2Y69E

Bovine heart cytochrome c oxidase re-refined with molecular oxygen
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE SUBUNIT 1
publication title A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
pubmed doi rcsb
molecule tags Electron transport
total genus 41
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2y69E00
1OCCE 2EINE 3ABLE 1OCZE 2EIJE 2EILE 3AG1E 2Y69E 3ASNE 1OCOE 3ABKE 3WG7E 2DYRE 5B3SE 2OCCE 2EIME 3AG4E 5IY5E 3AG3E 3ABME 2EIKE 1V54E 2ZXWE 3AG2E 3ASOE 3X2QE 1V55E 5B1BE 1OCRE 2DYSE 5B1AE
chains in the Genus database with same CATH superfamily
1P5QA 4R7LA 2YHEA 3Q73A 4W9RA 3D9PA 1H2TC 3IHVA 4AJWA 3RU0A 2WXQA 5ENPD 2VJ8A 3NZUA 3I4GA 3PZ2A 2HYZA 4B8CB 5BV0A 3CLJA 5KWDA 2EQXA 4XEIG 1DC2A 2XZDG 2AJAA 3FUNA 3ZGQA 4HNAD 3DBSA 1OT8A 4CT0A 1KT1A 3FH7A 2UWJG 2A5EA 4EZJA 3B95A 3HXBA 2AW6A 1MZCA 3EIQC 3W9FA 3LY7A 1JWGA 5EN5D 3MKRA 3UT7A 3FTXA 3OXGA 2LSUA 4DRXE 3URZA 3Q7AA 4IRUA 3QJZA 4U0ZA 4TUUA 2DZOA 2WB2A 3D9NA 1V54E 1BI7B 3IHYA 1N95A 3QWVA 3ONKA 2OOEA 4ANWA 4DLQA 2MOWA 4G8LA 4BESA 5G05J 3Q47B 2H6FA 3N71A 5AQ7A 1WM5A 1QQEA 4RLYA 2X6JA 4MBGA 4HI8A 4JD2G 1FVFA 5JMND 1TR4A 2HE0A 3EHRA 4XKBA 1JWFA 2CFUA 3DEOA 3QDNA 3UX4A 5FT9A 2PQRA 3CKCA 3L17A 4E6HA 1KLXA 4NRHB 2FULA 4NURA 4QFVA 4M3OA 3LKUA 1SA5A 4WNFA 5FZRA 3JQ0A 4EECA 3KD7A 3BG0B 4G23A 4IN3B 5H7PA 3LEWA 3EIJA 3T8KA 2WPVA 4UQZA 2GW1A 2XEEA 3NOCD 4BT9A 2XGOA 4FP7A 3Q9UC 3QAQA 2IOLA 2DBAA 5D0OD 2MYOA 1H6KA 4KBQA 3L16A 1DCEA 1E8WA 5CCLA 5JHAA 4C0EA 3LCAA 1E7UA 4UQYA 3MJWA 4LRZA 1NL4A 1UJJA 4YVQC 4TV3A 5JJTA 3V30A 4GTTA 2RD0A 4G25A 2MRIA 4CDNA 4PS7A 4I6JA 5CERB 3CVXA 4L9PA 3NOGD 2IONA 3TWWA 3FUJA 3FWVA 3L54A 3SNXA 3Q15A 3FTUA 3LVQE 2XEHA 5FQ8A 2R2LA 3G2UA 2VTBB 3PE3A 3Q78A 4EQFA 4B89A 3UPVA 3UKUG 3S7BA 3L08A 4N2SA 5EYPF 4MLPA 4RG6A 3PZ1A 4K5AB 4HQDA 2KZTB 1K3ZD 5CRUA 4GPKA 4A1GA 3FHEA 4GA0A 1TNOA 2WXIA 3UIPC 2C0MA 3AAAC 4KVMA 3DSSA 3HXDA 5AARA 1D8DA 5AENA 4I6EA 4DX7D 2V5QC 3MV2B 3NAWA 3GZSA 2IU1A 1UJKA 4HFGA 3AJIA 2XRYA 4HVBA 3ESKA 3V2XA 5BXUA 3D9OA 5BUZA 5B3SE 3CQGB 2FF4A 2R02A 4HB5A 3IEGA 4FLHA 3ZEFA 2KATA 3SGHA 3ULEG 2LAIA 1ZBPA 5FTPA 3FUKA 3ZYMA 1RW2A 3FH5A 3HXCA 4U8YD 2I6HA 4LCTA 4CYMD 2RFMA 1TJFA 4K0RA 3U4TA 1A17A 4NACA 2I2OA 2WQHA 2CFZA 2RFAA 4BTBA 3PDNA 2I9CA 3U3WA 2EINE 3HXFA 3FTZA 1SA4A 2LNIA 3PEVB 4APOA 1SQMA 4U0UA 1JCSA 2J4BA 3D9JA 3Q75A 2P9NG 4A3TA 2XCBA 3ABME 4Z68A 3ASDA 3D9KA 1V55E 1SZ9A 1ZU2A 2J8SD 4YDWA 5ANRA 2CG3A 2YQ8A 4H7YA 2V8SE 2DYRE 3Q7FA 3C98A 2YINA 3B13A 3MX3A 1K1BA 2CHZA 2BTDA 3KSQA 3VLDA 3TWXA 3PZ3A 3RO2A 3C3OA 3FH8A 2LO6A 4BY6A 1NP7A 4GMLA 5HS0A 5BT1A 1SVXA 4EHMA 2PQNA 3CHQA 3FUMA 3QARA 2ZIRA 1X5BA 2KCLA 3V2OA 2R59A 4NIKA 2OVBA 4OYSA 5FINA 2VYIA 3E4BA 3D9MA 3F6QA 4K03A 2ZGGA 1INZA 3FDHA 1K1AA 1RZ4A 5CRVA 3ULYA 4EZLA 3UKRG 2J4DA 3SHFA 3PS6A 1KZPA 4JHJA 4GYYA 2XS8A 4JL0A 1ELRA 1X81A 1HG2A 5AJDA 4YDYA 5C1DA 4V3IA 3C3QA 2ETAA 5M72A 1IHGA 1NFIE 2V4HC 3NF1A 4P29A 3RAUA 