2C0Z A;  2JG8 A;  3F2Z A;  1NZI A;  3PTY A;  1PIV 1;  2R32 A;  4F83 A;  1Z0H A;  3KF3 A;  1VAV A;  4DUW A;  4E27 A;  3WW1 A;  5EWS A;  4BQ3 A;  1K45 A;  2WT0 A;  4ES8 A;  4TWT A;  3NW4 A;  1MS1 A;  4N7U A;  4XIK A;  4Y20 A;  2VE1 A;  3GCX A;  4FAH A;  4I09 A;  2ZGU A;  1AR7 2;  3FLR A;  4LK6 A;  4CDU C;  4QGM A;  3P3N A;  4MXV A;  1WA4 A;  2VBP A;  4R4Z A;  2JG8 C;  1AYN 3;  4XIL A;  4JRA A;  3POS A;  4NAO A;  1QEX A;  4YGB A;  4QX0 A;  2VCC A;  3ZXK A;  4CP0 A;  4FBF A;  2Z5W A;  1Y9Q A;  1E5R A;  5EIY B;  4H7L A;  2HWC 3;  4IUG A;  1GP4 A;  4BIS A;  2LM3 A;  3OSD A;  3WR0 A;  1QJZ A;  2J1V A;  3OGG A;  4ASK A;  4CDQ C;  3NAP A;  1XOY A;  2YC4 A;  2RS1 1;  2VXR A;  5DUV A;  4X6R B;  1JZ3 A;  1PIV 2;  1GUI A;  4UF0 A;  5I0D A;  1DYO A;  3EHK A;  5DUW A;  3VKM A;  4XFI A;  1ZRI A;  3K46 A;  4RFT 0;  2KXL A;  3VV1 A;  1GOF A;  1VRH 3;  2VZR A;  3AZV A;  4QXC A;  1W0P A;  4IW3 A;  1Q5O A;  1W0O A;  2SLI A;  4XJ8 A;  4IES A;  4BK4 A;  3SH5 A;  4Z2A A;  5L9R A;  1UY1 A;  4XUN A;  3MF6 A;  5DXD A;  5H9R A;  5C33 A;  1ND3 C;  2EAK A;  3VHN A;  3H3L A;  1EYB A;  2EA7 A;  1AR9 3;  1FPN 2;  3V0A B;  1W8F A;  1POV 0;  1R08 1;  3CJI A;  3VZN A;  1HJG A;  2XKO A;  2HWD 2;  1H6Y A;  1LHV A;  2ET7 A;  3MPB A;  5K0U C;  3WW4 A;  4UFL A;  3ZSL A;  2QQN A;  5F1R A;  5L9B A;  3VDA A;  1XNB A;  2QNK A;  4IE5 A;  3UK9 A;  3BN6 A;  2WC2 A;  3POE A;  4QPY A;  4O9E A;  1RTV A;  3TRS B;  4ZU7 A;  2YPJ A;  1NE6 A;  1XYN A;  3AM2 A;  2Y34 A;  1S0C A;  2BP6 A;  3NJY A;  2X5I C;  5FO7 B;  1TME 3;  1S0B A;  1WW5 A;  5FBZ A;  1IPJ A;  4WVW A;  4MGS A;  2YYO A;  1RL3 A;  4A42 A;  1VAM A;  5EV7 A;  2VR4 A;  3DV8 A;  1AHS A;  3AMQ A;  4XJU A;  2VZP A;  4NE9 A;  4CCD A;  4R9D A;  4DIQ A;  4GD4 A;  3VZK A;  2ADE A;  4AL9 A;  1LEM A;  2HWE 3;  3ZR5 A;  5CU1 A;  4YAR A;  3OCP A;  4ARX A;  1F9K A;  3C8X A;  2CTV A;  4Q29 A;  1ZBE 2;  2P37 A;  4UFJ A;  1JTZ X;  1RIN A;  5IVJ A;  4FPL A;  2XQR A;  3N9P A;  1QJX 2;  2VMH A;  4FOW A;  1LGN A;  4I3P A;  5A3P A;  1NLQ A;  5APA A;  5LBB A;  3WDU A;  4YFZ A;  3WG2 A;  2ARB A;  1X82 A;  4KWU A;  1CX4 A;  3GGL A;  2VEC A;  3VD3 A;  4XPV A;  4YVW C;  3W20 A;  4CE8 A;  2X10 A;  4Q4W 3;  4N9I A;  4PF1 A;  4IEY A;  5FZM A;  3S0M A;  3OTF A;  2L9L A;  4N8M A;  1PVC 1;  4AFD A;  5C4W A;  3O12 A;  4JQR A;  3W59 A;  1CES A;  5F6L B;  3CBN A;  4BU2 A;  3SCF A;  1S2E A;  1AZD A;  1HRV 2;  1VMJ A;  3GM8 A;  3OD0 A;  3OGS A;  1WD3 A;  4HT1 T;  5A33 A;  2HYK A;  4L2N A;  3PVB B;  4AHY A;  1F31 A;  2IXK A;  4IGP A;  5FXW A;  2QQV A;  4CP2 A;  4XYX A;  1EV1 1;  4OHV A;  4GJZ A;  2WRA A;  5GLV A;  1FMD 3;  2D98 A;  3HT1 A;  2YC2 A;  4BLI A;  1H2K A;  2VBD A;  2OT7 A;  5CB7 A;  1W8N A;  3CKH A;  5ACA 1;  1OQD A;  1V6J A;  1Q8P A;  3Q9O A;  3WLU A;  1B35 B;  4IV3 B;  3NWK A;  5D2A A;  2MNG A;  2Q30 A;  1LHU A;  2Q4S A;  3RQ0 A;  2WZR 2;  3SEE A;  2YRO A;  1O4Z A;  1TEI A;  2PHX A;  2O0O A;  2NLR A;  5SV5 A;  3KHC A;  1X8E A;  4CUA A;  4AVT A;  2BBV A;  5FDB A;  2ZEW A;  4GIQ A;  3WHT A;  3EQE A;  3WSO A;  1WMD A;  2P3K A;  1OFN A;  1PVC 2;  3JU9 A;  5FZC A;  1C28 A;  4HMZ A;  1IHM A;  1U0A A;  1OKO A;  4WVV A;  3EXU A;  4QPG A;  3DEM A;  3KMH A;  2TUN A;  4NID A;  2PQQ A;  1HRI 2;  5FZL A;  4CEY C;  2E32 A;  2BGO A;  2WSV A;  1NKG A;  1SBE A;  1U5I A;  3JQX A;  4XCB A;  5FZA A;  5LRS A;  4FFG A;  5LB6 A;  3WD5 A;  1GNY A;  1W9W A;  4M3C E;  3WCR A;  5IFP A;  3I2F A;  5FOB B;  1XNK A;  4C0H A;  5ACA 2;  4BQX A;  1COV 1;  4DRV A;  2W08 A;  1POV 1;  4QX8 A;  3GJA A;  4B1L A;  1O8S A;  4MH0 E;  1IG3 A;  4C8D A;  3E1F 1;  2MEV 1;  3NNG A;  3BB6 A;  4A6O A;  2V4A A;  3OUH A;  4Y4Y A;  4DFS A;  5A1F A;  1MVE A;  3LAG A;  3IT8 A;  2R7E B;  3ZM8 A;  5ISL A;  2W2I A;  5GLU A;  1J59 A;  2E33 A;  1RJ8 A;  4MV2 A;  1LOE A;  3BTA A;  4MO3 M;  4NII A;  1O3S A;  3THT A;  1LHW A;  4ASM B;  1RUD 3;  2UWB A;  2WKK A;  2BPA 2;  4S2G A;  4A3Z A;  3L2Y A;  4HSL A;  1POQ A;  3ZYJ B;  5IVF A;  4AG4 A;  1OPM A;  2LUW A;  4DMI A;  5A6Y A;  1EPW A;  4OI0 A;  2A7A A;  3RZH A;  2H0V A;  3D0S A;  4XMI A;  3JB8 A;  2CDP A;  2W1W A;  1X9P A;  3VBF A;  1G9B A;  1WGP A;  1QDC A;  1BBT 1;  1AYM 2;  2DCT A;  1DGR A;  4CCM A;  3O0W A;  1W6O A;  1ND2 C;  4GAZ A;  4CPB A;  2VMF A;  3LF7 A;  3MLL A;  2ZKL A;  4IGQ A;  5LAT A;  1IKQ A;  2JIC A;  2P17 A;  4HN0 A;  3ILF A;  1W6N A;  1TQ5 A;  3AMM A;  4PDW B;  1Y43 B;  1VMH A;  4CDW B;  1C1L A;  3M4F A;  2RS3 3;  3POF A;  4YG3 A;  4AVV A;  5C8C C;  2HBT A;  4YFW A;  3SCG A;  4EN7 B;  3WF4 A;  1QJY 1;  4CU8 A;  1CQ9 A;  1M4W A;  2D6P A;  4CZS A;  4RHV 3;  3T4V A;  1WLW A;  1S4C A;  5G04 L;  3I4I A;  3PU3 A;  4WM7 A;  1NCR A;  2P5B A;  3ES1 A;  4HKO A;  1DU3 D;  2J1R A;  2CDO A;  2DTW A;  2WT2 A;  2G19 A;  2JD4 A;  4AVA A;  