2Y64A

Xylopentaose binding mutated (x-2 l110f) cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
167
structure length
167
Chain Sequence
MLVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSFDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
molecule keywords XYLANASE
total genus 41
structure length 167
sequence length 167
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y64A00
4FI9A 4YPJA 4ARYA 2WZ8A 3UETA 3OEBA 1UXZA 2YFZA 2VZOA 4ZXEA 1O8SA 5A1AA 3MV11 2VZTA 2WUHA 3CMGA 2VQUA 4LKSA 1XC6A 2QQKA 4AAXA 4MOAA 1YQ2A 3C7OA 3E1F1 3A21A 1UYXA 1CZSA 1GMMA 1PMJX 2ORZA 1O59A 1K45A 1K3IA 1OF3A 1ULPA 3P1IA 3LEKA 4PF1A 5IJRA 5F7UA 3ETPA 4CUCA 4DXRA 4Z2AA 2Y6GA 2X05A 3K4AA 4TTGA 3C7EA 1JU4A 1KEXA 4BXSV 2VZPA 3T2OA 2DCKA 3VDAA 1DYOA 2E33A 3WF2A 1JZ3A 1NX9A 4XUQA 4OMCA 1H6XA 2W94A 5FUIA 4OYUA 2B9VA 1DP0A 2W46A 3IB3A 3I3DA 2JE8A 1IQDC 2J1RA 3WF3A 2W1WA 4DUXA 1NAEA 2BGPA 4QB1A 4KWUA 3IIIA 3NNGA 3DYOA 1K12A 1JYWA 3PUIA 3WNPA 1XPWA 5IYYA 3WF0A 3VD9A 4MGQA 3I2JA 1UZ0A 2YFUA 3UNPA 1BHGA 5EJZB 1NUKA 2Y64A 3MBWA 1HN1A 2ZEWA 3BGAA 1PX4A 4CU9A 1J84A 3OGVA 3CKHA 3T08A 2VTFA 3VD3A 2VMFA 5HXMA 3P6BA 3GDBA 3OGSA 5B4NA 4DXTA 3I2IA 3WNKA 2ZEZA 2HYXA 3CIHA 1OH4A 1F4AA 3WNMA 1CX1A 3THCA 3VDCA 2V4VA 4GWJA 4P08A 3K77A 3SEPA 2QQMA 2WO3A 1OF4A 1W9WA 1LNSA 4E8DA 3IDAA 4IUGA 1JZ8A 4W4ZA 3FL7A 4L0PA 2L9LA 5EJ1B 2YC2A 1J83A 2RJ2A 3DYPA 3LE0A 2J1VA 4BDVB 2VC9A 2Y6LA 1GOGA 2J1TA 4ZZ5A 4RN5A 1WCQA 1OD3A 4QDSA 5IFPA 3F2ZA 1W8OA 4DXSA 5LA1A 1UMHA 1UY1A 1JI6A 3K46A 2JD9A 4DUVA 2E31A 4CVUA 2E32A 3GXUA 3K4ZA 1JZ5A 4MGSA 2B4KA 1I5PA 4A44A 3I2KA 3C7HA 4P5YA 5JXIA 3NJVA 2J1SA 4D8MA 2WABA 3LQCA 2VMDA 5EIYB 3A23A 5DQ0A 4XUNA 3I2FA 2VZUA 2V5DA 3IAQA 3BN6A 3I2GA 4JX0A 2HLEA 5J1XA 5DPNA 2ZXQA 3HJRA 1JHJA 2QQLA 3DYMA 5G04L 5LA0A 3MUZ1 2WBKA 2J7MA 5HPOA 5JMOA 2JKXA 4ZY9A 2BGOA 4M4PA 2C4XA 1UYZA 2YG0A 4XUPA 2VZ3A 3JXSA 4A45A 2JDAA 1L7RA 2VZ1A 2QQIA 3CZJA 4PQQA 4JKKA 1CZTA 3U37A 4KI5M 3THDA 2BZDA 3LPGA 4LPLA 1PX3A 3MV01 2W47A 4CU7A 2CDPA 2VQTA 3NJXA 3EB7A 3HOBA 1TVGA 5C7GA 2W3JA 4M4RA 2J1UA 2WAAA 5IFTA 3HEIA 5JUVA 2BERA 1US3A 2Y6JA 2BBAA 4RYDA 3VDBA 1UY4A 1JYNA 2WYSA 1MPXA 3T2PA 1UXXX 1XNTA 2W9XA 2X10A 3J7HA 5JR2A 2WDBA 4QX1A 4UAPA 4ZZ8A 4CUAA 1W9TA 2EICA 2XONA 4A41A 3WF1A 4DEQA 3NQHA 3HNBM 4OMDA 3SKJE 2ZEYA 3WNLA 5LA2A 4TXWA 4JHZA 1UY3A 4E8CA 2PQSA 2QQOA 3ECQA 5CZKA 4XVHA 2X09A 2LW8A 3W5NA 2ID4A 1JYXA 2Z4FA 2YC4A 1US2A 2W92A 1JZ7A 3HNYM 3OBAA 2VZVA 3A7QA 3WQBA 3HN3A 4PT6A 3MUY1 5B4XA 2VZSA 1SG3A 2W5FA 1UYYA 2VCBA 1JYVA 4JKLA 1GQPA 4DEVA 1SHWB 3ZM8A 2DCJA 2W1QA 3T0AA 3LPFA 2WN3A 1DLCA 4MADA 2W95A 4GWIA 2DDUA 1R64A 3AC0A 3CDZB 2Y8KA 4GZ9A 2EIEA 4QX3A 4KMQA 1GNYA 2CDOA 2RVAA 1UY2A 4W50A 5JXJA 2XQXA 4DUWA 3C7GA 3DECA 2QBXA 3OG2A 3EYPA 1SDDB 1JU3A 1P8JA 3K75B 4QDRA 4JKMA 3SEEA 2VO5A 4MO3M 5DMYA 2WN2A 1W99A 2VZQA 5G05L 1OT5A 5C71A 1JZ2A 3C7FA 3HPNA 4ARXA 4QB6A 4BK5A 2VOTA 3WEZA 2VL4A 1TG7A 4A3ZA 1EUTA 2VMCA 3MO4A 2Y6KA 2W87A 3WSOA 4BK4A 2Y6HA 3OGRA 2WZEA 4HG6B 4AG4A 3ABZA 4LQRA 3WNNA 2QQNA 5JXGA 2VM9A 3LEIA 3VD7A 2OKXA 3ACIA 1GUIA 2VCCA 2J22A 3GM8A 3T0BA 1PMHX 3WF4A 2V72A 1ULOA 4QDQA 5I0DA 2VMEA 2VZRA 4P02B 1GU3A 3CQOA 4UOJA 3T09A 3A22A 2WO1A 2WAOA 3K4DA 4LHSA 2XOMA 2J1EA 1XNAA 2VJXA 4CU6A 1CIYA 2C9KA 5DN2A 2J1AA 3I3BA 4QB2A 1UMIA 3ACGA 4A4AA 2WO2A 4P00B 1K42A 1UWWA 3I97A 3NRUA 1NKGA 2ZEXA 4CUBA 3D3AA 2EIDA 4XUOA 3FHQA 4QAWA 3ACHA 3ACFA 2QQJA 1W8NA 3W5MA 4W8JA 1O8PA 2E26A 3FHAA 3UESA 1JZ6A 3OB8A 4ET7A 1RYYA 3GGLA 4QPWA 2ORXA 4XZUG 5C70A 2LS6A 5JXHA 2WQ8A 1H6YA 2W1UA 4QX0A 1UY0A 4OUEA 4UI9L 3T0DA 2W91A 1L7QA 2EIBA 1GOFA 1KGYA 2W1SA 3WNOA 4A42A 5CYYA 2R7EB 1WKYA 2RV9A 4QX2A 4XURA 3FN9A 2C26A 3PUHA 3I2HA 5IHRA 2VR4A 2KD7A 3I3EA 1GOHA 3T2QA 4BJ0A 1UX7A 4OZOA 3VD5A 5LCWL 3C8XA 1T2XA 3IAPA 4A6OA 1EUUA 3SKVA 3LEGA 1W9SA 1W0NA 3OEAA 3HNMA 2VCAA 3VD4A 1F4HA 3CZUA 1CZVA 1JZ4A 2XHNA 2YB7A 1D7PM 4CU8A 4D0QA 4XUTA
chains in the Genus database with same CATH superfamily
4ARYA 1W3VA 2YGLA 2WZ8A 2UY8A 3MPPG 2BP6A 4KG0A 2DVBA 1U0AA 2Q1MA 1QXJA 2YFZA 4MGKE 2DURA 2XB6C 1LU1A 1WUVA 3ZPOA 5A1AA 1F8VA 3PL0A 1ZRDA 4KU8A 4IE4A 4RS5A 2DUQA 2QQKA 2DV9A 1WBLA 1YQ2A 2XJSA 2YBKA 4Q1PA 4COZA 2HWF2 2ZZJA 3RG0A 2OUHA 3E1F1 2D6KA 3A21A 1CZSA 3QOPA 2HBTA 5A3TA 3H50A 2PLV2 3ETPA 4CUCA 5C9AB 3ZFEA 1QDCA 2WT2A 4N7UA 4OULA 3BPZA 5F3EA 1XU2A 3M3IA 4GXLA 1CAUB 4BOWA 3VZJA 1AUYA 1LESA 3C7EA 1UOBA 3FLPA 4Y22A 1H1IA 4GD4A 4Q0UA 5LY2A 5GLZA 2VNVA 3VGIA 2DWRA 3QCWA 1VBC2 1OSGA 4K7JA 3VDAA 1G6NA 4R9CA 1GFF2 4CP1A 5CISA 1NX9A 1BBT3 2R30A 4XUQA 4UW6A 4IEOA 1H6XA 1FX5A 4QXKA 2W94A 2JB8A 4XJUA 4XQDA 4XXPA 5L73A 3ZKYA 2IFRA 2B9VA 1DP0A 3IB3A 1UMZA 2FMYA 1QJU1 2JE8A 2YDEA 3WF3A 2X8KA 4LHLA 2JD4A 2FCVA 2BGPA 4LBNA 4NHXA 4XE9A 2NP0A 4QB1A 2IVIB 4DY3A 1HV0A 4BM8A 2WNUB 5KC6A 5F5AA 2PMWB 1JYWA 3WNPA 2WLQA 5IYYA 4JTNA 4UW5A 1LHNA 1B35C 1HW5A 1YFYA 4YW4A 3I2JA 5T5JA 1OBNA 5FYSA 1QQP3 4WVMB 5FZEA 3MIFA 1BHGA 1UU6A 1KQRA 4HVOA 3ZFFC 5T52A 5F8PA 3ZN4A 3B9IA 4CPBD 1AR83 1HN1A 3BGAA 1W04A 1PX4A 2PA7A 2R043 2WIIB 4QT6A 1YJLA 3T08A 1TMF1 1DU3D 1FNZA 1J58A 1PIV1 3P6BA 2Q8OA 1VBC3 2V09A 4G3YC 3POFA 4DXTA 4PDWC 3E97A 3WY6A 1OLRA 1E57A 3B3QE 1O5UA 3NV3A 3IBMA 1ND2C 1OH4A 3AKSA 3FX3A 5EYYA 5AC92 2ERFA 1AR81 1FNYA 1RJ7A 5CVRA 2V4VA 4YGDA 4WVVA 5BNOB 2XUEA 5C8CB 1ULGA 1LOFC 4XBNA 4AI9A 2NN8A 2CY6A 3POIA 5A6XA 2ZGMA 3T1MA 3B01A 3INAA 4QGNA 3DPRA 2FDGA 5BPXA 5JSPA 4Q0VA 2BGCA 1QIQA 1LNSA 1ND3C 2RJKA 4LOSA 5SV5A 3IDAA 2WA4A 3N4MA 1W06A 1W6OA 3WP3A 1JTZX 2ZBJA 5IVJA 1OMIA 3A4UA 4S2FA 1JZ8A 2AUYA 3DPRB 3DUIA 5D1IA 3U4XA 3FL7A 1DIWA 5A1FA 2FDHA 4L0PA 1UAIA 4OI2A 2ZPXA 5EJ1B 5BV6A 5FFOC 4YVWB 1Q8OA 2G9GA 3WLUA 4AFMA 1MS8A 1PM7A 1QDOA 2JWPA 2RS31 2VC9A 1MVEA 1JOJA 2IXKA 2Y6LA 3RPQA 2J1TA 3N9MA 5KHGA 1OQDA 4ISRA 3RRDA 1ONAA 3BTAA 5A3PA 1OD3A 1PGW1 4D7SA 4LBQB 5F6KA 5HI0A 2CL2A 4Y1ZA 4A6SA 1URXA 3F2ZA 1AR63 1EAH3 3DEMA 1W8OA 3HVDA 5F37A 1VRH1 2BTVC 1AYM1 1QJY2 4LA3A 4LIVA 1TNFA 1S1AA 4EYUA 3WCSA 1JI6A 1NA1C 4FPOB 4GJZA 5EP9A 1REEA 4DUVA 1VBB2 5AC93 3A0NA 4CVUA 1SCRA 3K3NA 3K4ZA 1GR3A 4N90A 1JZ5A 5ACA1 2ENRA 2A6XA 4LO4B 4A44A 5EPAA 2I07B 4GIQA 1ZRRA 2AYHA 2O14A 4IEPA 4M0NA 1C5IA 5FWEA 3I2KA 5LBBA 5L9BA 1SZBA 5LK5A 5I93A 2BVVA 3VBOB 1AX1A 1UU4A 4IEUA 3NJVA 4AXOA 2J1SA 5FLJA 3JQXA 5CFDA 2R041 3SLIA 2XMLA 5IVYA 2E6VA 3AYDA 4QM8A 3AKTA 3VBUC 4F7ZA 2V5DA 1L7LA 3FUOA 1UW8A 4IEZA 2GNDA 3J26N 3WINE 4HK8A 2ZXQA 3N35A 4Y24A 1VBD1 4A3XA 5FQ0B 5CIRA 1ZBA3 3FJSA 4DINB 4QGLA 2WBKA 2J7MA 2XL7A 3VHPA 5JMOA 4MSVA 2VTXA 4SLIA 4ATFA 4CCLA 1ZREA 4M4PA 2PLV3 3KS7A 3OYWB 3AZWA 3RZMA 1UYZA 4QPGB 2WNVB 4HMZA 5IW0A 4B7KA 2P3JA 2X5IA 4GAZA 4YVSB 2V5YA 1Z0HA 1PGL1 1HIXA 5I91A 5D8AA 1APNA 4EN0A 1D4M3 1QQP1 1RC6A 2PHUA 2QQIA 1W6OB 1Y3TA 4Q4X2 2YROA 2JICA 5L19A 2VG9A 4ZXKA 1JYCA 1CZTA 1RJ8A 2OIIA 5L9RA 3V56A 2X53S 1LHOA 2VH9A 4YW2A 3PHMA 4RHV2 2RG4A 3E6CC 4I30A 4FFHA 4PLMA 1W8UA 3MV01 1NOVA 2ZGSA 4FPHA 4D6QA 3VZLA 4CU7A 4EN6B 1DGWA 5GALA 3IMMA 1VMJA 3BB6A 1V9U1 3KF5A 3M8LA 1QJX3 1YYNA 3VBSC 4I02A 5HXVA 3WX5A 1FAYA 2ZGUA 3NKGA 3QLQA 3VDDB 3GF6A 4YLZA 2J1UA 5ACA2 1RMU3 1TNRA 1WWYA 3RMYA 2P6CA 5F3CA 2DVDA 2HKXA 2Z2SB 3NV1A 5FO8B 4P5HA 2Y6JA 1RUF3 4OUSA 4RYDA 4JRAA 3T2PA 3D4KA 5JIUA 1YCIA 3ASIA 2JDYA 1CWPA 2X10A 3AP5A 3J7HA 2LROA 3NVCA 3PJQA 4WM7C 4Q4V3 1ENXA 2WDBA 2EXHA 3VBHB 2PXJA 3QH7A 1R091 1G9BA 2JX9A 1QEXA 1WW5A 4A7YA 1RGSA 1UZVA 3EBRA 4CUAA 2XONA 4LO7A 4A41A 2C1FA 1H8VA 3WF1A 2E7AA 2XJRA 2D40A 2ZKLA 2JG8B 5FO9B 3POEA 1N3PA 1OLQA 2XXZA 1HV1A 2MNGA 3X29B 2BV4A 3K3OA 3UJQA 5GZCA 1D0HA 1PO12 1V0AA 1GQHA 1AX2A 4P9GA 4FPEA 1HXS1 3MI8A 1IG3A 1UY3A 5FPVA 4GMP1 1HRI2 3S30A 5M0TA 4IV3C 3WQ1A 3ECQA 3S7EA 2KA3A 2X09A 2LW8A 5T55A 1C1FA 5F39A 5FZHA 5IVFA 4NIIA 3MF9A 4EROA 1M4WA 4BE3A 1JUIA 2W92A 1IS5A 4YM2A 3RWKX 1RUE3 1JZ7A 3NAPA 3CO2A 4K40A 4M01A 2Q4SA 2R042 4AW7A 3WQBA 4L9BA 2IXCA 3HBZA 3IMNA 2WC2A 1AF9A 3I59A 4WM7A 1W2TA 3TBDA 3ZXDA 5B4XA 1D4M1 3VDDA 5K7PA 2VZSA 2BDRA 4LO8A 1SG3A 1YIFA 4UWDA 3IT8A 4C91A 4E4SA 1S2KA 4XF9A 1UYYA 4GMP0 4KU7A 1J3QA 2ZHNA 3HIFA 3OSDA 1ZYBA 4J25A 4NRQA 1QWRA 1RUI1 4Q29A 2EVXA 1GQPA 2JJ6A 1JMUB 1SHWB 3ZM8A 2HWD3 1ND3B 2DCJA 5FY1A 3NW4A 5K9YA 3LA7A 1LB2A 2GC3A 1KS4A 1GZWB 2ZGQA 1EAH2 5AVPA 4PJYA 1AR62 1NLSA 4XFBA 3AVRA 4B3NA 2UY9A 2RHPA 3JD72 2A6WA 5A1LA 3CF6E 1CD3G 5K0UA 3CDZB 1GBGA 2XH6A 4Q5OA 3S5QA 3ZKUA 4ASLA 3KHCA 2EIEA 1POV3 1FPN3 1S4CA 2XHKA 2Z69A 5C9AC 5CFCB 3WG2A 1VAVA 2XQXA 3C7GA 1V6IA 4LA2A 3WDUA 4QXHA 1XNBA 3GJAA 1RUC1 4JC1A 3EYPA 3PDQA 4CCDA 5BY5A 1SDDB 3IWZA 1K5JA 2VOKA 1P8JA 1W2UA 3K75B 2MEV2 4K9SA 1Z7S1 4OHXA 1NCRA 2D3PA 5JI7A 3SEEA 4KNCA 3ME2A 1H9PA 2DUOA 3VUOA 2RDNA 3OD0A 2DBNA 5JAXA 1W99A 1O3SA 1YFUA 2AREA 3MW2A 1LU2A 3JBG3 1JZ2A 3BUCA 3HPNA 1SLTA 2FMDA 4NVPA 1RUH1 1BYHA 4QB6A 2VE1A 4IGQA 4W6WA 4XXAA 4KG8A 1ULFA 3EO6A 1YUDA 2E51A 3E6BA 5C8CA 1BMV2 3C2UA 2R063 4D94A 1RMU1 2GH8A 2W87A 1GNHA 4PI0A 4BK4A 2VOWA 4HG6B 4JDMA 4TN7A 3AL5A 4LULA 4AFBA 4LQRA 4BXFA 2QQNA 4KWKA 3LEIA 4CXYA 3H8RA 3NKTA 1OVSA 1PZ9A 4LITA 5F5IA 3DCQA 4K8FA 1X9TA 4CXWA 4H7MA 2G1MA 4DNYA 2J22A 1LKNA 1RUE1 4HT1T 2H6CA 2V72A 1RL3A 4CEYB 5AVAA 5A32A 3H8UA 2NMOA 4E9KA 4MGZE 1KDMA 1RUG2 2VMEA 2ZJCA 4P02B 3WHUA 2O1QA 5T50A 4P9IA 3H9AA 5FK8A 4QPGC 1FT9A 5DAWA 5A80A 4DB5A 4FAGA 5DDJ2 2J1EA 1ZBA2 3LDRA 1F15A 2RS53 2RR13 1CIYA 3ZSLA 4DOUA 4F3JA 1HDKA 3O1OA 1A8MA 4M3CB 1RUC2 1H8TA 3TN93 1QY4A 1UMIA 3HQUA 3ILFA 4N9IA 1JW6A 5CB7A 1UWWA 1ZNPA 3I97A 1AYN3 3GBWA 3VL8A 4OQ8A 4LIUA 1KJLA 4X6QB 5AFBA 4CEWB 5I0UA 4D6SA 4DS0A 1BJQA 1D4M2 2PHWA 1GKBA 2Y33A 1QHDA 3PJYA 3I3MA 3LWCA 4QAWA 1TME2 4WZCA 3ACFA 2DU0A 1W8NA 1SDWA 3FBYA 5A7QA 5JIAA 1RINA 1HJGA 1NA1B 3KD4A 3O1MA 3FFZA 2ZGRA 5KR7A 3B94A 2BW8A 1BXHA 2CWMA 1IOAA 4RS5C 3VKMA 5IK7A 1CAXA 1GWLA 2Y26A 2QZ2A 3OB8A 4AFCA 4ET7A 3GGLA 4QPWA 2ORXA 2ET7A 4COUA 1RVF3 5LB6A 4MH0E 4K20A 4AFDA 2I45A 2NLRA 1VMHA 4CP9B 1QF3A 3ETQA 4AI8A 3FWEA 2W1UA 1RUF2 3AFGA 1UY0A 4FPJA 4O7XA 3VHNA 2PYTA 4UI9L 4BIOA 3T0DA 5F6LB 3B69A 5IVEA 2EIBA 1SEFA 4NRMA 2DYCA 2CSGA 3WNOA 4A42A 1JN2P 3CJIA 3HR9A 1HRI1 2R7EB 3OYWA 4KL1A 2RV9A 1NLRA 2SLIA 3FN9A 2PAEA 4FOVA 3VZKA 3WP4A 3L2HA 1NYWA 1NQJA 4FVVA 1XYPA 2RMU2 2VR4A 2Q30A 4QQHA 4BQXA 5KHJA 5FYBA 3T2QA 3S5AA 1FOD3 5KXBA 1CAVB 1UX7A 5DDJ1 4CCNA 2UYBA 2QJVA 4Y1VA 1R1A2 1ENQA 1V00A 4HANA 2Q8DA 1T2XA 1UIKA 1WCKA 2WNVC 4IV3B 4N43B 1GICA 2C6SA 4A6OA 5I8YA 1EUUA 4YW1A 5A7OA 2VOVA 3LEGA 3SKVA 1QH6A 4HKOA 2VMHA 4ZU7A 2XBO2 1A34A 3HNMA 3H7YA 2X5IB 2QQPA 