3APFA 4ANXA 1WY6A 3FU0A 3ZYKA 5HQ8A 3CGHA 4GYWA 2WM9A 3EUVA 3PUKA 4DLOA 4DPRA 2UY1B 4HLLA 4JHKA 3MCXA 5DBKA 4O1PA 1EDUA 2AVPA 5AAOA 3HYMB 2KXPC 1MX6A 3UIOC 3CHPA 3UT4A 5KJNA 1BD8A 1EF1C 1D8EA 3PUJA 4XKCA 2IO3C 2WXKA 3T5XA 4EBAA 5AJLA 3VTXA 4YDEA 2Y0BG 1TJCA 2LUHA 3ZKJA 1HS6A 4HXIA 3HHMA 2EIME 1E8YA 4FHKA 3ZUVB 3CVWA 3V31A 4TUMA 3TAXA 1QYMA 3PREA 1O1RA 5LCWC 4CZ2D 4HOQA 4DK5A 5KNGA 5HKPA 3RO3A 2YHCA 2UY1A 1U3DA 3WG7E 3EU9A 4ABNA 4G2VA 3HXEA 4A55A 3GW4A 3GZ2A 3IBEA 4RQIA 4PH4B 2OEVA 4BWRA 3ZW3A 2MHKA 3PE4A 5KJMA 2CG2A 4IYPA 3JYSA 3AU5A 4C9BB 4OAVB 2F8XK 2AXVA 3CK8A 3FEYA 2CHWA 5E75A 2CHXA 3EHQA 3ASOE 5FQ4A 2J49A 2L6JA 2R17C 4RG9A 4I1OB 3CHSA 3V79K 2OEWA 4UWLA 3ZPJA 4I2ZA 2ZGDA 3ENEA 2I1JA 4G8KA 2P9LG 2V4LA 2OCCE 2WXOA 3UXGA 3GZ1A 4M7CA 4B8AA 5B1BE 3ZU7B 3ULQA 3QWPA 5JA4D 3FUHA 4GZ5A 4GZ6A 3U9WA 2GRPB 3MGBA 3O48A 2WXMA 5BNWA 4J8DA 2P2CP 1IQRA 4OAUC 4XIFA 4U63A 3I4RB 2ONDA 3ZVVA 2XENA 4L23A 4BTAA 1G3NB 1OXJA 4KXKB 1Y6IA 4N3AA 2X3MA 4LSZE 3FEXA 3FUDA 4U07A 3GYZA 3LPZA 1MX2A 1NZNA 3CVPA 1OUVA 3HG0D 4BT8A 5JJ6A 3SBSA 4N5QA 1Y8MA 1TN8A 2QYUA 1N0RA 5LOZA 5CECB 5LCWJ 1E8XA 3APDA 3ZN3A 4G24A 2ZU6B 1XGWA 3K9IA 3HDXA 3PNLB 2IOSA 4JPSA 1FVHA 5EIDA 1PY1A 2ZXWE 1JPLA 1KT0A 3ABLE 2XHEA 3ZNGA 3BUAA 3DRAA 1TEZA 1H2UA 2IF4A 4PS3A 5ENSD 4JA7A 4GYOA 4QQIA 4AV7A 1OWOA 4MKTA 3C3RA 2WXHA 3PNTB 3O4ZA 4ILGA 1ELKA 3ZIMA 2WXPA 4TRQA 5FWQA 3OXFA 2Q7FA 2BKGA 4AY6A 3EU5A 3SZ7A 3FUEA 4TXRA 3B7BA 5FZQA 3C72A 1E8ZA 3TWSA 2ZISA 1HH8A 2IJGX 3TWTA 5IY5E 2Y4UA 5KNHD 2X6IA 3JXIA 3RIBA 2VSOE 3UM0A 5ENNA 4XE0A 5ARFA 4PDXA 2GRLA 5LP0A 4AVXA 3S7FA 1N11A 1N4RA 3SFZA 4GU5A 2J07A 4JW1A 1TN7A 4O1OA 3D9HA 5CEDB 3DSUA 1S63A 4G26A 4WUYA 4L7TA 2IO2C 2IY0C 5D2MC 2GRQB 1NA0A 1BPOA 4GPMA 4ATGA 4C0MA 2XPZA 3MA5A 4A3VA 4AIFA 3MZLB 4GCNA 5A6CA 3MKQB 4HOTA 5BV1A 5HRYA 3FUFA 4N3BA 1TNUA 5JHBA 4UWGA 4JEUA 4I2WA 4BETA 3W9GA 4UWHA 2IFUA 3QOUA 3LYAA 4GMJA 5HI7A 3AG1E 2PL2A 4G1TA 1MX4A 4O60A 2PM6A 2RKKA 3ZRHA 1N9AA 4AXHA 5FZSA 4J7WA 3U64A 5CMWA 2FBNA 5LFAA 5A7DB 5E76A 2NXPA 2XGMA 3E34A 2VTBA 4J8FA 4B0ZA 4GTVA 3S2AA 1H2VC 3LS8A 2KZTA 2VGXB 4F53A 1LF8A 3RRUA 5AQAA 1U3CA 3L6AA 2AWIA 5AN8A 1N0QA 2VSXE 3E37A 1WG0A 1YCSB 3FTYA 3QNKA 3LXUX 2XCCA 4A63B 3ASHA 2IQCA 4GB9A 1O1TA 3LJ3A 2WXLA 4JA9A 4RVBA 2FI7A 3QK0A 4DUIA 3PEUB 3J5PA 2WMOA 2WQ6A 4UI9K 4BSXA 2J09A 3SQVA 3VLFA 3NB2A 1K8KG 5JJ7A 3UT8A 2VGXA 3KS2A 4J8SA 1H6OA 3OXLA 3AS4A 1OCRE 4YVOA 2BEDA 2EILE 2KBXA 5G2NA 4BX9A 2VGEA 3SBTB 5G04C 3CK9A 5AYWD 4ANVA 2L0TB 1MHQA 3QC1A 2XPYA 1QBQA 2KC7A 4GZ3A 4GTSA 3DPYA 4F1SA 3UM3A 1HU3A 1N4QA 3BEEA 3L22A 4F7AA 4G11A 5CCMA 3ML9A 3TG4A 4A1SA 2Y3AA 4GTRA 2V5FA 4HI9A 5DIZA 1OCOE 4JHRA 3UTMA 4JZYA 4N5CA 3DXMG 3E32A 2Y4TA 3J5QB 3SO8A 4MS6A 3UQ3A 4F6RD 4DX6D 4HRMB 2QC9A 4JXTA 1NI1A 2VGYA 3HIZA 3SY2A 1UW4B 3FP3A 1E90A 5J08A 2R5SA 3LVRE 2LAHA 2DWZA 4APFA 3AG4E 4KT6B 1OWLA 4L1BA 4I1AA 3UI2A 4K5CA 4FJYA 1JUQA 4WAFA 3FU5A 3UINC 3TL5A 3UM2A 2HR2A 