2Y69E

Bovine heart cytochrome c oxidase re-refined with molecular oxygen
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
b'ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE SUBUNIT 1
publication title A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
pubmed doi rcsb
molecule tags Electron transport
total genus 41
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2y69E00
2ZXWE 2EILE 2EIME 3WG7E 3AG4E 2EIJE 2EIKE 3ABLE 3ASOE 1OCOE 5B1BE 3X2QE 5B3SE 5IY5E 3AG3E 3AG1E 2DYRE 1V55E 1OCZE 3ASNE 1OCCE 1OCRE 3ABKE 1V54E 3ABME 3AG2E 2Y69E 5B1AE 2EINE 2OCCE 2DYSE
chains in the Genus database with same CATH superfamily
3Q73A 5FZQA 4K03A 4A55A 1KZOA 3AS8A 3D3MA 5A23A 3ASNE 5FQ6A 2XRYA 2WXGA 4BTBA 3TWQA 5BPPA 3RJVA 4RSYA 4U8HA 4JL0A 2XEVA 4LNGA 4LUNU 3OTNA 4DX1A 4ME2A 4UUCA 4U0UA 3ESLA 3UKUG 4EBAA 4JVSA 2IFUA 2CFZA 3APCA 4FLHA 1N0QA 4PDXA 3D9PA 3CR3A 2CFUA 3E33A 4HFGA 3MV3B 5JJ6A 4J6IA 2H6IA 2IO3C 5LOZA 1DCEA 3LYAA 3G2UA 3PE3A 3DSWA 2CG3A 3CQGB 2LNIA 4HOQA 1RZ4A 4LCTA 1LF8A 3JQ0A 1IKND 4GZDA 2AXZA 3J5PA 4ZHBA 3L08A 4AEZC 3V79K 2XZDG 3E34A 4ZFHA 2ZGGA 3PZ2A 4D10C 2C0LA 2KZTB 4GYOA 2BF0X 3FTSA 1SW6A 2F37A 2RFAA 3U9WA 5EYPF 3BQOA 2IOLA 3I4RB 4UWLA 4G2VA 1A5EA 3NZSA 2WXQA 4Y6CA 4L7TA 5HRYA 4UWKA 2XGMA 2KATA 4NACA 3ZYMA 2I6HA 3CEQA 1BPOA 3FUJA 1FVFA 2KC7A 4HOSA 2L6JA 5BXOA 1Q2ZA 4GTTA 4JB8P 4JHKA 4BT8A 3TWTA 5HQ8A 2QY7A 2VGYA 3O4ZA 3APDA 3EUVA 3UM2A 3C3QA 5T3RA 2LXMA 3ZHEA 3LVQE 3HVEB 4GMRA 1EYHA 3TL5A 3ASDA 1DC2A 3ZPJA 4B93B 2VSNA 5D0OD 2P9KG 4L2YA 5ARFA 4DX5D 2WXNA 2F8YA 3FTYA 2GROB 1JUQA 1TN6A 1N4PA 3SF4A 5BXUA 2Y4TA 4J8SA 4LEUA 1DNPA 4KVOA 1TNBA 3QB2A 4ILHB 3B7SA 2PNNA 1WM5A 3X2QE 2V4LA 1INZA 2R5SA 1OWLA 3MX3A 5EKQD 3FY4A 1OCCE 3S7FA 2KXPC 5LCWJ 2F0YA 5ENTD 4CT4A 3D9JA 3RIBA 1WG0A 3MZLB 5AQ7A 5C2YA 5KCMA 3S7BA 5EIDA 1BU9A 1Y8MA 4G8LA 5FWQA 4J8EA 3CVPA 4MLPA 4B8AA 2B6CA 4LSZE 4DRXE 4DX6D 1HG5A 4JHJA 3QWWA 2HO1A 2VGEA 3FEXA 3CVNA 3UX4A 3DPDA 3JXIA 4HOTA 4MKTA 2X6HA 4HB5A 4I43A 4LNBA 4ILIA 4Z68A 3MEKA 2PQRA 2LSVA 4CDMA 1N0RA 1H2UA 5HS0A 3FFLA 3ZYQA 4BERA 4HI9A 4B89A 3OXGA 4WWOA 1H6OA 2QZAA 3TXMA 3VTXA 3CHPA 2XCBA 3FU0A 5G05C 2EQXA 3TAXA 2DZNA 3DBSA 3L54A 1FT2A 4FA6A 4EECA 1LD8A 2BUGA 2AVPA 3L6AA 5ENQD 4C0MA 3R9MA 3ML8A 2IU1A 2XPYA 2YQ8A 5LCWC 4B8CB 3PUJA 3LEWA 4AY6A 4A63B 4UQYA 2VGXB 2WQHA 4FU3A 4AM9A 4J8DA 2XS1A 4B94A 3T9KA 2MRIA 3S7JA 3D9KA 3QK0A 3UINC 1U2VG 3TWRA 1GW6A 3CKCA 2J8SD 1E8YA 4ATZD 1N11A 4RVBA 3L16A 3E4BA 5BV0A 3Q15A 1O1TA 1S63A 5CEDB 3HXDA 1NL4A 1PY1A 1ELRA 4N2QA 3CVLA 3OXFA 3Q9UC 3SI5A 1OWMA 1FCHA 3ZFWA 2ETCA 4K5CA 1UW4B 2A5EA 1O1RA 4WNDA 4RQIA 4U7EB 2EILE 3NF1A 4XKCA 4HLEA 3CK9A 3P2BA 1BLXB 2WXHA 1OWOA 2WXKA 5CCMA 4ANVA 2BTDA 1H2TC 4U63A 2H6HA 2XPZA 5AAOA 2HYZA 4C9BB 5KJNA 5ANLA 5ANRA 2DVWA 3FTVA 3APFA 3FTWA 3ENEA 1U3DA 3FTXA 3BUAA 4YNDA 3CVUA 2NSZA 3D9HA 1EDUA 3Q75A 4FULA 5KJLA 1MZCA 5FIOA 2WXJA 3PNLB 4YDWA 4R7LA 3EJNA 3QWPA 2VJ8A 3RU0A 3ZNGA 