1F4HA 2R6QA 3BU0A 1W6PB 1YQ8A 3MIEA 2WO7A 1W8TA 2YB7A 2VW0A 2ZTNA 3I4IA 4LLOA 1PO23 1I6XA 4D0QA 3PIGA 4FI9A 5ABJB 2VNRA 4YVSC 1ZZCA 3OEBA 1UXZA 4MHUA 1ZM1A 2BNNA 2HWC2 3AX4A 2QCSB 2VZOA 4XFAA 2K0GA 2DVFA 4Q4Y2 2JDKA 2VZTA 2YPDA 5FYYA 3GZTB 1KRIA 4CEWA 2WUHA 4JZRA 4J1WA 1HJFA 3NNMA 2RDQA 2VQUA 1ZRIA 4LO6B 3ZFEB 5DAQA 4AAXA 2WZR2 2AEYA 2B7YA 4AZZA 2BWCA 3H1YA 2WR9A 1UYXA 2E63A 1RIRA 1XE0A 1CAUA 1PMJX 1MVQA 1QJEA 2YU1A 3MYXA 5IJRA 4D7TA 5T5LA 1IG0A 3WZ1A 1IQAA 1RUF1 1OOPA 3GBFA 4HN1A 4IGOA 5FYCA 5FMDA 2A5ZA 5FPXA 4DXRA 4Z2AA 4IEYA 2HWB1 1BVVA 2GC1A 1OUXA 4Y5SA 3U1XA 2PLV1 1G7YA 2XR4A 2X05A 3K4AA 3V0AA 5DUVA 4TTGA 4LUKA 1BCXA 5FP4A 3O1PA 4IEXA 4BU2A 2ZHLA 1BK0A 3CL1A 1WW6A 3T2OA 1LULA 1UD1A 2DCKA 4CXXA 1DYOA 5JPNB 3WF2A 2DBIA 3VBHC 2A3XA 4OMCA 1S0DA 1Y7BA 2DUPA 3TEZA 2R0FA 3HQXA 3LA2A 4Q4W1 4YM3A 3MZHA 3D82A 4LKEA 5IK5A 1O91A 3CU7A 3I3DA 1DDLA 4EV0A 4Y1UA 1IQDC 1O5LA 2J1RA 1RUD3 4GQ7A 5FZ1A 4DUXA 1NAEA 4P14A 3AJZA 4LO5B 1U5YA 3IIIA 4KWUA 4QQLA 1HKDA 4WZFA 4W6YA 3DYOA 2C24A 3UKVA 4HPKA 4YM1A 5FLIA 1NZIA 4NROA 1XPWA 1PIV3 1VBD2 1DG6A 1S0FA 2P3YA 1DQ0A 4JAAA 3HN1A 4MGQA 3VV1A 1QMJA 2XVGA 3J7LA 2YFUA 4FFGA 1RUH3 5FZ3A 3RYPA 1JH5A 5EJZB 3H8XA 1AXYA 4M3CF 1NE6A 1SLAA 4H55A 2AR6A 4QQPA 5A3LA 4Z1VA 3ZYBA 1D4VB 3NAPB 3VHOA 3OY8B 1J84A 5FPLA 5KXCA 1Q5OA 2QZ3A 3CKHA 3J4UH 4AVSA 2BUKA 3PIJA 3N9OA 4UYBA 4MGTA 4MXWA 5LY1A 4CDQB 1UPSA 3OGSA 2WWSA 3E5UA 4YVWA 2NM1A 3G7DA 4AVTA 3I2IA 2BPA2 1I1EA 3WNKA 3OBZA 2ZEZA 1S0IA 1ST8A 2GC2A 5KXEA 3MIBA 4OHYA 1GQGA 2Y6FA 5JOWA 3UKNA 3T30A 1CX1A 3UKTA 3THCA 4N9HA 3VDCA 1MZEA 5LRRA 1DHKB 1EV11 4WV8A 1VBA3 5H9PA 5EFUA 2ZACA 3V0BA 1GANA 3BTYA 3AP9A 1GZWA 2PFWA 2QQMA 3R4SA 4HETA 3TAYA 1COV1 2YBPA 3HD8B 3GYDA 1NLQA 1W9WA 3LOIA 4UT5A 5LK7B 2WS93 4Q1RA 4X8PA 5JCTA 1FYUA 3ENRA 3DL3A 2FCTA 4IUGA 2XLAA 4FXKB 3TEYA 3WDYA 5A7PA 4YGCA 4AGVA 1LTEA 3N9PA 5F3GA 2F4LA 1J83A 2PHRA 2Q1ZB 2RJ2A 5C4WB 2J1VA 4Z07A 4KH9A 4Z92B 3ZYJB 4KQ7A 1W2AX 1DQ2A 2XWBB 1HX6A 5SV8A 5C3SA 5FDBA 5C3PA 1W0OA 1XYNA 3WQ7A 4AQSA 1GOGA 1UU5A 2LM3A 3O1SA 1MZ6A 3OUHA 1VB2A 2OZ6A 1NG0A 1PO11 2VNGA 3IZOA 4IE0A 2OQ7A 3RQ0A 5IFPA 4IE5A 3LSDA 4M3CE 2ZOEB 3ELNA 4PIYA 1I9RA 4BQ4A 1MS9A 1N47A 2WFPA 5FXVA 3ZFGB 1FI2A 5BNQA 5JPMB 5KXDA 3I49A 3PVBB 1AR73 2IZWA 4LKDA 4OHZA 3CJIC 4D3WA 4HKWA 1ZZ8A 3KCXA 2VMIA 1Q8QA 2FDKA 4UFLA 1J59A 2E31A 1VP6A 2E53A 4BHPA 4CDUA 4FAHA 5J36A 3GXUA 5T3NA 4G9SB 2GZWA 4NPLA 4XBLA 4MGSA 2B4KA 4YZ5A 4AQ2A 1PGSA 1VBB3 4NIGA 1UOGA 2Z42A 5GLWA 1GZCA 3C7HA 3ZN6A 1IS3A 2VQ0A 4JCKA 1HRI3 1I3HA 1WD4A 4P5YA 4BH9A 3FUQA 4OVEA 5JXIA 3FHIB 2WABA 2WFF3 1OXCA 5FZDA 3A23A 2D6PA 4I0WB 5DQ0A 3RI9A 4NWWA 1OUSA 1S0JA 5T54A 3AJYA 3VBFB 4BWOA 4RSUA 2XVLA 3BN6A 5EZWA 1AXZA 4XDQA 1YJKA 4I09A 5DZGA 4GJYA 5DPNA 5FZ9A 3AKQA 2BFUL 2W2IA 1D2SA 3QBQA 1JHJA 2O8OA 2QQLA 4LBOA 4FOWA 2OXBA 3E5QA 4MYEA 2EXJA 3DYMA 3O7OA 3MUZ1 4RFT0 4Y20B 4GALA 4YM0A 5G04L 2A1XA 4Y22B 2OPWA 5A70A 3WW4A 1Q43A 4ZY9A 5ERLA 3FLTA 1HQLA 1PVXA 1RITA 2B46X 2E7QA 3N9NA 2JG9B 2YHJA 2YG0A 3KGLA 4R9AA 1RUI2 1RUJ2 4N53B 2JDAA 2VD7A 2WJSA 3ORJA 1ZBE2 4XFFA 3U14A 4FSJA 4XEZA 4JGYA 2HWE2 2VZ1A 3KCYA 5FYMA 4PQQA 1Q8VA 4CDWC 1BBT2 3GHNA 3AMQA 4JKKA 3ROUA 1NE4A 3VBRB 1REFA 3ACLA 3MLJA 1JBCA 3MLKA 1IPJA 2BZDA 3N9LA 1LJ7A 4S2HA 4XFIA 3O1UA 5BNNB 4LPLA 2QDNA 2GNMA 1GWMA 5IATA 1PX3A 3EHKA 1N1SA 2WL1A 3DV8A 3NJXA 5ANQA 3SH4A 4RHV3 3WHTA 2JDUA 3A0KA 4XF4A 1SBEA 3ZYRA 3DGTA 1W9YA 2VPVA 4JTOA 1LEMA 1W6QA 1A8DA 2YYOA 1XSQA 2VUJA 3MHZA 4M4RA 3EJKA 3HEIA 3O0XA 4Y4YA 3TNPB 4L99A 4PI2A 1FPN2 4AVAA 4DRVA 2BERA 1BKZA 5C3OA 2AC1A 3FBMA 1S0BA 2WYSA 2YMZA 3NJZA 1MPXA 4XIKA 4NAOA 4QMAA 1ASJ2 1BMV1 2OQ6A 3T3YA 3RJRA 3MF6A 2YU2A 2RR12 4WM8A 3SMHA 4GKXA 3FLRA 3BTZA 3UJOA 1F35A 4IQPA 4QX1A 4DMIA 1RUH2 4QGMA 2JE9A 1V6OA 5CU1A 3ST7A 4CRQA 1W9TA 2EICA 1NCQA 3CLPA 1FOD1 5A6ZA 3RI8A 4XC9A 1XBFA 5FZAA 3KHBA 4OMDA 3B93A 4CDWA 3SKJE 1C1LA 1WMDA 3WG3A 1TME3 5H9SA 3D8CA 5D8AC 5LA2A 4XZPA 2I74A 4JHZA 3VKFC 5GZFA 4RA0A 1IZ3A 1MQTA 1PVC3 1R083 5J3UA 4JHTA 4YW6A 4E8CA 2CGNA 5A3NA 1IKQA 4LT5A 2RS51 1R1A3 3OGGA 4HVRA 1KFUL 2PQQA 3JQWA 4C0HA 5A7SA 2EXIA 1LECA 3LIHA 3W5NA 3ZXGA 4JV4A 4OHWA 4FOQA 3N7JA 3SXWA 5FKBA 2NMNA 5FYHA 3ZO0B 3TEWA 4AVBA 5KC5A 2K9ZA 4PCRA 1WLCA 4CE8A 2DFCA 5GLVA 3TB0A 5FZ4A 2PTMA 2ZX1A 3NNJA 3USSA 3NNFA 1WMXA 3HNYM 1TQ5A 2JDPA 1W39A 4M3CA 4NJ4A 4XJZA 1T6GC 4GKYA 4HONA 3N7KA 3HN3A 3KV5A 4BMBA 1TMF2 4XFHA 1ZX5A 1ALYA 3PUAA 1ZRCA 2FDJA 1V9U2 5LEJA 2P4EA 1XQNA 3IKWA 4ITCA 2EF6A 3IDCB 4DEVA 1JYTA 5FUNA 3R6SA 2DF7A 3GALA 3NMBA 2AH2A 1COV3 1DZQA 3ZFEC 3VZMA 1OH3A 4CZSA 5A7WA 4GWIA 1LHVA 2R32A 3B02A 4YRDA 2DDUA 4HXCA 1DBNA 2WS92 3AYAA 3KSCA 1R64A 5I0TA 4E4DX 3ZXAC 2XDVA 1WLDA 1MS3A 4KGGA 1GNYA 5JXJA 1UY2A 1HRV1 1WLWA 4Z82A 5LBEA 5FYIA 2RDRA 5A7WB 1U5ZA 1VR3A 3OG2A 1BLZA 5GM0A 4CDUC 1CQ9A 1H2MA 1B35B 4K6BA 2ZS6B 4AHXA 2ZX2A 4JKMA 4JGZB 4B4QA 3ZFGC 1PZ8A 1QJU3 2P17A 2WN2A 5K8SA 4CCOA 1AYM2 1QJY1 3MFCA 5C71A 4WVMA 1UO9A 1ZVFA 2GP5A 4C1XA 1H2LA 1AR71 2TEPA 1CAVA 1PGW2 2RE9A 1KS5A 1MQTB 2XJUA 2Q5TA 3PLQA 4UXAA 1W2NA 4FXGB 3M1HA 2HWF3 5F32A 5C8WA 1PHMA 5CA6A 5A33B 3IPVB 3ZXKA 1EUTA 1XNKA 2Y6KA 2RDSA 2IVJA 1HLCA 3OPZA 2VOXA 1IPSA 4UF0B 3OGRA 4DXZA 1R1A1 1Q56A 2Y0OA 3AZXA 3ZMNA 4IE7A 2VM9A 5FO7B 5CADA 3ZR5A 2NPIA 5L7OA 1BVP1 1WA4A 3ZXLA 3VBFC 3SH3A 3PNAA 3N36A 1GUIA 1V70A 2A73B 4Q4V1 4NUBA 3GM8A 2XWJB 5ABJA 4CSWA 4DZGA 2OVUA 1Y43B 1E5IA 2BNMA 3ZIWA 3SC7X 1ZZBA 3P3PA 4YSFA 2QNKA 3E6DA 1XNCA 1NT0A 5FPAA 4AGRA 1ULOA 2H0VA 4XJAA 3LEMA 3KT4A 1S2BA 3I3QA 5CAZA 3Q8EA 3IIAA 2VZRA 3T09A 1GU3A 5FY5A 1RMU2 3VBUA 2I2SA 2WO1A 4LK6A 3O1VA 3D0SA 3K4DA 4HKLA 1X8EA 4Q4X1 5GJ6A 2A70A 1S0CA 1H30A 5LATA 2C9KA 1C8M3 2J1AA 4QB2A 1HQWA 4MGYE 1KITA 4FT8A 3NV2A 1Y4WA 5FY7A 4D69A 5FRAA 2XQRA 3LSEA 3AM2A 3NRUA 3HWJA 4XHBA 3WW3A 5I8TA 1DGLA 2ZEXA 1YXWA 3L2YA 4CUBA 5LASA 3D3AA 3FMGA 5CKQA 5I0RA 2UWAA 4RQPB 1AYN2 1RUD1 3FHQA 4GA9A 1HN0A 1YIPA 3LKJA 4PLNA 2JECA 1C5HA 4LKFA 1REDA 1H9WA 5HV0A 4E4ZA 1WMFA 4J6GA 1ASJ1 5FZCA 5HBAA 3C3VA 5FOBB 4W8JA 5E88A 4AGGA 2E26A 3FHAA 1YC61 3KCCA 3W9AA 1RYYA 5FUPA 1ZZ6A 3BU7A 4O61A 4B4PA 4QKDA 4ZHNA 1XJAA 3W58A 2VXRA 3AMNA 3ZMOA 4AOCA 5EV7A 3T2TA 2LS6A 2VGDA 2Y60A 4AHZA 1OOPC 2ZX4A 2WFF2 4F83A 1GYKA 1V6MA 4AHYA 4R9DA 2Q0AA 1OA2A 4LTAA 1L7QA 1GOFA 4YW7A 4NIAA 5KHKA 5CBLA 1KGYA 1HB2A 3CHXA 5FY4A 5BNPC 3DXUA 5FZGA 1QU0A 2CTVA 3O14A 4XURA 4XF3A 4NO4A 3I2HA 1YEWA 4KWLA 5D8AB 3VDDC 2KD7A 5IHRA 4TWTA 1GOHA 2WNEA 3RYRA 2O8QA 3EMRA 4UBGA 1RB8G 3E5XA 3OUIA 3UT0A 4NHLA 4OZOA 4DIQA 3VD5A 2FDFA 2FQPA 5LCWL 4XAEA 5DUWA 2XGXA 4YW3A 4YZ2A 4H3WA 4CCMA 3WDTA 2UWBA 4K1YA 5FBJA 1VRBA 1BEV2 3IN9A 4QPGA 1DZRA 1NZCA 2JDMA 3UL2A 1UPIA 3CNAA 1SPPA 5ACA3 2HEVF 4A7KA 2QDRA 2A71A 3VD4A 1CZVA 1JZ4A 3H3UA 5L7OB 5FZIA 4XHXA 1ODMA 1D7PM 1JUHA 4CU8A 2LRPA 1N1VA 2GALA 1FATA 3NL1A 3VN4A 1SMVA 1COV2 5FZOB 1QOOA 3HT2A 1WMEA 2HWB3 5LZ6A 3UETA 1DLLA 2ZGKA 4FTSA 4Q4V2 1DQ6A 4S2DA 2HEYF 3OBRA 4HVQA 5J09A 1ZRFA 4NIDA 4GH4C 4XJ8A 3R4UA 1OQEA 3I7DA 4LKSA 1PVC2 1R082 2ARAA 4RR3B 4NIHA 1DYPA 4Q0PA 2XJPA 4QPYA 1PO21 3C7OA 2XJTA 4QPIB 3DPRC 3V65A 5EQUA 4MGIE 4D7YA 1X8MA 2ORZA 1O59A 1K45A 1K3IA 4PF1A 1CONA 2WS91 3P1IA 5H9RA 1SFNA 1MS4A 4YVWC 4PF5A 4XJ9A 2JG8A 5JWPA 1VE0A 4RR3A 1OA3A 3B9CA 3KB5A 4KWJA 4IESA 4BZ4A 4CDWB 4AE2A 1OKQA 4Y5Z0 3U10A 5IAXA 5JSRA 1VLNA 2Y6GA 5A32B 3THTA 5CEHA 4PDWA 2GP3A 2R061 1KEXA 2YZ4A 3JD71 4MX3A 1EYBA 2VZPA 4V1PA 4YG0A 1F5JA 1QOSA 5DDJ3 4P9WA 1HRV2 5HCAA 2YBSA 3RYKA 2WWUA 2E33A 1CAWA 4B1MA 3BOWA 2HH9A 1Z7S2 3NJYA 3N9QA 4AFAA 4BCUA 2WYFA 1POQA 3RMXA 5I0SA 3WUCA 1LOCA 2HWE3 5JDBA 1KDKA 3ZDVA 2D5HA 3FC0A 4OYUA 4P9JA 4AHWA 4URAA 4EE2A 3KT7A 2W46A 4X6RB 2ARXA 3RVHA 1X50A 2RMU1 1C4RA 3I8TA 3POSA 1HQNA 4OLLA 2XLGA 4JDNA 5F2WA 3ZOIA 4LR4A 5C9AA 1G9AA 4MXVA 3MPBA 2ADDA 2OX0A 4TLFA 5CKMA 3PUIA 1WW7A 2Q8EA 3SNMA 5IWFA 3APBA 5I8SA 4BLIA 4E2SA 2HWD1 2Z79A 1ZZ9A 1UZ0A 2VCMA 5IUQA 4AI2A 3LAGA 4XDOA 3ZR6A 4ZPIA 2W52A 1NUKA 1Q8PA 2EA7A 3M3CA 5A6QA 3J8F1 3MBWA 1DGRA 5FBZA 1RUOA 2ZEWA 5F5QA 5C5TA 2VAUA 3OGVA 1YRZA 4CDXC 5JLVA 4XMAA 1QJFA 1RUE2 3EXUA 4YGBA 3U11A 4JRLA 3MEPA 4BYYA 2NYYA 2VMFA 1CX4A 2ZGNA 4EN7B 4EN9B 5HXMA 1N1TA 3B00A 5B4NA 5C4WA 3VKOA 1MZFA 4IXLA 4RD7A 1JS9A 1HRV3 1MR5A 1VJ2A 2DFBA 4FTEA 5J96B 2NZ9A 1WCDJ 2ZA9A 5A7NA 2QUOA 2XKOA 1GLHA 1U5IA 4LBMA 3WNMA 3U78A 1ULCA 1YFWA 1DFQA 4SBVA 4P08A 1HB3A 4XFGA 3K77A 1SCSA 3AXDA 1MS0A 2QVSB 4FQ4A 4O9GA 2WO3A 3R0RA 4WVZA 1DQ4A 1YO8A 1OF4A 1VBA2 3CJXA 3RJ2X 5JSOA 5CFCC 3O1TA 3AP4A 1PO13 1LGBA 1C8M1 1FV2A 1F31A 4MV2A 4XF0A 5DZFA 4CDUB 1EV13 1A6CA 3OPTA 4L8QA 3TNQA 4O65A 3AK0A 1W03A 4L97A 4UFJA 4LNVA 3DYPA 1PVC1 1R081 1YQCA 3LE0A 4BDVB 2A3WA 5L9VA 4ATEA 5DG1A 1QJZA 2DU1A 2K2SA 2WQZC 2J42A 2Z5WA 5GLTA 3I2DA 4L11A 4ZZ5A 3AZZA 1AJKA 1PK6A 1PZ7A 1D2QA 4YARA 4NRPA 4RN5A 5FK7A 4A7ZA 1XNDA 5E1RA 1TMF3 1AXKA 5FZ7A 1F2NA 5FZBA 1FMD2 1R092 2DTYA 3BODA 3J8F2 1H0BA 4A2UA 4DXSA 5LA1A 1UMHA 1ULEA 4MUVA 3IPVA 3K46A 1CIWA 4JVAA 4CEYA 4Y20A 2JD9A 2BJSA 1ND3A 3BI3A 5DAXA 1VBE3 2E32A 4V2VA 3NO8A 1WW4A 1I5ZA 3UK9A 2P6HA 1AR61 1EAH1 3BPSA 1JODA 3Q9OA 5FMOL 3H3LA 1UQXA 5FZMA 4AI1A 2ATFA 1BEV3 1J1LA 1ND2A 1I5PA 1BZWA 5FKCA 4QQOA 3GCWA 2WNUC 4GB33 2VU9A 4YZ4A 5DUXA 3O0VA 4XDPA 4BB3A 4FPCA 4Y5TA 1LOFA 2D6OX 2B45X 1XXNA 1X33A 2H6BA 1RHI1 5C5UA 2VMDA 5EIYB 3NWKA 3MICA 3GNEA 4LOTA 4XUNA 3WDWA 3J7MA 3WV6A 1LGCA 1W28A 3LZZA 4UFKA 4XCBA 4E2GA 2ZGPA 3GZUC 3I2GA 4QXBA 4AEDB 4JX0A 4LHKA 5D2AA 4NPRA 1AZDA 5J1XA 2FHRA 3AB0A 2Q8CA 1UN1A 1BEV1 1RXGA 3HJRA 1K5MA 2YC0A 3DKWA 3DXTA 2A75A 5IAVA 5HPOA 3ILRA 1NA1A 1OFNA 3M70A 1PIV2 1W6QB 1IS6A 2IXIA 4IETA 5T5PA 3VHRA 2JKXA 2BGOA 2PHXA 3U75A 4J1XA 5C3QA 5FP3A 5J7MA 2C4XA 4XUPA 1JYIA 3JXSA 4A45A 1G9CA 2BWAA 3OF1A 1MEC1 3POGA 4HL0A 4Y4RA 1E5SA 1HB4A 4XTPA 2ETEA 3WW1A 3NNLA 1QJX1 4XACA 1EY2A 4OHVA 4GULA 1UKGA 4KI5M 4R8HA 4RR3C 5LW9A 1H8TC 5C33A 2D5FA 4RGKA 2D3SA 3LPGA 1S55A 2R062 3ZVXA 4W6XA 2WNUA 4B4RA 3H8OA 2CDPA 2VQTA 2RMU3 2WA3A 1CAXB 4I3PA 4R52A 5FP8A 3VLBB 2MEV3 4COYA 5J98B 3HOBA 4R4ZA 1H1MA 1TVGA 2P5BA 1UNBA 1QXRA 5C7GA 2W3JA 3KZ4C 1LOAA 2WT0A 1CJPA 1KXGA 1Y9GA 2WAAA 5C3RA 3JBG2 1B09A 3VL9A 5IFTA 2GSYA 1KFXL 5FZLA 2BBAA 3VDBA 1SACA 1UY4A 3RGBA 3D6EA 5IVCA 4JDOA 1XNTA 3ZYHA 3JD73 2IXHA 4PQ9A 4EWDA 1HXS2 1J3RA 1SQ4A 3GHMA 3Q8BA 4UBHA 3UV9A 4CP0A 1UF2C 1VIWB 1X9PA 2ES3A 4XFCA 5JR2A 2YY1A 1SPPB 5FJHA 4UAPA 2R1BA 4ZZ8A 2RM21 5A33A 3MIHA 1PNFA 3ZXEA 3PURA 2QE3A 1AHSA 3WQ0A 1OQ1A 2R49A 3USUA 2ZEYA 4GB31 3WNLA 3LDKA 2C9AA 1V6LA 