1JHJ A;  3CMG A;  4EN9 B;  4DO0 A;  1RUI 1;  2JWP A;  4OZX A;  1CIW A;  1PVX A;  3PVE A;  2WYS A;  5A3T A;  3U4S A;  2MPF A;  2DU0 A;  3VBR A;  4MX3 A;  4QQ2 A;  3JBG 3;  3VBS A;  1RXG A;  4AAP A;  1RUC 1;  1D2S A;  2X09 A;  2HBU A;  1VBB 2;  1DGW X;  1JUH A;  2ZZJ A;  2WS9 1;  5DZE A;  3PUA A;  1CX1 A;  3UV9 A;  1EP0 A;  1AR9 2;  3WP5 A;  4NIH A;  5ANN A;  1A8D A;  3ON7 A;  1R09 1;  1NCQ A;  3VBO B;  5EZW A;  3AK0 A;  3K48 A;  2X05 A;  3WZ1 A;  2R04 1;  2XML A;  4FFH A;  4MAD A;  4CXW A;  2D6O X;  1OF4 A;  2DBN A;  2H6C A;  4JC1 A;  1V00 A;  3VBH A;  3OD4 A;  1S0I A;  1CAU B;  4QDS A;  1C3H A;  4WBB A;  4K20 A;  4YNI A;  5FRA A;  2W92 A;  5KBF A;  3RYR A;  3ZYF A;  5CNA A;  1S1A A;  1WWY A;  3J8F 3;  2QUO A;  1JBC A;  1RUI 2;  1W03 A;  5EP9 A;  3IAP A;  2XVG A;  4XF9 A;  3J7L A;  1QQP 3;  4K9S A;  1AL2 1;  3WP4 A;  3B9I A;  1RB8 G;  1GNH A;  4FTE A;  4BDV B;  4RQP B;  1W04 A;  5IHR A;  1LEN A;  3AMH A;  4IEQ A;  1TNF A;  1RJ7 A;  2B39 A;  3FJS A;  3IDE A;  4AYU A;  1RUE 3;  1EAH 3;  2EXK A;  3CF6 E;  1PMJ X;  1KDM A;  4CUB A;  3VDC A;  5LEJ A;  2W39 A;  5C4W B;  3GZT B;  1I3H A;  1NY7 2;  1IS4 A;  3E6B A;  4JGY C;  4COZ A;  4D7Y A;  5A7W A;  4JKM A;  4OQ9 A;  3ZYR A;  4KBZ A;  4Q4W 2;  4CEW B;  2Y60 A;  1XRU A;  4XAA A;  5EXO A;  4BCU A;  5IAT A;  1BCX A;  4LBQ A;  4UFM A;  1W8W A;  4GMP 3;  4QXH A;  4FQZ A;  3WNN A;  2H0B A;  3FLP A;  1QOO A;  5FP8 A;  1XJA A;  4OLL A;  1W06 A;  4DXT A;  3FFQ A;  2FDF A;  4KU7 A;  1MQT B;  3T08 A;  2IXJ A;  1R1A 3;  1YHF A;  1MVQ A;  4GB3 1;  3H1W A;  4EYU A;  1QOS A;  4AQS A;  1WMF A;  2EAL A;  1H8T A;  2YBS A;  1QNY A;  3M7A A;  1O59 A;  1FYU A;  5FY7 A;  4AEJ A;  4P9Y A;  1JZ4 A;  2CGP A;  2E31 A;  2GN7 A;  4N53 C;  5GLW A;  2ERF A;  4FSJ A;  2BQP A;  2B9U A;  3AYC A;  3I3B A;  3UKV A;  3VL8 A;  5JVV A;  2OKX A;  2UWA A;  1RUF 3;  1LR5 A;  2GME A;  3GZA A;  4Q4X 1;  2DVA A;  3V64 A;  3A7Q A;  2JG9 A;  5FY8 A;  1LES A;  5C3S A;  5KXD A;  5FP4 A;  4LQR A;  4AE2 A;  4P5Y A;  1H8T C;  4LIV A;  1CON A;  4Q0S A;  4XFF A;  5AFE A;  5CFD C;  3IDA A;  3N35 A;  3W58 A;  1A78 A;  4FXG B;  1LHO A;  1DGW A;  2UYB A;  4ZS2 A;  1C4R A;  3VL9 A;  3CHX A;  4Z2W A;  5FR3 A;  1CAX A;  1QKQ A;  2A3W A;  2F4P A;  4CXY A;  2YBP A;  1GZT A;  5L7O C;  3ZYG A;  2ARA A;  1ULG A;  3ZFF A;  3FUQ A;  1IPS A;  4FPJ A;  4FP3 A;  2BVB A;  3VHO A;  3ACF A;  2PYT A;  4W50 A;  5T52 A;  4Q0P A;  3URF A;  1PK6 A;  2BU9 A;  4HXC A;  4K7J A;  1QDO A;  2IXH A;  3PLQ A;  2QZ3 A;  2WWJ A;  3B93 A;  3RG0 A;  3UJO A;  4YZ2 A;  1ZNP A;  4L8Q A;  5LA2 A;  5LA1 A;  3LEM A;  4P02 B;  1GMM A;  1W90 A;  4PIX A;  2ZEX A;  1RMU 2;  3ZXJ A;  3ZN4 A;  1BKZ A;  1BZW A;  1YYN A;  2OQ7 A;  1PGS A;  4NVP A;  2GND A;  2QVS B;  5JI9 A;  1LOB A;  1S2K A;  1URX A;  4LHK A;  4WV8 A;  4JTN A;  4P14 A;  5FQ0 A;  4LMF A;  1RUD 2;  5DDJ 3;  3VBU A;  1NYW A;  5D8A B;  3SLI A;  3ZYH A;  4AR2 A;  3VBF B;  1K3I A;  1O4T A;  1UQX A;  1GP5 A;  1RED A;  5A3N A;  2ZHK A;  5JI7 A;  3CZJ A;  2VXJ A;  2NM1 A;  4W4Z A;  5GZE A;  1W6O B;  1U5Y A;  2V4V A;  2Y6H A;  3KCC A;  3LDB A;  1VBD 3;  3OBZ A;  1I9R A;  2KM2 A;  1J84 A;  2WSU A;  2YFU A;  1I6X A;  5FBJ A;  1WLC A;  1OPO A;  5KHI A;  1PGW 2;  3OB8 A;  2R0H A;  2YZ4 A;  3B94 A;  1SPP B;  3AXD A;  4V2W A;  2GH8 A;  3A4U A;  4NN0 A;  4O65 A;  2ZGN A;  4S2D A;  3OBA A;  3H1M A;  3LSD A;  3M3O A;  3HVD A;  4BIO A;  3JCI A;  3AZX A;  4BOW A;  2ZGL A;  1W2N A;  4R9B A;  1NA1 C;  3FBM A;  5EYX A;  3W9A A;  4COW A;  3RZM A;  1LAJ A;  2R1B A;  1WD4 A;  3D3A A;  4LBJ A;  1Z7S 3;  1NCR B;  2A73 B;  2FBE A;  2RS3 2;  3J4U H;  4COU A;  3N4M A;  3SQO A;  3O1T A;  2PHF A;  3C7O A;  1QXP A;  1MR5 A;  4JGZ B;  1V9U 2;  2JEM A;  3C7E A;  4H2A A;  5FYZ A;  1KXG A;  2ARE A;  2Q1M A;  2QQW A;  3RS6 A;  1UO9 A;  1UY3 A;  1TVG A;  3T30 A;  2B7Y A;  3ZDV A;  2QDR A;  2RS5 3;  4MZU A;  3KF5 A;  5JIU A;  3PUI A;  4K8F A;  4QB2 A;  1ZBA 3;  2ATF A;  1K12 A;  2V5D A;  4LO8 A;  4M3C F;  4AGV A;  3DN7 A;  2VCA A;  1R1Z A;  4CU7 A;  3VBS B;  2VM9 A;  4UXA A;  4R9A A;  1YQ2 A;  2TNF A;  3CNA A;  2IFW A;  1UXZ A;  3C7G A;  2YG0 A;  3DPR B;  3M3I A;  4K21 A;  1ULE A;  1XNC A;  4IE0 A;  3RI9 A;  1E5H A;  1NCQ B;  1CPM A;  2WIN B;  1PO1 1;  3H9A A;  2XOM A;  4QKF A;  1W9S A;  5FZ7 A;  3MO4 A;  3K4Z A;  5IT6 A;  1ENS A;  1VJ2 A;  2Z79 A;  3VBH B;  4AXO A;  2RR1 1;  3HIF A;  3WXP A;  2BWA A;  3H7Y A;  5AC9 1;  5FPV A;  4XCA A;  4CP9 A;  1RC6 A;  4QPI A;  5FP9 A;  5FP3 A;  1AR7 3;  4YZ4 A;  1AX0 A;  2BDR A;  4I0A A;  1QXR A;  4I3G A;  4FCA A;  4B4R A;  4UW3 A;  5C5T A;  3KT4 A;  2Y33 A;  4LIU A;  2O8O A;  2RHP A;  3UGH A;  4GWN A;  1GZ9 A;  2BOI A;  3FUO A;  4E8C A;  5T55 A;  1YEW A;  2JDY A;  3GBG A;  5I0T A;  3RPQ A;  4AF9 A;  4RR3 C;  1BEV 