3CVUA 3KEAA 1O1SA 4U96D 4XX5A 4GA1A 5FIOA 1S64A 1TNBA 4I6GA 4ATZD 3DSTA 5T4YA 1Z5SC 3FTWA 5ENTD 3FU3A 3NBNB 3SI5A 5ENQD 3ML8A 4URKA 3TWUA 2EIKE 3EDTB 2DCPA 3CQCB 3KEZA 4KVOA 1HX8A 3FTVA 4KMOA 3JCKC 3TWQA 2BF0X 4RSYA 2BUGA 4DX1A 1YMPA 5G04J 4FLBA 4U04A 3Q9NC 3E30A 3EHNA 2L9BA 4XI0A 3B7RL 2WMNA 4LEUA 5EKQD 1Z3XA 3MV3B 3PVLA 5J90A 3DSWA 2KM4A 5CHEE 4E85A 4DJAA 2FO1E 5BXOA 2OV8A 3FULA 1UN9A 3KSLA 4BSZB 3L13A 3QB2A 3ISMC 1O5MA 3HVEB 1ELWA 5BPPA 4J6IA 4U0SA 5KJLA 4WNDA 3RRNB 2B0OE 1N52A 3ZYLA 3G2VA 2WXNA 1JCRA 2RG8A 4WNEA 4L2LA 3ASGA 3Q4AB 1OY3D 2JABA 4ILHB 1SW6A 4I9CA 5CMYA 2P9IG 3LDZA 4F1PA 2F0YA 4JC8A 4Q69A 3TXMA 3DEPA 1LTXA 3RJVA 2JLBA 3AS5A 4AEZC 5EDSA 1MJ0A 4DI3A 3I3NA 5KJKA 5AQBA 3DSXA 3RSEG 1TN6A 1WDYA 3WXXA 3HVEA 4TXQA 2KCKA 4UWKA 1D9SA 2P58C 4IULA 4UI9J 1N4PA 3ONLA 3TJPA 2VQ2A 5CEAA 1LD8A 2L0IA 3CHOA 2XGSA 4KYOB 4GTOA 4FC8A 4GZDA 3CHMA 3Q79A 3NZSA 5BW8C 1JCQA 4ACLA 4LERA 3AS8A 3P2BA 2WXGA 4HBDA 4HLEA 1W3BA 4C48B 4B93B 3SD5A 1L5JA 2LXMA 1AWCB 2YNQA 3AG2E 3VLEA 4DI4A 1SZAA 4KZCA 2QYJA 1H6PA 4MRUA 2VSYA 1E96B 5D0QD 3BU8A 1EPUA 1H19A 2KCVA 2XEVA 2DZNA 4Q96A 4FA6A 2HO1A 4U7EB 3DWLG 4YNDA 3IV0A 4TXPA 3IKOB 1OCCE 4NQ0A 2LXLA 2WQ7A 3ASNE 2XPIA 3L82A 5EX0A 2ILRA 2IEJA 5ENRD 4CGVA 3D9IA 3RK6A 3FTSA 3CIAA 1IXVA 4L2YA 2X38A 1HE8A 1IQUA 3TXNA 2ETBA 4AP2A 4FU3A 3CVVA 4ZFHA 2A4ZA 2XRZA 3BG1B 4WNGA 4HOSA 2E2EA 1Z6TA 2LSVA 2R03A 3R9AB 1LD7A 1XNFA 5B1AE 4PUCA 3R7RA 1OCZE 4U95D 1TYQG 4PS8A 4N2QA 4LG6A 3R9MA 4BX8A 2H6IA 2F37A 4CEMA 1TNZA 2WVIA 3G2SA 3TG5A 1DCQA 5FQ6A 3U66A 5FQ7A 4CRWA 4GA2A 3DXKG 1PC2A 1OWNA 3T9KA 5G55A 1MYOA 2DIWA 3S7JA 1TNYA 3LY8A 3I5PA 5ITZF 3UMVA 1E7VA 2GRNB 3JUIA 3LY9A 1VDYA 2GGFA 1FPPA 3OTNA 3AU4A 4ZHBA 1FT1A 2PZIA 3NQPA 2DYSE 1S0PA 1NA3A 2J08A 3E33A 3FFLA 4FULA 2NSZA 4FHJA 3FU6A 4D10C 4JVSA 3CV0A 2P9SG 4WWPA 4XI9A 1BI8B 2WXRA 1DNPA 3FY4A 3EJNA 2PNNA 3CSFA 3ZHEB 2GROB 2OVFA 5A23A 2NYJA 2XS1A 3ZYQA 3CVNA 5CBNA 4CCAA 4JB8P 2P9KG 4K5BA 1KZOA 3JUEA 1KPSB 1N54A 1FCHA 1YA0A 4Y6WA 3R7QA 1OWPA 2R05A 3UM1A 2P9PG 2C2LA 3TGOA 1S70B 3QKYA 2DVWA 5ANLA 4AM9A 4WWNA 3MKQA 2X6HA 4LNBA 2BKKB 3MYVA 4LNGA 4H7XA 2C0LA 4DX5D 5KBAA 3CK7A 3ZHEA 3L9TA 2X6FA 4B94A 3TWVA 1N94A 2AXZA 3T8MA 1U2VG 3UUXA 4EZKA 3BQOA 4JEHA 2H6HA 2V0PA 3OAWA 4EBAG 1IHBA 2B6CA 4UQXA 4I1MA 4BEPA 5AIJA 4J0UA 2PM7A 3PZ4A 4GCOA 3ZFWA 1IKND 5EILA 2ETCA 1HZ4A 3APCA 4KZ0A 4DX2A 4X8QA 3SFYA 3JXJA 3TWRA 4FJZA 3CVQA 5CBOA 3VTYA 3CSTA 3ASFA 3PZDA 3Q5MA 3JQ1A 3T5VA 1UG3A 4I43A 3X2QE 4F3VA 4CDMA 1YYHA 4GTQA 2I1KA 3D3MA 1HF8A 2XZTG 4J8YA 4LNUD 3SFXA 3CEQA 1BU9A 4HS2A 5AQ9A 3RRMB 3LJNA 1OWMA 4LUNU 1BLXB 2QFCA 2WXFA 3Q49B 1A5EA 4GAAA 5C2YA 3CKBA 3DSVA 4I17A 3G2TA 4BERA 4ME2A 4HORA 4HRNA 1GW6A 3CVLA 2VSNA 4GZCA 2P9UG 4EPZA 3PH0C 5EIBE 3D9LA 1QZ2A 4OVUA 1N4SA 4N3CA 4FADA 2EIJE 3C5RA 4XZ4A 1HO8A 3FUIA 1HG5A 5LX8A 4UUCA 2Y1LE 3EHMA 3AG3E 2M63A 4U8HA 1FT2A 4UWFA 5ARGA 2Y69E 3CHRA 5T3RA 1UOHA 5FJYA 4UI9C 3ZXPA 4YDOA 3HRAA 