1H2NA 1WBFA 2VBPA 3KV4A 4JGYC 2X5IC 5IVVA 3OBTA 4TXWA 5JOZA 4NOTA 2XJQA 4HFSA 2PQSA 2ARBA 2FBEA 3RSJA 2RR11 3BVCA 2V73A 4NHMA 2W39A 3WD5A 4XVHA 2JDZA 2B5HA 1XE8A 5FPUA 1POV0 2RS52 1UZZA 2Z4FA 4CDXB 5JMCA 3GZAA 2YC4A 1AR92 3U0ZA 5F2SA 1GNZA 2P3IA 3F95A 4N53A 4INDA 3V0AB 2KM2A 2BBVA 3OBAA 2VZVA 4U2AA 2B39A 3HMYA 5FZKA 3A7QA 4AEDA 4I2OA 1QJY3 1C3HA 1SBDA 2LUWA 3ZX7A 4QHZA 4BQWA 4Q0QA 5CFCA 1VMFA 3RZKA 3ZYFA 3WVJA 2WZR3 2RM23 2IFWA 2OYZA 2ZKNA 2VUCA 2WZPP 1C8M2 4QU2A 1TEIA 3ZYPA 5AFEA 2W5FA 4TSVA 5L7OC 2GU9A 3PMSA 3LFMA 3FZ3A 2TUNA 4CEWC 1CN1A 1AL0G 1AYN1 3PVEA 2O0OA 1XU1A 1QQP2 3MW4A 4XW3A 5ABJC 1IHMA 3RNSA 4Q8LA 5C6CA 2UU8A 3TWIA 2VVFA 3T0AA 3VBRC 3JCIA 3AZVA 3LPFA 3D5OA 1DLCA 4MADA 1OURA 1PK6C 5C8CC 2W95A 4XETA 5F3IA 4LORA 2K46A 4K1ZA 1DQ5A 2H0BA 2HJIA 3AC0A 3DKQA 3ON7A 5JI9A 1M06G 4WM8B 4GZ9A 1W6MA 2CDOA 3Q8CA 2RVAA 1H4HA 4W50A 3SCFA 3T4HB 5ISLA 2YPJA 2YV8A 2UWCA 1VBC1 3DECA 3PTYA 3U07A 2MPFA 4FFIA 1O4TA 4LBQD 4QDRA 5HCBA 4QKBA 1W6MB 3PU3A 3P3NA 5FQ0A 4ZS2A 4FQZA 4MO3M 4MXWB 4KGQA 5FR3A 5DMYA 3V64A 3ZPYA 2VZQA 3ZFFA 1QNWA 5G05L 1LOEA 2HYKA 4HSLA 3WDXA 3C7FA 5GZGA 1FMD3 3GZEA 1CPNA 2D7FA 4XYXA 4B7EA 3QACA 4LLFA 2W0XA 3VBUB 2VL4A 2D98A 2JG8C 3MO4A 2CAVA 2VMCA 1RUI3 4MHRA 3ES1A 2GDFA 1WGPA 2WZEA 2A6ZA 4LE4A 3VBRA 1YNAA 3ABZA 3UGHA 4AG4A 4CDXA 3USUB 4ZONA 3LIGA 1FV3A 4CP2A 3VD7A 3ACIA 1R093 4LMFA 1OPMA 3OOXA 4AL9A 1A3KA 1IGOA 2GNBA 2AEZA 4NWVA 4BA6A 3AVSA 5BNPA 1NCRC 1GZ9A 3K48A 1XRUA 1MACA 5EXOA 3UGFA 3WF4A 5CG8A 2CAUA 4XQWA 3ZSJA 4PIXA 4QDQA 5DXDA 3AKPA 3SH5A 5I0DA 1RUJ1 1XOYA 2QQUA 3OUJA 1V6NA 4ZS3A 4UOJA 3CQOA 4IEWA 3A22A 1LEDA 2WAOA 2XOMA 5E16A 2VJXA 3DN7A 2JDHA 4ISQA 3WOGA 3HQRA 4RQPA 1PO22 1RUNA 4PBOA 3KLSA 4IGPA 4QM9A 4Q0SA 1VAMA 4P00B 1G86A 1VALA 3PVOA 3RWNA 3POYA 4E4HA 1X82A 4QXCA 2P2KA 4AI3A 4F8AA 2D6LX 1W2OA 3M7AA 4CA9A 3ACHA 3QH6A 2RS32 2CU5A 4RFRB 2QQJA 4C1WA 4YG6A 3W20A 1E5HA 1VBE2 2A7AA 4WBBA 5E8AA 2QTWB 5HCHA 3RFRA 2FZ2A 2WKKA 3ZN5A 1VPHA 5DAPA 3TYJA 5FMCA 2GC0A 3Q8AA 1JZ6A 4LBKA 3TOJA 2WNVA 1LENA 4FP2A 1FPN1 4UFIA 3LFIA 4FPYA 4XZUG 5BNOA 3P5BA 4ZU5A 1WCUA 3OY8A 5C70A 4N43A 1OHFA 3AP7A 1Y9QA 3B5LB 3W21A 1SLIA 3J8F3 5KHHA 3LCPA 1BK1A 1CVNA 4R9BA 2YGMA 4HSJA 4XMIA 2IXLA 2PAKA 5EYXA 2OA2A 1XSRA 3RZGA 2P1BA 1LODA 2ADEA 4XILA 2W1SA 2ZCWA 2ZMNA 4BQ3A 5LWBA 4I0AA 2P3KA 4OQ9A 1LOGA 1WKYA 2IWGB 2IUWA 1OC1A 2HWD2 3HT1A 3VBFA 1DCSA 4FPFA 3ZFFB 1V6KA 4JGYB 4RGAA 3M3QA 4FP3A 1LHWA 4XIOA 4BJ0A 3NSTA 1ULDA 3AYCA 4QHBA 3VZOA 1AL21 1NCQC 3ATGA 3KVAA 1K5MB 3PMEA 1LCLA 2VUDA 3JB8A 1ACCA 2Y34A 4P9YA 2ZGLA 3IAPA 4N53C 2B9UA 4L92A 4AEDC 1B35A 2YUEA 2ZHMA 4N8MA 1OKOA 2KXLA 2XJVA 4W65A 4CP9A 1AYM3 2FDIA 1W0NA 1OI6A 2OPKA 3O12A 2R0HA 2R073 3OEAA 4QWNA 5H9QA 4FOYA 2VCAA 3LB9A 4YWAA 4IV1B 3KQRA 4XCAA 4AQTA 3CZUA 4K3UA 3ZXFA 2XHNA 5HV4A 3KWVA 5A3UA 1NQDA 1L3JA 1C8NA 2QQWA 4LHNA 4QU1A 3WNXA 3POWA 4DY5A 4XUTA 3RZHA 1O3QA 5FMBA 4MG2A 4YPJA 5A3OA 2BRTA 2FZ1A 3ILNA 4AI0A 4CEYC 2UYAA 4IV1A 4DQAA 4E27A 1OVPA 5FMOS 3W59A 4ZXEA 1O8SA 3MLLA 3MV11 2VBBA 2R16A 3CMGA 5FZFA 2BQPA 3S6PA 3T1LA 4FO9A 1ENRA 1W3XA 1XC6A 4H14A 4YZ3A 2CNAA 3H1WA 4IEVA 4MOAA 4GWMA 5DABA 5CFDC 4BLJA 1O3RA 4R4XA 1GMMA 1SLLA 1OF3A 1ULPA 3LEKA 5F7UA 3JZVA 5C4WC 3I2OA 3S7IA 1V6JA 1O6UA 3AMPA 1UX6A 1GWKA 4M0HA 4TLGA 5FOJB 1IKPA 1ZZ7A 1PK6B 1W6PA 2D3RA 4YG3A 2E7TA 4L2NA 5FY9A 2ZHKA 1EPZA 5KWRA 5L36A 1JU4A 1UZWA 3WCRA 4BXSV 5BNNC 2ZX0A 4Q26A 4QQ2A 4B29A 2IC1A 1X7NA 4YFWA 3AZYA 2JG9A 2VVEA 5JZGA 3JB4C 3H3ZA 1JZ3A 1FMD1 2PHTA 1W8ZA 1XE7A 2F17A 5FUIA 1MS5A 3PU8A 2HEWF 4OI1A 5K0UB 4ES8A 3PUSA 3RS6A 1RHI2 4EWAA 2DTWA 4RL7A 2UURA 2P34A 3ZSEA 3VKNA 1FXZA 1XYOA 4AAPA 5IK4A 5FY0A 2W1WA 4B8EA 4Q2FA 5F9TA 1GZTA 1XB9A 4EZ4A 1OOPB 1RUC3 3NNGA 4I01A 4META 2VBDA 1J1TA 1K12A 4HK9A 2A6VA 3VBOC 1AR72 1OLME 3WF0A 3H1MA 2VUAA 3VD9A 4AWDA 4CCEA 3SCGA 1YHFA 4QX5A 2TNFA 4N7IA 4C0BA 1AR82 3UNPA 5DAVA 1H4GA 1A78A 1DGWX 2PHFA 1STMA 2Y64A 2LALA 3ITQA 2X29A 3OJBA 3GCXA 5JVVA 1RUJ3 4CU9A 2RS12 2WSUA 5A3WA 1N1YA 1UIJA 3VBHA 1C28A 2VTFA 3VD3A 2VY0A 3WP5A 1TME1 4M00A 1AR93 3GDBA 4Q4Y3 2PN5A 1UL9A 3WG1A 1FOD2 4Z2WA 1YQ5A 4OI4A 5K4LA 1JOBA 2HYXA 4MLOA 2D43A 3CIHA 1F4AA 2CV6A 2BYVE 3FE5A 4XOGA 1ENSA 3MIGA 4Q4W3 2PHDA 3ZLIA 5J37A 1RUG3 4GWJA 4FTBA 2VQAA 4Y3OA 3SEPA 1Q3EA 1Z78A 2D93A 4AK3A 2ZZQA 3H7JA 2EXKA 2GH2A 4IE6A 3EQEA 3HAGA 3AKRA 4E8DA 3WUDA 4S2GA 3ZDSA 4XF1A 5IT6A 1NY72 1Q8SA 1TZOA 1VBA1 2SBAA 4Q8KA 4RS5B 4W4ZA 3KQ4B 2HWC3 2V4AA 4KBBA 2L9LA 3BYWA 2YC2A 1LHUA 2MEV1 2BVBA 4Z8BA 4H7LA 3AMMA 1EV12 1N3OA 4YFZA 2A3YA 2HWB2 2QQVA 4BQYA 4LE3A 1QOTA 3KGZA 1G9DA 3N3HA 5FV3A 4ONUA 3OPWA 4JQRA 2GMMA 5T5OA 4OI0A 1RTVA 4WM7B 2JE7A 2TBVA 2VXJA 2DVAA 4Q27A 1WCQA 2RM22 4QDSA 2RS33 4P9XA 4QX7A 4LUMA 5JOYA 2XKPA 1EPWA 3WG4A 1F5FA 5APAA 4YZ1A 3RDIA 1MEC3 1UYPA 2GMEA 4WM8C 5B2GB 1UY1A 2VW2A 4MZUA 1GP4A 2ILMA 4AQ6A 3AMHA 3CBNA 5JZGB 2E9QA 2GNTA 1OFSA 1AL23 3WW2A 4XTMA 2KR2A 4FPLA 4QHOA 1V9U3 2PELA 1JXNA 1E5RA 2R1DA 3MGUA 2JEMA 4NMIA 4BMEA 3O1RA 3LF7A 4BQ2A 1UOFA 1WLTA 2GN3A 3VB9A 5KBFA 2D44A 3FFQA 5BXXA 4EN8B 3UYJA 3WDVA 5GZEA 1POV1 5KHIA 1PGL2 2IXJA 5FJKA 2WZR1 2ZGOA 4D8MA 3LQCA 1S0GA 1UOJA 2GAUA 1DZTA 1TE1B 1W8FA 4AVVA 1MS1A 5DZEA 4EJRA 1CAWB 1JOPA 2G9FA 2CYFA 3I2FA 4FPKA 2VZUA 1SLBA 2HWE1 3IAQA 4AR2A 5ANNA 4EWEA 2HLEA 1BBT1 4JGZA 1AR91 1NCRB 1W8HA 4AEKA 3M4FA 1WA6X 2PAMA 4X8NA 5GKAC 2BNOA 2Y38A 2AENA 4NR1A 4CPBA 1RVF1 4IV1C 1LR5A 3BCWA 4FBFA 5LA0A 5FXZA 4IV3A 3GJBA 4BQ1A 2B8MA 2VTXJ 3PUQA 2RJLA 3H0OA 4NPMA 1DF0A 2WSVA 4Q4X3 2VZ3A 4RQPC 1RUG1 3BALA 4C8DA 3LA3A 2R072 2QFEA 2ZAHA 3SCHA 2D6NA 4G4FA 4LJHA 1VRH3 3WXPA 1LRHA 1L7RA 4BPZA 2ZAAA 3AP6A 4ES9A 4RHV1 3CZJA 4EQVA 2D6MA 3KMHA 1Z7S3 4B1LA 5EHDA 2XPJA 1QGLA 4COVA 3U37A 1VBD3 1PMIA 3JUUA 4XQ4A 3THDA 1QJX2 4TYSA 1OLMA 1AX0A 2WNOA 5IVBA 3R4DB 1VB4A 2W47A 2XLFA 5FYVA 2VW1A 1KJRA 5FYTA 3ZYIB 3CEWA 3EB7A 3MDPA 4BQ5A 3ZSMA 5FWJA 5TSWA 1O7FA 4NAMA 2XBO3 4HZFA 2JXAA 2BFUS 4Y33A 5JUVA 1MZ5A 2HBUA 5FZ8A 1JHNA 2JB4A 3MIDA 1US3A 4JGZC 4IL7A 1JYNA 1H1AA 1H2KA 1G9FA 4HBNA 1UXXX 1QKQA 4PIZA 2W9XA 4XAAA 2ARCA 2BU9A 2YXSA 2PHLA 3KV6A 1O4ZA 5K0UC 4K8RB 4BIFA 2ZX3A 2OZJA 3AXEA 4XBQA 3QD6A 1RXFA 1S0EA 4U36A 1QNYA 2FCUA 3NV4A 1AVBA 3K51A 4H2AA 5FAXA 5LBCA 5JR7B 4UW3A 4Y1XA 1VRH2 4D6RA 4DEQA 5FXWA 1EP0A 2WRAA 3HNBM 1PNGA 3NQHA 4DO0A 1RUD2 3TRSB 1ODNA 2W08A 4AEMA 4NN0A 5E6HA 4K21A 3JU9A 1IS4A 4NHYA 1VBB1 2FD8A 2ET1A 2D97A 3KV9A 2OT7A 4CCCA 1IPKA 1WD3A 2R071 1SLCA 2VVDA 3BOPA 4NE9A 5FZ0A 4FFFA 4CDQC 3S57A 1K5MC 2QQOA 4LXLA 4QD2A 4AVCA 4PBPA 4URTA 3BIEA 5FXXA 5CZKA 3TN92 1G8WA 2BOIA 4UFMA 2ID4A 5FP9A 1AJOA 3VKLA 4GMP3 3WP6A 3SQOA 1JYXA 2CGPA 3O5SA 2JKBA 5LBFA 3H42B 5BNOC 3ES4A 3I54A 1US2A 4OZXA 4BISA 5CFDB 3AL6A 1NCQB 1U12A 5DG2A 4RGGA 1CJDA 1YFXA 4QPIC 2OUJA 4YW5A 3M3OA 4IW3A 2RS13 2ZABA 4FCAA 4O9EA 5EWSA 1PM4A 5FY8A 4PT6A 3LOBA 4JQTA 3MUY1 1ND2B 2G9ZA 4E2QA 4CDQA 4HN0A 1NY71 4I3GA 3N7MA 1SBFA 3ZFGA 5FPBA 2HWC1 4AF9A 2WWJA 2EAAA 4QKFA 2VCBA 3ZN6B 4XPVA 4ASMB 1LGNA 1RVF2 1ZBE1 1CR7A 3U4SA 4FPGA 3IM0A 4IDZA 4UFHA 3I59B 4JKLA 1YLLA 1JYVA 2NQYA 2BOJA 3LDBA 4PDWB 2DCTA 1DGRN 1Y9MA 4CTEA 3G6JB 5J48A 3RZLA 1ZBA1 2BEOA 2W1QA 1WCSA 5FYZA 1VBE1 3V0BB 1H8TB 2WN3A 4GH4B 1ZA4A 2JIGA 5BUVA 2CGOA 1NXD1 2DCYA 2Y0IA 4PHZA 4V2WA 1ASJ3 2ZMLA 1BQPA 1X36A 1CESA 4ASKA 1YI9A 1J3PA 3AFKA 5A3MA 2Y8KA 5FREA 3R05A 4MVTA 4QX3A 4KMQA 2XL9A 3WT3A 3TEXA 5FZOA 1W0PA 4DUWA 2QBXA 4HOOA 4Q4W2 4IERA 1YQ6A 1QXPA 1T6BX 2VECA 5FYUA 1JU3A 2B42B 1W90A 3VZNA 3TN91 2VO5A 3ALQA 3L9JT 3Q8FA 4OFGA 4QX8A 3KF3A 1RHI3 3HBKA 5BNPB 4COWA 3MW3A 2C5DA 4ZKTB 5A6YA 1OT5A 5BNNA 2AZ5A 2G4IA 4LBQA 4Y1YA 4ARXA 2VULA 5FP7A 4BK5A 2VOTA 3WEZA 2XVKA 5HCFA 3O0WA 4CYDA 4CCJA 4WVWA 1TG7A 5FTTC 4A3ZA 3D0JA 3WSOA 3CJIB 2Y6HA 4N43C 1AL22 1UKRA 3BIWE 5JXGA 3WNNA 1F9KA 4LBJA 1O4YA 4XABA 3RZZA 4LK7A 3B7MA 1UCXA 2OKXA 1DYKA 2VCCA 1YI7A 1LOBA 2JG9C 5JZGC 4LEJA 5F5CA 5FZ6A 3T0BA 1PMHX 1W05A 2DCZA 1W8WA 5IK8A 2CWSA 4AYUA 2F4PA 4DFSA 2JIJA 2HWF1 4DPNA 3ZSKA 2LTNA 5JOXA 2N7GA 1QH7A 5AC91 3KT1A 1GP6A 1OPOA 2XBO1 4LHSA 2ZGTA 3IDBB 1GP5A 1XNAA 4GWNA 3MFAA 3WR0A 5LRSA 4CU6A 1OD5A 5D21A 1KD7A 5DN2A 4UF0A 1GV9A 3I3BA 4LBLA 3VBOA 2Q1FA 2DVGA 4ORFA 1N3QA 5DUUA 2F6BA 3ZIXA 2EIGA 4GH4A 3ACGA 4A4AA 1HXS3 1SFYA 2AACA 2WO2A 1C57A 1K42A 2EAKA 2VNOA 4YVSA 1O3TA 1W9FA 1NKGA 3OD4A 4Q4Y1 4IEQA 3T4VA 1MEC2 1D0GA 5EJ3A 2EIDA 4XUOA 3GBGA 3BTXA 4HPKB 2AGSA 2JENA 4QKNA 3SHRA 2WFF1 5LEKA 5CKNA 3S0MA 2EALA 4YGEA 3SISA 2GMPA 5E89A 5GZDA 4C90A 3W5MA 1QJU2 5FCCA 3VBSA 3POBA 1O8PA 2QKDA 3M2MA 5FIXA 1UZYA 3KVBA 3IDEA 2OS2A 4UW4A 4ZU4A 3UESA 1CPMA 4YYOA 3PVNA 5F1RA 3J7NA 4YNIA 1CGPA 5CNAA 2WLPA 3M3EA 4OCTA 3VBSB 2P37A 1DQ1A 1ZBE3 4Y26A 5JXHA 2MHFA 2WQ8A 2JDNA 1H6YA 4NHKA 2GN7A 4P9LA 2XG3A 3JBG1 4QX0A 4EZHA 4OUEA 4CCKA 2W91A 3OGJA 2A6YA 3J9SA 5FLHA 2WT1A 4GB32 3LD8A 3POJA 5CYYA 4QX2A 1R1ZA 3DF0A 1ZA7A 2C26A 3PUHA 4PLOA 4I0BA 5FPZA 3SITA 5GLUA 1WZXA 3KM5A 4CUGA 1MQTC 1S2EA 2XUMA 2WQ4A 3I3EA 4TZDA 3BKZA 1NXMA 3NAPC 2G19A 4XJWA 4KBZA 5LA9A 4AEJA 1LAJA 3RZJA 4OUMA 3N7LA 2WINB 1W6NA 3C8XA 3URFA 1U5XA 4QPIA 2RS11 1HB1A 5CG9A 4HLTA 1OA4A 2W68A 1GSLA 1SFPA 3UGGA 3PTRB 5BYNA 1W9SA 3ZYGA 2ZMKA 3OCPA 1YWKA 2C0ZA 1W6NB 2VMGA 3AYEA 3ZXJA 1VAKA 4DRRA 2OW4A 3K2OA 3THPA 2CHHA 3LGRA 3OTFA
chains in the Genus database with same CATH topology