1;  2ZGT A;  3NV1 A;  4Q8L A;  2BVV A;  2ZAB A;  4Q5O A;  3TNQ A;  5FXX A;  3BPZ A;  4GQ7 A;  1QJU 1;  2ARX A;  2WNV B;  3Q8E A;  2FMD A;  4XJA A;  5CVR A;  4CDX B;  5ABJ B;  2NMN A;  4NIG A;  4WVZ A;  2OXB A;  3KV4 A;  3KZ4 C;  4GXL A;  1PIV 3;  1OVS A;  3DYM A;  1PO1 2;  4BM8 A;  5A7W B;  3ROU A;  2PHT A;  4C90 A;  1S0J A;  3S30 A;  3RZL A;  4DQA A;  5KC5 A;  3ZXE A;  5KXC A;  1EAH 2;  1ENX A;  5FPU A;  2JE8 A;  2FHR A;  2JDN A;  2V72 A;  4LBQ B;  4NRQ A;  3TEX A;  3ZFE B;  1W39 A;  1GIC A;  1N1S A;  1MS5 A;  3MV0 1;  1UWW A;  4LHS A;  4EZH A;  2VQU A;  5CZK A;  2WII B;  2ETE A;  1FPN 3;  5EJZ B;  1GQG A;  2VJX A;  3HQX A;  4Y1V A;  5BNO A;  4QWN A;  2HWD 3;  5LBC A;  3MLK A;  3GHN A;  1SLT A;  3VHP A;  1BEV 2;  2I74 A;  4AFB A;  2PHW A;  4WVM A;  3BTX A;  2B45 X;  4LO7 A;  5F3G A;  1IQA A;  1QJU 2;  1R1A 2;  2D6N A;  3AZZ A;  5JWP A;  4HG6 B;  4BQ2 A;  5FLH A;  3X29 B;  1JU4 A;  4XUT A;  5FLJ A;  3Q8C A;  2NP0 A;  3TYJ A;  2WDB A;  3GYD A;  1WBL A;  2JG9 B;  2WJS A;  1GAN A;  2ARC A;  5A3O A;  2VY0 A;  4FPO B;  3R6S A;  4AQ6 A;  4NHY A;  2EIB A;  4LLO A;  4NJ4 A;  3AYD A;  3CU7 A;  1RUF 2;  1QHD A;  3IMN A;  1PM4 A;  1JXN A;  2D7F A;  2VNO A;  3I2G A;  3AMN A;  1ZBE 3;  2I2S A;  1UZY A;  1CN1 A;  4X8P A;  1PO2 1;  1QJX 3;  2XLA A;  1GR3 A;  5CFC A;  3NNJ A;  1T6G C;  4KG0 A;  3PVO A;  4HSJ A;  2D40 A;  3TAY A;  3USU B;  5FYV A;  1Q8V A;  4QAW A;  3WP6 A;  1GZW B;  4DEV A;  4FVV A;  3SKV A;  2VVD A;  1VB2 A;  3GF6 A;  1PK6 B;  3VKF C;  2IWG B;  1SDD B;  3SMH A;  1UYY A;  1BJQ A;  5IW0 A;  3GBW A;  1O3R A;  3VN4 A;  3WNL A;  3FE5 A;  1UIJ A;  4XZP A;  3IBM A;  1IPK A;  1HRV 3;  5GJ6 A;  2YPD A;  1OQE A;  4AI3 A;  5C6C A;  5CG8 A;  1RUO A;  3KCY A;  3CZU A;  5EQU A;  2VOW A;  4BK5 A;  1B09 A;  5FYI A;  5BYN A;  2ZAA A;  1DQ2 A;  3VBU B;  1DIW A;  4NRM A;  1C8N A;  3HEI A;  4P9G A;  3M70 A;  4E9K A;  5BNP A;  2KA3 A;  2LS6 A;  2RVA A;  3AFK A;  1O3Q A;  4HFS A;  1H0B A;  1PO2 2;  5DDJ 2;  3GBF A;  5JZG A;  2WWU A;  3WQ1 A;  3WT3 A;  4M4P A;  2DCZ A;  5FYB A;  2LAL A;  1JYW A;  3QD6 A;  5DAB A;  4OHW A;  4EN6 B;  2OW4 A;  1LJ7 A;  3K4D A;  4XE9 A;  2X29 A;  4XTP A;  3OJB A;  2Q1Z B;  4DB5 A;  5JMC A;  5HCH A;  1QJE A;  1HB4 A;  4I02 A;  3A0N A;  4LHL A;  3KSC A;  1LU1 A;  5T3N A;  2R06 1;  1PVC 3;  5F2S A;  1DP0 A;  2UY8 A;  2RV9 A;  5KWR A;  3WG3 A;  3JD7 1;  4AWD A;  4XF0 A;  2JDM A;  3PUQ A;  4PLM A;  4RL7 A;  4Z1V A;  1QGL A;  1HRI 3;  1JZ2 A;  1C8M 1;  2PTM A;  3V56 A;  2XPJ A;  2VW2 A;  4LO4 B;  2JB8 A;  4JDN A;  4GH4 A;  2XUM A;  1HQL A;  5FZB A;  1DGL A;  2BJS A;  3LD8 A;  5B4N A;  2W3J A;  2JE7 A;  1EV1 3;  2RM2 2;  2PLV 2;  4NAM A;  1JOP A;  4LBN A;  5BNN A;  3POB A;  5GKA C;  2AEZ A;  2R0F A;  3I2K A;  2XBO 1;  5E1R A;  3SEP A;  5ACA 3;  4XFG A;  2J1U A;  1EUU A;  4BE3 A;  4QHO A;  5LW9 A;  4RD7 A;  1DBN A;  2ZX2 A;  3I2D A;  4LUL A;  3ZIX A;  4J6G A;  5FZ3 A;  3PJQ A;  2W9X A;  1AXY A;  3N7M A;  3NKG A;  1FV2 A;  4IEO A;  4LO5 B;  2DVD A;  5FUP A;  5FZO A;  2JXA A;  2YU1 A;  1SQ4 A;  3P3P A;  1SFN A;  3BOP A;  4XQD A;  2RJL A;  4IEU A;  1SBF A;  2B8M A;  2VME A;  1O6U A;  2VOK A;  4M00 A;  5F3I A;  1R64 A;  4FAG A;  1G86 A;  1N1V A;  4FFI A;  4CDU A;  2BW8 A;  4CCN A;  4UFK A;  3AL5 A;  4IE4 A;  3LEI A;  4E2S A;  2BBA A;  4CP9 B;  4CCC A;  1WLD A;  3BU7 A;  4XUQ A;  3ZN6 B;  5IFT A;  2OZ6 A;  3HMY A;  5FY0 A;  3IZO A;  2PAM A;  4H3W A;  1S0F A;  2CAV A;  1AYM 3;  2J7M A;  4UOJ A;  4A7Z A;  1VLN A;  1WCD J;  2QTW B;  1VE0 A;  2VQ0 A;  5HCF A;  4U36 A;  1MS9 A;  2WBK A;  5DN2 A;  5IWF A;  3N9N A;  5GLT A;  1H30 A;  4CDQ A;  4ISQ A;  3O1P A;  1VBE 1;  1O5U A;  1ST8 A;  1W6P B;  2AEN A;  2EIC A;  3U78 A;  5F5C A;  3LPF A;  1VBA 1;  2ZGO A;  1D0G A;  5JSP A;  3ZYI B;  4OMD A;  1MEC 1;  1RUH 2;  1WCS A;  4RGG A;  3D8C A;  1KRI A;  4ZXE A;  3HAG A;  1MS4 A;  3PHM A;  1LOD A;  1Y9G A;  2FCU A;  1GV9 A;  4FPG A;  3WDV A;  1ND3 A;  3ZXG A;  3D82 A;  3MF9 A;  4JKK A;  5FZI A;  1IGO A;  4PLN A;  1UOG A;  1LB2 A;  1T6B X;  3SNM A;  5FY1 A;  4GKY A;  2VMI A;  1EUT A;  2BRT A;  5ERL A;  1HQN A;  2B46 X;  3INA A;  5K0U A;  2BZD A;  1NG0 A;  3J26 N;  4BQY A;  3TEZ A;  1XE7 A;  4WM8 C;  1GLH A;  4JZR A;  1RUG 1;  1REE A;  5FYH A;  3IAQ A;  4QX2 A;  4CP1 A;  5I0S A;  3SKJ E;  5F5Q A;  1LCL A;  1UU5 A;  2EF6 A;  3MFA A;  4MG2 A;  3AP9 A;  1VBB 3;  2CNA A;  3NMB A;  3NNL A;  4ONU A;  2X5I A;  2JKX A;  5FUN A;  4DUX A;  5CBL A;  1FT9 A;  3I3E A;  1QJY 3;  1GBG A;  2GMM A;  2WA3 A;  3S7I A;  2QFE A;  5FCC A;  1L3J A;  2ADD A;  3WW3 A;  3EB7 A;  1V6M A;  3LB9 A;  4D6Q A;  4FPY A;  3BU0 A;  4PDW C;  4TTG A;  1X8M A;  1NUK A;  4CDW C;  4LBQ D;  1WLT A;  2IFR A;  2RS1 2;  2ZML A;  3PMS A;  1VIW B;  2GZW A;  2BOJ A;  4YPJ A;  3A23 