1UN8A 3CR3A 4ILIA 3MEKA 4CGWA 2X6KA 2WXJA 3DPDA 2F8YA 1IYGA 3QWWA 4AOFA 1HFAA 2GRMA 4WWOA 1QNFA 4CT4A 5EYLA 3B7TA 2GRRB 3B7SA 2E0IA 1Q2ZA 1Z3YA 4J8EA 2JEKA 4Q94A 4HOUA 3CVYA 2QY7A 5ENOD 4ACKA 5EX3A 1MQSA 2QZAA 4GTMA 1WAO1 3SF4A 1H0AA 3S7DA 4Y6CA 5G05C 4BFRA 4GMRA 4U8VD 4OVVA 3ZXSA 4GTPA 3PRZA 1DVPA 2XQ0A 2FO7A 3IXEA 3B7UX 3KAEA 1B89A 3ESLA 4N39A 3G2WA 1HXIA 1PAQA 1EYHA 4HRLA 4AY5A 1ZB1A 1AP7A 2H6GA 2AXUA 3P1UA 4O6FA 5T8IA 4CDRA 3ABKE 2HM8A 2NC9A 5KCMA 2J9QA 3RKVA 5D66A 4ANUA 4I9EA 2A5UA 2FEZA 2L6BA
chains in the Genus database with same CATH topology
1OCCE 2EINE 3ABLE 1OCZE 2EIJE 2EILE 3AG1E 2Y69E 3ASNE 1OCOE 3ABKE 3WG7E 2DYRE 5B3SE 2OCCE 2EIME 3AG4E 5IY5E 3AG3E 3ABME 2EIKE 1V54E 2ZXWE 3AG2E 3ASOE 3X2QE 1V55E 5B1BE 1OCRE 2DYSE 5B1AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCC E;  2EIN E;  3ABL E;  1OCZ E;  2EIJ E;  2EIL E;  3AG1 E;  2Y69 E;  3ASN E;  1OCO E;  3ABK E;  3WG7 E;  2DYR E;  5B3S E;  2OCC E;  2EIM E;  3AG4 E;  5IY5 E;  3AG3 E;  3ABM E;  2EIK E;  1V54 E;  2ZXW E;  3AG2 E;  3ASO E;  3X2Q E;  1V55 E;  5B1B E;  1OCR E;  2DYS E;  5B1A E; 
#chains in the Genus database with same CATH topology
 1P5Q A;  4R7L A;  2YHE A;  3Q73 A;  4W9R A;  3D9P A;  1H2T C;  3IHV A;  4AJW A;  3RU0 A;  2WXQ A;  5ENP D;  2VJ8 A;  3NZU A;  3I4G A;  3PZ2 A;  2HYZ A;  4B8C B;  5BV0 A;  3CLJ A;  5KWD A;  2EQX A;  4XEI G;  1DC2 A;  2XZD G;  2AJA A;  3FUN A;  3ZGQ A;  4HNA D;  3DBS A;  1OT8 A;  4CT0 A;  1KT1 A;  3FH7 A;  2UWJ G;  2A5E A;  4EZJ A;  3B95 A;  3HXB A;  2AW6 A;  1MZC A;  3EIQ C;  3W9F A;  3LY7 A;  1JWG A;  5EN5 D;  3MKR A;  3UT7 A;  3FTX A;  3OXG A;  2LSU A;  4DRX E;  3URZ A;  3Q7A A;  4IRU A;  3QJZ A;  4U0Z A;  4TUU A;  2DZO A;  2WB2 A;  3D9N A;  1V54 E;  1BI7 B;  3IHY A;  1N95 A;  3QWV A;  3ONK A;  2OOE A;  4ANW A;  4DLQ A;  2MOW A;  4G8L A;  4BES A;  5G05 J;  3Q47 B;  2H6F A;  3N71 A;  5AQ7 A;  1WM5 A;  1QQE A;  4RLY A;  2X6J A;  4MBG A;  4HI8 A;  4JD2 G;  1FVF A;  5JMN D;  1TR4 A;  2HE0 A;  3EHR A;  4XKB A;  1JWF A;  2CFU A;  3DEO A;  3QDN A;  3UX4 A;  5FT9 A;  2PQR A;  3CKC A;  3L17 A;  4E6H A;  1KLX A;  4NRH B;  2FUL A;  4NUR A;  4QFV A;  4M3O A;  3LKU A;  1SA5 A;  4WNF A;  5FZR A;  3JQ0 A;  4EEC A;  3KD7 A;  3BG0 B;  4G23 A;  4IN3 B;  5H7P A;  3LEW A;  3EIJ A;  3T8K A;  2WPV A;  4UQZ A;  2GW1 A;  2XEE A;  3NOC D;  4BT9 A;  2XGO A;  4FP7 A;  3Q9U C;  3QAQ A;  2IOL A;  2DBA A;  5D0O D;  2MYO A;  1H6K A;  4KBQ A;  3L16 A;  1DCE A;  1E8W A;  5CCL A;  5JHA A;  4C0E A;  3LCA A;  1E7U A;  4UQY A;  3MJW A;  4LRZ A;  1NL4 A;  1UJJ A;  4YVQ C;  4TV3 A;  5JJT A;  3V30 A;  4GTT A;  2RD0 A;  4G25 A;  2MRI A;  4CDN A;  4PS7 A;  4I6J A;  5CER B;  3CVX A;  4L9P A;  3NOG D;  2ION A;  3TWW A;  3FUJ A;  3FWV A;  3L54 A;  3SNX A;  3Q15 A;  3FTU A;  3LVQ E;  2XEH A;  5FQ8 A;  2R2L A;  3G2U A;  2VTB B;  3PE3 A;  3Q78 A;  4EQF A;  4B89 A;  3UPV A;  3UKU G;  3S7B A;  3L08 