4FI9A 4YPJA 4ARYA 2WZ8A 3UETA 3OEBA 1UXZA 2YFZA 2VZOA 4ZXEA 1O8SA 5A1AA 3MV11 2VZTA 2WUHA 3CMGA 2VQUA 4LKSA 1XC6A 2QQKA 4AAXA 4MOAA 1YQ2A 3C7OA 3E1F1 3A21A 1UYXA 1CZSA 1GMMA 1PMJX 2ORZA 1O59A 1K45A 1K3IA 1OF3A 1ULPA 3P1IA 3LEKA 4PF1A 5IJRA 5F7UA 3ETPA 4CUCA 4DXRA 4Z2AA 2Y6GA 2X05A 3K4AA 4TTGA 3C7EA 1JU4A 1KEXA 4BXSV 2VZPA 3T2OA 2DCKA 3VDAA 1DYOA 2E33A 3WF2A 1JZ3A 1NX9A 4XUQA 4OMCA 1H6XA 2W94A 5FUIA 4OYUA 2B9VA 1DP0A 2W46A 3IB3A 3I3DA 2JE8A 1IQDC 2J1RA 3WF3A 2W1WA 4DUXA 1NAEA 2BGPA 4QB1A 4KWUA 3IIIA 3NNGA 3DYOA 1K12A 1JYWA 3PUIA 3WNPA 1XPWA 5IYYA 3WF0A 3VD9A 4MGQA 3I2JA 1UZ0A 2YFUA 3UNPA 1BHGA 5EJZB 1NUKA 2Y64A 3MBWA 1HN1A 2ZEWA 3BGAA 1PX4A 4CU9A 1J84A 3OGVA 3CKHA 3T08A 2VTFA 3VD3A 2VMFA 5HXMA 3P6BA 3GDBA 3OGSA 5B4NA 4DXTA 3I2IA 3WNKA 2ZEZA 2HYXA 3CIHA 1OH4A 1F4AA 3WNMA 1CX1A 3THCA 3VDCA 2V4VA 4GWJA 4P08A 3K77A 3SEPA 2QQMA 2WO3A 1OF4A 1W9WA 1LNSA 4E8DA 3IDAA 4IUGA 1JZ8A 4W4ZA 3FL7A 4L0PA 2L9LA 5EJ1B 2YC2A 1J83A 2RJ2A 3DYPA 3LE0A 2J1VA 4BDVB 2VC9A 2Y6LA 1GOGA 2J1TA 4ZZ5A 4RN5A 1WCQA 1OD3A 4QDSA 5IFPA 3F2ZA 1W8OA 4DXSA 5LA1A 1UMHA 1UY1A 1JI6A 3K46A 2JD9A 4DUVA 2E31A 4CVUA 2E32A 3GXUA 3K4ZA 1JZ5A 4MGSA 2B4KA 1I5PA 4A44A 3I2KA 3C7HA 4P5YA 5JXIA 3NJVA 2J1SA 4D8MA 2WABA 3LQCA 2VMDA 5EIYB 3A23A 5DQ0A 4XUNA 3I2FA 2VZUA 2V5DA 3IAQA 3BN6A 3I2GA 4JX0A 2HLEA 5J1XA 5DPNA 2ZXQA 3HJRA 1JHJA 2QQLA 3DYMA 5G04L 5LA0A 3MUZ1 2WBKA 2J7MA 5HPOA 5JMOA 2JKXA 4ZY9A 2BGOA 4M4PA 2C4XA 1UYZA 2YG0A 4XUPA 2VZ3A 3JXSA 4A45A 2JDAA 1L7RA 2VZ1A 2QQIA 3CZJA 4PQQA 4JKKA 1CZTA 3U37A 4KI5M 3THDA 2BZDA 3LPGA 4LPLA 1PX3A 3MV01 2W47A 4CU7A 2CDPA 2VQTA 3NJXA 3EB7A 3HOBA 1TVGA 5C7GA 2W3JA 4M4RA 2J1UA 2WAAA 5IFTA 3HEIA 5JUVA 2BERA 1US3A 2Y6JA 2BBAA 4RYDA 3VDBA 1UY4A 1JYNA 2WYSA 1MPXA 3T2PA 1UXXX 1XNTA 2W9XA 2X10A 3J7HA 5JR2A 2WDBA 4QX1A 4UAPA 4ZZ8A 4CUAA 1W9TA 2EICA 2XONA 4A41A 3WF1A 4DEQA 3NQHA 3HNBM 4OMDA 3SKJE 2ZEYA 3WNLA 5LA2A 4TXWA 4JHZA 1UY3A 4E8CA 2PQSA 2QQOA 3ECQA 5CZKA 4XVHA 2X09A 2LW8A 3W5NA 2ID4A 1JYXA 2Z4FA 2YC4A 1US2A 2W92A 1JZ7A 3HNYM 3OBAA 2VZVA 3A7QA 3WQBA 3HN3A 4PT6A 3MUY1 5B4XA 2VZSA 1SG3A 2W5FA 1UYYA 2VCBA 1JYVA 4JKLA 1GQPA 4DEVA 1SHWB 3ZM8A 2DCJA 2W1QA 3T0AA 3LPFA 2WN3A 1DLCA 4MADA 2W95A 4GWIA 2DDUA 1R64A 3AC0A 3CDZB 2Y8KA 4GZ9A 2EIEA 4QX3A 4KMQA 1GNYA 2CDOA 2RVAA 1UY2A 4W50A 5JXJA 2XQXA 4DUWA 3C7GA 3DECA 2QBXA 3OG2A 3EYPA 1SDDB 1JU3A 1P8JA 3K75B 4QDRA 4JKMA 3SEEA 2VO5A 4MO3M 5DMYA 2WN2A 1W99A 2VZQA 5G05L 1OT5A 5C71A 1JZ2A 3C7FA 3HPNA 4ARXA 4QB6A 4BK5A 2VOTA 3WEZA 2VL4A 1TG7A 4A3ZA 1EUTA 2VMCA 3MO4A 2Y6KA 2W87A 3WSOA 4BK4A 2Y6HA 3OGRA 2WZEA 4HG6B 4AG4A 3ABZA 4LQRA 3WNNA 2QQNA 5JXGA 2VM9A 3LEIA 3VD7A 2OKXA 3ACIA 1GUIA 2VCCA 2J22A 3GM8A 3T0BA 1PMHX 3WF4A 2V72A 1ULOA 4QDQA 5I0DA 2VMEA 2VZRA 4P02B 1GU3A 3CQOA 4UOJA 3T09A 3A22A 2WO1A 2WAOA 3K4DA 4LHSA 2XOMA 2J1EA 1XNAA 2VJXA 4CU6A 1CIYA 2C9KA 5DN2A 2J1AA 3I3BA 4QB2A 1UMIA 3ACGA 4A4AA 2WO2A 4P00B 1K42A 1UWWA 3I97A 3NRUA 1NKGA 2ZEXA 4CUBA 3D3AA 2EIDA 4XUOA 3FHQA 4QAWA 3ACHA 3ACFA 2QQJA 1W8NA 3W5MA 4W8JA 1O8PA 2E26A 3FHAA 3UESA 1JZ6A 3OB8A 4ET7A 1RYYA 3GGLA 4QPWA 2ORXA 4XZUG 5C70A 2LS6A 5JXHA 2WQ8A 1H6YA 2W1UA 4QX0A 1UY0A 4OUEA 4UI9L 3T0DA 2W91A 1L7QA 2EIBA 1GOFA 1KGYA 2W1SA 3WNOA 4A42A 5CYYA 2R7EB 1WKYA 2RV9A 4QX2A 4XURA 3FN9A 2C26A 3PUHA 3I2HA 5IHRA 2VR4A 2KD7A 3I3EA 1GOHA 3T2QA 4BJ0A 1UX7A 4OZOA 3VD5A 5LCWL 3C8XA 1T2XA 3IAPA 4A6OA 1EUUA 3SKVA 3LEGA 1W9SA 1W0NA 3OEAA 3HNMA 2VCAA 3VD4A 1F4HA 3CZUA 1CZVA 1JZ4A 2XHNA 2YB7A 1D7PM 4CU8A 4D0QA 4XUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FI9 A;  4YPJ A;  4ARY A;  2WZ8 A;  3UET A;  3OEB A;  1UXZ A;  2YFZ A;  2VZO A;  4ZXE A;  1O8S A;  5A1A A;  3MV1 1;  2VZT A;  2WUH A;  3CMG A;  2VQU A;  4LKS A;  1XC6 A;  2QQK A;  4AAX A;  4MOA A;  1YQ2 A;  3C7O A;  3E1F 1;  3A21 A;  1UYX A;  1CZS A;  1GMM A;  1PMJ X;  2ORZ A;  1O59 A;  1K45 A;  1K3I A;  1OF3 A;  1ULP A;  3P1I A;  3LEK A;  4PF1 A;  5IJR A;  5F7U A;  3ETP A;  4CUC A;  4DXR A;  4Z2A A;  2Y6G A;  2X05 A;  3K4A A;  4TTG A;  3C7E A;  1JU4 A;  1KEX A;  4BXS V;  2VZP A;  3T2O A;  2DCK A;  3VDA A;  1DYO A;  2E33 A;  3WF2 A;  1JZ3 A;  1NX9 A;  4XUQ A;  4OMC A;  1H6X A;  2W94 A;  5FUI A;  4OYU A;  2B9V A;  1DP0 A;  2W46 A;  3IB3 A;  3I3D A;  2JE8 A;  1IQD C;  2J1R A;  3WF3 A;  2W1W A;  4DUX A;  1NAE A;  2BGP A;  4QB1 A;  4KWU A;  3III A;  3NNG A;  3DYO A;  1K12 A;  1JYW A;  3PUI A;  3WNP A;  1XPW A;  5IYY A;  3WF0 A;  3VD9 A;  4MGQ A;  3I2J A;  1UZ0 A;  2YFU A;  3UNP A;  1BHG A;  5EJZ B;  1NUK A;  2Y64 A;  3MBW A;  1HN1 A;  2ZEW A;  3BGA A;  1PX4 A;  4CU9 A;  1J84 A;  3OGV A;  3CKH A;  3T08 A;  2VTF A;  3VD3 A;  2VMF A;  5HXM A;  3P6B A;  3GDB A;  3OGS A;  5B4N A;  4DXT A;  3I2I A;  3WNK A;  2ZEZ A;  2HYX A;  3CIH A;  1OH4 A;  1F4A A;  3WNM A;  1CX1 A;  3THC A;  3VDC A;  2V4V A;  4GWJ A;  4P08 A;  3K77 A;  3SEP A;  2QQM A;  2WO3 A;  1OF4 A;  1W9W A;  1LNS A;  4E8D A;  3IDA A;  4IUG A;  1JZ8 A;  4W4Z A;  3FL7 A;  4L0P A;  2L9L A;  5EJ1 B;  2YC2 A;  1J83 A;  2RJ2 A;  3DYP A;  3LE0 A;  2J1V A;  4BDV B;  2VC9 A;  2Y6L A;  1GOG A;  2J1T A;  4ZZ5 A;  4RN5 A;  1WCQ A;  1OD3 A;  4QDS A;  5IFP A;  3F2Z A;  1W8O A;  4DXS A;  5LA1 A;  1UMH A;  1UY1 A;  1JI6 A;  3K46 A;  2JD9 A;  4DUV A;  2E31 A;  4CVU A;  2E32 A;  3GXU A;  3K4Z A;  1JZ5 A;  4MGS A;  2B4K A;  1I5P A;  4A44 A;  3I2K A;  3C7H A;  4P5Y A;  5JXI A;  3NJV A;  2J1S A;  4D8M A;  2WAB A;  3LQC A;  2VMD A;  5EIY B;  3A23 A;  5DQ0 A;  4XUN A;  3I2F A;  2VZU A;  2V5D A;  3IAQ A;  3BN6 A;  3I2G A;  4JX0 A;  2HLE A;  5J1X A;  5DPN A;  2ZXQ A;  3HJR A;  1JHJ A;  2QQL A;  3DYM A;  5G04 L;  5LA0 A;  3MUZ 1;  2WBK A;  2J7M A;  5HPO A;  5JMO A;  2JKX A;  4ZY9 A;  2BGO A;  4M4P A;  2C4X A;  1UYZ A;  2YG0 A;  4XUP A;  2VZ3 A;  3JXS A;  4A45 A;  2JDA A;  1L7R A;  2VZ1 A;  2QQI A;  3CZJ A;  4PQQ A;  4JKK A;  1CZT A;  3U37 A;  4KI5 M;  3THD A;  2BZD A;  3LPG A;  4LPL A;  1PX3 A;  3MV0 1;  2W47 A;  4CU7 A;  2CDP A;  2VQT A;  3NJX A;  3EB7 A;  3HOB A;  1TVG A;  5C7G A;  2W3J A;  4M4R A;  2J1U A;  2WAA A;  5IFT A;  3HEI A;  5JUV A;  2BER A;  1US3 A;  2Y6J A;  2BBA A;  4RYD A;  3VDB A;  1UY4 A;  1JYN A;  2WYS A;  1MPX A;  3T2P A;  1UXX X;  1XNT A;  2W9X A;  2X10 A;  3J7H A;  5JR2 A;  2WDB A;  4QX1 A;  4UAP A;  4ZZ8 A;  4CUA A;  1W9T A;  2EIC A;  2XON A;  4A41 A;  3WF1 A;  4DEQ A;  3NQH A;  3HNB M;  4OMD A;  3SKJ E;  2ZEY A;  3WNL A;  5LA2 A;  4TXW A;  4JHZ A;  1UY3 A;  4E8C A;  2PQS A;  2QQO A;  3ECQ A;  5CZK A;  4XVH A;  2X09 A;  2LW8 A;  3W5N A;  2ID4 A;  1JYX A;  2Z4F A;  2YC4 A;  1US2 A;  2W92 A;  1JZ7 A;  3HNY M;  3OBA A;  2VZV A;  3A7Q A;  3WQB A;  3HN3 A;  4PT6 A;  3MUY 1;  5B4X A;  2VZS A;  1SG3 A;  2W5F A;  1UYY A;  2VCB A;  1JYV A;  4JKL A;  1GQP A;  4DEV A;  1SHW B;  3ZM8 A;  2DCJ A;  2W1Q A;  3T0A A;  3LPF A;  2WN3 A;  1DLC A;  4MAD A;  2W95 A;  4GWI A;  2DDU A;  1R64 A;  3AC0 A;  3CDZ B;  2Y8K A;  4GZ9 A;  2EIE A;  4QX3 A;  4KMQ A;  1GNY A;  2CDO A;  2RVA A;  1UY2 A;  4W50 A;  5JXJ A;  2XQX A;  4DUW A;  3C7G A;  3DEC A;  2QBX A;  3OG2 A;  3EYP A;  1SDD B;  1JU3 A;  1P8J A;  3K75 B;  4QDR A;  4JKM A;  3SEE A;  2VO5 A;  4MO3 M;  5DMY A;  2WN2 A;  1W99 A;  2VZQ A;  5G05 L;  1OT5 A;  5C71 A;  1JZ2 A;  3C7F A;  3HPN A;  4ARX A;  4QB6 A;  4BK5 A;  2VOT A;  3WEZ A;  2VL4 A;  1TG7 A;  4A3Z A;  1EUT A;  2VMC A;  3MO4 A;  2Y6K A;  2W87 A;  3WSO A;  4BK4 A;  2Y6H A;  3OGR A;  2WZE A;  4HG6 B;  4AG4 A;  3ABZ A;  4LQR A;  3WNN A;  2QQN A;  5JXG A;  2VM9 A;  3LEI A;  3VD7 A;  2OKX A;  3ACI A;  1GUI A;  2VCC A;  2J22 A;  3GM8 A;  3T0B A;  1PMH X;  3WF4 A;  2V72 A;  1ULO A;  4QDQ A;  5I0D A;  2VME A;  2VZR A;  4P02 B;  1GU3 A;  3CQO A;  4UOJ A;  3T09 A;  3A22 A;  2WO1 A;  2WAO A;  3K4D A;  4LHS A;  2XOM A;  2J1E A;  1XNA A;  2VJX A;  4CU6 A;  1CIY A;  2C9K A;  5DN2 A;  2J1A A;  3I3B A;  4QB2 A;  1UMI A;  3ACG A;  4A4A A;  2WO2 A;  4P00 B;  1K42 A;  1UWW A;  3I97 A;  3NRU A;  1NKG A;  2ZEX A;  4CUB A;  3D3A A;  2EID A;  4XUO A;  3FHQ A;  4QAW A;  3ACH A;  3ACF A;  2QQJ A;  1W8N A;  3W5M A;  4W8J A;  1O8P A;  2E26 A;  3FHA A;  3UES A;  1JZ6 A;  3OB8 A;  4ET7 A;  1RYY A;  3GGL A;  4QPW A;  2ORX A;  4XZU G;  5C70 A;  2LS6 A;  5JXH A;  2WQ8 A;  1H6Y A;  2W1U A;  4QX0 A;  1UY0 A;  4OUE A;  4UI9 L;  3T0D A;  2W91 A;  1L7Q A;  2EIB A;  1GOF A;  1KGY A;  2W1S A;  3WNO A;  4A42 A;  5CYY A;  2R7E B;  1WKY A;  2RV9 A;  4QX2 A;  4XUR A;  3FN9 A;  2C26 A;  3PUH A;  3I2H A;  5IHR A;  2VR4 A;  2KD7 A;  3I3E A;  1GOH A;  3T2Q A;  4BJ0 A;  1UX7 A;  4OZO A;  3VD5 A;  5LCW L;  3C8X A;  1T2X A;  3IAP A;  4A6O A;  1EUU A;  3SKV A;  3LEG A;  1W9S A;  1W0N A;  3OEA A;  3HNM A;  2VCA A;  3VD4 A;  1F4H A;  3CZU A;  1CZV A;  1JZ4 A;  2XHN A;  2YB7 A;  1D7P M;  4CU8 A;  4D0Q A;  4XUT A; 
#chains in the Genus database with same CATH topology
 4ARY A;  1W3V A;  2YGL A;  2WZ8 A;  2UY8 A;  3MPP G;  2BP6 A;  4KG0 A;  2DVB A;  1U0A A;  2Q1M A;  1QXJ A;  2YFZ A;  4MGK E;  2DUR A;  2XB6 C;  1LU1 A;  1WUV A;  3ZPO A;  5A1A A;  1F8V A;  3PL0 A;  1ZRD A;  4KU8 A;  4IE4 A;  4RS5 A;  2DUQ A;  2QQK A;  2DV9 A;  1WBL A;  1YQ2 A;  2XJS A;  2YBK A;  4Q1P A;  4COZ A;  2HWF 2;  2ZZJ A;  3RG0 A;  2OUH A;  3E1F 1;  2D6K A;  3A21 A;  1CZS A;  3QOP A;  2HBT A;  5A3T A;  3H50 A;  2PLV 2;  3ETP A;  4CUC A;  5C9A B;  3ZFE A;  1QDC A;  2WT2 A;  4N7U A;  4OUL A;  3BPZ A;  5F3E A;  1XU2 A;  3M3I A;  4GXL A;  1CAU B;  4BOW A;  3VZJ A;  1AUY A;  1LES A;  3C7E A;  1UOB A;  3FLP A;  4Y22 A;  1H1I A;  4GD4 A;  4Q0U A;  5LY2 A;  5GLZ A;  2VNV A;  3VGI A;  2DWR A;  3QCW A;  1VBC 2;  1OSG A;  4K7J A;  3VDA A;  1G6N A;  4R9C A;  1GFF 2;  4CP1 A;  5CIS A;  1NX9 A;  1BBT 3;  2R30 A;  4XUQ A;  4UW6 A;  4IEO A;  1H6X A;  1FX5 A;  4QXK A;  2W94 A;  2JB8 A;  4XJU A;  4XQD A;  4XXP A;  5L73 A;  3ZKY A;  2IFR A;  2B9V A;  1DP0 A;  3IB3 A;  1UMZ A;  2FMY A;  1QJU 1;  2JE8 A;  2YDE A;  3WF3 A;  2X8K A;  4LHL A;  2JD4 A;  2FCV A;  2BGP A;  4LBN A;  4NHX A;  4XE9 A;  2NP0 A;  4QB1 A;  2IVI B;  4DY3 A;  1HV0 A;  4BM8 A;  2WNU B;  5KC6 A;  5F5A A;  2PMW B;  1JYW A;  3WNP A;  2WLQ A;  5IYY A;  4JTN A;  4UW5 A;  1LHN A;  1B35 C;  1HW5 A;  1YFY A;  4YW4 A;  3I2J A;  5T5J A;  1OBN A;  5FYS A;  1QQP 3;  4WVM B;  5FZE A;  3MIF A;  1BHG A;  1UU6 A;  1KQR A;  4HVO A;  3ZFF C;  5T52 A;  5F8P A;  3ZN4 A;  3B9I A;  4CPB D;  1AR8 3;  1HN1 A;  3BGA A;  1W04 A;  1PX4 A;  2PA7 A;  2R04 3;  2WII B;  4QT6 A;  1YJL A;  3T08 A;  1TMF 1;  1DU3 D;  1FNZ A;  1J58 A;  1PIV 1;  3P6B A;  2Q8O A;  1VBC 3;  2V09 A;  4G3Y C;  3POF A;  4DXT A;  4PDW C;  3E97 A;  3WY6 A;  1OLR A;  1E57 A;  3B3Q E;  1O5U A;  3NV3 A;  3IBM A;  1ND2 C;  1OH4 A;  3AKS A;  3FX3 A;  5EYY A;  5AC9 2;  2ERF A;  1AR8 1;  1FNY A;  1RJ7 A;  5CVR A;  2V4V A;  4YGD A;  4WVV A;  5BNO B;  2XUE A;  5C8C B;  1ULG A;  1LOF C;  4XBN A;  4AI9 A;  2NN8 A;  2CY6 A;  3POI A;  5A6X A;  2ZGM A;  3T1M A;  3B01 A;  3INA A;  4QGN A;  3DPR A;  2FDG A;  5BPX A;  5JSP A;  4Q0V A;  2BGC A;  1QIQ A;  1LNS A;  1ND3 C;  2RJK A;  4LOS A;  5SV5 A;  3IDA A;  2WA4 A;  3N4M A;  1W06 A;  1W6O A;  3WP3 A;  1JTZ X;  2ZBJ A;  5IVJ A;  1OMI A;  3A4U A;  4S2F A;  1JZ8 A;  2AUY A;  3DPR B;  3DUI A;  5D1I A;  3U4X A;  3FL7 A;  1DIW A;  5A1F A;  2FDH A;  4L0P A;  1UAI A;  4OI2 A;  2ZPX A;  5EJ1 B;  5BV6 A;  5FFO C;  4YVW B;  1Q8O A;  2G9G A;  3WLU A;  4AFM A;  1MS8 A;  1PM7 A;  1QDO A;  2JWP A;  2RS3 1;  2VC9 A;  1MVE A;  1JOJ A;  2IXK A;  2Y6L A;  3RPQ A;  2J1T A;  3N9M A;  5KHG A;  1OQD A;  4ISR A;  3RRD A;  1ONA A;  3BTA A;  5A3P A;  1OD3 A;  1PGW 1;  4D7S