A;  5DAX A;  1LKN A;  1RUI 3;  3B9C A;  2G4I A;  4AVB A;  3ZSJ A;  1HKD A;  1OSG A;  1BQP A;  1UF2 C;  1W3X A;  2R07 1;  1JN2 P;  2VZO A;  4QU2 A;  5FMB A;  4DXZ A;  4YVW A;  5CA6 A;  4EE2 A;  1DYK A;  4GUL A;  3ZSK A;  1HV0 A;  1Q8Q A;  3NNF A;  3GAL A;  2WQ4 A;  5CKN A;  2G9Z A;  4HOO A;  5A7O A;  1CAV A;  1GQP A;  5FKC A;  3VZM A;  1LNS A;  1JZ5 A;  1LOG A;  1W3V A;  1R08 2;  2WFF 1;  4N9H A;  4XFC A;  1BLZ A;  2QQO A;  2Y8K A;  2DF7 A;  2R04 3;  4D69 A;  1YNA A;  1GQH A;  1HQW A;  2ENR A;  3PME A;  4Y24 A;  5A1A A;  4XIO A;  3IMM A;  2VZT A;  1O91 A;  4IQP A;  3SIT A;  3T1L A;  1G9A A;  3BI3 A;  2D6M A;  1MS0 A;  1ONA A;  2R16 A;  1OOP C;  2XG3 A;  3NNM A;  5IK4 A;  2C1F A;  1ZRE A;  2D5F A;  1O4Y A;  1CZS A;  3TOJ A;  5FXZ A;  2DVB A;  1ASJ 1;  3WNK A;  2DYC A;  4JDO A;  2W46 A;  2XHN A;  3ZR6 A;  5A1L A;  2VL4 A;  3HNM A;  3VZJ A;  3RDI A;  5A3W A;  3NKT A;  5JZG B;  1MZF A;  3S5A A;  1AL2 3;  4FTB A;  5F32 A;  1AR8 1;  2VQT A;  2VG9 A;  4FXK B;  5FZ9 A;  2WZP P;  4AFA A;  3N3H A;  3GZU C;  4XUR A;  1RVF 1;  1W6M B;  1T2X A;  4YVS C;  5FYC A;  1UCX A;  1DQ4 A;  4LOT A;  4QB6 A;  4D8M A;  1OXC A;  1M06 G;  4CEY A;  2A6X A;  2E63 A;  5JXG A;  2R1D A;  3KVB A;  4LUK A;  2XJR A;  5BXX A;  4TZD A;  1QMJ A;  5LRR A;  2ZJC A;  3J7N A;  4GWI A;  3HN1 A;  4DPN A;  3PIJ A;  4AED B;  4AW7 A;  2OPK A;  4RQP C;  3WDT A;  3B7M A;  2CY6 A;  5LEK A;  2I07 B;  1US3 A;  2HWF 1;  2FQP A;  3RFR A;  3M8L A;  5BNN B;  2VNV A;  1GWM A;  4CCK A;  2VU9 A;  3RRD A;  3B69 A;  2D6L X;  3J7M A;  1OA3 A;  4IGO A;  5LA0 A;  1S55 A;  2RDS A;  4LR4 A;  3D4K A;  2J22 A;  3JZV A;  2OUH A;  2QZ2 A;  1EV1 2;  1BYH A;  3CIH A;  4CEW C;  2WNU B;  5DUU A;  3HOB A;  2WWS A;  3MZH A;  3AP5 A;  4Y3O A;  4A7K A;  3TEW A;  3QH7 A;  1GOH A;  1DZR A;  4EWA A;  2ZXQ A;  1RVF 2;  3O7O A;  3OPZ A;  4XFA A;  2XWB B;  5L9V A;  3U4X A;  3O1S A;  1HX6 A;  4IXL A;  2IXL A;  5F8P A;  1MQT C;  4EZ4 A;  1FXZ A;  4FFF A;  3T4H B;  1RMU 3;  3BVC A;  5A32 A;  2W91 A;  2EVX A;  4CDU B;  2FCV A;  4X8N A;  3U75 A;  1H1I A;  4QT6 A;  5I8T A;  1X36 A;  3T1M A;  3T0B A;  3ASI A;  2JG8 B;  1SZB A;  2VGD A;  3VGI A;  3ECQ A;  4ARY A;  1ND2 A;  2VOX A;  2P2K A;  3HT2 A;  4XFH A;  5T5L A;  5FP7 A;  2ZPX A;  3RZZ A;  4MVT A;  1V70 A;  3U11 A;  4P5H A;  1HXS 1;  4Y20 B;  1OFS A;  2OZJ A;  3DXT A;  3OG2 A;  3S5Q A;  1DZT A;  1VBC 1;  5C8C A;  3FFZ A;  4GWM A;  4CDQ B;  1CVN A;  3C3V A;  5J48 A;  1AYN 1;  1LRH A;  2RE9 A;  1J83 A;  1WUV A;  3P5B A;  5CIR A;  1DHK B;  3E6C C;  1XC6 A;  3DF0 A;  4LA2 A;  1UN1 A;  4NHL A;  2PN5 A;  3OGV A;  3FWE A;  3LCP A;  1COV 2;  1ZZ9 A;  4IEV A;  5FY4 A;  1PGL 1;  4OI4 A;  2ZGK A;  1PNF A;  1V6I A;  2C24 A;  2G1M A;  2J1A A;  2MEV 2;  2HWC 1;  2FDH A;  5LA9 A;  1YWK A;  3WF2 A;  2E51 A;  2YUE A;  1YJL A;  1VAL A;  2B4K A;  2VTX J;  2JB4 A;  3O1V A;  2A3Y A;  2QBX A;  1GOG A;  4AEM A;  4UWD A;  1JI6 A;  3NAP B;  1ND3 B;  3Q8F A;  4N90 A;  4MLO A;  2C9A A;  1V9U 3;  1W0N A;  3BYW A;  3CEW A;  4NPR A;  4RYD A;  4AAX A;  4UF0 B;  3I3M A;  4LTA A;  1SLB A;  3E5U A;  4UW4 A;  1VRH 1;  2C9K A;  2YV8 A;  4OFG A;  5HXV A;  1UW8 A;  2EXJ A;  3FN9 A;  1W8O A;  5LY2 A;  3UGF A;  4NMI A;  3W5N A;  2XB6 C;  3O0V A;  4IE6 A;  4Q4Y 1;  4XC9 A;  4HPK A;  3AFG A;  3CO2 A;  1VB4 A;  2BNN A;  4RSU A;  4AFC A;  4AQT A;  4KMQ A;  5H9Q A;  3AKR A;  3AP4 A;  5CKQ A;  4YW1 A;  1BBT 2;  3ACG A;  3SHR A;  4C1W A;  1W9F A;  4XJ9 A;  5D8A C;  4YG6 A;  1ODN A;  3CJI B;  4O7X A;  4DY5 A;  1KJL A;  4OUL A;  2GNT A;  3WW2 A;  4YM1 A;  3R4U A;  2E9Q A;  1ENR A;  4CCJ A;  3T2T A;  1OLM A;  5KXB A;  3P1I A;  2W47 A;  4NWW A;  1ZX5 A;  3NVC A;  1AX1 A;  3GZE A;  1MZ6 A;  2WO3 A;  1AX2 A;  3IN9 A;  3MBW A;  1QJY 2;  4D3W A;  1TME 1;  2EIG A;  1ODM A;  4ZHN A;  4MSV A;  3NJV A;  4YGD A;  3VZL A;  1STM A;  5T54 A;  2A6W A;  5A3U A;  2VCM A;  3GDB A;  5C9A C;  5GM0 A;  3QBQ A;  5DAQ A;  5F39 A;  1LEC A;  4U2A A;  1CZV A;  1K5M A;  1S2B A;  3CJX A;  5DG2 A;  4YVW B;  2HWE 1;  2YDE A;  4XEZ A;  4QX7 A;  5SV8 A;  5FAX A;  5FZD A;  5FPZ A;  1KFU L;  3WDX A;  5F37 A;  3ZFG C;  2EXI A;  1CAV B;  4JGZ C;  4E2G A;  3LIG A;  4J1W A;  4CCO A;  1KD7 A;  1KS4 A;  2Q5T A;  4EN0 A;  4JGY A;  5FZ6 A;  3QH6 A;  1ALY A;  3BOW A;  4XHB A;  3ZKU A;  5FLI A;  1PO1 3;  3WNM A;  3FC0 A;  2AEY A;  1W9T A;  1K5M C;  1RUC 2;  5IVY A;  2QQL A;  2XJS A;  2FDG A;  2WS9 2;  4QGN A;  5HCB A;  4F7Z A;  4EV0 A;  4AOC A;  5JXH A;  1BMV 1;  3ENR A;  1IG0 A;  1RIT A;  1QWR A;  2QQI A;  1BXH A;  1R09 2;  3E5X A;  5T5O A;  1P8J A;  5L36 A;  3E5Q A;  4OUS A;  3DPR C;  2R04 2;  4A2U A;  2A75 A;  4GZ9 A;  3KWV A;  2DV9 A;  1VAK A;  4XVH A;  3VBR C;  1UOF A;  3UKT A;  5A33 B;  4NPL A;  4HON A;  3EBR A;  4QKD A;  3SH3 A;  2IZW A;  