A;  4N2S A;  5EYP F;  4MLP A;  4RG6 A;  3PZ1 A;  4K5A B;  4HQD A;  2KZT B;  1K3Z D;  5CRU A;  4GPK A;  4A1G A;  3FHE A;  4GA0 A;  1TNO A;  2WXI A;  3UIP C;  2C0M A;  3AAA C;  4KVM A;  3DSS A;  3HXD A;  5AAR A;  1D8D A;  5AEN A;  4I6E A;  4DX7 D;  2V5Q C;  3MV2 B;  3NAW A;  3GZS A;  2IU1 A;  1UJK A;  4HFG A;  3AJI A;  2XRY A;  4HVB A;  3ESK A;  3V2X A;  5BXU A;  3D9O A;  5BUZ A;  5B3S E;  3CQG B;  2FF4 A;  2R02 A;  4HB5 A;  3IEG A;  4FLH A;  3ZEF A;  2KAT A;  3SGH A;  3ULE G;  2LAI A;  1ZBP A;  5FTP A;  3FUK A;  3ZYM A;  1RW2 A;  3FH5 A;  3HXC A;  4U8Y D;  2I6H A;  4LCT A;  4CYM D;  2RFM A;  1TJF A;  4K0R A;  3U4T A;  1A17 A;  4NAC A;  2I2O A;  2WQH A;  2CFZ A;  2RFA A;  4BTB A;  3PDN A;  2I9C A;  3U3W A;  2EIN E;  3HXF A;  3FTZ A;  1SA4 A;  2LNI A;  3PEV B;  4APO A;  1SQM A;  4U0U A;  1JCS A;  2J4B A;  3D9J A;  3Q75 A;  2P9N G;  4A3T A;  2XCB A;  3ABM E;  4Z68 A;  3ASD A;  3D9K A;  1V55 E;  1SZ9 A;  1ZU2 A;  2J8S D;  4YDW A;  5ANR A;  2CG3 A;  2YQ8 A;  4H7Y A;  2V8S E;  2DYR E;  3Q7F A;  3C98 A;  2YIN A;  3B13 A;  3MX3 A;  1K1B A;  2CHZ A;  2BTD A;  3KSQ A;  3VLD A;  3TWX A;  3PZ3 A;  3RO2 A;  3C3O A;  3FH8 A;  2LO6 A;  4BY6 A;  1NP7 A;  4GML A;  5HS0 A;  5BT1 A;  1SVX A;  4EHM A;  2PQN A;  3CHQ A;  3FUM A;  3QAR A;  2ZIR A;  1X5B A;  2KCL A;  3V2O A;  2R59 A;  4NIK A;  2OVB A;  4OYS A;  5FIN A;  2VYI A;  3E4B A;  3D9M A;  3F6Q A;  4K03 A;  2ZGG A;  1INZ A;  3FDH A;  1K1A A;  1RZ4 A;  5CRV A;  3ULY A;  4EZL A;  3UKR G;  2J4D A;  3SHF A;  3PS6 A;  1KZP A;  4JHJ A;  4GYY A;  2XS8 A;  4JL0 A;  1ELR A;  1X81 A;  1HG2 A;  5AJD A;  4YDY A;  5C1D A;  4V3I A;  3C3Q A;  2ETA A;  5M72 A;  1IHG A;  1NFI E;  2V4H C;  3NF1 A;  4P29 A;  3RAU A;  3APF A;  4ANX A;  1WY6 A;  3FU0 A;  3ZYK A;  5HQ8 A;  3CGH A;  4GYW A;  2WM9 A;  3EUV A;  3PUK A;  4DLO A;  4DPR A;  2UY1 B;  4HLL A;  4JHK A;  3MCX A;  5DBK A;  4O1P A;  1EDU A;  2AVP A;  5AAO A;  3HYM B;  2KXP C;  1MX6 A;  3UIO C;  3CHP A;  3UT4 A;  5KJN A;  1BD8 A;  1EF1 C;  1D8E A;  3PUJ A;  4XKC A;  2IO3 C;  2WXK A;  3T5X A;  4EBA A;  5AJL A;  3VTX A;  4YDE A;  2Y0B G;  1TJC A;  2LUH A;  3ZKJ A;  1HS6 A;  4HXI A;  3HHM A;  2EIM E;  1E8Y A;  4FHK A;  3ZUV B;  3CVW A;  3V31 A;  4TUM A;  3TAX A;  1QYM A;  3PRE A;  1O1R A;  5LCW C;  4CZ2 D;  4HOQ A;  4DK5 A;  5KNG A;  5HKP A;  3RO3 A;  2YHC A;  2UY1 A;  1U3D A;  3WG7 E;  3EU9 A;  4ABN A;  4G2V A;  3HXE A;  4A55 A;  3GW4 A;  3GZ2 A;  3IBE A;  4RQI A;  4PH4 B;  2OEV A;  4BWR A;  3ZW3 A;  2MHK A;  3PE4 A;  5KJM A;  2CG2 A;  4IYP A;  3JYS A;  3AU5 A;  4C9B B;  4OAV B;  2F8X K;  2AXV A;  3CK8 A;  3FEY A;  2CHW A;  5E75 A;  2CHX A;  3EHQ A;  3ASO E;  5FQ4 A;  2J49 A;  2L6J A;  2R17 C;  4RG9 A;  4I1O B;  3CHS A;  3V79 K;  2OEW A;  4UWL A;  3ZPJ A;  4I2Z A;  2ZGD A;  3ENE A;  2I1J A;  4G8K A;  2P9L G;  2V4L A;  2OCC E;  2WXO A;  3UXG A;  3GZ1 A;  4M7C A;  4B8A A;  5B1B E;  3ZU7 B;  