A;  4LBQ B;  5F6K A;  5HI0 A;  2CL2 A;  4Y1Z A;  4A6S A;  1URX A;  3F2Z A;  1AR6 3;  1EAH 3;  3DEM A;  1W8O A;  3HVD A;  5F37 A;  1VRH 1;  2BTV C;  1AYM 1;  1QJY 2;  4LA3 A;  4LIV A;  1TNF A;  1S1A A;  4EYU A;  3WCS A;  1JI6 A;  1NA1 C;  4FPO B;  4GJZ A;  5EP9 A;  1REE A;  4DUV A;  1VBB 2;  5AC9 3;  3A0N A;  4CVU A;  1SCR A;  3K3N A;  3K4Z A;  1GR3 A;  4N90 A;  1JZ5 A;  5ACA 1;  2ENR A;  2A6X A;  4LO4 B;  4A44 A;  5EPA A;  2I07 B;  4GIQ A;  1ZRR A;  2AYH A;  2O14 A;  4IEP A;  4M0N A;  1C5I A;  5FWE A;  3I2K A;  5LBB A;  5L9B A;  1SZB A;  5LK5 A;  5I93 A;  2BVV A;  3VBO B;  1AX1 A;  1UU4 A;  4IEU A;  3NJV A;  4AXO A;  2J1S A;  5FLJ A;  3JQX A;  5CFD A;  2R04 1;  3SLI A;  2XML A;  5IVY A;  2E6V A;  3AYD A;  4QM8 A;  3AKT A;  3VBU C;  4F7Z A;  2V5D A;  1L7L A;  3FUO A;  1UW8 A;  4IEZ A;  2GND A;  3J26 N;  3WIN E;  4HK8 A;  2ZXQ A;  3N35 A;  4Y24 A;  1VBD 1;  4A3X A;  5FQ0 B;  5CIR A;  1ZBA 3;  3FJS A;  4DIN B;  4QGL A;  2WBK A;  2J7M A;  2XL7 A;  3VHP A;  5JMO A;  4MSV A;  2VTX A;  4SLI A;  4ATF A;  4CCL A;  1ZRE A;  4M4P A;  2PLV 3;  3KS7 A;  3OYW B;  3AZW A;  3RZM A;  1UYZ A;  4QPG B;  2WNV B;  4HMZ A;  5IW0 A;  4B7K A;  2P3J A;  2X5I A;  4GAZ A;  4YVS B;  2V5Y A;  1Z0H A;  1PGL 1;  1HIX A;  5I91 A;  5D8A A;  1APN A;  4EN0 A;  1D4M 3;  1QQP 1;  1RC6 A;  2PHU A;  2QQI A;  1W6O B;  1Y3T A;  4Q4X 2;  2YRO A;  2JIC A;  5L19 A;  2VG9 A;  4ZXK A;  1JYC A;  1CZT A;  1RJ8 A;  2OII A;  5L9R A;  3V56 A;  2X53 S;  1LHO A;  2VH9 A;  4YW2 A;  3PHM A;  4RHV 2;  2RG4 A;  3E6C C;  4I30 A;  4FFH A;  4PLM A;  1W8U A;  3MV0 1;  1NOV A;  2ZGS A;  4FPH A;  4D6Q A;  3VZL A;  4CU7 A;  4EN6 B;  1DGW A;  5GAL A;  3IMM A;  1VMJ A;  3BB6 A;  1V9U 1;  3KF5 A;  3M8L A;  1QJX 3;  1YYN A;  3VBS C;  4I02 A;  5HXV A;  3WX5 A;  1FAY A;  2ZGU A;  3NKG A;  3QLQ A;  3VDD B;  3GF6 A;  4YLZ A;  2J1U A;  5ACA 2;  1RMU 3;  1TNR A;  1WWY A;  3RMY A;  2P6C A;  5F3C A;  2DVD A;  2HKX A;  2Z2S B;  3NV1 A;  5FO8 B;  4P5H A;  2Y6J A;  1RUF 3;  4OUS A;  4RYD A;  4JRA A;  3T2P A;  3D4K A;  5JIU A;  1YCI A;  3ASI A;  2JDY A;  1CWP A;  2X10 A;  3AP5 A;  3J7H A;  2LRO A;  3NVC A;  3PJQ A;  4WM7 C;  4Q4V 3;  1ENX A;  2WDB A;  2EXH A;  3VBH B;  2PXJ A;  3QH7 A;  1R09 1;  1G9B A;  2JX9 A;  1QEX A;  1WW5 A;  4A7Y A;  1RGS A;  1UZV A;  3EBR A;  4CUA A;  2XON A;  4LO7 A;  4A41 A;  2C1F A;  1H8V A;  3WF1 A;  2E7A A;  2XJR A;  2D40 A;  2ZKL A;  2JG8 B;  5FO9 B;  3POE A;  1N3P A;  1OLQ A;  2XXZ A;  1HV1 A;  2MNG A;  3X29 B;  2BV4 A;  3K3O A;  3UJQ A;  5GZC A;  1D0H A;  1PO1 2;  1V0A A;  1GQH A;  1AX2 A;  4P9G A;  4FPE A;  1HXS 1;  3MI8 A;  1IG3 A;  1UY3 A;  5FPV A;  4GMP 1;  1HRI 2;  3S30 A;  5M0T A;  4IV3 C;  3WQ1 A;  3ECQ A;  3S7E A;  2KA3 A;  2X09 A;  2LW8 A;  5T55 A;  1C1F A;  5F39 A;  5FZH A;  5IVF A;  4NII A;  3MF9 A;  4ERO A;  1M4W A;  4BE3 A;  1JUI A;  2W92 A;  1IS5 A;  4YM2 A;  3RWK X;  1RUE 3;  1JZ7 A;  3NAP A;  3CO2 A;  4K40 A;  4M01 A;  2Q4S A;  2R04 2;  4AW7 A;  3WQB A;  4L9B A;  2IXC A;  3HBZ A;  3IMN A;  2WC2 A;  1AF9 A;  3I59 A;  4WM7 A;  1W2T A;  3TBD A;  3ZXD A;  5B4X A;  1D4M 1;  3VDD A;  5K7P A;  2VZS A;  2BDR A;  4LO8 A;  1SG3 A;  1YIF A;  4UWD A;  3IT8 A;  4C91 A;  4E4S A;  1S2K A;  4XF9 A;  1UYY A;  4GMP 0;  4KU7 A;  1J3Q A;  2ZHN A;  3HIF A;  3OSD A;  1ZYB A;  4J25 A;  4NRQ A;  1QWR A;  1RUI 1;  4Q29 A;  2EVX A;  1GQP A;  2JJ6 A;  1JMU B;  1SHW B;  3ZM8 A;  2HWD 3;  1ND3 B;  2DCJ A;  5FY1 A;  3NW4 A;  5K9Y A;  3LA7 A;  1LB2 A;  2GC3 A;  1KS4 A;  1GZW B;  2ZGQ A;  1EAH 2;  5AVP A;  4PJY A;  1AR6 2;  1NLS A;  4XFB A;  3AVR A;  4B3N A;  2UY9 A;  2RHP A;  3JD7 2;  2A6W A;  5A1L A;  3CF6 E;  1CD3 G;  5K0U A;  3CDZ B;  1GBG A;  2XH6 A;  4Q5O A;  3S5Q A;  3ZKU A;  4ASL A;  3KHC A;  2EIE A;  1POV 3;  1FPN 3;  1S4C A;  2XHK A;  2Z69 A;  5C9A C;  5CFC B;  3WG2 A;  1VAV A;  2XQX A;  3C7G A;  1V6I A;  4LA2 A;  3WDU A;  4QXH A;  1XNB A;  3GJA A;  1RUC 1;  4JC1 A;  3EYP A;  3PDQ A;  4CCD A;  5BY5 A;  1SDD B;  3IWZ A;  1K5J A;  2VOK A;  1P8J A;  1W2U A;  3K75 B;  2MEV 2;  4K9S A;  1Z7S 1;  4OHX A;  1NCR A;  2D3P A;  5JI7 A;  3SEE A;  4KNC A;  3ME2 A;  1H9P A;  2DUO A;  3VUO A;  2RDN A;  3OD0 A;  2DBN A;  5JAX A;  1W99 A;  1O3S A;  1YFU A;  2ARE A;  3MW2 A;  1LU2 A;  3JBG 3;  1JZ2 A;  3BUC A;  3HPN A;  1SLT A;  2FMD A;  4NVP A;  1RUH 1;  1BYH A;  4QB6 A;  2VE1 A;  4IGQ A;  4W6W A;  4XXA A;  4KG8 A;  1ULF A;  3EO6 A;  1YUD A;  2E51 A;  3E6B A;  5C8C A;  1BMV 2;  3C2U A;  2R06 3;  4D94 A;  1RMU 1;  2GH8 A;  2W87 A;  1GNH A;  4PI0 A;  4BK4 A;  2VOW A;  4HG6 B;  4JDM A;  4TN7 A;  3AL5 A;  4LUL A;  4AFB A;  4LQR A;  4BXF A;  2QQN A;  4KWK A;  3LEI A;  4CXY A;  3H8R A;  3NKT A;  1OVS A;  1PZ9 A;  4LIT A;  5F5I A;  3DCQ A;  4K8F A;  1X9T A;  4CXW A;  4H7M A;  2G1M A;  4DNY A;  2J22 A;  1LKN A;  1RUE 1;  4HT1 T;  2H6C A;  2V72 A;  1RL3 A;  4CEY B;  5AVA A;  5A32 A;  3H8U A;  2NMO A;  4E9K A;  4MGZ E;  1KDM A;  1RUG 2;  2VME A;  2ZJC A;  4P02 B;  3WHU A;  2O1Q A;  5T50 A;  4P9I A;  3H9A A;  5FK8 A;  4QPG C;  1FT9 A;  5DAW A;  5A80 A;  4DB5 A;  4FAG A;  5DDJ 2;  2J1E A;  1ZBA 2;  3LDR A;  1F15 A;  2RS5 3;  2RR1 3;  1CIY A;  3ZSL A;  4DOU A;  4F3J A;  1HDK A;  3O1O A;  1A8M A;  4M3C B;  1RUC 2;  1H8T A;  3TN9 3;  1QY4 A;  1UMI A;  3HQU A;  3ILF A;  4N9I A;  1JW6 A;  5CB7 A;  1UWW A;  1ZNP A;  3I97 A;  1AYN 3;  3GBW A;  3VL8 A;  4OQ8 A;  4LIU A;  1KJL A;  4X6Q B;  5AFB A;  4CEW B;  5I0U A;  4D6S A;  4DS0 A;  1BJQ A;  1D4M 2;  2PHW A;  1GKB A;  2Y33 A;  1QHD A;  3PJY A;  3I3M A;  3LWC A;  4QAW A;  1TME 2;  4WZC A;  3ACF A;  2DU0 A;  1W8N A;  1SDW A;  3FBY A;  5A7Q A;  5JIA A;  1RIN A;  1HJG A;  1NA1 B;  3KD4 A;  3O1M A;  3FFZ A;  2ZGR A;  5KR7 A;  3B94 A;  2BW8 A;  1BXH A;  2CWM A;  1IOA A;  4RS5 C;  3VKM A;  5IK7 A;  1CAX A;  1GWL A;  2Y26 A;  2QZ2 A;  3OB8 A;  4AFC A;  4ET7 A;  3GGL A;  4QPW A;  2ORX A;  2ET7 A;  4COU A;  1RVF 3;  5LB6 A;  4MH0 E;  4K20 A;  4AFD A;  2I45 A;  2NLR A;  1VMH A;  4CP9 B;  1QF3 A;  3ETQ A;  4AI8 A;  3FWE A;  2W1U A;  1RUF 2;  3AFG A;  1UY0 A;  4FPJ A;  4O7X A;  3VHN A;  2PYT A;  4UI9 L;  4BIO A;  3T0D A;  5F6L B;  3B69 A;  5IVE A;  2EIB A;  1SEF A;  4NRM A;  2DYC A;  2CSG A;  3WNO A;  4A42 A;  1JN2 P;  3CJI A;  3HR9 A;  1HRI 1;  2R7E B;  3OYW A;  4KL1 A;  2RV9 A;  1NLR A;  2SLI A;  3FN9 A;  2PAE A;  4FOV A;  3VZK A;  3WP4 A;  3L2H A;  1NYW A;  1NQJ A;  4FVV A;  1XYP A;  2RMU 2;  2VR4 A;  2Q30 A;  4QQH A;  4BQX A;  5KHJ A;  5FYB A;  3T2Q A;  3S5A A;  1FOD 3;  5KXB A;  1CAV B;  1UX7 A;  5DDJ 1;  4CCN A;  2UYB A;  2QJV A;  4Y1V A;  1R1A 2;  1ENQ A;  1V00 A;  4HAN A;  2Q8D A;  1T2X A;  1UIK A;  1WCK A;  2WNV C;  4IV3 B;  4N43 B;  1GIC A;  2C6S A;  4A6O A;  5I8Y A;  1EUU A;  4YW1 A;  5A7O A;  2VOV A;  3LEG A;  3SKV A;  1QH6 A;  4HKO A;  2VMH A;  4ZU7 A;  2XBO 2;  1A34 A;  3HNM A;  3H7Y A;  2X5I B;  2QQP A;  1F4H A;  2R6Q A;  3BU0 A;  1W6P B;  1YQ8 A;  3MIE A;  2WO7 A;  1W8T A;  2YB7 A;  2VW0 A;  2ZTN A;  3I4I A;  4LLO A;  1PO2 3;  1I6X A;  4D0Q A;  3PIG A;  4FI9 A;  5ABJ B;  2VNR A;  4YVS C;  1ZZC A;  3OEB A;  1UXZ A;  4MHU A;  1ZM1 A;  2BNN A;  2HWC 2;  3AX4 A;  2QCS B;  2VZO A;  4XFA A;  2K0G A;  2DVF A;  4Q4Y 2;  2JDK A;  2VZT A;  2YPD A;  5FYY A;  3GZT B;  1KRI A;  4CEW A;  2WUH A;  4JZR A;  4J1W A;  1HJF A;  3NNM A;  2RDQ A;  2VQU A;  1ZRI A;  4LO6 B;  3ZFE B;  5DAQ A;  4AAX A;  2WZR 2;  2AEY A;  2B7Y A;  4AZZ A;  2BWC A;  3H1Y A;  2WR9 A;  1UYX A;  2E63 A;  1RIR A;  1XE0 A;  1CAU A;  1PMJ X;  1MVQ A;  1QJE A;  2YU1 A;  3MYX A;  5IJR A;  4D7T A;  5T5L A;  1IG0 A;  3WZ1 A;  1IQA A;  1RUF 1;  1OOP A;  3GBF A;  4HN1 A;  4IGO A;  5FYC A;  5FMD A;  2A5Z A;  5FPX A;  4DXR A;  4Z2A A;  4IEY A;  2HWB 1;  1BVV A;  2GC1 A;  1OUX A;  4Y5S A;  3U1X A;  2PLV 1;  1G7Y A;  2XR4 A;  2X05 A;  3K4A A;  3V0A A;  5DUV A;  4TTG A;  4LUK A;  1BCX A;  5FP4 A;  3O1P A;  4IEX A;  4BU2 A;  2ZHL A;  1BK0 A;  3CL1 A;  1WW6 A;  3T2O A;  1LUL A;  1UD1 A;  2DCK A;  4CXX A;  1DYO A;  5JPN B;  3WF2 A;  2DBI A;  3VBH C;  2A3X A;  4OMC A;  1S0D A;  1Y7B A;  2DUP A;  3TEZ A;  2R0F A;  3HQX A;  3LA2 A;  4Q4W 1;  4YM3 A;  3MZH A;  3D82 A;  4LKE A;  5IK5 A;  1O91 A;  3CU7 A;  3I3D A;  1DDL A;  4EV0 A;  4Y1U A;  1IQD C;  1O5L A;  2J1R A;  1RUD 3;  4GQ7 A;  5FZ1 A;  4DUX A;  1NAE A;  4P14 A;  3AJZ A;  4LO5 B;  1U5Y A;  3III A;  4KWU A;  4QQL A;  1HKD A;  4WZF A;  4W6Y A;  3DYO A;  2C24 A;  3UKV A;  4HPK A;  4YM1 A;  5FLI A;  1NZI A;  4NRO A;  1XPW A;  1PIV 3;  1VBD 2;  1DG6 A;  1S0F A;  2P3Y A;  1DQ0 A;  4JAA A;  3HN1 A;  4MGQ A;  3VV1 A;  1QMJ A;  2XVG A;  3J7L A;  2YFU A;  4FFG A;  1RUH 3;  5FZ3 A;  3RYP A;  1JH5 A;  5EJZ B;  3H8X A;  1AXY A;  4M3C F;  1NE6 A;  1SLA A;  4H55 A;  2AR6 A;  4QQP A;  5A3L A;  4Z1V A;  3ZYB A;  1D4V B;  3NAP B;  3VHO A;  3OY8 B;  1J84 A;  5FPL A;  5KXC A;  1Q5O A;  2QZ3 A;  3CKH A;  3J4U H;  4AVS A;  2BUK A;  3PIJ A;  3N9O A;  4UYB A;  4MGT A;  4MXW A;  5LY1 A;  4CDQ B;  1UPS A;  3OGS A;  2WWS A;  3E5U A;  4YVW A;  2NM1 A;  3G7D A;  4AVT A;  3I2I A;  2BPA 2;  1I1E A;  3WNK A;  3OBZ A;  2ZEZ A;  1S0I A;  1ST8 A;  2GC2 A;  5KXE A;  3MIB A;  4OHY A;  1GQG A;  2Y6F A;  5JOW A;  3UKN A;  3T30 A;  1CX1 A;  3UKT A;  3THC A;  4N9H A;  3VDC A;  1MZE A;  5LRR A;  1DHK B;  1EV1 1;  4WV8 A;  1VBA 3;  5H9P A;  5EFU A;  2ZAC A;  3V0B A;  1GAN A;  3BTY A;  3AP9 A;  1GZW A;  2PFW A;  2QQM A;  3R4S A;  4HET A;  3TAY A;  1COV 1;  2YBP A;  3HD8 B;  3GYD A;  1NLQ A;  1W9W A;  3LOI A;  4UT5 A;  5LK7 B;  2WS9 3;  4Q1R A;  4X8P A;  5JCT A;  1FYU A;  3ENR A;  3DL3 A;  2FCT A;  4IUG A;  2XLA A;  4FXK B;  3TEY A;  3WDY A;  5A7P A;  4YGC A;  4AGV A;  1LTE A;  3N9P A;  5F3G A;  2F4L A;  1J83 A;  2PHR A;  2Q1Z B;  2RJ2 A;  5C4W B;  2J1V A;  4Z07 A;  4KH9 A;  4Z92 B;  3ZYJ B;  4KQ7 A;  1W2A X;  1DQ2 A;  2XWB B;  1HX6 A;  5SV8 A;  5C3S A;  5FDB A;  5C3P A;  1W0O A;  1XYN A;  3WQ7 A;  4AQS A;  1GOG A;  1UU5 A;  2LM3 A;  3O1S A;  1MZ6 A;  3OUH A;  1VB2 A;  2OZ6 A;  1NG0 A;  1PO1 1;  2VNG A;  3IZO A;  4IE0 A;  2OQ7 A;  3RQ0 A;  5IFP A;  4IE5 A;  3LSD A;  4M3C E;  2ZOE B;  3ELN A;  4PIY A;  1I9R A;  4BQ4 A;  1MS9 A;  1N47 A;  2WFP A;  5FXV A;  3ZFG B;  1FI2 A;  5BNQ A;  5JPM B;  5KXD A;  3I49 A;  3PVB B;  1AR7 3;  2IZW A;  4LKD A;  4OHZ A;  3CJI C;  4D3W A;  4HKW A;  1ZZ8 A;  3KCX A;  2VMI A;  1Q8Q A;  2FDK A;  