3OEA A;  4XOG A;  2VUC A;  1AXK A;  2BYV E;  4N53 A;  4RGK A;  1W2A X;  3I97 A;  1BEV 3;  3BUC A;  2GN3 A;  2W1S A;  1UMH A;  2GNM A;  1AVB A;  2CGO A;  2P6H A;  1DQ6 A;  1QJU 3;  1RHI 1;  3PVN A;  5C71 A;  2J1T A;  3OYW A;  3LQC A;  1BVV A;  1XXN A;  2LW8 A;  4IV1 C;  4WZC A;  3QAC A;  4A44 A;  4D6S A;  4CU6 A;  3ZKY A;  5B2G B;  1AL2 2;  2GNB A;  4W6Y A;  5C3O A;  3T3Y A;  4AQ2 A;  2ZX0 A;  4P9X A;  3R05 A;  1OQ1 A;  3K51 A;  3AKQ A;  5CFD A;  1RUJ 1;  3LFM A;  2X8K A;  1AUY A;  3ZPY A;  5F2W A;  5FFO C;  1NAE A;  1GFF 2;  3R4D B;  4CDX C;  1G9C A;  2HYX A;  5L7O A;  3BTY A;  4QPG B;  1UX6 A;  1D4M 1;  1HN1 A;  5FZ0 A;  2CGN A;  5FYU A;  4CYD A;  1CD3 G;  3AKS A;  4XF4 A;  1D2Q A;  3V0B A;  4MGT A;  3HPN A;  2V5Y A;  2XL7 A;  4CRQ A;  1G9D A;  3MUZ 1;  4I0W B;  5FJK A;  3THD A;  4W8J A;  1H1A A;  4F8A A;  4LIT A;  3ZO0 B;  2RDN A;  5FRE A;  4D94 A;  2GC0 A;  2K46 A;  4XXA A;  1SFY A;  2R30 A;  4GB3 2;  1N47 A;  5FO8 B;  2ZOE B;  3WY6 A;  4OHZ A;  3HQU A;  4RN5 A;  4D7T A;  2FD8 A;  1OLQ A;  1W99 A;  2IC1 A;  3L2H A;  1CZT A;  1UX7 A;  2R49 A;  4NR1 A;  4R52 A;  4YW2 A;  1Y3T A;  5TSW A;  4OHY A;  4XQW A;  4MUV A;  4COV A;  3BKZ A;  1G6N A;  1ND2 B;  4L11 A;  4PT6 A;  4DIN B;  3H8U A;  3PUS A;  5L73 A;  3OF1 A;  4Q4X 2;  3DCQ A;  4AHW A;  3I3Q A;  3IB3 A;  4MYE A;  1D4M 2;  1GZC A;  2ZGS A;  1JMU B;  5K9Y A;  3KQ4 B;  4LEJ A;  4QKB A;  5CIS A;  4GMP 0;  2GAU A;  1UXX X;  1PO2 3;  5C8C B;  4UW5 A;  4D0Q A;  4G4F A;  3JQW A;  4DRR A;  3MLJ A;  2NZ9 A;  1UAI A;  4IEZ A;  1JHN A;  2XLG A;  1NA1 A;  3DKQ A;  4K8R B;  2ZX1 A;  5LZ6 A;  2LTN A;  4MXW A;  1IS3 A;  1DF0 A;  3USS A;  1UPI A;  2YFZ A;  3WNO A;  5FZH A;  3OOX A;  3AX4 A;  3I2J A;  1W6N B;  4LKE A;  5C8W A;  2DFB A;  3H8R A;  3VDD C;  4O9G A;  1UNB A;  4O61 A;  3VLB B;  3GXU A;  3G6J B;  4RHV 1;  2Z4F A;  5FZF A;  1V0A A;  4Y5T A;  3B02 A;  4OUE A;  3MID A;  2RM2 3;  2PLV 3;  5DAV A;  3B5L B;  4A3X A;  4WM7 B;  3WEZ A;  3WP3 A;  5GZG A;  3AP7 A;  4K40 A;  4XF3 A;  1AR6 1;  2ID4 A;  2JX9 A;  3FHA A;  2BNO A;  1XU1 A;  3RJ2 X;  4Y5Z 0;  4JDM A;  2VZ3 A;  1A34 A;  2DDU A;  3KCX A;  4JRL A;  5EPA A;  5J1X A;  3KVA A;  1QH6 A;  5A70 A;  3AYA A;  1QF3 A;  3R4S A;  1G9F A;  1XYP A;  2V73 A;  1UYZ A;  1DLC A;  5DMY A;  4LO6 B;  3VKL A;  1ULC A;  3JBG 1;  2PFW A;  3LA2 A;  3VBR B;  1JH5 A;  3KGZ A;  4KH9 A;  4AI0 A;  5J36 A;  3O1U A;  3OGR A;  2F6B A;  5BY5 A;  2DUR A;  3JD7 3;  4NHX A;  5F3C A;  2Y6L A;  1OLR A;  2PHL A;  3ZMO A;  5T50 A;  3KV6 A;  1X33 A;  1UKG A;  4B4P A;  3MW3 A;  3I2O A;  4SBV A;  5EJ1 B;  4G9S B;  4YSF A;  3LWC A;  3RZK A;  3FHI B;  4RR3 A;  1MPX A;  2XBO 3;  2WZE A;  4PIZ A;  1W9Y A;  3IIA A;  1YFX A;  4Z82 A;  4LXL A;  4LHN A;  3MIB A;  4R8H A;  3WUC A;  4D7S A;  3N36 A;  4KQ7 A;  5FPX A;  1H2N A;  4G3Y C;  4GKX A;  1VR3 A;  3M3C A;  3LA3 A;  2UYA A;  2ORZ A;  2DVG A;  1QQP 1;  3L9J T;  3QCW A;  4JGY B;  1V6N A;  2RMU 1;  1V6L A;  1YXW A;  4QKN A;  3ALQ A;  3AVS A;  3MEP A;  4Y26 A;  5A7Q A;  3O1M A;  1Q8O A;  4M0N A;  1RUH 3;  1Q8S A;  1GSL A;  2WFP A;  2E26 A;  4BH9 A;  2RDR A;  2FCT A;  2HWB 1;  4LE4 A;  1SLA A;  5T5P A;  5KHJ A;  1RUE 1;  4HBN A;  3C7F A;  1XNT A;  2VTX A;  4LKS A;  1XND A;  4LUM A;  4IEP A;  4AK3 A;  3GJB A;  3OUI A;  2VVF A;  1DDL A;  4N43 C;  4DS0 A;  2P6C A;  2BNM A;  2H6B A;  3VD4 A;  4K1Y A;  4HZF A;  2RR1 2;  3VHR A;  4GMP 1;  1KDK A;  4M01 A;  2Q0A A;  1XB9 A;  4ZY9 A;  4RS5 C;  1NE4 A;  2V09 A;  1SEF A;  4MGI E;  5FXV A;  4N53 B;  1J3R A;  4D6R A;  5A6Z A;  3FBY A;  1H8V A;  1W8H A;  3GCW A;  3H3Z A;  3KHB A;  2VZU A;  1VBE 3;  1BK0 A;  3C7H A;  3I59 A;  2JDA A;  4CXX A;  1UIK A;  2VTF A;  4J25 A;  4YW5 A;  1OH3 A;  1OBN A;  3OYW B;  1MZE A;  2ZS6 B;  1W2T A;  1DQ0 A;  2KR2 A;  1YQ5 A;  2XWJ B;  1MEC 3;  1ACC A;  1VP6 A;  3ME2 A;  3R0R A;  1H8T B;  4MET A;  2A6V A;  2VUD A;  3LPG A;  1PHM A;  3RMY A;  5CFD B;  3E6D A;  2XLF A;  5CG9 A;  1HW5 A;  1YO8 A;  1LHN A;  1KGY A;  1ZZB A;  4JAA A;  2Q8O A;  2ZHM A;  4HK8 A;  2PHD A;  3WOG A;  2RS1 3;  2GC2 A;  1YJK A;  2UWC A;  4ITC A;  4NO4 A;  5IAV A;  4OQ8 A;  5L7O B;  1WZX A;  3GNE A;  1NZC A;  3CL1 A;  1OA2 A;  4CSW A;  5FIX A;  3V0B B;  1REF A;  2BFU S;  3I2I A;  4JCK A;  3P6B A;  4UI9 L;  1APN A;  1K5J A;  1RUG 3;  4R9C A;  3U10 A;  5KR7 A;  3Q8A A;  3KT1 A;  5HPO A;  2WQ8 A;  1WW4 A;  3UKN A;  3W5M A;  2Q1F A;  3NV4 A;  1YQ6 A;  1CAX B;  3FX3 A;  3WG4 A;  2W5F A;  5A7N A;  3V0A A;  4GA9 A;  2WLQ A;  4AI8 A;  1R08 3;  3ZFF B;  5HV0 A;  1UMZ A;  4E4Z A;  4BQ5 A;  3O5S A;  1HB2 A;  1ENQ A;  1J3P A;  5DPN A;  1QXJ A;  2QJV A;  3IPV A;  1IZ3 A;  4Q0V A;  2FZ1 A;  3S6P A;  3KM5 A;  4YM0 A;  1C1F A;  2HEY F;  1HV1 A;  4YRD A;  3CQO A;  4AVC A;  4AZZ A;  2WT1 A;  1CIY A;  