3ULQ A;  3QWP A;  5JA4 D;  3FUH A;  4GZ5 A;  4GZ6 A;  3U9W A;  2GRP B;  3MGB A;  3O48 A;  2WXM A;  5BNW A;  4J8D A;  2P2C P;  1IQR A;  4OAU C;  4XIF A;  4U63 A;  3I4R B;  2OND A;  3ZVV A;  2XEN A;  4L23 A;  4BTA A;  1G3N B;  1OXJ A;  4KXK B;  1Y6I A;  4N3A A;  2X3M A;  4LSZ E;  3FEX A;  3FUD A;  4U07 A;  3GYZ A;  3LPZ A;  1MX2 A;  1NZN A;  3CVP A;  1OUV A;  3HG0 D;  4BT8 A;  5JJ6 A;  3SBS A;  4N5Q A;  1Y8M A;  1TN8 A;  2QYU A;  1N0R A;  5LOZ A;  5CEC B;  5LCW J;  1E8X A;  3APD A;  3ZN3 A;  4G24 A;  2ZU6 B;  1XGW A;  3K9I A;  3HDX A;  3PNL B;  2IOS A;  4JPS A;  1FVH A;  5EID A;  1PY1 A;  2ZXW E;  1JPL A;  1KT0 A;  3ABL E;  2XHE A;  3ZNG A;  3BUA A;  3DRA A;  1TEZ A;  1H2U A;  2IF4 A;  4PS3 A;  5ENS D;  4JA7 A;  4GYO A;  4QQI A;  4AV7 A;  1OWO A;  4MKT A;  3C3R A;  2WXH A;  3PNT B;  3O4Z A;  4ILG A;  1ELK A;  3ZIM A;  2WXP A;  4TRQ A;  5FWQ A;  3OXF A;  2Q7F A;  2BKG A;  4AY6 A;  3EU5 A;  3SZ7 A;  3FUE A;  4TXR A;  3B7B A;  5FZQ A;  3C72 A;  1E8Z A;  3TWS A;  2ZIS A;  1HH8 A;  2IJG X;  3TWT A;  5IY5 E;  2Y4U A;  5KNH D;  2X6I A;  3JXI A;  3RIB A;  2VSO E;  3UM0 A;  5ENN A;  4XE0 A;  5ARF A;  4PDX A;  2GRL A;  5LP0 A;  4AVX A;  3S7F A;  1N11 A;  1N4R A;  3SFZ A;  4GU5 A;  2J07 A;  4JW1 A;  1TN7 A;  4O1O A;  3D9H A;  5CED B;  3DSU A;  1S63 A;  4G26 A;  4WUY A;  4L7T A;  2IO2 C;  2IY0 C;  5D2M C;  2GRQ B;  1NA0 A;  1BPO A;  4GPM A;  4ATG A;  4C0M A;  2XPZ A;  3MA5 A;  4A3V A;  4AIF A;  3MZL B;  4GCN A;  5A6C A;  3MKQ B;  4HOT A;  5BV1 A;  5HRY A;  3FUF A;  4N3B A;  1TNU A;  5JHB A;  4UWG A;  4JEU A;  4I2W A;  4BET A;  3W9G A;  4UWH A;  2IFU A;  3QOU A;  3LYA A;  4GMJ A;  5HI7 A;  3AG1 E;  2PL2 A;  4G1T A;  1MX4 A;  4O60 A;  2PM6 A;  2RKK A;  3ZRH A;  1N9A A;  4AXH A;  5FZS A;  4J7W A;  3U64 A;  5CMW A;  2FBN A;  5LFA A;  5A7D B;  5E76 A;  2NXP A;  2XGM A;  3E34 A;  2VTB A;  4J8F A;  4B0Z A;  4GTV A;  3S2A A;  1H2V C;  3LS8 A;  2KZT A;  2VGX B;  4F53 A;  1LF8 A;  3RRU A;  5AQA A;  1U3C A;  3L6A A;  2AWI A;  5AN8 A;  1N0Q A;  2VSX E;  3E37 A;  1WG0 A;  1YCS B;  3FTY A;  3QNK A;  3LXU X;  2XCC A;  4A63 B;  3ASH A;  2IQC A;  4GB9 A;  1O1T A;  3LJ3 A;  2WXL A;  4JA9 A;  4RVB A;  2FI7 A;  3QK0 A;  4DUI A;  3PEU B;  3J5P A;  2WMO A;  2WQ6 A;  4UI9 K;  4BSX A;  2J09 A;  3SQV A;  3VLF A;  3NB2 A;  1K8K G;  5JJ7 A;  3UT8 A;  2VGX A;  3KS2 A;  4J8S A;  1H6O A;  3OXL A;  3AS4 A;  1OCR E;  4YVO A;  2BED A;  2EIL E;  2KBX A;  5G2N A;  4BX9 A;  2VGE A;  3SBT B;  5G04 C;  3CK9 A;  5AYW D;  4ANV A;  2L0T B;  1MHQ A;  3QC1 A;  2XPY A;  1QBQ A;  2KC7 A;  4GZ3 A;  4GTS A;  3DPY A;  4F1S A;  3UM3 A;  1HU3 A;  1N4Q A;  3BEE A;  3L22 A;  4F7A A;  4G11 A;  5CCM A;  3ML9 A;  3TG4 A;  4A1S A;  2Y3A A;  4GTR A;  2V5F A;  4HI9 A;  5DIZ A;  1OCO E;  4JHR A;  3UTM A;  4JZY A;  4N5C A;  3DXM G;  3E32 A;  2Y4T A;  3J5Q B;  3SO8 A;  4MS6 A;  3UQ3 A;  4F6R D;  4DX6 D;  4HRM B;  2QC9 A;  4JXT