4UFL A;  1J59 A;  2E31 A;  1VP6 A;  2E53 A;  4BHP A;  4CDU A;  4FAH A;  5J36 A;  3GXU A;  5T3N A;  4G9S B;  2GZW A;  4NPL A;  4XBL A;  4MGS A;  2B4K A;  4YZ5 A;  4AQ2 A;  1PGS A;  1VBB 3;  4NIG A;  1UOG A;  2Z42 A;  5GLW A;  1GZC A;  3C7H A;  3ZN6 A;  1IS3 A;  2VQ0 A;  4JCK A;  1HRI 3;  1I3H A;  1WD4 A;  4P5Y A;  4BH9 A;  3FUQ A;  4OVE A;  5JXI A;  3FHI B;  2WAB A;  2WFF 3;  1OXC A;  5FZD A;  3A23 A;  2D6P A;  4I0W B;  5DQ0 A;  3RI9 A;  4NWW A;  1OUS A;  1S0J A;  5T54 A;  3AJY A;  3VBF B;  4BWO A;  4RSU A;  2XVL A;  3BN6 A;  5EZW A;  1AXZ A;  4XDQ A;  1YJK A;  4I09 A;  5DZG A;  4GJY A;  5DPN A;  5FZ9 A;  3AKQ A;  2BFU L;  2W2I A;  1D2S A;  3QBQ A;  1JHJ A;  2O8O A;  2QQL A;  4LBO A;  4FOW A;  2OXB A;  3E5Q A;  4MYE A;  2EXJ A;  3DYM A;  3O7O A;  3MUZ 1;  4RFT 0;  4Y20 B;  4GAL A;  4YM0 A;  5G04 L;  2A1X A;  4Y22 B;  2OPW A;  5A70 A;  3WW4 A;  1Q43 A;  4ZY9 A;  5ERL A;  3FLT A;  1HQL A;  1PVX A;  1RIT A;  2B46 X;  2E7Q A;  3N9N A;  2JG9 B;  2YHJ A;  2YG0 A;  3KGL A;  4R9A A;  1RUI 2;  1RUJ 2;  4N53 B;  2JDA A;  2VD7 A;  2WJS A;  3ORJ A;  1ZBE 2;  4XFF A;  3U14 A;  4FSJ A;  4XEZ A;  4JGY A;  2HWE 2;  2VZ1 A;  3KCY A;  5FYM A;  4PQQ A;  1Q8V A;  4CDW C;  1BBT 2;  3GHN A;  3AMQ A;  4JKK A;  3ROU A;  1NE4 A;  3VBR B;  1REF A;  3ACL A;  3MLJ A;  1JBC A;  3MLK A;  1IPJ A;  2BZD A;  3N9L A;  1LJ7 A;  4S2H A;  4XFI A;  3O1U A;  5BNN B;  4LPL A;  2QDN A;  2GNM A;  1GWM A;  5IAT A;  1PX3 A;  3EHK A;  1N1S A;  2WL1 A;  3DV8 A;  3NJX A;  5ANQ A;  3SH4 A;  4RHV 3;  3WHT A;  2JDU A;  3A0K A;  4XF4 A;  1SBE A;  3ZYR A;  3DGT A;  1W9Y A;  2VPV A;  4JTO A;  1LEM A;  1W6Q A;  1A8D A;  2YYO A;  1XSQ A;  2VUJ A;  3MHZ A;  4M4R A;  3EJK A;  3HEI A;  3O0X A;  4Y4Y A;  3TNP B;  4L99 A;  4PI2 A;  1FPN 2;  4AVA A;  4DRV A;  2BER A;  1BKZ A;  5C3O A;  2AC1 A;  3FBM A;  1S0B A;  2WYS A;  2YMZ A;  3NJZ A;  1MPX A;  4XIK A;  4NAO A;  4QMA A;  1ASJ 2;  1BMV 1;  2OQ6 A;  3T3Y A;  3RJR A;  3MF6 A;  2YU2 A;  2RR1 2;  4WM8 A;  3SMH A;  4GKX A;  3FLR A;  3BTZ A;  3UJO A;  1F35 A;  4IQP A;  4QX1 A;  4DMI A;  1RUH 2;  4QGM A;  2JE9 A;  1V6O A;  5CU1 A;  3ST7 A;  4CRQ A;  1W9T A;  2EIC A;  1NCQ A;  3CLP A;  1FOD 1;  5A6Z A;  3RI8 A;  4XC9 A;  1XBF A;  5FZA A;  3KHB A;  4OMD A;  3B93 A;  4CDW A;  3SKJ E;  1C1L A;  1WMD A;  3WG3 A;  1TME 3;  5H9S A;  3D8C A;  5D8A C;  5LA2 A;  4XZP A;  2I74 A;  4JHZ A;  3VKF C;  5GZF A;  4RA0 A;  1IZ3 A;  1MQT A;  1PVC 3;  1R08 3;  5J3U A;  4JHT A;  4YW6 A;  4E8C A;  2CGN A;  5A3N A;  1IKQ A;  4LT5 A;  2RS5 1;  1R1A 3;  3OGG A;  4HVR A;  1KFU L;  2PQQ A;  3JQW A;  4C0H A;  5A7S A;  2EXI A;  1LEC A;  3LIH A;  3W5N A;  3ZXG A;  4JV4 A;  4OHW A;  4FOQ A;  3N7J A;  3SXW A;  5FKB A;  2NMN A;  5FYH A;  3ZO0 B;  3TEW A;  4AVB A;  5KC5 A;  2K9Z A;  4PCR A;  1WLC A;  4CE8 A;  2DFC A;  5GLV A;  3TB0 A;  5FZ4 A;  2PTM A;  2ZX1 A;  3NNJ A;  3USS A;  3NNF A;  1WMX A;  3HNY M;  1TQ5 A;  2JDP A;  1W39 A;  4M3C A;  4NJ4 A;  4XJZ A;  1T6G C;  4GKY A;  4HON A;  3N7K A;  3HN3 A;  3KV5 A;  4BMB A;  1TMF 2;  4XFH A;  1ZX5 A;  1ALY A;  3PUA A;  1ZRC A;  2FDJ A;  1V9U 2;  5LEJ A;  2P4E A;  1XQN A;  3IKW A;  4ITC A;  2EF6 A;  3IDC B;  4DEV A;  1JYT A;  5FUN A;  3R6S A;  2DF7 A;  3GAL A;  3NMB A;  2AH2 A;  1COV 3;  1DZQ A;  3ZFE C;  3VZM A;  1OH3 A;  4CZS A;  5A7W A;  4GWI A;  1LHV A;  2R32 A;  3B02 A;  4YRD A;  2DDU A;  4HXC A;  1DBN A;  2WS9 2;  3AYA A;  3KSC A;  1R64 A;  5I0T A;  4E4D X;  3ZXA C;  2XDV A;  1WLD A;  1MS3 A;  4KGG A;  1GNY A;  5JXJ A;  1UY2 A;  1HRV 1;  1WLW A;  4Z82 A;  5LBE A;  5FYI A;  2RDR A;  5A7W B;  1U5Z A;  1VR3 A;  3OG2 A;  1BLZ A;  5GM0 A;  4CDU C;  1CQ9 A;  1H2M A;  1B35 B;  4K6B A;  2ZS6 B;  4AHX A;  2ZX2 A;  4JKM A;  4JGZ B;  4B4Q A;  3ZFG C;  1PZ8 A;  1QJU 3;  2P17 A;  2WN2 A;  5K8S A;  4CCO A;  1AYM 2;  1QJY 1;  3MFC A;  5C71 A;  4WVM A;  1UO9 A;  1ZVF A;  2GP5 A;  4C1X A;  1H2L A;  1AR7 1;  2TEP A;  1CAV A;  1PGW 2;  2RE9 A;  1KS5 A;  1MQT B;  2XJU A;  2Q5T A;  3PLQ A;  4UXA A;  1W2N A;  4FXG B;  3M1H A;  2HWF 3;  5F32 A;  5C8W A;  1PHM A;  5CA6 A;  5A33 B;  3IPV B;  3ZXK A;  1EUT A;  1XNK A;  2Y6K A;  2RDS A;  2IVJ A;  1HLC A;  3OPZ A;  2VOX A;  1IPS A;  4UF0 B;  3OGR A;  4DXZ A;  1R1A 1;  1Q56 A;  2Y0O A;  3AZX A;  3ZMN A;  4IE7 A;  2VM9 A;  5FO7 B;  5CAD A;  3ZR5 A;  2NPI A;  5L7O A;  1BVP 1;  1WA4 A;  3ZXL A;  3VBF C;  3SH3 A;  3PNA A;  3N36 A;  1GUI A;  1V70 A;  2A73 B;  4Q4V 1;  4NUB A;  3GM8 A;  2XWJ B;  5ABJ A;  4CSW A;  4DZG A;  2OVU A;  1Y43 B;  1E5I A;  2BNM A;  3ZIW A;  3SC7 X;  1ZZB A;  3P3P A;  4YSF A;  2QNK A;  3E6D A;  1XNC A;  1NT0 A;  5FPA A;  4AGR A;  1ULO A;  2H0V A;  4XJA A;  3LEM A;  3KT4 A;  1S2B A;  3I3Q A;  5CAZ A;  3Q8E A;  3IIA A;  2VZR A;  3T09 A;  1GU3 A;  5FY5 A;  1RMU 2;  3VBU A;  2I2S A;  2WO1 A;  4LK6 A;  3O1V A;  3D0S A;  3K4D A;  4HKL A;  1X8E A;  4Q4X 1;  5GJ6 A;  2A70 A;  1S0C A;  1H30 A;  5LAT A;  2C9K A;  1C8M 3;  2J1A A;  4QB2 A;  1HQW A;  4MGY E;  1KIT A;  4FT8 A;  3NV2 A;  1Y4W A;  5FY7 A;  4D69 A;  5FRA A;  2XQR A;  3LSE A;  3AM2 A;  3NRU A;  3HWJ A;  4XHB A;  3WW3 A;  5I8T A;  1DGL A;  2ZEX A;  1YXW A;  3L2Y A;  4CUB A;  5LAS A;  3D3A A;  3FMG A;  5CKQ A;  5I0R A;  2UWA A;  4RQP B;  1AYN 2;  1RUD 1;  3FHQ A;  4GA9 A;  1HN0 A;  1YIP A;  3LKJ A;  4PLN A;  2JEC A;  1C5H A;  4LKF A;  1RED A;  1H9W A;  5HV0 A;  4E4Z A;  1WMF A;  4J6G A;  1ASJ 1;  5FZC A;  5HBA A;  3C3V A;  5FOB B;  4W8J A;  5E88 A;  4AGG A;  2E26 A;  3FHA A;  1YC6 1;  3KCC A;  3W9A A;  1RYY A;  5FUP A;  1ZZ6 A;  3BU7 A;  4O61 A;  4B4P A;  4QKD A;  4ZHN A;  1XJA A;  3W58 A;  2VXR A;  3AMN A;  3ZMO A;  4AOC A;  5EV7 A;  3T2T A;  2LS6 A;  2VGD A;  2Y60 A;  4AHZ A;  1OOP C;  2ZX4 A;  2WFF 2;  4F83 A;  1GYK A;  1V6M A;  4AHY A;  4R9D A;  2Q0A A;  1OA2 A;  4LTA A;  1L7Q A;  1GOF A;  4YW7 A;  4NIA A;  5KHK A;  5CBL A;  1KGY A;  1HB2 A;  3CHX A;  5FY4 A;  5BNP C;  3DXU A;  5FZG A;  1QU0 A;  2CTV A;  3O14 A;  4XUR A;  4XF3 A;  4NO4 A;  3I2H A;  1YEW A;  4KWL A;  5D8A B;  3VDD C;  2KD7 A;  5IHR A;  4TWT A;  1GOH A;  2WNE A;  3RYR A;  2O8Q A;  3EMR A;  4UBG A;  1RB8 G;  3E5X A;  3OUI A;  3UT0 A;  4NHL A;  4OZO A;  4DIQ A;  3VD5 A;  2FDF A;  2FQP A;  5LCW L;  4XAE A;  5DUW A;  2XGX A;  4YW3 A;  4YZ2 A;  4H3W A;  4CCM A;  3WDT A;  2UWB A;  4K1Y A;  5FBJ A;  1VRB A;  1BEV 2;  3IN9 A;  4QPG A;  1DZR A;  1NZC A;  2JDM A;  3UL2 A;  1UPI A;  3CNA A;  1SPP A;  5ACA 3;  2HEV F;  4A7K A;  2QDR A;  2A71 A;  3VD4 A;  1CZV A;  1JZ4 A;  3H3U A;  5L7O B;  5FZI A;  4XHX A;  1ODM A;  1D7P M;  1JUH A;  4CU8 A;  2LRP A;  1N1V A;  2GAL A;  1FAT A;  3NL1 A;  3VN4 A;  1SMV A;  1COV 2;  5FZO B;  1QOO A;  3HT2 A;  1WME A;  2HWB 3;  5LZ6 A;  3UET A;  1DLL A;  2ZGK A;  4FTS A;  4Q4V 2;  1DQ6 A;  4S2D A;  2HEY F;  3OBR A;  4HVQ A;  5J09 A;  1ZRF A;  4NID A;  4GH4 C;  4XJ8 A;  3R4U A;  1OQE A;  3I7D A;  4LKS A;  1PVC 2;  1R08 2;  2ARA A;  4RR3 B;  4NIH A;  1DYP A;  4Q0P A;  2XJP A;  4QPY A;  1PO2 1;  3C7O A;  2XJT A;  4QPI B;  3DPR C;  3V65 A;  5EQU A;  4MGI E;  4D7Y A;  1X8M A;  2ORZ A;  1O59 A;  1K45 A;  1K3I A;  4PF1 A;  1CON A;  2WS9 1;  3P1I A;  5H9R A;  1SFN A;  1MS4 A;  4YVW C;  4PF5 A;  4XJ9 A;  2JG8 A;  5JWP A;  1VE0 A;  4RR3 A;  1OA3 A;  3B9C A;  3KB5 A;  4KWJ A;  4IES A;  4BZ4 A;  4CDW B;  4AE2 A;  1OKQ A;  4Y5Z 0;  3U10 A;  5IAX A;  5JSR A;  1VLN A;  2Y6G A;  5A32 B;  3THT A;  5CEH A;  4PDW A;  2GP3 A;  2R06 1;  1KEX A;  2YZ4 A;  3JD7 1;  4MX3 A;  1EYB A;  2VZP A;  4V1P A;  4YG0 A;  1F5J A;  1QOS A;  5DDJ 3;  4P9W A;  1HRV 2;  5HCA A;  2YBS A;  3RYK A;  2WWU A;  2E33 A;  1CAW A;  4B1M A;  3BOW A;  2HH9 A;  1Z7S 2;  3NJY A;  3N9Q A;  4AFA A;  4BCU A;  2WYF A;  1POQ A;  3RMX A;  5I0S A;  3WUC A;  1LOC A;  2HWE 3;  5JDB A;  1KDK A;  3ZDV A;  2D5H A;  3FC0 A;  4OYU A;  4P9J A;  4AHW A;  4URA A;  4EE2 A;  3KT7 A;  2W46 A;  4X6R B;  2ARX A;  3RVH A;  1X50 A;  2RMU 1;  1C4R A;  3I8T A;  3POS A;  1HQN A;  4OLL A;  2XLG A;  4JDN A;  5F2W A;  3ZOI A;  4LR4 A;  5C9A A;  1G9A A;  4MXV A;  3MPB A;  2ADD A;  2OX0 A;  4TLF A;  5CKM A;  3PUI A;  1WW7 A;  2Q8E A;  3SNM A;  5IWF A;  3APB A;  5I8S A;  4BLI A;  4E2S A;  2HWD 1;  2Z79 A;  1ZZ9 A;  1UZ0 A;  2VCM A;  5IUQ A;  4AI2 A;  3LAG A;  4XDO A;  3ZR6 A;  4ZPI A;  2W52 A;  1NUK A;  1Q8P A;  2EA7 A;  3M3C A;  5A6Q A;  3J8F 1;  3MBW A;  1DGR A;  5FBZ A;  1RUO A;  2ZEW A;  5F5Q A;  5C5T A;  2VAU A;  3OGV A;  1YRZ A;  4CDX C;  5JLV A;  4XMA A;  1QJF A;  1RUE 2;  3EXU A;  4YGB A;  3U11 A;  4JRL A;  3MEP A;  4BYY A;  2NYY A;  2VMF A;  1CX4 A;  2ZGN A;  4EN7 B;  4EN9 B;  5HXM A;  1N1T A;  3B00 A;  5B4N A;  5C4W A;  3VKO A;  1MZF A;  4IXL A;  4RD7 A;  1JS9 A;  1HRV 3;  1MR5 A;  1VJ2 A;  2DFB A;  4FTE A;  5J96 B;  2NZ9 A;  1WCD J;  2ZA9 A;  5A7N A;  2QUO A;  2XKO A;  1GLH A;  1U5I A;  4LBM A;  3WNM A;  3U78 A;  1ULC A;  1YFW A;  1DFQ A;  4SBV A;  4P08 A;  1HB3 A;  4XFG A;  3K77 A;  1SCS A;  3AXD A;  1MS0 A;  2QVS B;  4FQ4 A;  4O9G A;  2WO3 A;  3R0R A;  4WVZ A;  1DQ4 A;  1YO8 A;  1OF4 A;  1VBA 2;  3CJX A;  3RJ2 X;  5JSO A;  5CFC C;  3O1T A;  3AP4 A;  1PO1 3;  1LGB A;  1C8M 1;  1FV2 A;  1F31 A;  4MV2 A;  4XF0 A;  5DZF A;  4CDU B;  1EV1 3;  1A6C A;  3OPT A;  4L8Q A;  3TNQ A;  4O65 A;  3AK0 A;  1W03 A;  4L97 A;  4UFJ A;  4LNV A;  3DYP A;  1PVC 1;  1R08 1;  1YQC A;  3LE0 A;  4BDV B;  2A3W A;  5L9V A;  4ATE A;  5DG1 A;  1QJZ A;  2DU1 A;  2K2S A;  2WQZ C;  2J42 A;  2Z5W A;  5GLT A;  3I2D A;  4L11 A;  4ZZ5 A;  3AZZ A;  1AJK A;  1PK6 A;  1PZ7 A;  1D2Q A;  4YAR A;  4NRP A;  4RN5 A;  5FK7 A;  4A7Z A;  1XND A;  5E1R A;  1TMF 3;  1AXK A;  5FZ7 A;  1F2N A;  5FZB A;  1FMD 2;  1R09 2;  2DTY A;  3BOD A;  3J8F 2;  1H0B A;  4A2U A;  4DXS A;  5LA1 A;  1UMH A;  1ULE A;  4MUV A;  3IPV A;  3K46 A;  1CIW A;  4JVA A;  4CEY A;  4Y20 A;  2JD9 A;  2BJS A;  1ND3 A;  3BI3 A;  5DAX A;  1VBE 3;  2E32 A;  4V2V A;  3NO8 A;  1WW4 A;  1I5Z A;  3UK9 A;  2P6H A;  1AR6 1;  1EAH 1;  3BPS A;  1JOD A;  3Q9O A;  5FMO L;  3H3L A;  1UQX A;  5FZM A;  4AI1 A;  2ATF A;  1BEV 3;  1J1L A;  1ND2 A;  1I5P A;  1BZW A;  5FKC A;  4QQO A;  3GCW A;  2WNU C;  4GB3 3;  2VU9 A;  4YZ4 A;  5DUX A;  3O0V A;  4XDP A;  4BB3 A;  4FPC A;  4Y5T A;  1LOF A;  2D6O X;  2B45 X;  1XXN A;  1X33 A;  2H6B A;  1RHI 1;  5C5U A;  2VMD A;  5EIY B;  3NWK A;  3MIC A;  3GNE A;  4LOT A;  4XUN A;  3WDW A;  