4FJYA 3KD7A 3VLFA 3FTZA 4BTAA 3HG0D 3ABME 1HH8A 4AJWA 4TXRA 4GU5A 3B13A 4GTRA 4J8YA 3PZ3A 3ULYA 3MKRA 2L0IA 2X6KA 4Y6WA 1QQEA 2PL2A 1H0AA 3FH5A 2QFCA 4WUYA 4GMLA 3LJNA 4O6FA 2IONA 3I4GA 3RKVA 3FUMA 1EF1C 4I9CA 1MX2A 3AS4A 2GRQB 3L13A 3R9AB 3ZN3A 2J08A 3AU4A 4N5CA 4OYSA 1NA0A 3AS5A 1HF8A 2FULA 4KBQA 3GW4A 4WNFA 1TR4A 4GPMA 4CDRA 2WXPA 2IY0C 4QFVA 3MJWA 2EIJE 1BI8B 1QBQA 4G1TA 4F1PA 4WNGA 1E7VA 3C5RA 3RRMB 2JEKA 4YDYA 5HKPA 3GYZA 5KBAA 4RG9A 4OAVB 3TG4A 2ZXWE 1FT1A 5G2NA 3QKYA 4KVMA 3L82A 3DEPA 2R02A 4XKBA 4APOA 4JA7A 4DLQA 3UIPC 3E32A 1SA4A 1MHQA 1PC2A 3IV0A 5H7PA 2OEWA 3RO3A 3ZYLA 3ZXSA 1N4QA 2P9PG 1UJKA 3TWXA 5ENNA 4YDEA 3TWVA 1H6PA 4MS6A 2V0PA 4XI0A 4PH4B 3UM0A 4F1SA 3DSXA 4EQFA 1N95A 1HG2A 3OAWA 1Z3YA 4YVQC 2OEVA 4GPKA 1S64A 2VTBA 3JYSA 4BSZB 2VSYA 1K1AA 2BEDA 5AN8A 1B89A 4ACLA 4HXIA 4KZCA 3MKQB 4CYMD 4J8FA 1H2VC 4LG6A 5EYLA 4FC8A 5ENRD 1HO8A 3Q78A 4NIKA 2AXVA 2P9LG 3Q49B 1WDYA 2ETAA 4PS3A 5ENPD 3IHYA 1JWGA 3UT4A 1O5MA 4N39A 1IHBA 5LP0A 5EILA 4JW1A 3TJPA 2OOEA 2LAHA 5CERB 4GTQA 3EIQC 3UQ3A 1JCQA 2FI7A 1UJJA 3IXEA 4JHRA 2VQ2A 3PEUB 1E8ZA 2P9SG 2WVIA 1OWPA 3CSFA 2WB2A 2H6GA 3URZA 4GA0A 3I5PA 3CV0A 2Y3AA 3JQ1A 3D9IA 1K1BA 1NA3A 2MYOA 3CVWA 2RFMA 4GCOA 4I2ZA 3B7RL 1QNFA 2R2LA 1YMPA 4F7AA 3U3WA 4E6HA 5T4YA 2UY1B 4UQZA 2X3MA 3MCXA 3MV2B 1TNUA 2CHWA 4GB9A 3VLDA 3SHFA 4BX9A 2P2CP 3IEGA 2ETBA 4TRQA 2BKKB 5FZRA 3ZVVA 4AVXA 5B1BE 2QYJA 1QZ2A 1D8EA 3SY2A 3AG1E 3B95A 3PUKA 2XEEA 2WQ6A 4K5AB 5CRVA 3IKOB 5G05J 5DBKA 1NI1A 3SQVA 1XNFA 3KEAA 3UM3A 2OV8A 2PM6A 1ZB1A 4WWNA 3LPZA 4U0SA 5ARGA 3UPVA 2GRRB 3CSTA 3Q7FA 5EX3A 4AP2A 2AXUA 4JEUA 3ONLA 2ZISA 5KNHD 2FF4A 3SO8A 1EPUA 1UG3A 4O1PA 3QDNA 1WAO1 4N3CA 1TYQG 4DI3A 2RKKA 3Q9NC 3UXGA 1TNYA 4RG6A 1OCRE 4CZ2D 2E0IA 3DRAA 5AQAA 4CT0A 1FPPA 4TUMA 2CHZA 5J90A 3NBNB 4BT9A 5EX0A 2KM4A 1L5JA 4MRUA 4GTVA 3CGHA 4H7XA 2Y4UA 4EPZA 3EU9A 3CVQA 1JPLA 4PUCA 1P5QA 3ZYKA 2DIWA 3FDHA 4OAUC 2HM8A 3KS2A 4JPSA 5E75A 1IXVA 1DVPA 3LY9A 5D66A 2V5QC 3WG7E 3TGOA 2I9CA 3ASHA 5CECB 2GRNB 1G3NB 1VDYA 3EDTB 2KCKA 2KZTA 5FZSA 2LAIA 4C0EA 4KZ0A 4XZ4A 2UWJG 5LFAA 3PDNA 3T8MA 3SZ7A 1SVXA 3BG0B 5ENSD 3RAUA 5A7DB 4GZ3A 2DBAA 2NC9A 2V5FA 2WXRA 3Q47B 2ONDA 4HNAD 4GTPA 4AXHA 3AU5A 2V8SE 3T5VA 2OVFA 3DXMG 4TV3A 3LJ3A 3E37A 4N3BA 3FU6A 4UI9K 5CMWA 4U95D 1SZAA 4A1SA 2MHKA 2XZTG 2RG8A 5AJLA 3NOGD 3CQCB 2IJGX 3QARA 2XCCA 3WXXA 2R03A 5AYWD 4DX2A 2FEZA 3QOUA 4NRHB 4HBDA 4BSXA 5G04C 3TWUA 2WXLA 2XENA 4JC8A 1IYGA 5T8IA 3FU5A 1JCSA 1K3ZD 4IULA 4F53A 1HZ4A 2QC9A 3CLJA 3HVEA 2IQCA 1OXJA 1IQRA 4HOUA 3PRZA 3CK8A 3ZEFA 2WMOA 4JD2G 3QC1A 5JA4D 4U07A 5FQ4A 2YNQA 2VYIA 4GTOA 3HRAA 3PZ4A 3Q4AB 1BD8A 3FHEA 2J49A 1DCQA 2LUHA 1Z3XA 4XX5A 1PAQA 3BEEA 4I1AA 2DYRE 4GCNA 1X5BA 2VSXE 3ASFA 3U64A 1HE8A 2CG2A 4C48B 5G55A 2NYJA 5DIZA 3RK6A 1IHGA 5CBOA 5EN5D 5AJDA 3FUHA 3FEYA 3BG1B 3QAQA 4V3IA 3EHQA 3ASGA 3RRNB 2WMNA 2AW6A 1HU3A 3KAEA 4I2WA 3PVLA 1YCSB 2L9BA 4EHMA 4DUIA 4E85A 2C0MA 3L9TA 1ZBPA 