A;  1NI1 A;  2VGY A;  3HIZ A;  3SY2 A;  1UW4 B;  3FP3 A;  1E90 A;  5J08 A;  2R5S A;  3LVR E;  2LAH A;  2DWZ A;  4APF A;  3AG4 E;  4KT6 B;  1OWL A;  4L1B A;  4I1A A;  3UI2 A;  4K5C A;  4FJY A;  1JUQ A;  4WAF A;  3FU5 A;  3UIN C;  3TL5 A;  3UM2 A;  2HR2 A;  3CVU A;  3KEA A;  1O1S A;  4U96 D;  4XX5 A;  4GA1 A;  5FIO A;  1S64 A;  1TNB A;  4I6G A;  4ATZ D;  3DST A;  5T4Y A;  1Z5S C;  3FTW A;  5ENT D;  3FU3 A;  3NBN B;  3SI5 A;  5ENQ D;  3ML8 A;  4URK A;  3TWU A;  2EIK E;  3EDT B;  2DCP A;  3CQC B;  3KEZ A;  4KVO A;  1HX8 A;  3FTV A;  4KMO A;  3JCK C;  3TWQ A;  2BF0 X;  4RSY A;  2BUG A;  4DX1 A;  1YMP A;  5G04 J;  4FLB A;  4U04 A;  3Q9N C;  3E30 A;  3EHN A;  2L9B A;  4XI0 A;  3B7R L;  2WMN A;  4LEU A;  5EKQ D;  1Z3X A;  3MV3 B;  3PVL A;  5J90 A;  3DSW A;  2KM4 A;  5CHE E;  4E85 A;  4DJA A;  2FO1 E;  5BXO A;  2OV8 A;  3FUL A;  1UN9 A;  3KSL A;  4BSZ B;  3L13 A;  3QB2 A;  3ISM C;  1O5M A;  3HVE B;  1ELW A;  5BPP A;  4J6I A;  4U0S A;  5KJL A;  4WND A;  3RRN B;  2B0O E;  1N52 A;  3ZYL A;  3G2V A;  2WXN A;  1JCR A;  2RG8 A;  4WNE A;  4L2L A;  3ASG A;  3Q4A B;  1OY3 D;  2JAB A;  4ILH B;  1SW6 A;  4I9C A;  5CMY A;  2P9I G;  3LDZ A;  4F1P A;  2F0Y A;  4JC8 A;  4Q69 A;  3TXM A;  3DEP A;  1LTX A;  3RJV A;  2JLB A;  3AS5 A;  4AEZ C;  5EDS A;  1MJ0 A;  4DI3 A;  3I3N A;  5KJK A;  5AQB A;  3DSX A;  3RSE G;  1TN6 A;  1WDY A;  3WXX A;  3HVE A;  4TXQ A;  2KCK A;  4UWK A;  1D9S A;  2P58 C;  4IUL A;  4UI9 J;  1N4P A;  3ONL A;  3TJP A;  2VQ2 A;  5CEA A;  1LD8 A;  2L0I A;  3CHO A;  2XGS A;  4KYO B;  4GTO A;  4FC8 A;  4GZD A;  3CHM A;  3Q79 A;  3NZS A;  5BW8 C;  1JCQ A;  4ACL A;  4LER A;  3AS8 A;  3P2B A;  2WXG A;  4HBD A;  4HLE A;  1W3B A;  4C48 B;  4B93 B;  3SD5 A;  1L5J A;  2LXM A;  1AWC B;  2YNQ A;  3AG2 E;  3VLE A;  4DI4 A;  1SZA A;  4KZC A;  2QYJ A;  1H6P A;  4MRU A;  2VSY A;  1E96 B;  5D0Q D;  3BU8 A;  1EPU A;  1H19 A;  2KCV A;  2XEV A;  2DZN A;  4Q96 A;  4FA6 A;  2HO1 A;  4U7E B;  3DWL G;  4YND A;  3IV0 A;  4TXP A;  3IKO B;  1OCC E;  4NQ0 A;  2LXL A;  2WQ7 A;  3ASN E;  2XPI A;  3L82 A;  5EX0 A;  2ILR A;  2IEJ A;  5ENR D;  4CGV A;  3D9I A;  3RK6 A;  3FTS A;  3CIA A;  1IXV A;  4L2Y A;  2X38 A;  1HE8 A;  1IQU A;  3TXN A;  2ETB A;  4AP2 A;  4FU3 A;  3CVV A;  4ZFH A;  2A4Z A;  2XRZ A;  3BG1 B;  4WNG A;  4HOS A;  2E2E A;  1Z6T A;  2LSV A;  2R03 A;  3R9A B;  1LD7 A;  1XNF A;  5B1A E;  4PUC A;  3R7R A;  1OCZ E;  4U95 D;  1TYQ G;  4PS8 A;  4N2Q A;  4LG6 A;  3R9M A;  4BX8 A;  2H6I A;  2F37 A;  4CEM A;  1TNZ A;  2WVI A;  3G2S A;  3TG5 A;  1DCQ A;  5FQ6 A;  3U66 A;  5FQ7 A;  4CRW A;  4GA2 A;  3DXK G;  1PC2 A;  1OWN A;  3T9K A;  5G55 A;  1MYO A;  2DIW A;  3S7J A;  1TNY A;  3LY8 A;  3I5P A;  5ITZ F;  3UMV A;  1E7V A;  2GRN B;  3JUI A;  3LY9 A;  1VDY A;  2GGF A;  1FPP A;  3OTN A;  3AU4 A;  4ZHB A;  1FT1 A;  2PZI A;  3NQP A;  2DYS E;  1S0P A;  1NA3 A;  2J08 A;  3E33 A;  3FFL A;  4FUL A;  