3J7M A;  3WV6 A;  1LGC A;  1W28 A;  3LZZ A;  4UFK A;  4XCB A;  4E2G A;  2ZGP A;  3GZU C;  3I2G A;  4QXB A;  4AED B;  4JX0 A;  4LHK A;  5D2A A;  4NPR A;  1AZD A;  5J1X A;  2FHR A;  3AB0 A;  2Q8C A;  1UN1 A;  1BEV 1;  1RXG A;  3HJR A;  1K5M A;  2YC0 A;  3DKW A;  3DXT A;  2A75 A;  5IAV A;  5HPO A;  3ILR A;  1NA1 A;  1OFN A;  3M70 A;  1PIV 2;  1W6Q B;  1IS6 A;  2IXI A;  4IET A;  5T5P A;  3VHR A;  2JKX A;  2BGO A;  2PHX A;  3U75 A;  4J1X A;  5C3Q A;  5FP3 A;  5J7M A;  2C4X A;  4XUP A;  1JYI A;  3JXS A;  4A45 A;  1G9C A;  2BWA A;  3OF1 A;  1MEC 1;  3POG A;  4HL0 A;  4Y4R A;  1E5S A;  1HB4 A;  4XTP A;  2ETE A;  3WW1 A;  3NNL A;  1QJX 1;  4XAC A;  1EY2 A;  4OHV A;  4GUL A;  1UKG A;  4KI5 M;  4R8H A;  4RR3 C;  5LW9 A;  1H8T C;  5C33 A;  2D5F A;  4RGK A;  2D3S A;  3LPG A;  1S55 A;  2R06 2;  3ZVX A;  4W6X A;  2WNU A;  4B4R A;  3H8O A;  2CDP A;  2VQT A;  2RMU 3;  2WA3 A;  1CAX B;  4I3P A;  4R52 A;  5FP8 A;  3VLB B;  2MEV 3;  4COY A;  5J98 B;  3HOB A;  4R4Z A;  1H1M A;  1TVG A;  2P5B A;  1UNB A;  1QXR A;  5C7G A;  2W3J A;  3KZ4 C;  1LOA A;  2WT0 A;  1CJP A;  1KXG A;  1Y9G A;  2WAA A;  5C3R A;  3JBG 2;  1B09 A;  3VL9 A;  5IFT A;  2GSY A;  1KFX L;  5FZL A;  2BBA A;  3VDB A;  1SAC A;  1UY4 A;  3RGB A;  3D6E A;  5IVC A;  4JDO A;  1XNT A;  3ZYH A;  3JD7 3;  2IXH A;  4PQ9 A;  4EWD A;  1HXS 2;  1J3R A;  1SQ4 A;  3GHM A;  3Q8B A;  4UBH A;  3UV9 A;  4CP0 A;  1UF2 C;  1VIW B;  1X9P A;  2ES3 A;  4XFC A;  5JR2 A;  2YY1 A;  1SPP B;  5FJH A;  4UAP A;  2R1B A;  4ZZ8 A;  2RM2 1;  5A33 A;  3MIH A;  1PNF A;  3ZXE A;  3PUR A;  2QE3 A;  1AHS A;  3WQ0 A;  1OQ1 A;  2R49 A;  3USU A;  2ZEY A;  4GB3 1;  3WNL A;  3LDK A;  2C9A A;  1V6L A;  1H2N A;  1WBF A;  2VBP A;  3KV4 A;  4JGY C;  2X5I C;  5IVV A;  3OBT A;  4TXW A;  5JOZ A;  4NOT A;  2XJQ A;  4HFS A;  2PQS A;  2ARB A;  2FBE A;  3RSJ A;  2RR1 1;  3BVC A;  2V73 A;  4NHM A;  2W39 A;  3WD5 A;  4XVH A;  2JDZ A;  2B5H A;  1XE8 A;  5FPU A;  1POV 0;  2RS5 2;  1UZZ A;  2Z4F A;  4CDX B;  5JMC A;  3GZA A;  2YC4 A;  1AR9 2;  3U0Z A;  5F2S A;  1GNZ A;  2P3I A;  3F95 A;  4N53 A;  4IND A;  3V0A B;  2KM2 A;  2BBV A;  3OBA A;  2VZV A;  4U2A A;  2B39 A;  3HMY A;  5FZK A;  3A7Q A;  4AED A;  4I2O A;  1QJY 3;  1C3H A;  1SBD A;  2LUW A;  3ZX7 A;  4QHZ A;  4BQW A;  4Q0Q A;  5CFC A;  1VMF A;  3RZK A;  3ZYF A;  3WVJ A;  2WZR 3;  2RM2 3;  2IFW A;  2OYZ A;  2ZKN A;  2VUC A;  2WZP P;  1C8M 2;  4QU2 A;  1TEI A;  3ZYP A;  5AFE A;  2W5F A;  4TSV A;  5L7O C;  2GU9 A;  3PMS A;  3LFM A;  3FZ3 A;  2TUN A;  4CEW C;  1CN1 A;  1AL0 G;  1AYN 1;  3PVE A;  2O0O A;  1XU1 A;  1QQP 2;  3MW4 A;  4XW3 A;  5ABJ C;  1IHM A;  3RNS A;  4Q8L A;  5C6C A;  2UU8 A;  3TWI A;  2VVF A;  3T0A A;  3VBR C;  3JCI A;  3AZV A;  3LPF A;  3D5O A;  1DLC A;  4MAD A;  1OUR A;  1PK6 C;  5C8C C;  2W95 A;  4XET A;  5F3I A;  4LOR A;  2K46 A;  4K1Z A;  1DQ5 A;  2H0B A;  2HJI A;  3AC0 A;  3DKQ A;  3ON7 A;  5JI9 A;  1M06 G;  4WM8 B;  4GZ9 A;  1W6M A;  2CDO A;  3Q8C A;  2RVA A;  1H4H A;  4W50 A;  3SCF A;  3T4H B;  5ISL A;  2YPJ A;  2YV8 A;  2UWC A;  1VBC 1;  3DEC A;  3PTY A;  3U07 A;  2MPF A;  4FFI A;  1O4T A;  4LBQ D;  4QDR A;  5HCB A;  4QKB A;  1W6M B;  3PU3 A;  3P3N A;  5FQ0 A;  4ZS2 A;  4FQZ A;  4MO3 M;  4MXW B;  4KGQ A;  5FR3 A;  5DMY A;  3V64 A;  3ZPY A;  2VZQ A;  3ZFF A;  1QNW A;  5G05 L;  1LOE A;  2HYK A;  4HSL A;  3WDX A;  3C7F A;  5GZG A;  1FMD 3;  3GZE A;  1CPN A;  2D7F A;  4XYX A;  4B7E A;  3QAC A;  4LLF A;  2W0X A;  3VBU B;  2VL4 A;  2D98 A;  2JG8 C;  3MO4 A;  2CAV A;  2VMC A;  1RUI 3;  4MHR A;  3ES1 A;  2GDF A;  1WGP A;  2WZE A;  2A6Z A;  4LE4 A;  3VBR A;  1YNA A;  3ABZ A;  3UGH A;  4AG4 A;  4CDX A;  3USU B;  4ZON A;  3LIG A;  1FV3 A;  4CP2 A;  3VD7 A;  3ACI A;  1R09 3;  4LMF A;  1OPM A;  3OOX A;  4AL9 A;  1A3K A;  1IGO A;  2GNB A;  2AEZ A;  4NWV A;  4BA6 A;  3AVS A;  5BNP A;  1NCR C;  1GZ9 A;  3K48 A;  1XRU A;  1MAC A;  5EXO A;  3UGF A;  3WF4 A;  5CG8 A;  2CAU A;  4XQW A;  3ZSJ A;  4PIX A;  4QDQ A;  5DXD A;  3AKP A;  3SH5 A;  5I0D A;  1RUJ 1;  1XOY A;  2QQU A;  3OUJ A;  1V6N A;  4ZS3 A;  4UOJ A;  3CQO A;  4IEW A;  3A22 A;  1LED A;  2WAO A;  2XOM A;  5E16 A;  2VJX A;  3DN7 A;  2JDH A;  4ISQ A;  3WOG A;  3HQR A;  4RQP A;  1PO2 2;  1RUN A;  4PBO A;  3KLS A;  4IGP A;  4QM9 A;  4Q0S A;  1VAM A;  4P00 B;  1G86 A;  1VAL A;  3PVO A;  3RWN A;  3POY A;  4E4H A;  1X82 A;  4QXC A;  2P2K A;  4AI3 A;  4F8A A;  2D6L X;  1W2O A;  3M7A A;  4CA9 A;  3ACH A;  3QH6 A;  2RS3 2;  2CU5 A;  4RFR B;  2QQJ A;  4C1W A;  4YG6 A;  3W20 A;  1E5H A;  1VBE 2;  2A7A A;  4WBB A;  5E8A A;  2QTW B;  5HCH A;  3RFR A;  2FZ2 A;  2WKK A;  3ZN5 A;  1VPH A;  5DAP A;  3TYJ A;  5FMC A;  2GC0 A;  3Q8A A;  1JZ6 A;  4LBK A;  3TOJ A;  2WNV A;  1LEN A;  4FP2 A;  1FPN 1;  4UFI A;  3LFI A;  4FPY A;  4XZU G;  5BNO A;  3P5B A;  4ZU5 A;  1WCU A;  3OY8 A;  5C70 A;  4N43 A;  1OHF A;  3AP7 A;  1Y9Q A;  3B5L B;  3W21 A;  1SLI A;  3J8F 3;  5KHH A;  3LCP A;  1BK1 A;  1CVN A;  4R9B A;  2YGM A;  4HSJ A;  4XMI A;  2IXL A;  2PAK A;  5EYX A;  2OA2 A;  1XSR A;  3RZG A;  2P1B A;  1LOD A;  2ADE A;  4XIL A;  2W1S A;  2ZCW A;  2ZMN A;  4BQ3 A;  5LWB A;  4I0A A;  2P3K A;  4OQ9 A;  1LOG A;  1WKY A;  2IWG B;  2IUW A;  1OC1 A;  2HWD 2;  3HT1 A;  3VBF A;  1DCS A;  4FPF A;  3ZFF B;  1V6K A;  4JGY B;  4RGA A;  3M3Q A;  4FP3 A;  1LHW A;  4XIO A;  4BJ0 A;  3NST A;  1ULD A;  3AYC A;  4QHB A;  3VZO A;  1AL2 1;  1NCQ C;  3ATG A;  3KVA A;  1K5M B;  3PME A;  1LCL A;  2VUD A;  3JB8 A;  1ACC A;  2Y34 A;  4P9Y A;  2ZGL A;  3IAP A;  4N53 C;  2B9U A;  4L92 A;  4AED C;  1B35 A;  2YUE A;  2ZHM A;  4N8M A;  1OKO A;  2KXL A;  2XJV A;  4W65 A;  4CP9 A;  1AYM 3;  2FDI A;  1W0N A;  1OI6 A;  2OPK A;  3O12 A;  2R0H A;  2R07 3;  3OEA A;  4QWN A;  5H9Q A;  4FOY A;  2VCA A;  3LB9 A;  4YWA A;  4IV1 B;  3KQR A;  4XCA A;  4AQT A;  3CZU A;  4K3U A;  3ZXF A;  2XHN A;  5HV4 A;  3KWV A;  5A3U A;  1NQD A;  1L3J A;  1C8N A;  2QQW A;  4LHN A;  4QU1 A;  3WNX A;  3POW A;  4DY5 A;  4XUT A;  3RZH A;  1O3Q A;  5FMB A;  4MG2 A;  4YPJ A;  5A3O A;  2BRT A;  2FZ1 A;  3ILN A;  4AI0 A;  4CEY C;  2UYA A;  4IV1 A;  4DQA A;  4E27 A;  1OVP A;  5FMO S;  3W59 A;  4ZXE A;  1O8S A;  3MLL A;  3MV1 1;  2VBB A;  2R16 A;  3CMG A;  5FZF A;  2BQP A;  3S6P A;  3T1L A;  4FO9 A;  1ENR A;  1W3X A;  1XC6 A;  4H14 A;  4YZ3 A;  2CNA A;  3H1W A;  4IEV A;  4MOA A;  4GWM A;  5DAB A;  5CFD C;  4BLJ A;  1O3R A;  4R4X A;  1GMM A;  1SLL A;  1OF3 A;  1ULP A;  3LEK A;  5F7U A;  3JZV A;  5C4W C;  3I2O A;  3S7I A;  1V6J A;  1O6U A;  3AMP A;  1UX6 A;  1GWK A;  4M0H A;  4TLG A;  5FOJ B;  1IKP A;  1ZZ7 A;  1PK6 B;  1W6P A;  2D3R A;  4YG3 A;  2E7T A;  4L2N A;  5FY9 A;  2ZHK A;  1EPZ A;  5KWR A;  5L36 A;  1JU4 A;  1UZW A;  3WCR A;  4BXS V;  5BNN C;  2ZX0 A;  4Q26 A;  4QQ2 A;  4B29 A;  2IC1 A;  1X7N A;  4YFW A;  3AZY A;  2JG9 A;  2VVE A;  5JZG A;  3JB4 C;  3H3Z A;  1JZ3 A;  1FMD 1;  2PHT A;  1W8Z A;  1XE7 A;  2F17 A;  5FUI A;  1MS5 A;  3PU8 A;  2HEW F;  4OI1 A;  5K0U B;  4ES8 A;  3PUS A;  3RS6 A;  1RHI 2;  4EWA A;  2DTW A;  4RL7 A;  2UUR A;  2P34 A;  3ZSE A;  3VKN A;  1FXZ A;  1XYO A;  4AAP A;  5IK4 A;  5FY0 A;  2W1W A;  4B8E A;  4Q2F A;  5F9T A;  1GZT A;  1XB9 A;  4EZ4 A;  1OOP B;  1RUC 3;  3NNG A;  4I01 A;  4MET A;  2VBD A;  1J1T A;  1K12 A;  4HK9 A;  2A6V A;  3VBO C;  1AR7 2;  1OLM E;  3WF0 A;  3H1M A;  2VUA A;  3VD9 A;  4AWD A;  4CCE A;  3SCG A;  1YHF A;  4QX5 A;  2TNF A;  4N7I A;  4C0B A;  1AR8 2;  3UNP A;  5DAV A;  1H4G A;  1A78 A;  1DGW X;  2PHF A;  1STM A;  2Y64 A;  2LAL A;  3ITQ A;  2X29 A;  3OJB A;  3GCX A;  5JVV A;  1RUJ 3;  4CU9 A;  2RS1 2;  2WSU A;  5A3W A;  1N1Y A;  1UIJ A;  3VBH A;  1C28 A;  2VTF A;  3VD3 A;  2VY0 A;  3WP5 A;  1TME 1;  4M00 A;  1AR9 3;  3GDB A;  4Q4Y 3;  2PN5 A;  1UL9 A;  3WG1 A;  1FOD 2;  4Z2W A;  1YQ5 A;  4OI4 A;  5K4L A;  1JOB A;  2HYX A;  4MLO A;  2D43 A;  3CIH A;  1F4A A;  2CV6 A;  2BYV E;  3FE5 A;  4XOG A;  1ENS A;  3MIG A;  4Q4W 3;  2PHD A;  3ZLI A;  5J37 A;  1RUG 3;  4GWJ A;  4FTB A;  2VQA A;  4Y3O A;  3SEP A;  1Q3E A;  1Z78 A;  2D93 A;  4AK3 A;  2ZZQ A;  3H7J A;  2EXK A;  2GH2 A;  4IE6 A;  3EQE A;  3HAG A;  3AKR A;  4E8D A;  3WUD A;  4S2G A;  3ZDS A;  4XF1 A;  5IT6 A;  1NY7 2;  1Q8S A;  1TZO A;  1VBA 1;  2SBA A;  4Q8K A;  4RS5 B;  4W4Z A;  3KQ4 B;  2HWC 3;  2V4A A;  4KBB A;  2L9L A;  3BYW A;  2YC2 A;  1LHU A;  2MEV 1;  2BVB A;  4Z8B A;  4H7L A;  3AMM A;  1EV1 2;  1N3O A;  4YFZ A;  2A3Y A;  2HWB 2;  2QQV A;  4BQY A;  4LE3 A;  1QOT A;  3KGZ A;  1G9D A;  3N3H A;  5FV3 A;  4ONU A;  3OPW A;  4JQR A;  2GMM A;  5T5O A;  4OI0 A;  1RTV A;  4WM7 B;  2JE7 A;  2TBV A;  2VXJ A;  2DVA A;  4Q27 A;  1WCQ A;  2RM2 2;  4QDS A;  2RS3 3;  4P9X A;  4QX7 A;  4LUM A;  5JOY A;  2XKP A;  1EPW A;  3WG4 A;  1F5F A;  5APA A;  4YZ1 A;  3RDI A;  1MEC 3;  1UYP A;  2GME A;  4WM8 C;  5B2G B;  1UY1 A;  2VW2 A;  4MZU A;  1GP4 A;  2ILM A;  4AQ6 A;  3AMH A;  3CBN A;  5JZG B;  2E9Q A;  2GNT A;  1OFS A;  1AL2 3;  3WW2 A;  4XTM A;  2KR2 A;  4FPL A;  4QHO A;  1V9U 3;  2PEL A;  1JXN A;  1E5R A;  2R1D A;  3MGU A;  2JEM A;  4NMI A;  4BME A;  3O1R A;  3LF7 A;  4BQ2 A;  1UOF A;  1WLT A;  2GN3 A;  3VB9 A;  5KBF A;  2D44 A;  3FFQ A;  5BXX A;  4EN8 B;  3UYJ A;  3WDV A;  5GZE A;  1POV 1;  5KHI A;  1PGL 2;  2IXJ A;  5FJK A;  2WZR 1;  2ZGO A;  4D8M A;  3LQC A;  1S0G A;  1UOJ A;  2GAU A;  1DZT A;  1TE1 B;  1W8F A;  4AVV A;  1MS1 A;  5DZE A;  4EJR A;  1CAW B;  1JOP A;  2G9F A;  2CYF A;  3I2F A;  4FPK A;  2VZU A;  1SLB A;  2HWE 1;  3IAQ A;  4AR2 A;  5ANN A;  4EWE A;  2HLE A;  1BBT 1;  4JGZ A;  1AR9 1;  1NCR B;  1W8H A;  4AEK A;  3M4F A;  1WA6 X;  2PAM A;  4X8N A;  5GKA C;  2BNO A;  2Y38 A;  2AEN A;  4NR1 A;  4CPB A;  1RVF 1;  4IV1 C;  1LR5 A;  3BCW A;  4FBF A;  5LA0 A;  5FXZ A;  4IV3 A;  3GJB A;  4BQ1 A;  2B8M A;  2VTX J;  3PUQ A;  2RJL A;  3H0O A;  4NPM A;  1DF0 A;  2WSV A;  4Q4X 3;  2VZ3 A;  4RQP C;  1RUG 1;  3BAL A;  4C8D A;  3LA3 A;  2R07 2;  2QFE A;  2ZAH A;  3SCH A;  2D6N A;  4G4F A;  4LJH A;  1VRH 3;  3WXP A;  1LRH A;  1L7R A;  4BPZ A;  2ZAA A;  3AP6 A;  4ES9 A;  4RHV 1;  3CZJ A;  4EQV A;  2D6M A;  3KMH A;  1Z7S 3;  4B1L A;  5EHD A;  2XPJ A;  1QGL A;  4COV A;  3U37 A;  1VBD 3;  1PMI A;  3JUU A;  4XQ4 A;  3THD A;  1QJX 2;  4TYS A;  1OLM A;  1AX0 A;  2WNO A;  5IVB A;  3R4D B;  1VB4 A;  2W47 A;  2XLF A;  5FYV A;  2VW1 A;  1KJR A;  5FYT A;  3ZYI