1D8DA 2OVBA 5CEAA 2NXPA 3B7BA 4UWGA 3DSSA 3CVYA 3HIZA 3SBTB 3DPYA 2HE0A 3SBSA 4CDNA 3HHMA 3C98A 4IYPA 4DX7D 1FVHA 4HVBA 2DZOA 3EU5A 3J5QB 4UI9J 3PZ1A 4U8YD 2LO6A 1S0PA 3SFYA 4CGVA 5A6CA 1Z6TA 3JXJA 4N3AA 4Q94A 3AAAC 4ANUA 3NAWA 2X6JA 1D9SA 2WM9A 4IN3B 3UM1A 1HS6A 2P9UG 1Z5SC 2KCLA 3FU3A 4X8QA 4I6GA 2Y1LE 4LNUD 3B7TA 2VGXA 3CHQA 3C72A 4Q69A 3EHNA 1V55E 3P1UA 3Q5MA 4CGWA 2PZIA 3V31A 3G2VA 1MJ0A 3ZHEB 4CCAA 1OT8A 4KXKB 2FO7A 3KSQA 4ANWA 2EINE 3V2OA 4TXPA 3ZXPA 3RRUA 5JHBA 4L9PA 3HXFA 3TWWA 2WXMA 3W9FA 4B0ZA 3DWLG 5ENOD 4XE0A 3JUIA 4AV7A 2LXLA 3D9LA 4FJZA 3R7QA 4F6RD 4U8VD 4QQIA 2A5UA 3FP3A 3PE4A 3LY7A 4O60A 4N2SA 1E8XA 3UMVA 2EIKE 4M3OA 4UI9C 5LX8A 4I6JA 2A4ZA 4LRZA 4U04A 4K5BA 1OY3D 4IRUA 4BWRA 2XS8A 2HR2A 3CHRA 2WXOA 4URKA 2DWZA 4LERA 4OVVA 4CEMA 1KPSB 4CRWA 3AG4E 3UUXA 4BX8A 3FUFA 3L17A 3UKRG 5CCLA 1E7UA 1TJFA 2KCVA 2PM7A 4GYYA 2IOSA 1H6KA 4JA9A 2I1KA 3HXCA 2XQ0A 5AQBA 3QJZA 3CIAA 2E2EA 4GYWA 3GZ1A 3FWVA 5EIBE 4K0RA 4Q96A 2VSOE 5FJYA 4GTMA 4AY5A 3S7DA 4DLOA 5JMND 4DK5A 4PS7A 1ELKA 4MBGA 4W9RA 2J4DA 1AWCB 5KJMA 3FH8A 4FHJA 2P9IG 2CHXA 1TNZA 5CMYA 5AIJA 2H6FA 4I6EA 3DSTA 4BETA 5FTPA 2X6FA 1TNOA 1Y6IA 3G2SA 4RLYA 3F6QA 1HFAA 4YVOA 4G11A 4L2LA 3PS6A 1N4RA 3ISMC 4BFRA 3UT7A 3CVVA 3SNXA 3PEVB 1N9AA 1K8KG 5BNWA 3G2TA 4JZYA 3ZKJA 4L1BA 3ULEG 3C3RA 1A17A 2DYSE 1TN7A 4HORA 1UN9A 4O1OA 3LVRE 1RW2A 3ZGQA 4FHKA 4APFA 2I2OA 3UTMA 3PNTB 1NZNA 3D9OA 3LS8A 1UOHA 3TG5A 1HX8A 5ITZF 1N54A 1IQUA 2WPVA 3ZUVB 3NOCD 3NZUA 4FLBA 5BW8C 4HS2A 3U4TA 2IO2C 2PQNA 3KEZA 4G24A 3HXEA 4G23A 1SZ9A 4DJAA 3R7RA 2J9QA 2EIME 4KYOB 3CHSA 1JCRA 2GRLA 3SFZA 4ATGA 4ABNA 3K9IA 4KMOA 2YHCA 4EZLA 4GA1A 2C2LA 2WQ7A 4L23A 3ULQA 2XPIA 3FTUA 4JEHA 3CKBA 4HRMB 4GMJA 3VTYA 3LY8A 2J4BA 3SD5A 4I1OB 5D0QD 3MGBA 1OCZE 4XI9A 5M72A 4GZCA 3D9MA 3ABKE 5FT9A 1KLXA 3V30A 3MKQA 1N94A 4WNEA 3NQPA 2LSUA 3CHMA 3B7UX 5CBNA 5G04J 3DSUA 1MYOA 2L0TB 3ZW3A 2M63A 3MYVA 5J08A 3EIJA 2R17C 4HI8A 3D9NA 2ILRA 3RSEG 5B1AE 3HXBA 2J09A 4TUUA 3EHMA 2WXFA 3NB2A 5JJTA 3PH0C 3Q7AA 2GRPB 5HI7A 5EDSA 2FBNA 3DXKG 2XGSA 3T8KA 4M7CA 4JXTA 4HRNA 2JLBA 4I17A 3IBEA 5AARA 3GZ2A 2BKGA 4WAFA 1ZU2A 4ANXA 4G25A 1UN8A 2X6IA 1HXIA 3CVXA 3E30A 1MX4A 4GTSA 2X38A 1N52A 4WWPA 3LCAA 4I1MA 5KJKA 3ZRHA 1KZPA 3V2XA 2ZGDA 3JCKC 3L22A 1E90A 2UY1A 3S2AA 4NQ0A 2IEJA 3AG2E 2R05A 2AWIA 2FO1E 3ABLE 3I3NA 5BV1A 5B3SE 4AOFA 1MQSA 2B0OE 3Q79A 5CRUA 1V54E 1U3CA 4GZ6A 4U96D 3ZU7B 3C3OA 1E8WA 2GRMA 2OCCE 3FUIA 4XIFA 2Q7FA 1JWFA 4GA2A 4TXQA 3UT8A 2IF4A 2L6BA 3CHOA 2KBXA 3LDZA 5AQ9A 3AG3E 5KNGA 2R59A 3HDXA 5FQ7A 2P58C 3UI2A 4DI4A 4EBAG 2Y69E 3N71A 3OXLA 3QWVA 4AIFA 3T5XA 1AP7A 2QYUA 1NP7A 2VTBB 1X81A 1YYHA 4HLLA 4UQXA 4A3TA 5KWDA 1QYMA 2RD0A 4GZ5A 1H19A 2GGFA 3ML9A 2YHEA 5JHAA 3FULA 2XRZA 2YINA 4G26A 1KT0A 4F3VA 4EZKA 5D2MC 1TEZA 3RO2A 2I1JA 3U66A 3FH7A 3SGHA 4I9EA 4GAAA 4A3VA 2F8XK 4UWFA 1BI7B 4EZJA 3FUDA 2J07A 2JABA 3JUEA 1OCOE 5FQ8A 4BEPA 3QNKA 1NFIE 1LD7A 2XGOA 4G8KA 1WY6A 2ZIRA 