4AEK A;  2EIE A;  4YZ5 A;  2JDZ A;  5FTT C;  4XFB A;  4LLF A;  5FZG A;  2Y38 A;  4Q8K A;  4PCR A;  3MFC A;  2ZGR A;  4KGQ A;  1YIF A;  4CA9 A;  1X50 A;  2PA7 A;  2Q8C A;  3LOB A;  3BIW E;  4PQ9 A;  5FQ0 B;  1CJP A;  1PX3 A;  1UD1 A;  4ET7 A;  1F15 A;  1FOD 1;  4HKL A;  1H2M A;  2VUJ A;  5HCA A;  2XVL A;  5IVB A;  5DAW A;  5E16 A;  3HNY M;  5FJH A;  5KHK A;  5FZ4 A;  1VBD 1;  1JYI A;  5DZG A;  4MXW B;  2E53 A;  1DZQ A;  5LCW L;  1SDW A;  2XL9 A;  4XDP A;  1PMI A;  1HN0 A;  2AAC A;  1H1M A;  3ZXL A;  4E8D A;  2BER A;  2WFF 3;  3AL6 A;  5FMO S;  1JU3 A;  4Q0Q A;  4RA0 A;  4BJ0 A;  2AC1 A;  3ST7 A;  4I2O A;  1J1L A;  4NHK A;  4B29 A;  4H14 A;  2CU5 A;  2C6S A;  4Q4V 1;  1HB3 A;  1XQN A;  2DVF A;  1CAW A;  3TEY A;  3B3Q E;  4ES9 A;  3UGG A;  1ZRR A;  3VZO A;  1F2N A;  4NHM A;  1Z7S 1;  2VW0 A;  3OGJ A;  2E6V A;  2NPI A;  4XMA A;  4Z07 A;  3U07 A;  5FYS A;  5J96 B;  3IDC B;  3LSE A;  5GAL A;  3PUR A;  2JIG A;  4A6S A;  5LK7 B;  4EWD A;  3DL3 A;  4XHX A;  2F4L A;  2CV6 A;  2G9F A;  2RS5 1;  1FOD 2;  2HLE A;  1U5X A;  2RJK A;  2VW1 A;  3LDR A;  3OBR A;  1AR8 3;  2AR6 A;  5K0U B;  1ZBA 1;  2IVI B;  3O0X A;  4KL1 A;  5KC6 A;  4IV3 A;  4CPB D;  5FKB A;  3H42 B;  5FPB A;  1J1T A;  1RVF 3;  1HLC A;  4M3C A;  3ZDS A;  3AYE A;  3WQ0 A;  3VKO A;  5A3L A;  1KFX L;  4ATF A;  1S0D A;  4OUM A;  4UBG A;  1Y9M A;  3ORJ A;  1NOV A;  2WL1 A;  1X9T A;  2JJ6 A;  2O14 A;  4KNC A;  4Y4R A;  1D7P M;  2DTY A;  3B01 A;  2XJU A;  1JYV A;  3N7K A;  1D4V B;  2NMO A;  2FMY A;  2R06 2;  4PF5 A;  2WNO A;  4YWA A;  1B35 C;  4IV3 C;  1AL0 G;  1MZ5 A;  2DWR A;  5BV6 A;  3JD7 2;  5FO9 B;  1UYP A;  1DFQ A;  2Y6G A;  4RR3 B;  4ZZ8 A;  4XDO A;  5D1I A;  5LK5 A;  1C8M 2;  4P9J A;  1KQR A;  3NJX A;  4QPI B;  1AR7 1;  2W87 A;  1NXD 1;  3SCH A;  2IVJ A;  1C5H A;  5JPN B;  3AP6 A;  4JVA A;  4AED C;  5A6X A;  2DCJ A;  5J37 A;  4IET A;  2FDK A;  1DYP A;  4H7M A;  1V6K A;  3AMP A;  2XBO 2;  4UYB A;  3WHU A;  4PIY A;  1XE0 A;  1COV 3;  2D3S A;  4DOU A;  3MIF A;  1POV 3;  5F7U A;  1NX9 A;  5F5I A;  5JOY A;  2Q8E A;  4BQ4 A;  3H8O A;  2MEV 3;  4ISR A;  2J1S A;  4R4X A;  5JDB A;  3AKP A;  3ILN A;  3RWK X;  2C5D A;  4YZ3 A;  2UY9 A;  4UFH A;  4KGG A;  4IER A;  1HB1 A;  2B9V A;  2VOV A;  4QD2 A;  3DYO A;  4ZON A;  2ZZQ A;  3SXW A;  4BMB A;  2WNU C;  1PNG A;  4LOR A;  1WME A;  3VD7 A;  3HN3 A;  3Q8B A;  4WM8 A;  3K75 B;  5LWB A;  1IQD C;  4MHR A;  4ZPI A;  1OF3 A;  3V65 A;  2ZCW A;  4QQP A;  5A32 B;  1QIQ A;  1HXS 3;  1XSQ A;  3ZLI A;  3KT7 A;  4A4A A;  2PEL A;  2K9Z A;  3CDZ B;  4C1X A;  1UY4 A;  4HVO A;  1VBC 3;  1MS8 A;  4S2H A;  3WVJ A;  5M0T A;  4OHX A;  2WN3 A;  2YMZ A;  1Y4W A;  5HXM A;  2K0G A;  3VD5 A;  3I59 B;  1BBT 3;  3IKW A;  2JIJ A;  5GZF A;  1PZ9 A;  4B8E A;  3AJY A;  1FPN 1;  2VPV A;  1SCR A;  1NT0 A;  3K77 A;  4CUG A;  1TMF 1;  1ZRF A;  2HWD 1;  5BNO B;  3VDB A;  4PDW A;  5A3M A;  5I93 A;  4CDW A;  1H2L A;  1VBE 2;  4WVM B;  5FMD A;  3HBZ A;  3N9L A;  4Y22 A;  1YFW A;  1NQJ A;  3NV2 A;  4P9I A;  4IEX A;  1VBA 2;  3N9O A;  1JYC A;  1Q56 A;  4RFR B;  2X53 S;  2UU8 A;  1MEC 2;  2WNE A;  2WZ8 A;  1H9P A;  5JUV A;  4Y1Y A;  1OUX A;  1OHF A;  2YGM A;  4ATE A;  3AKT A;  3GHM A;  5C3R A;  5A80 A;  2HJI A;  4Q4Y 3;  2RG4 A;  3ACL A;  3MIE A;  4L9B A;  2JD9 A;  3T0A A;  2DU1 A;  2XKP A;  5C70 A;  1O7F A;  2GAL A;  5FYM A;  3NAP C;  2ZX3 A;  3KD4 A;  1ZBE 1;  4JV4 A;  4UAP A;  2WLP A;  1NLR A;  1ZRD A;  5K8S A;  2JEC A;  1QJX 1;  3A0K A;  1IS6 A;  4QHZ A;  4BLJ A;  1RUG 2;  3POG A;  5CFC B;  2EAA A;  1TMF 2;  3FMG A;  2J42 A;  5BUV A;  4E4D X;  2ZMK A;  3KV5 A;  4ZU5 A;  4Y1U A;  3ZYB A;  5CAD A;  4GJY A;  2PAE A;  1YI7 A;  1RUC 3;  3IPV B;  4QMA A;  1OOP A;  2WS9 3;  5LBF A;  3O1O A;  1C5I A;  1DGR N;  4W6X A;  4B4Q A;  1R09 3;  3VBO A;  5I91 A;  3JUU A;  5E88 A;  3APB A;  1HRV 1;  5GZD A;  2E7T A;  3POY A;  3CJI C;  3TNP B;  3I49 A;  1CAU A;  4KWL A;  4LBO A;  3MIC A;  4YM3 A;  5H9S A;  2OS2 A;  3H8X A;  2CYF A;  3MHZ A;  3AVR A;  5I8S A;  3BIE A;  2VZQ A;  2TEP A;  4YVS A;  5F6K A;  1GNZ A;  2WO2 A;  1FAT A;  4IEW A;  1SMV A;  2OQ6 A;  3LOI A;  3VBO C;  2YC0 A;  4A45 A;  5BNP B;  3LDK A;  2R07 2;  3I2H A;  4URT A;  1YUD A;  2AYH A;  4QM8 A;  2WZR 1;  1F4A A;  2LRP A;  1KS5 A;  2E7Q A;  2DCY A;  2WAO A;  4QU1 A;  2Y0I A;  4P9W A;  5FV3 A;  3NO8 A;  2PXJ A;  4RQP A;  2ZEZ A;  2CSG A;  3UL2 A;  2N7G A;  1H9W A;  2ZHN A;  4KBB A;  1DCS A;  2D3P A;  4J1X A;  1OVP A;  3K3N A;  3U1X A;  1CAW B;  1SLC A;  5C5U A;  3ATG A;  4DZG A;  2WFF 2;  3OBT A;  3WF0 A;  2VO5 A;  4XW3 A;  4PI0 A;  2BV4 A;  4DUV A;  1UOJ A;  1N1Y A;  5JR7 B;  4E2Q A;  1HRI 1;  5ANQ A;  4FPF A;  4CEW A;  3RWN A;  4AFM A;  1A8M A;  2CAU A;  4KU8 A;  5J09 A;  4NRP A;  4GH4 B;  1ZM1 A;  4L99 A;  3RMX A;  