B;  3CEW A;  3EB7 A;  3MDP A;  4BQ5 A;  3ZSM A;  5FWJ A;  5TSW A;  1O7F A;  4NAM A;  2XBO 3;  4HZF A;  2JXA A;  2BFU S;  4Y33 A;  5JUV A;  1MZ5 A;  2HBU A;  5FZ8 A;  1JHN A;  2JB4 A;  3MID A;  1US3 A;  4JGZ C;  4IL7 A;  1JYN A;  1H1A A;  1H2K A;  1G9F A;  4HBN A;  1UXX X;  1QKQ A;  4PIZ A;  2W9X A;  4XAA A;  2ARC A;  2BU9 A;  2YXS A;  2PHL A;  3KV6 A;  1O4Z A;  5K0U C;  4K8R B;  4BIF A;  2ZX3 A;  2OZJ A;  3AXE A;  4XBQ A;  3QD6 A;  1RXF A;  1S0E A;  4U36 A;  1QNY A;  2FCU A;  3NV4 A;  1AVB A;  3K51 A;  4H2A A;  5FAX A;  5LBC A;  5JR7 B;  4UW3 A;  4Y1X A;  1VRH 2;  4D6R A;  4DEQ A;  5FXW A;  1EP0 A;  2WRA A;  3HNB M;  1PNG A;  3NQH A;  4DO0 A;  1RUD 2;  3TRS B;  1ODN A;  2W08 A;  4AEM A;  4NN0 A;  5E6H A;  4K21 A;  3JU9 A;  1IS4 A;  4NHY A;  1VBB 1;  2FD8 A;  2ET1 A;  2D97 A;  3KV9 A;  2OT7 A;  4CCC A;  1IPK A;  1WD3 A;  2R07 1;  1SLC A;  2VVD A;  3BOP A;  4NE9 A;  5FZ0 A;  4FFF A;  4CDQ C;  3S57 A;  1K5M C;  2QQO A;  4LXL A;  4QD2 A;  4AVC A;  4PBP A;  4URT A;  3BIE A;  5FXX A;  5CZK A;  3TN9 2;  1G8W A;  2BOI A;  4UFM A;  2ID4 A;  5FP9 A;  1AJO A;  3VKL A;  4GMP 3;  3WP6 A;  3SQO A;  1JYX A;  2CGP A;  3O5S A;  2JKB A;  5LBF A;  3H42 B;  5BNO C;  3ES4 A;  3I54 A;  1US2 A;  4OZX A;  4BIS A;  5CFD B;  3AL6 A;  1NCQ B;  1U12 A;  5DG2 A;  4RGG A;  1CJD A;  1YFX A;  4QPI C;  2OUJ A;  4YW5 A;  3M3O A;  4IW3 A;  2RS1 3;  2ZAB A;  4FCA A;  4O9E A;  5EWS A;  1PM4 A;  5FY8 A;  4PT6 A;  3LOB A;  4JQT A;  3MUY 1;  1ND2 B;  2G9Z A;  4E2Q A;  4CDQ A;  4HN0 A;  1NY7 1;  4I3G A;  3N7M A;  1SBF A;  3ZFG A;  5FPB A;  2HWC 1;  4AF9 A;  2WWJ A;  2EAA A;  4QKF A;  2VCB A;  3ZN6 B;  4XPV A;  4ASM B;  1LGN A;  1RVF 2;  1ZBE 1;  1CR7 A;  3U4S A;  4FPG A;  3IM0 A;  4IDZ A;  4UFH A;  3I59 B;  4JKL A;  1YLL A;  1JYV A;  2NQY A;  2BOJ A;  3LDB A;  4PDW B;  2DCT A;  1DGR N;  1Y9M A;  4CTE A;  3G6J B;  5J48 A;  3RZL A;  1ZBA 1;  2BEO A;  2W1Q A;  1WCS A;  5FYZ A;  1VBE 1;  3V0B B;  1H8T B;  2WN3 A;  4GH4 B;  1ZA4 A;  2JIG A;  5BUV A;  2CGO A;  1NXD 1;  2DCY A;  2Y0I A;  4PHZ A;  4V2W A;  1ASJ 3;  2ZML A;  1BQP A;  1X36 A;  1CES A;  4ASK A;  1YI9 A;  1J3P A;  3AFK A;  5A3M A;  2Y8K A;  5FRE A;  3R05 A;  4MVT A;  4QX3 A;  4KMQ A;  2XL9 A;  3WT3 A;  3TEX A;  5FZO A;  1W0P A;  4DUW A;  2QBX A;  4HOO A;  4Q4W 2;  4IER A;  1YQ6 A;  1QXP A;  1T6B X;  2VEC A;  5FYU A;  1JU3 A;  2B42 B;  1W90 A;  3VZN A;  3TN9 1;  2VO5 A;  3ALQ A;  3L9J T;  3Q8F A;  4OFG A;  4QX8 A;  3KF3 A;  1RHI 3;  3HBK A;  5BNP B;  4COW A;  3MW3 A;  2C5D A;  4ZKT B;  5A6Y A;  1OT5 A;  5BNN A;  2AZ5 A;  2G4I A;  4LBQ A;  4Y1Y A;  4ARX A;  2VUL A;  5FP7 A;  4BK5 A;  2VOT A;  3WEZ A;  2XVK A;  5HCF A;  3O0W A;  4CYD A;  4CCJ A;  4WVW A;  1TG7 A;  5FTT C;  4A3Z A;  3D0J A;  3WSO A;  3CJI B;  2Y6H A;  4N43 C;  1AL2 2;  1UKR A;  3BIW E;  5JXG A;  3WNN A;  1F9K A;  4LBJ A;  1O4Y A;  4XAB A;  3RZZ A;  4LK7 A;  3B7M A;  1UCX A;  2OKX A;  1DYK A;  2VCC A;  1YI7 A;  1LOB A;  2JG9 C;  5JZG C;  4LEJ A;  5F5C A;  5FZ6 A;  3T0B A;  1PMH X;  1W05 A;  2DCZ A;  1W8W A;  5IK8 A;  2CWS A;  4AYU A;  2F4P A;  4DFS A;  2JIJ A;  2HWF 1;  4DPN A;  3ZSK A;  2LTN A;  5JOX A;  2N7G A;  1QH7 A;  5AC9 1;  3KT1 A;  1GP6 A;  1OPO A;  2XBO 1;  4LHS A;  2ZGT A;  3IDB B;  1GP5 A;  1XNA A;  4GWN A;  3MFA A;  3WR0 A;  5LRS A;  4CU6 A;  1OD5 A;  5D21 A;  1KD7 A;  5DN2 A;  4UF0 A;  1GV9 A;  3I3B A;  4LBL A;  3VBO A;  2Q1F A;  2DVG A;  4ORF A;  1N3Q A;  5DUU A;  2F6B A;  3ZIX A;  2EIG A;  4GH4 A;  3ACG A;  4A4A A;  1HXS 3;  1SFY A;  2AAC A;  2WO2 A;  1C57 A;  1K42 A;  2EAK A;  2VNO A;  4YVS A;  1O3T A;  1W9F A;  1NKG A;  3OD4 A;  4Q4Y 1;  4IEQ A;  3T4V A;  1MEC 2;  1D0G A;  5EJ3 A;  2EID A;  4XUO A;  3GBG A;  3BTX A;  4HPK B;  2AGS A;  2JEN A;  4QKN A;  3SHR A;  2WFF 1;  5LEK A;  5CKN A;  3S0M A;  2EAL A;  4YGE A;  3SIS A;  2GMP A;  5E89 A;  5GZD A;  4C90 A;  3W5M A;  1QJU 2;  5FCC A;  3VBS A;  3POB A;  1O8P A;  2QKD A;  3M2M A;  5FIX A;  1UZY A;  3KVB A;  3IDE A;  2OS2 A;  4UW4 A;  4ZU4 A;  3UES A;  1CPM A;  4YYO A;  3PVN A;  5F1R A;  3J7N A;  4YNI A;  1CGP A;  5CNA A;  2WLP A;  3M3E A;  4OCT A;  3VBS B;  2P37 A;  1DQ1 A;  1ZBE 3;  4Y26 A;  5JXH A;  2MHF A;  2WQ8 A;  2JDN A;  1H6Y A;  4NHK A;  2GN7 A;  4P9L A;  2XG3 A;  3JBG 1;  4QX0 A;  4EZH A;  4OUE A;  4CCK A;  2W91 A;  3OGJ A;  2A6Y A;  3J9S A;  5FLH A;  2WT1 A;  4GB3 2;  3LD8 A;  3POJ A;  5CYY A;  4QX2 A;  1R1Z A;  3DF0 A;  1ZA7 A;  2C26 A;  3PUH A;  4PLO A;  4I0B A;  5FPZ A;  3SIT A;  5GLU A;  1WZX A;  3KM5 A;  4CUG A;  1MQT C;  1S2E A;  2XUM A;  2WQ4 A;  3I3E A;  4TZD A;  3BKZ A;  1NXM A;  3NAP C;  2G19 A;  4XJW A;  4KBZ A;  5LA9 A;  4AEJ A;  1LAJ A;  3RZJ A;  4OUM A;  3N7L A;  2WIN B;  1W6N A;  3C8X A;  3URF A;  1U5X A;  4QPI A;  2RS1 1;  1HB1 A;  5CG9 A;  4HLT A;  1OA4 A;  2W68 A;  1GSL A;  1SFP A;  3UGG A;  3PTR B;  5BYN A;  1W9S A;  3ZYG A;  2ZMK A;  3OCP A;  1YWK A;  2C0Z A;  1W6N B;  2VMG A;  3AYE A;  3ZXJ A;  1VAK A;  4DRR A;  2OW4 A;  3K2O A;  3THP A;  2CHH A;  3LGR A;  3OTF A; 
#chains in the Genus database with same CATH homology
 4FI9 A;  4YPJ A;  4ARY A;  2WZ8 A;  3UET A;  3OEB A;  1UXZ A;  2YFZ A;  2VZO A;  4ZXE A;  1O8S A;  5A1A A;  3MV1 1;  2VZT A;  2WUH A;  3CMG A;  2VQU A;  4LKS A;  1XC6 A;  2QQK A;  4AAX A;  4MOA A;  1YQ2 A;  3C7O A;  3E1F 1;  3A21 A;  1UYX A;  1CZS A;  1GMM A;  1PMJ X;  2ORZ A;  1O59 A;  1K45 A;  1K3I A;  1OF3 A;  1ULP A;  3P1I A;  3LEK A;  4PF1 A;  5IJR A;  5F7U A;  3ETP A;  4CUC A;  4DXR A;  4Z2A A;  2Y6G A;  2X05 A;  3K4A A;  4TTG A;  3C7E A;  1JU4 A;  1KEX A;  4BXS V;  2VZP A;  3T2O A;  2DCK A;  3VDA A;  1DYO A;  2E33 A;  3WF2 A;  1JZ3 A;  1NX9 A;  4XUQ A;  4OMC A;  1H6X A;  2W94 A;  5FUI A;  4OYU A;  2B9V A;  1DP0 A;  2W46 A;  3IB3 A;  3I3D A;  2JE8 A;  1IQD C;  2J1R A;  3WF3 A;  2W1W A;  4DUX A;  1NAE A;  2BGP A;  4QB1 A;  4KWU A;  3III A;  3NNG A;  3DYO A;  1K12 A;  1JYW A;  3PUI A;  3WNP A;  1XPW A;  5IYY A;  3WF0 A;  3VD9 A;  4MGQ A;  3I2J A;  1UZ0 A;  2YFU A;  3UNP A;  1BHG A;  5EJZ B;  1NUK A;  2Y64 A;  3MBW A;  1HN1 A;  2ZEW A;  3BGA A;  1PX4 A;  4CU9 A;  1J84 A;  3OGV A;  3CKH A;  3T08 A;  2VTF A;  3VD3 A;  2VMF A;  5HXM A;  3P6B A;  3GDB A;  3OGS A;  5B4N A;  4DXT A;  3I2I A;  3WNK A;  2ZEZ A;  2HYX A;  3CIH A;  1OH4 A;  1F4A A;  3WNM A;  1CX1 A;  3THC A;  3VDC A;  2V4V A;  4GWJ A;  4P08 A;  3K77 A;  3SEP A;  2QQM A;  2WO3 A;  1OF4 A;  1W9W A;  1LNS A;  4E8D A;  3IDA A;  4IUG A;  1JZ8 A;  4W4Z A;  3FL7 A;  4L0P A;  2L9L A;  5EJ1 B;  2YC2 A;  1J83 A;  2RJ2 A;  3DYP A;  3LE0 A;  2J1V A;  4BDV B;  2VC9 A;  2Y6L A;  1GOG A;  2J1T A;  4ZZ5 A;  4RN5 A;  1WCQ A;  1OD3 A;  4QDS A;  5IFP A;  3F2Z A;  1W8O A;  4DXS A;  5LA1 A;  1UMH A;  1UY1 A;  1JI6 A;  3K46 A;  2JD9 A;  4DUV A;  2E31 A;  4CVU A;  2E32 A;  3GXU A;  3K4Z A;  1JZ5 A;  4MGS A;  2B4K A;  1I5P A;  4A44 A;  3I2K A;  3C7H A;  4P5Y A;  5JXI A;  3NJV A;  2J1S A;  4D8M A;  2WAB A;  3LQC A;  2VMD A;  5EIY B;  3A23 A;  5DQ0 A;  4XUN A;  3I2F A;  2VZU A;  2V5D A;  3IAQ A;  3BN6 A;  3I2G A;  4JX0 A;  2HLE A;  5J1X A;  5DPN A;  2ZXQ A;  3HJR A;  1JHJ A;  2QQL A;  3DYM A;  5G04 L;  5LA0 A;  3MUZ 1;  2WBK A;  2J7M A;  5HPO A;  5JMO A;  2JKX A;  4ZY9 A;  2BGO A;  4M4P A;  2C4X A;  1UYZ A;  2YG0 A;  4XUP A;  2VZ3 A;  3JXS A;  4A45 A;  2JDA A;  1L7R A;  2VZ1 A;  2QQI A;  3CZJ A;  4PQQ A;  4JKK A;  1CZT A;  3U37 A;  4KI5 M;  3THD A;  2BZD A;  3LPG A;  4LPL A;  1PX3 A;  3MV0 1;  2W47 A;  4CU7 A;  2CDP A;  2VQT A;  3NJX A;  3EB7 A;  3HOB A;  1TVG A;  5C7G A;  2W3J A;  4M4R A;  2J1U A;  2WAA A;  5IFT A;  3HEI A;  5JUV A;  2BER A;  1US3 A;  2Y6J A;  2BBA A;  4RYD A;  3VDB A;  1UY4 A;  1JYN A;  2WYS A;  1MPX A;  3T2P A;  1UXX X;  1XNT A;  2W9X A;  2X10 A;  3J7H A;  5JR2 A;  2WDB A;  4QX1 A;  4UAP A;  4ZZ8 A;  4CUA A;  1W9T A;  2EIC A;  2XON A;  4A41 A;  3WF1 A;  4DEQ A;  3NQH A;  3HNB M;  4OMD A;  3SKJ E;  2ZEY A;  3WNL A;  5LA2 A;  4TXW A;  4JHZ A;  1UY3 A;  4E8C A;  2PQS A;  2QQO A;  3ECQ A;  5CZK A;  4XVH A;  2X09 A;  2LW8 A;  3W5N A;  2ID4 A;  1JYX A;  2Z4F A;  2YC4 A;  1US2 A;  2W92 A;  1JZ7 A;  3HNY M;  3OBA A;  2VZV A;  3A7Q A;  3WQB A;  3HN3 A;  4PT6 A;  3MUY 1;  5B4X A;  2VZS A;  1SG3 A;  2W5F A;  1UYY A;  2VCB A;  1JYV A;  4JKL A;  1GQP A;  4DEV A;  1SHW B;  3ZM8 A;  2DCJ A;  2W1Q A;  3T0A A;  3LPF A;  2WN3 A;  1DLC A;  4MAD A;  2W95 A;  4GWI A;  2DDU A;  1R64 A;  3AC0 A;  3CDZ B;  2Y8K A;  4GZ9 A;  2EIE A;  4QX3 A;  4KMQ A;  1GNY A;  2CDO A;  2RVA A;  1UY2 A;  4W50 A;  5JXJ A;  2XQX A;  4DUW A;  3C7G A;  3DEC A;  2QBX A;  3OG2 A;  3EYP A;  1SDD B;  1JU3 A;  1P8J A;  3K75 B;  4QDR A;  4JKM A;  3SEE A;  2VO5 A;  4MO3 M;  5DMY A;  2WN2 A;  1W99 A;  2VZQ A;  5G05 L;  1OT5 A;  5C71 A;  1JZ2 A;  3C7F A;  3HPN A;  4ARX A;  4QB6 A;  4BK5 A;  2VOT A;  3WEZ A;  2VL4 A;  1TG7 A;  4A3Z A;  1EUT A;  2VMC A;  3MO4 A;  2Y6K A;  2W87 A;  3WSO A;  4BK4 A;  2Y6H A;  3OGR A;  2WZE A;  4HG6 B;  4AG4 A;  3ABZ A;  4LQR A;  3WNN A;  2QQN A;  5JXG A;  2VM9 A;  3LEI A;  3VD7 A;  2OKX A;  3ACI A;  1GUI A;  2VCC A;  2J22 A;  3GM8 A;  3T0B A;  1PMH X;  3WF4 A;  2V72 A;  1ULO A;  4QDQ A;  5I0D A;  2VME A;  2VZR A;  4P02 B;  1GU3 A;  3CQO A;  4UOJ A;  3T09 A;  3A22 A;  2WO1 A;  2WAO A;  3K4D A;  4LHS A;  2XOM A;  2J1E A;  1XNA A;  2VJX A;  4CU6 A;  1CIY A;  2C9K A;  5DN2 A;  2J1A A;  3I3B A;  4QB2 A;  1UMI A;  3ACG A;  4A4A A;  2WO2 A;  4P00 B;  1K42 A;  1UWW A;  3I97 A;  3NRU A;  1NKG A;  2ZEX A;  4CUB A;  3D3A A;  2EID A;  4XUO A;  3FHQ A;  4QAW A;  3ACH A;  3ACF A;  2QQJ A;  1W8N A;  3W5M A;  4W8J A;  1O8P A;  2E26 A;  3FHA A;  3UES A;  1JZ6 A;  3OB8 A;  4ET7 A;  1RYY A;  3GGL A;  4QPW A;  2ORX A;  4XZU G;  5C70 A;  2LS6 A;  5JXH A;  2WQ8 A;  1H6Y A;  2W1U A;  4QX0 A;  1UY0 A;  4OUE A;  4UI9 L;  3T0D A;  2W91 A;  1L7Q A;  2EIB A;  1GOF A;  1KGY A;  2W1S A;  3WNO A;  4A42 A;  5CYY A;  2R7E B;  1WKY A;  2RV9 A;  4QX2 A;  4XUR A;  3FN9 A;  2C26 A;  3PUH A;  3I2H A;  5IHR A;  2VR4 A;  2KD7 A;  3I3E A;  1GOH A;  3T2Q A;  4BJ0 A;  1UX7 A;  4OZO A;  3VD5 A;  5LCW L;  3C8X A;  1T2X A;  3IAP A;  4A6O A;  1EUU A;  3SKV A;  3LEG A;  1W9S A;  1W0N A;  3OEA A;  3HNM A;  2VCA A;  3VD4 A;  1F4H A;  3CZU A;  1CZV A;  1JZ4 A;  2XHN A;  2YB7 A;  1D7P M;  4CU8 A;  4D0Q A;  4XUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...