3GZSA 1S70B 4N5QA 4KT6B 4OVUA 4BY6A 3G2WA 1SA5A 5FINA 1OWNA 4H7YA 3PREA 3SFXA 3TWSA 1OUVA 3CK7A 4J7WA 4P29A 2XEHA 4A1GA 3HYMB 1XGWA 4J0UA 4XEIG 4NURA 3DSVA 1LTXA 3AJIA 3DEOA 2Y0BG 3VLEA 3ONKA 5C1DA 3LKUA 4YDOA 4ILGA 3FUKA 1E96B 3LXUX 3ZIMA 1TN8A 2WXIA 2ZU6B 1N4SA 3PZDA 3FUNA 2DCPA 3KSLA 4BESA 5E76A 1W3BA 5IY5E 4UWHA 2XHEA 3MA5A 3EHRA 4ACKA 1ELWA 3TXNA 3BU8A 4DPRA 3ESKA 2V4HC 4FADA 2GW1A 3O48A 3FUEA 2P9NG 1TJCA 4FP7A 5AENA 3ASOE 4PS8A 1SQMA 3UIOC 5BUZA 1KT1A 5CHEE 5BT1A 1O1SA 2AJAA 3IHVA 5JJ7A 4HQDA 4HRLA 1YA0A 1MX6A 4U0ZA 3W9GA 2MOWA
chains in the Genus database with same CATH topology
2ZXWE 2EILE 2EIME 3WG7E 3AG4E 2EIJE 2EIKE 3ABLE 3ASOE 1OCOE 5B1BE 3X2QE 5B3SE 5IY5E 3AG3E 3AG1E 2DYRE 1V55E 1OCZE 3ASNE 1OCCE 1OCRE 3ABKE 1V54E 3ABME 3AG2E 2Y69E 5B1AE 2EINE 2OCCE 2DYSE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXW E;  2EIL E;  2EIM E;  3WG7 E;  3AG4 E;  2EIJ E;  2EIK E;  3ABL E;  3ASO E;  1OCO E;  5B1B E;  3X2Q E;  5B3S E;  5IY5 E;  3AG3 E;  3AG1 E;  2DYR E;  1V55 E;  1OCZ E;  3ASN E;  1OCC E;  1OCR E;  3ABK E;  1V54 E;  3ABM E;  3AG2 E;  2Y69 E;  5B1A E;  2EIN E;  2OCC E;  2DYS E; 
#chains in the Genus database with same CATH topology
 3Q73 A;  5FZQ A;  4K03 A;  4A55 A;  1KZO A;  3AS8 A;  3D3M A;  5A23 A;  3ASN E;  5FQ6 A;  2XRY A;  2WXG A;  4BTB A;  3TWQ A;  5BPP A;  3RJV A;  4RSY A;  4U8H A;  4JL0 A;  2XEV A;  4LNG A;  4LUN U;  3OTN A;  4DX1 A;  4ME2 A;  4UUC A;  4U0U A;  3ESL A;  3UKU G;  4EBA A;  4JVS A;  2IFU A;  2CFZ A;  3APC A;  4FLH A;  1N0Q A;  4PDX A;  3D9P A;  3CR3 A;  2CFU A;  3E33 A;  4HFG A;  3MV3 B;  5JJ6 A;  4J6I A;  2H6I A;  2IO3 C;  5LOZ A;  1DCE A;  3LYA A;  3G2U A;  3PE3 A;  3DSW A;  2CG3 A;  3CQG B;  2LNI A;  4HOQ A;  1RZ4 A;  4LCT A;  1LF8 A;  3JQ0 A;  1IKN D;  4GZD A;  2AXZ A;  3J5P A;  4ZHB A;  3L08 A;  4AEZ C;  3V79 K;  2XZD G;  3E34 A;  4ZFH A;  2ZGG A;  3PZ2 A;  4D10 C;  2C0L A;  2KZT B;  4GYO A;  2BF0 X;  3FTS A;  1SW6 A;  2F37 A;  2RFA A;  3U9W A;  5EYP F;  3BQO A;  2IOL A;  3I4R B;  4UWL A;  4G2V A;  1A5E A;  3NZS A;  2WXQ A;  4Y6C A;  4L7T A;  5HRY A;  4UWK A;  2XGM A;  2KAT A;  4NAC A;  3ZYM A;  2I6H A;  3CEQ A;  1BPO A;  3FUJ A;  1FVF A;  2KC7 A;  4HOS A;  2L6J A;  5BXO A;  1Q2Z A;  4GTT A;  4JB8 P;  4JHK A;  4BT8 A;  3TWT A;  5HQ8 A;  2QY7 A;  2VGY A;  3O4Z A;  3APD A;  3EUV A;  3UM2 A;  3C3Q A;  5T3R A;  2LXM A;  3ZHE A;  3LVQ E;  3HVE B;  4GMR A;  1EYH A;  3TL5 A;  3ASD A;  1DC2 A;  3ZPJ A;  4B93 B;  2VSN A;  5D0O D;  2P9K G;  4L2Y A;  5ARF A;  4DX5 D;  2WXN A;  2F8Y A;  3FTY A;  2GRO B;  1JUQ A;  1TN6 A;  1N4P A;  3SF4 A;  5BXU A;  2Y4T A;  4J8S A;  4LEU A;  1DNP A;  4KVO A;  1TNB A;  3QB2 A;  4ILH B;  3B7S A;  2PNN A;  1WM5 A;  3X2Q E;  2V4L A;  1INZ A;  2R5S A;  1OWL A;  3MX3 A;  5EKQ D;  3FY4 A;  1OCC E;  3S7F A;  2KXP C;  5LCW J;  2F0Y A;  5ENT D;  4CT4 A;  3D9J A;  3RIB A;  1WG0 A;  3MZL B;  5AQ7 A;  5C2Y A;  