2GC1 A;  2XON A;  3OPW A;  3A22 A;  1UU4 A;  2DUQ A;  3WQ7 A;  1MQT A;  4MGY E;  2W1Q A;  2ZEY A;  4YW4 A;  5C4W C;  3NV3 A;  1ASJ 2;  3PTR B;  2CWS A;  1RHI 3;  1C57 A;  2VUL A;  4FQ4 A;  1CR7 A;  1ZYB A;  4GB3 3;  4M3C B;  4Q2F A;  3TN9 1;  3VKN A;  5C3P A;  4TYS A;  2VMC A;  1GYK A;  1G8W A;  1A3K A;  3K4A A;  5FYY A;  1AR8 2;  1LOC A;  5FZO B;  3UET A;  1RGS A;  3OEB A;  4PI2 A;  1RUJ 3;  5FY5 A;  3S57 A;  3WDW A;  3ACH A;  2AH2 A;  2BEO A;  1G7Y A;  4Y33 A;  3WQB A;  4H55 A;  1UMI A;  5FK7 A;  1DQ5 A;  4Q4X 3;  4XBL A;  3S7E A;  3WF1 A;  1D4M 3;  1UL9 A;  3ZXF A;  4P00 B;  3N9M A;  4FO9 A;  4ERO A;  5AFB A;  4MGQ A;  2VD7 A;  4SLI A;  2ZTN A;  1D0H A;  2BWC A;  4YM2 A;  5A7S A;  3MPP G;  2HWF 2;  2JDU A;  1AYM 1;  2ZGP A;  3RI8 A;  3N7L A;  3ES4 A;  2IXI A;  3T2P A;  1HDK A;  4TN7 A;  4XBQ A;  3O14 A;  3THP A;  2PHR A;  3J7H A;  1OT5 A;  3POW A;  2VCB A;  4QPG C;  3ZXD A;  3TN9 2;  3DYP A;  3VB9 A;  5AVP A;  1RIR A;  1F8V A;  2W68 A;  1FV3 A;  3FL7 A;  2O1Q A;  4IDZ A;  2XJQ A;  3UNP A;  5A7P A;  4HK9 A;  3I7D A;  1NQD A;  2A71 A;  1EY2 A;  1EPZ A;  4A7Y A;  3CLP A;  2BGP A;  2D93 A;  2XGX A;  4Q1P A;  4CU9 A;  2GMP A;  5IUQ A;  3N9Q A;  1IKP A;  2OPW A;  4BWO A;  2ZA9 A;  1BHG A;  2A6Z A;  2WA4 A;  4WM8 B;  4M0H A;  5F5A A;  3A21 A;  1YFY A;  2VAU A;  2BGC A;  4DY3 A;  2XH6 A;  4BHP A;  3H7J A;  2QE3 A;  5D8A A;  4NOT A;  1JW6 A;  1RXF A;  2GC3 A;  3HNB M;  4C0B A;  4EQV A;  4TLG A;  2VMD A;  1W2O A;  5J7M A;  1GWK A;  4JHZ A;  4W65 A;  1HXS 2;  1PZ8 A;  2MHF A;  1BK1 A;  2QQU A;  5JCT A;  1GU3 A;  1VBC 2;  2J1E A;  2ZKN A;  1H6X A;  3T09 A;  1ULD A;  2QQJ A;  1VBB 1;  4QGL A;  3VUO A;  1SPP A;  1AYN 2;  3EO6 A;  3B00 A;  3NL1 A;  2X5I B;  4Y22 B;  1AR9 1;  5E8A A;  3ZYP A;  4B1M A;  3RNS A;  2LRO A;  3VBF C;  1DG6 A;  3ZOI A;  5C9A A;  1PGL 2;  4BA6 A;  2BFU L;  2QQP A;  1FNY A;  1AXZ A;  1FAY A;  4EWE A;  2HWC 2;  3RJR A;  4GWJ A;  4S2F A;  4YGE A;  3ZVX A;  4QXB A;  2AGS A;  1OKQ A;  3ETQ A;  4K3U A;  4Q26 A;  1AR6 3;  5FZE A;  3ZFG A;  4JGZ A;  1SAC A;  3SH4 A;  2VH9 A;  2ET1 A;  1WBF A;  1PZ7 A;  2QKD A;  2K2S A;  4MHU A;  2W94 A;  3U0Z A;  3T2Q A;  3WCS A;  3KQR A;  1VRH 2;  1FX5 A;  4YW3 A;  1LU2 A;  1J3Q A;  4Y1Z A;  1W8Z A;  4Q4Y 2;  4WM7 C;  1NCR C;  3KGL A;  1A6C A;  2WQZ C;  1XE8 A;  4XUP A;  2QCS B;  5EYY A;  4XAE A;  4QQH A;  4JX0 A;  3PUH A;  1LED A;  2GP5 A;  1UOB A;  2D97 A;  2VNR A;  1LTE A;  1OOP B;  3DPR A;  2VZ1 A;  3AZY A;  2W1U A;  3H0O A;  2Z69 A;  3HD8 B;  1JOD A;  2P3I A;  2XHK A;  3EJK A;  2Q8D A;  4TSV A;  3UJQ A;  4MOA A;  1NY7 1;  4FOV A;  3MIG A;  1Z78 A;  1SFP A;  1HJF A;  2ZMN A;  5KHG A;  2D3R A;  1S0G A;  2OUJ A;  4TLF A;  4PBO A;  3ACI A;  2R6Q A;  1J58 A;  4Q4W 1;  4W6W A;  3VBS C;  5A6Q A;  3FZ3 A;  2RR1 3;  5JPM B;  4Y1X A;  3RGB A;  4DXS A;  4N7I A;  3HBK A;  2IXC A;  3K3O A;  4YG0 A;  2YB7 A;  3H3U A;  5F9T A;  2WN2 A;  1TME 2;  1TNR A;  3MV1 1;  4YVS B;  4IV1 A;  5FK8 A;  4HKW A;  1KEX A;  2VMG A;  4ZU4 A;  5FMO L;  1NCQ C;  1N3O A;  5LAS A;  2ZAH A;  4V2V A;  2Y26 A;  4QX3 A;  2RMU 3;  1FMD 1;  3VBH C;  1F35 A;  2HWE 2;  4IE7 A;  1OD3 A;  2VQA A;  5JSO A;  2NQY A;  4YW7 A;  4I01 A;  4DNY A;  1MAC A;  3WDY A;  3ELN A;  1ULF A;  2OX0 A;  2WO1 A;  4CDX A;  2WNV A;  1RUN A;  5ABJ A;  2HWB 3;  2QDN A;  1YLL A;  4UW6 A;  1UY2 A;  1L7R A;  3AXE A;  4CEY B;  5J3U A;  1AJO A;  2DCK A;  4E4S A;  3QLQ A;  5F3E A;  4P9L A;  1UZW A;  3SIS A;  1BMV 2;  2B42 B;  4AI9 A;  4BME A;  2WAA A;  3RVH A;  4CUC A;  2Z2S B;  3ZFE A;  1GWL A;  5FZ8 A;  2XJP A;  1WW6 A;  2I45 A;  2WNV C;  5AC9 3;  5ABJ C;  5IK5 A;  3OUJ A;  4XQ4 A;  1XU2 A;  1TZO A;  4DXR A;  1QOT A;  1XNA A;  3D0J A;  3EMR A;  4LBL A;  5IVC A;  4LNV A;  4UBH A;  5CKM A;  2FZ2 A;  4XDQ A;  3T0D A;  1ZA7 A;  4XAC A;  5FZK A;  2ES3 A;  1FMD 2;  1E5S A;  4P08 A;  3MW2 A;  2JDP A;  2BTV C;  4Q0U A;  5T5J A;  4XET A;  2WYF A;  2WUH A;  5K4L A;  3ZFE C;  1OUS A;  4Q27 A;  3U37 A;  1RHI 2;  4WZF A;  5FWE A;  4AGG A;  4QX1 A;  4CCL A;  4FTS A;  4LKD A;  3D5O A;  4HVQ A;  1O5L A;  5G05 L;  1RMU 1;  3IM0 A;  2XXZ A;  4AVS A;  3MDP A;  3MI8 A;  4BYY A;  1RUJ 2;  3DEC A;  3M3Q A;  2O8Q A;  3BTZ A;  4LA3 A;  3AJZ A;  1F5J A;  4JTO A;  3TB0 A;  1RUD 1;  4BB3 A; 
#chains in the Genus database with same CATH homology