2NSZ A;  4FHJ A;  3FU6 A;  4D10 C;  4JVS A;  3CV0 A;  2P9S G;  4WWP A;  4XI9 A;  1BI8 B;  2WXR A;  1DNP A;  3FY4 A;  3EJN A;  2PNN A;  3CSF A;  3ZHE B;  2GRO B;  2OVF A;  5A23 A;  2NYJ A;  2XS1 A;  3ZYQ A;  3CVN A;  5CBN A;  4CCA A;  4JB8 P;  2P9K G;  4K5B A;  1KZO A;  3JUE A;  1KPS B;  1N54 A;  1FCH A;  1YA0 A;  4Y6W A;  3R7Q A;  1OWP A;  2R05 A;  3UM1 A;  2P9P G;  2C2L A;  3TGO A;  1S70 B;  3QKY A;  2DVW A;  5ANL A;  4AM9 A;  4WWN A;  3MKQ A;  2X6H A;  4LNB A;  2BKK B;  3MYV A;  4LNG A;  4H7X A;  2C0L A;  4DX5 D;  5KBA A;  3CK7 A;  3ZHE A;  3L9T A;  2X6F A;  4B94 A;  3TWV A;  1N94 A;  2AXZ A;  3T8M A;  1U2V G;  3UUX A;  4EZK A;  3BQO A;  4JEH A;  2H6H A;  2V0P A;  3OAW A;  4EBA G;  1IHB A;  2B6C A;  4UQX A;  4I1M A;  4BEP A;  5AIJ A;  4J0U A;  2PM7 A;  3PZ4 A;  4GCO A;  3ZFW A;  1IKN D;  5EIL A;  2ETC A;  1HZ4 A;  3APC A;  4KZ0 A;  4DX2 A;  4X8Q A;  3SFY A;  3JXJ A;  3TWR A;  4FJZ A;  3CVQ A;  5CBO A;  3VTY A;  3CST A;  3ASF A;  3PZD A;  3Q5M A;  3JQ1 A;  3T5V A;  1UG3 A;  4I43 A;  3X2Q E;  4F3V A;  4CDM A;  1YYH A;  4GTQ A;  2I1K A;  3D3M A;  1HF8 A;  2XZT G;  4J8Y A;  4LNU D;  3SFX A;  3CEQ A;  1BU9 A;  4HS2 A;  5AQ9 A;  3RRM B;  3LJN A;  1OWM A;  4LUN U;  1BLX B;  2QFC A;  2WXF A;  3Q49 B;  1A5E A;  4GAA A;  5C2Y A;  3CKB A;  3DSV A;  4I17 A;  3G2T A;  4BER A;  4ME2 A;  4HOR A;  4HRN A;  1GW6 A;  3CVL A;  2VSN A;  4GZC A;  2P9U G;  4EPZ A;  3PH0 C;  5EIB E;  3D9L A;  1QZ2 A;  4OVU A;  1N4S A;  4N3C A;  4FAD A;  2EIJ E;  3C5R A;  4XZ4 A;  1HO8 A;  3FUI A;  1HG5 A;  5LX8 A;  4UUC A;  2Y1L E;  3EHM A;  3AG3 E;  2M63 A;  4U8H A;  1FT2 A;  4UWF A;  5ARG A;  2Y69 E;  3CHR A;  5T3R A;  1UOH A;  5FJY A;  4UI9 C;  3ZXP A;  4YDO A;  3HRA A;  1UN8 A;  3CR3 A;  4ILI A;  3MEK A;  4CGW A;  2X6K A;  2WXJ A;  3DPD A;  2F8Y A;  1IYG A;  3QWW A;  4AOF A;  1HFA A;  2GRM A;  4WWO A;  1QNF A;  4CT4 A;  5EYL A;  3B7T A;  2GRR B;  3B7S A;  2E0I A;  1Q2Z A;  1Z3Y A;  4J8E A;  2JEK A;  4Q94 A;  4HOU A;  3CVY A;  2QY7 A;  5ENO D;  4ACK A;  5EX3 A;  1MQS A;  2QZA A;  4GTM A;  1WAO 1;  3SF4 A;  1H0A A;  3S7D A;  4Y6C A;  5G05 C;  4BFR A;  4GMR A;  4U8V D;  4OVV A;  3ZXS A;  4GTP A;  3PRZ A;  1DVP A;  2XQ0 A;  2FO7 A;  3IXE A;  3B7U X;  3KAE A;  1B89 A;  3ESL A;  4N39 A;  3G2W A;  1HXI A;  1PAQ A;  1EYH A;  4HRL A;  4AY5 A;  1ZB1 A;  1AP7 A;  2H6G A;  2AXU A;  3P1U A;  4O6F A;  5T8I A;  4CDR A;  3ABK E;  2HM8 A;  2NC9 A;  5KCM A;  2J9Q A;  3RKV A;  5D66 A;  4ANU A;  4I9E A;  2A5U A;  2FEZ A;  2L6B A; 
#chains in the Genus database with same CATH homology
 1OCC E;  2EIN E;  3ABL E;  1OCZ E;  2EIJ E;  2EIL E;  3AG1 E;  2Y69 E;  3ASN E;  1OCO E;  3ABK E;  3WG7 E;  2DYR E;  5B3S E;  2OCC E;  2EIM E;  3AG4 E;  5IY5 E;  3AG3 E;  3ABM E;  2EIK E;  1V54 E;  2ZXW E;  3AG2 E;  3ASO E;  3X2Q E;  1V55 E;  5B1B E;  1OCR E;  2DYS E;  5B1A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...