5KCM A;  3S7B A;  5EID A;  1BU9 A;  1Y8M A;  4G8L A;  5FWQ A;  4J8E A;  3CVP A;  4MLP A;  4B8A A;  2B6C A;  4LSZ E;  4DRX E;  4DX6 D;  1HG5 A;  4JHJ A;  3QWW A;  2HO1 A;  2VGE A;  3FEX A;  3CVN A;  3UX4 A;  3DPD A;  3JXI A;  4HOT A;  4MKT A;  2X6H A;  4HB5 A;  4I43 A;  4LNB A;  4ILI A;  4Z68 A;  3MEK A;  2PQR A;  2LSV A;  4CDM A;  1N0R A;  1H2U A;  5HS0 A;  3FFL A;  3ZYQ A;  4BER A;  4HI9 A;  4B89 A;  3OXG A;  4WWO A;  1H6O A;  2QZA A;  3TXM A;  3VTX A;  3CHP A;  2XCB A;  3FU0 A;  5G05 C;  2EQX A;  3TAX A;  2DZN A;  3DBS A;  3L54 A;  1FT2 A;  4FA6 A;  4EEC A;  1LD8 A;  2BUG A;  2AVP A;  3L6A A;  5ENQ D;  4C0M A;  3R9M A;  3ML8 A;  2IU1 A;  2XPY A;  2YQ8 A;  5LCW C;  4B8C B;  3PUJ A;  3LEW A;  4AY6 A;  4A63 B;  4UQY A;  2VGX B;  2WQH A;  4FU3 A;  4AM9 A;  4J8D A;  2XS1 A;  4B94 A;  3T9K A;  2MRI A;  3S7J A;  3D9K A;  3QK0 A;  3UIN C;  1U2V G;  3TWR A;  1GW6 A;  3CKC A;  2J8S D;  1E8Y A;  4ATZ D;  1N11 A;  4RVB A;  3L16 A;  3E4B A;  5BV0 A;  3Q15 A;  1O1T A;  1S63 A;  5CED B;  3HXD A;  1NL4 A;  1PY1 A;  1ELR A;  4N2Q A;  3CVL A;  3OXF A;  3Q9U C;  3SI5 A;  1OWM A;  1FCH A;  3ZFW A;  2ETC A;  4K5C A;  1UW4 B;  2A5E A;  1O1R A;  4WND A;  4RQI A;  4U7E B;  2EIL E;  3NF1 A;  4XKC A;  4HLE A;  3CK9 A;  3P2B A;  1BLX B;  2WXH A;  1OWO A;  2WXK A;  5CCM A;  4ANV A;  2BTD A;  1H2T C;  4U63 A;  2H6H A;  2XPZ A;  5AAO A;  2HYZ A;  4C9B B;  5KJN A;  5ANL A;  5ANR A;  2DVW A;  3FTV A;  3APF A;  3FTW A;  3ENE A;  1U3D A;  3FTX A;  3BUA A;  4YND A;  3CVU A;  2NSZ A;  3D9H A;  1EDU A;  3Q75 A;  4FUL A;  5KJL A;  1MZC A;  5FIO A;  2WXJ A;  3PNL B;  4YDW A;  4R7L A;  3EJN A;  3QWP A;  2VJ8 A;  3RU0 A;  3ZNG A;  4FJY A;  3KD7 A;  3VLF A;  3FTZ A;  4BTA A;  3HG0 D;  3ABM E;  1HH8 A;  4AJW A;  4TXR A;  4GU5 A;  3B13 A;  4GTR A;  4J8Y A;  3PZ3 A;  3ULY A;  3MKR A;  2L0I A;  2X6K A;  4Y6W A;  1QQE A;  2PL2 A;  1H0A A;  3FH5 A;  2QFC A;  4WUY A;  4GML A;  3LJN A;  4O6F A;  2ION A;  3I4G A;  3RKV A;  3FUM A;  1EF1 C;  4I9C A;  1MX2 A;  3AS4 A;  2GRQ B;  3L13 A;  3R9A B;  3ZN3 A;  2J08 A;  3AU4 A;  4N5C A;  4OYS A;  1NA0 A;  3AS5 A;  1HF8 A;  2FUL A;  4KBQ A;  3GW4 A;  4WNF A;  1TR4 A;  4GPM A;  4CDR A;  2WXP A;  2IY0 C;  4QFV A;  3MJW A;  2EIJ E;  1BI8 B;  1QBQ A;  4G1T A;  4F1P A;  4WNG A;  1E7V A;  3C5R A;  3RRM B;  2JEK A;  4YDY A;  5HKP A;  3GYZ A;  5KBA A;  4RG9 A;  4OAV B;  3TG4 A;  2ZXW E;  1FT1 A;  5G2N A;  3QKY A;  4KVM A;  3L82 A;  3DEP A;  2R02 A;  4XKB A;  4APO A;  4JA7 A;  4DLQ A;  3UIP C;  3E32 A;  1SA4 A;  1MHQ A;  1PC2 A;  3IV0 A;  5H7P A;  2OEW A;  3RO3 A;  3ZYL A;  3ZXS A;  1N4Q A;  2P9P G;  1UJK A;  3TWX A;  5ENN A;  4YDE A;  3TWV A;  1H6P A;  4MS6 A;  2V0P A;  4XI0 A;  4PH4 B;  3UM0 A;  4F1S A;  3DSX A;  4EQF A;  1N95 A;  1HG2 A;  3OAW A;  1Z3Y A;  4YVQ C;  2OEV A;  4GPK A;  1S64 A;  2VTB A;  3JYS A;  4BSZ B;  2VSY A;  1K1A A;  2BED A;  5AN8 A;  1B89 A;  4ACL A;  4HXI