 4AG4 A;  4XZU G;  2C26 A;  3WNP A;  1EUT A;  3I2I A;  4UI9 L;  3P6B A;  2CDP A;  2BZD A;  2W1W A;  5HPO A;  2WQ8 A;  3JXS A;  3W5M A;  3IAQ A;  4QX2 A;  2W95 A;  2VMF A;  1PMH X;  3SKJ E;  2W5F A;  2C4X A;  1ULP A;  2JKX A;  3THC A;  4DUX A;  1TG7 A;  5DPN A;  3I3E A;  3CQO A;  3WF4 A;  1CIY A;  3EB7 A;  4CU8 A;  2EIE A;  1XPW A;  5G04 L;  1WKY A;  4TTG A;  1NUK A;  3HJR A;  1SHW B;  4KI5 M;  4DEQ A;  2J1R A;  2CDO A;  4YPJ A;  3A23 A;  4ET7 A;  1PX3 A;  4LPL A;  1K42 A;  1JHJ A;  3CMG A;  3I3D A;  2VZO A;  5JXJ A;  3HNY M;  5JMO A;  2WYS A;  5LCW L;  5IJR A;  1GQP A;  4E8D A;  2BER A;  1LNS A;  1JZ5 A;  1JU3 A;  1PX4 A;  2X09 A;  4BJ0 A;  1CX1 A;  2Y8K A;  2QQO A;  3VD9 A;  4A41 A;  1L7Q A;  2X05 A;  5A1A A;  4MAD A;  1OF4 A;  2VZT A;  1JZ8 A;  4QDS A;  5C7G A;  1I5P A;  2W92 A;  1CZS A;  3WNK A;  2HLE A;  2W46 A;  2XHN A;  2VL4 A;  3HNM A;  3ABZ A;  3IAP A;  4XUO A;  3MUY 1;  1ULO A;  2VQT A;  4TXW A;  4XUR A;  4BDV B;  1T2X A;  5IHR A;  2ORX A;  4QB6 A;  3BGA A;  4D8M A;  1JYX A;  5JXG A;  1D7P M;  1JYV A;  1PMJ X;  3VDC A;  1UY0 A;  4GWI A;  4JKM A;  2Y6G A;  1RYY A;  1US3 A;  1US2 A;  2VZS A;  4ZZ8 A;  1UZ0 A;  3NJX A;  2W87 A;  3WNN A;  5LA0 A;  2DCJ A;  4DXT A;  2J22 A;  3T08 A;  3CIH A;  3HOB A;  1NX9 A;  5F7U A;  5FUI A;  2Y64 A;  1GOH A;  2J1S A;  1O59 A;  2ZXQ A;  1JZ4 A;  2E31 A;  2XQX A;  2B9V A;  4BXS V;  3DYO A;  3I3B A;  2Y6K A;  2OKX A;  2W91 A;  3VD7 A;  3HN3 A;  3T0B A;  3K75 B;  3A7Q A;  1IQD C;  3ECQ A;  4ARY A;  1OF3 A;  3WF3 A;  4LQR A;  4P5Y A;  4A4A A;  3CDZ B;  1UY4 A;  3IDA A;  4QDQ A;  3UES A;  1F4H A;  1UYX A;  2VZV A;  2WN3 A;  3OG2 A;  4OMC A;  5HXM A;  3VD5 A;  3NQH A;  3K77 A;  1J83 A;  4OYU A;  1XC6 A;  3VDB A;  4QB1 A;  3ACF A;  4W50 A;  2J1A A;  2VC9 A;  3WF2 A;  1JZ6 A;  4CVU A;  2B4K A;  4JKL A;  5LA2 A;  5LA1 A;  5JXI A;  2QBX A;  1GOG A;  2WZ8 A;  4P02 B;  1JI6 A;  1GMM A;  2VOT A;  2ZEX A;  5JUV A;  1W0N A;  4RYD A;  4AAX A;  3AC0 A;  2C9K A;  2JD9 A;  3FN9 A;  3T0A A;  1W8O A;  4OZO A;  3W5N A;  5C70 A;  1WCQ A;  1K3I A;  4UAP A;  4ZZ5 A;  3CZJ A;  4W4Z A;  4CUB A;  2V4V A;  2Y6H A;  3OGV A;  1OH4 A;  4KMQ A;  1J84 A;  5JR2 A;  2YFU A;  3ACG A;  2WAB A;  3OB8 A;  3LE0 A;  3OBA A;  3P1I A;  2W47 A;  2WO3 A;  2KD7 A;  3D3A A;  3ETP A;  3MBW A;  3EYP A;  2QQK A;  3C7O A;  3NJV A;  3C7E A;  3GDB A;  5B4X A;  2VZQ A;  1UY3 A;  1TVG A;  2WO2 A;  3III A;  1CZV A;  3FHQ A;  5IYY A;  3PUI A;  4A45 A;  4QB2 A;  2V5D A;  1K12 A;  1JYN A;  3T2O A;  3I2H A;  5CYY A;  2VCA A;  2Y6J A;  3NRU A;  1F4A A;  4CU7 A;  2WAO A;  2VM9 A;  2PQS A;  1YQ2 A;  2ZEZ A;  1UXZ A;  3C7G A;  2YG0 A;  3WNM A;  1W9T A;  2QQL A;  2XOM A;  1W9S A;  5JXH A;  3WF0 A;  2VO5 A;  3MO4 A;  2QQI A;  4DUV A;  3K4Z A;  2QQM A;  2RJ2 A;  1P8J A;  4QPW A;  2EID A;  4QDR A;  4GZ9 A;  4XVH A;  2XON A;  3A22 A;  3OEA A;  2W1Q A;  2ZEY A;  3I97 A;  2W1S A;  3LEG A;  4E8C A;  1UMH A;  2VMC A;  4PQQ A;  5C71 A;  2J1T A;  3K4A A;  3LQC A;  2LW8 A;  4A44 A;  3UET A;  4CU6 A;  1JZ7 A;  3OEB A;  5DQ0 A;  3LEK A;  4M4R A;  1SG3 A;  3ACH A;  4L0P A;  3WQB A;  3DYM A;  1O8P A;  1UMI A;  4FI9 A;  3F2Z A;  3WF1 A;  1NAE A;  4DUW A;  2HYX A;  4P00 B;  1K45 A;  2JE8 A;  1HN1 A;  2V72 A;  4MGQ A;  3MV0 1;  1UWW A;  3HPN A;  4LHS A;  3T2P A;  2VQU A;  5CZK A;  3MUZ 1;  3THD A;  4W8J A;  5EJZ B;  3J7H A;  1OT5 A;  2VCB A;  2VJX A;  3DYP A;  3FL7 A;  3UNP A;  4QX0 A;  2VCC A;  5EIY B;  4RN5 A;  4IUG A;  2BGP A;  4CU9 A;  4HG6 B;  1W99 A;  1CZT A;  1UX7 A;  1JU4 A;  1BHG A;  2J1V A;  4XUT A;  2WDB A;  2YC4 A;  3A21 A;  1JZ3 A;  4PT6 A;  1GUI A;  5I0D A;  1DYO A;  2EIB A;  3IB3 A;  3K46 A;  1GOF A;  2VZR A;  3HNB M;  3I2G A;  1UXX X;  2VMD A;  4BK4 A;  4D0Q A;  4Z2A A;  1UY1 A;  4JHZ A;  4XUN A;  1GU3 A;  2J1E A;  1H6X A;  3T09 A;  2QQJ A;  4QAW A;  2YFZ A;  3WNO A;  4DEV A;  3SKV A;  3I2J A;  1H6Y A;  2QQN A;  3VDA A;  1SDD B;  1UYY A;  3BN6 A;  3WNL A;  4GWJ A;  3GXU A;  2Z4F A;  3CZU A;  4OUE A;  4BK5 A;  3WEZ A;  4MGS A;  4A42 A;  2ID4 A;  2VR4 A;  3FHA A;  2VZP A;  3HEI A;  2W94 A;  2VZ3 A;  3T2Q A;  2DDU A;  5J1X A;  2LS6 A;  2RVA A;  4ARX A;  3C8X A;  1UYZ A;  1JYW A;  1DLC A;  4XUP A;  4M4P A;  5DMY A;  4JX0 A;  3PUH A;  3K4D A;  3OGR A;  2VZ1 A;  2W1U A;  4KWU A;  3VD3 A;  3GGL A;  2Y6L A;  4MOA A;  2X10 A;  1DP0 A;  4PF1 A;  2RV9 A;  2L9L A;  3ACI A;  1JZ2 A;  5EJ1 B;  3GM8 A;  4DXS A;  3OGS A;  2YB7 A;  5B4N A;  2W3J A;  1MPX A;  2WN2 A;  3MV1 1;  1KEX A;  2WZE A;  3I2K A;  3SEP A;  2J1U A;  1EUU A;  2YC2 A;  3CKH A;  1W8N A;  4QX3 A;  2ORZ A;  1OD3 A;  2W9X A;  2WO1 A;  3SEE A;  1UY2 A;  2E26 A;  1L7R A;  4CUA A;  2VME A;  2ZEW A;  2DCK A;  3C7F A;  1XNT A;  3WSO A;  1R64 A;  4LKS A;  3LEI A;  2BBA A;  2WAA A;  4CUC A;  4XUQ A;  5IFT A;  3VD4 A;  2E32 A;  2BGO A;  4ZY9 A;  1NKG A;  2J7M A;  4UOJ A;  4DXR A;  1XNA A;  1GNY A;  1W9W A;  5IFP A;  3I2F A;  2VZU A;  3C7H A;  3T0D A;  2WBK A;  2JDA A;  5DN2 A;  2VTF A;  4P08 A;  1O8S A;  3E1F 1;  2EIC A;  2WUH A;  3NNG A;  3LPF A;  4A6O A;  3U37 A;  3LPG A;  4OMD A;  2R7E B;  3ZM8 A;  4QX1 A;  2E33 A;  5G05 L;  1KGY A;  4ZXE A;  4MO3 M;  3DEC A;  4A3Z A;  4JKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...