A;  4KZC A;  3MKQ B;  4CYM D;  4J8F A;  1H2V C;  4LG6 A;  5EYL A;  4FC8 A;  5ENR D;  1HO8 A;  3Q78 A;  4NIK A;  2AXV A;  2P9L G;  3Q49 B;  1WDY A;  2ETA A;  4PS3 A;  5ENP D;  3IHY A;  1JWG A;  3UT4 A;  1O5M A;  4N39 A;  1IHB A;  5LP0 A;  5EIL A;  4JW1 A;  3TJP A;  2OOE A;  2LAH A;  5CER B;  4GTQ A;  3EIQ C;  3UQ3 A;  1JCQ A;  2FI7 A;  1UJJ A;  3IXE A;  4JHR A;  2VQ2 A;  3PEU B;  1E8Z A;  2P9S G;  2WVI A;  1OWP A;  3CSF A;  2WB2 A;  2H6G A;  3URZ A;  4GA0 A;  3I5P A;  3CV0 A;  2Y3A A;  3JQ1 A;  3D9I A;  1K1B A;  1NA3 A;  2MYO A;  3CVW A;  2RFM A;  4GCO A;  4I2Z A;  3B7R L;  1QNF A;  2R2L A;  1YMP A;  4F7A A;  3U3W A;  4E6H A;  5T4Y A;  2UY1 B;  4UQZ A;  2X3M A;  3MCX A;  3MV2 B;  1TNU A;  2CHW A;  4GB9 A;  3VLD A;  3SHF A;  4BX9 A;  2P2C P;  3IEG A;  2ETB A;  4TRQ A;  2BKK B;  5FZR A;  3ZVV A;  4AVX A;  5B1B E;  2QYJ A;  1QZ2 A;  1D8E A;  3SY2 A;  3AG1 E;  3B95 A;  3PUK A;  2XEE A;  2WQ6 A;  4K5A B;  5CRV A;  3IKO B;  5G05 J;  5DBK A;  1NI1 A;  3SQV A;  1XNF A;  3KEA A;  3UM3 A;  2OV8 A;  2PM6 A;  1ZB1 A;  4WWN A;  3LPZ A;  4U0S A;  5ARG A;  3UPV A;  2GRR B;  3CST A;  3Q7F A;  5EX3 A;  4AP2 A;  2AXU A;  4JEU A;  3ONL A;  2ZIS A;  5KNH D;  2FF4 A;  3SO8 A;  1EPU A;  1UG3 A;  4O1P A;  3QDN A;  1WAO 1;  4N3C A;  1TYQ G;  4DI3 A;  2RKK A;  3Q9N C;  3UXG A;  1TNY A;  4RG6 A;  1OCR E;  4CZ2 D;  2E0I A;  3DRA A;  5AQA A;  4CT0 A;  1FPP A;  4TUM A;  2CHZ A;  5J90 A;  3NBN B;  4BT9 A;  5EX0 A;  2KM4 A;  1L5J A;  4MRU A;  4GTV A;  3CGH A;  4H7X A;  2Y4U A;  4EPZ A;  3EU9 A;  3CVQ A;  1JPL A;  4PUC A;  1P5Q A;  3ZYK A;  2DIW A;  3FDH A;  4OAU C;  2HM8 A;  3KS2 A;  4JPS A;  5E75 A;  1IXV A;  1DVP A;  3LY9 A;  5D66 A;  2V5Q C;  3WG7 E;  3TGO A;  2I9C A;  3ASH A;  5CEC B;  2GRN B;  1G3N B;  1VDY A;  3EDT B;  2KCK A;  2KZT A;  5FZS A;  2LAI A;  4C0E A;  4KZ0 A;  4XZ4 A;  2UWJ G;  5LFA A;  3PDN A;  3T8M A;  3SZ7 A;  1SVX A;  3BG0 B;  5ENS D;  3RAU A;  5A7D B;  4GZ3 A;  2DBA A;  2NC9 A;  2V5F A;  2WXR A;  3Q47 B;  2OND A;  4HNA D;  4GTP A;  4AXH A;  3AU5 A;  2V8S E;  3T5V A;  2OVF A;  3DXM G;  4TV3 A;  3LJ3 A;  3E37 A;  4N3B A;  3FU6 A;  4UI9 K;  5CMW A;  4U95 D;  1SZA A;  4A1S A;  2MHK A;  2XZT G;  2RG8 A;  5AJL A;  3NOG D;  3CQC B;  2IJG X;  3QAR A;  2XCC A;  3WXX A;  2R03 A;  5AYW D;  4DX2 A;  2FEZ A;  3QOU A;  4NRH B;  4HBD A;  4BSX A;  5G04 C;  3TWU A;  2WXL A;  2XEN A;  4JC8 A;  1IYG A;  5T8I A;  3FU5 A;  1JCS A;  1K3Z D;  4IUL A;  4F53 A;  1HZ4 A;  2QC9 A;  3CLJ A;  3HVE A;  2IQC A;  1OXJ A;  1IQR A;  4HOU A;  3PRZ A;  3CK8 A;  3ZEF A;  2WMO A;  4JD2 G;  3QC1 A;  5JA4 D;  4U07 A;  5FQ4 A;  2YNQ A;  2VYI A;  4GTO A;  3HRA A;  3PZ4 A;  3Q4A B;  1BD8 A;  3FHE A;  2J49 A;  1DCQ A;  2LUH A;  1Z3X A;  4XX5 A;  1PAQ A;  3BEE A;  4I1A A;  2DYR E;  4GCN A;  1X5B A;  2VSX E;  3ASF A;  3U64 A;  1HE8 A;  2CG2 A;  4C48 B;  5G55 A;  2NYJ A;  5DIZ A;  3RK6 A;  1IHG A;  5CBO A;  5EN5 D;  5AJD A;  3FUH A;  3FEY A;  3BG1 B;  3QAQ A;  4V3I A;  3EHQ A;  3ASG A;  3RRN B;  2WMN A;  2AW6 A;  1HU3 A;  3KAE A;  4I2W A;  3PVL A;  1YCS B;  2L9B A;  4EHM A;  4DUI A;  4E85 A;  2C0M A;  3L9T A;  1ZBP A;  1D8D A;  2OVB A;  5CEA A;  2NXP A;  3B7B A;  4UWG A;  3DSS A;  3CVY A;  3HIZ A;  3SBT B;  3DPY A;  2HE0 A;  3SBS A;  4CDN A;  3HHM A;  3C98 A;  4IYP A;  4DX7 D;  1FVH A;  4HVB A;  2DZO A;  3EU5 A;  3J5Q B;  4UI9 J;  3PZ1 A;  4U8Y D;  2LO6 A;  1S0P A;  3SFY A;  4CGV A;  5A6C A;  1Z6T A;  3JXJ A;  4N3A A;  4Q94 A;  3AAA C;  4ANU A;  3NAW A;  2X6J A;  1D9S A;  2WM9 A;  4IN3 B;  3UM1 A;  1HS6 A;  2P9U G;  1Z5S C;  2KCL A;  3FU3 A;  4X8Q A;  4I6G A;  2Y1L E;  4LNU D;  3B7T A;  2VGX A;  3CHQ A;  3C72 A;  4Q69 A;  3EHN A;  1V55 E;  3P1U A;  3Q5M A;  4CGW A;  2PZI A;  3V31 A;  3G2V A;  1MJ0 A;  3ZHE B;  4CCA A;  1OT8 A;  4KXK B;  2FO7 A;  3KSQ A;  4ANW A;  2EIN E;  3V2O A;  4TXP A;  3ZXP A;  3RRU A;  5JHB A;  4L9P A;  3HXF A;  3TWW A;  2WXM A;  3W9F A;  4B0Z A;  3DWL G;  5ENO D;  4XE0 A;  3JUI A;  4AV7 A;  2LXL A;  3D9L A;  4FJZ A;  3R7Q A;  4F6R D;  4U8V D;  4QQI A;  2A5U A;  3FP3 A;  3PE4 A;  3LY7 A;  4O60 A;  4N2S A;  1E8X A;  3UMV A;  2EIK E;  4M3O A;  4UI9 C;  5LX8 A;  4I6J A;  2A4Z A;  4LRZ A;  4U04 A;  4K5B A;  1OY3 D;  4IRU A;  4BWR A;  2XS8 A;  2HR2 A;  3CHR A;  2WXO A;  4URK A;  2DWZ A;  4LER A;  4OVV A;  4CEM A;  1KPS B;  4CRW A;  3AG4 E;  3UUX A;  4BX8 A;  3FUF A;  3L17 A;  3UKR G;  5CCL A;  1E7U A;  1TJF A;  2KCV A;  2PM7 A;  4GYY A;  2IOS A;  1H6K A;  4JA9 A;  2I1K A;  3HXC A;  2XQ0 A;  5AQB A;  3QJZ A;  3CIA A;  2E2E A;  4GYW A;  3GZ1 A;  3FWV A;  5EIB E;  4K0R A;  4Q96 A;  2VSO E;  5FJY A;  4GTM A;  4AY5 A;  3S7D A;  4DLO A;  5JMN D;  4DK5 A;  4PS7 A;  1ELK A;  4MBG A;  4W9R A;  2J4D A;  1AWC B;  5KJM A;  3FH8 A;  4FHJ A;  2P9I G;  2CHX A;  1TNZ A;  5CMY A;  5AIJ A;  2H6F A;  4I6E A;  3DST A;  4BET A;  5FTP A;  2X6F A;  1TNO A;  1Y6I A;  3G2S A;  4RLY A;  3F6Q A;  1HFA A;  4YVO A;  4G11 A;  4L2L A;  3PS6 A;  1N4R A;  3ISM C;  4BFR A;  3UT7 A;  3CVV A;  3SNX A;  3PEV B;  1N9A A;  1K8K G;  5BNW A;  3G2T A;  4JZY A;  3ZKJ A;  4L1B A;  3ULE G;  3C3R A;  1A17 A;  2DYS E;  1TN7 A;  4HOR A;  1UN9 A;  4O1O A;  3LVR E;  1RW2 A;  3ZGQ A;  4FHK A;  4APF A;  2I2O A;  3UTM A;  3PNT B;  1NZN A;  3D9O A;  3LS8 A;  1UOH A;  3TG5 A;  1HX8 A;  5ITZ F;  1N54 A;  1IQU A;  2WPV A;  3ZUV B;  3NOC D;  3NZU A;  4FLB A;  5BW8 C;  4HS2 A;  3U4T A;  2IO2 C;  2PQN A;  3KEZ A;  4G24 A;  3HXE A;  4G23 A;  1SZ9 A;  4DJA A;  3R7R A;  2J9Q A;  2EIM E;  4KYO B;  3CHS A;  1JCR A;  2GRL A;  3SFZ A;  4ATG A;  4ABN A;  3K9I A;  4KMO A;  2YHC A;  4EZL A;  4GA1 A;  2C2L A;  2WQ7 A;  4L23 A;  3ULQ A;  2XPI A;  3FTU A;  4JEH A;  3CKB A;  4HRM B;  4GMJ A;  3VTY A;  3LY8 A;  2J4B A;  3SD5 A;  4I1O B;  5D0Q D;  3MGB A;  1OCZ E;  4XI9 A;  5M72 A;  4GZC A;  3D9M A;  3ABK E;  5FT9 A;  1KLX A;  3V30 A;  3MKQ A;  1N94 A;  4WNE A;  3NQP A;  2LSU A;  3CHM A;  3B7U X;  5CBN A;  5G04 J;  3DSU A;  1MYO A;  2L0T B;  3ZW3 A;  2M63 A;  3MYV A;  5J08 A;  3EIJ A;  2R17 C;  4HI8 A;  3D9N A;  2ILR A;  3RSE G;  5B1A E;  3HXB A;  2J09 A;  4TUU A;  3EHM A;  2WXF A;  3NB2 A;  5JJT A;  3PH0 C;  3Q7A A;  2GRP B;  5HI7 A;  5EDS A;  2FBN A;  3DXK G;  2XGS A;  3T8K A;  4M7C A;  4JXT A;  4HRN A;  2JLB A;  4I17 A;  3IBE A;  5AAR A;  3GZ2 A;  2BKG A;  4WAF A;  1ZU2 A;  4ANX A;  4G25 A;  1UN8 A;  2X6I A;  1HXI A;  3CVX A;  3E30 A;  1MX4 A;  4GTS A;  2X38 A;  1N52 A;  4WWP A;  3LCA A;  4I1M A;  5KJK A;  3ZRH A;  1KZP A;  3V2X A;  2ZGD A;  3JCK C;  3L22 A;  1E90 A;  2UY1 A;  3S2A A;  4NQ0 A;  2IEJ A;  3AG2 E;  2R05 A;  2AWI A;  2FO1 E;  3ABL E;  3I3N A;  5BV1 A;  5B3S E;  4AOF A;  1MQS A;  2B0O E;  3Q79 A;  5CRU A;  1V54 E;  1U3C A;  4GZ6 A;  4U96 D;  3ZU7 B;  3C3O A;  1E8W A;  2GRM A;  2OCC E;  3FUI A;  4XIF A;  2Q7F A;  1JWF A;  4GA2 A;  4TXQ A;  3UT8 A;  2IF4 A;  2L6B A;  3CHO A;  2KBX A;  3LDZ A;  5AQ9 A;  3AG3 E;  5KNG A;  2R59 A;  3HDX A;  5FQ7 A;  2P58 C;  3UI2 A;  4DI4 A;  4EBA G;  2Y69 E;  3N71 A;  3OXL A;  3QWV A;  4AIF A;  3T5X A;  1AP7 A;  2QYU A;  1NP7 A;  2VTB B;  1X81 A;  1YYH A;  4HLL A;  4UQX A;  4A3T A;  5KWD A;  1QYM A;  2RD0 A;  4GZ5 A;  1H19 A;  2GGF A;  3ML9 A;  2YHE A;  5JHA A;  3FUL A;  2XRZ A;  2YIN A;  4G26 A;  1KT0 A;  4F3V A;  4EZK A;  5D2M C;  1TEZ A;  3RO2 A;  2I1J A;  3U66 A;  3FH7 A;  3SGH A;  4I9E A;  4GAA A;  4A3V A;  2F8X K;  4UWF A;  1BI7 B;  4EZJ A;  3FUD A;  2J07 A;  2JAB A;  3JUE A;  1OCO E;  5FQ8 A;  4BEP A;  3QNK A;  1NFI E;  1LD7 A;  2XGO A;  4G8K A;  1WY6 A;  2ZIR A;  3GZS A;  1S70 B;  4N5Q A;  4KT6 B;  4OVU A;  4BY6 A;  3G2W A;  1SA5 A;  5FIN A;  1OWN A;  4H7Y A;  3PRE A;  3SFX A;  3TWS A;  1OUV A;  3CK7 A;  4J7W A;  4P29 A;  2XEH A;  4A1G A;  3HYM B;  1XGW A;  4J0U A;  4XEI G;  4NUR A;  3DSV A;  1LTX A;  3AJI A;  3DEO A;  2Y0B G;  3VLE A;  3ONK A;  5C1D A;  3LKU A;  4YDO A;  4ILG A;  3FUK A;  1E96 B;  3LXU X;  3ZIM A;  1TN8 A;  2WXI A;  2ZU6 B;  1N4S A;  3PZD A;  3FUN A;  2DCP A;  3KSL A;  4BES A;  5E76 A;  1W3B A;  5IY5 E;  4UWH A;  2XHE A;  3MA5 A;  3EHR A;  4ACK A;  1ELW A;  3TXN A;  3BU8 A;  4DPR A;  3ESK A;  2V4H C;  4FAD A;  2GW1 A;  3O48 A;  3FUE A;  2P9N G;  1TJC A;  4FP7 A;  5AEN A;  3ASO E;  4PS8 A;  1SQM A;  3UIO C;  5BUZ A;  1KT1 A;  5CHE E;  5BT1 A;  1O1S A;  2AJA A;  3IHV A;  5JJ7 A;  4HQD A;  4HRL A;  1YA0 A;  1MX6 A;  4U0Z A;  3W9G A;  2MOW A; 
#chains in the Genus database with same CATH homology
 2ZXW E;  2EIL E;  2EIM E;  3WG7 E;  3AG4 E;  2EIJ E;  2EIK E;  3ABL E;  3ASO E;  1OCO E;  5B1B E;  3X2Q E;  5B3S E;  5IY5 E;  3AG3 E;  3AG1 E;  2DYR E;  1V55 E;  1OCZ E;  3ASN E;  1OCC E;  1OCR E;  3ABK E;  1V54 E;  3ABM E;  3AG2 E;  2Y69 E;  5B1A E;  2EIN E;  2OCC E;  2DYS E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...