2Y69E

Bovine heart cytochrome c oxidase re-refined with molecular oxygen
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME C OXIDASE SUBUNIT 1
total genus 41
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2y69E00
3ABLE 3ABKE 2OCCE 1OCZE 2DYRE 3AG4E 2Y69E 3X2QE 3AG1E 2EILE 2EIKE 3ASNE 3AG2E 1OCCE 5B3SE 2EIME 1OCOE 1V55E 3WG7E 1V54E 3AG3E 5IY5E 2ZXWE 2EIJE 1OCRE 3ASOE 2DYSE 3ABME 5B1BE 5B1AE 2EINE
chains in the Genus database with same CATH superfamily
3ABLE 2KZTB 2R03A 3RO3A 4QFVA 3FHEA 3R7QA 4PUCA 3B13A 4WNFA 1H2VC 1E90A 2FBNA 3L13A 2RKKA 4L2LA 3LY7A 3FUKA 2XENA 3UUXA 4YNDA 4F53A 4GTOA 1HO8A 3LEWA 2XPYA 2XGMA 5D66A 4FLHA 4BWRA 1N95A 3FH8A 2PQRA 5CMWA 4UQZA 3HXDA 3NOCD 3MZLB 1S70B 2XGOA 4LCTA 3E4BA 4GPKA 5E76A 4IRUA 1HE8A 4GYOA 4L23A 2WM9A 1OWLA 2CHXA 3SZ7A 3ZKJA 1K8KG 1N4PA 5CCMA 3HRAA 2J4BA 2EILE 3NB2A 4BFRA 1N52A 3APDA 3U9WA 5J90A 2P9NG 4G8KA 4YVOA 1TNUA 3RRMB 4FP7A 3FUHA 4J8EA 1U2VG 5JHAA 1O1RA 3CK7A 1WAO1 3TXNA 4YDYA 3SBTB 2VTBA 1S64A 2AW6A 3PVLA 1SW6A 2ZXWE 3RO2A 2DYSE 4BSXA 4YDOA 4G1TA 2UWJG 4HOUA 5FZRA 5ENNA 2J07A 4DUIA 5ENPD 3ENEA 4G8LA 4GZ5A 2WMNA 1RZ4A 2XRYA 3QB2A 3ISMC 5JJ7A 4PS7A 2YQ8A 2JLBA 3J5QB 3PREA 3CKCA 4WWPA 3SHFA 3ZHEA 3MGBA 3APCA 3FTYA 3EHQA 4WNDA 3AAAC 4DPRA 3TXMA 4G11A 3Q47B 4D10C 4GA1A 3S7JA 5JA4D 4JA9A 3PZ4A 4J8DA 3EIJA 1P5QA 2ZIRA 3AJIA 4GMLA 4ANUA 4ILIA 3CHMA 2KCVA 4JEHA 1A5EA 4LSZE 2AJAA 4G26A 5T8IA 2PQNA 5G04J 3NZUA 3SD5A 3F6QA 4RSYA 2H6GA 2RFMA 5KNGA 1DCEA 3LCAA 3DSWA 3EDTB 1IQUA 5KJMA 4TXQA 2DCPA 1NA0A 3DPDA 3MV3B 2NYJA 3QOUA 1Z3YA 3MCXA 1N4RA 5C1DA 2J4DA 2LSVA 2KM4A 5KJKA 2PNNA 1ELWA 2X6KA 2WB2A 4N5QA 3NBNB 2EQXA 1NI1A 5JHBA 1UOHA 3PUKA 4E6HA 2VGXB 4FHJA 3C3QA 3TWRA 3KSLA 5T3RA 1HS6A 3ZVVA 3LPZA 5LCWC 4KBQA 3PEVB 4PS8A 2YNQA 5AQAA 2IF4A 1OUVA 2R59A 5AIJA 4U0ZA 4C48B 1S0PA 5CEDB 2HE0A 3GZ2A 3LY8A 5KWDA 2OEWA 1X81A 3CQGB 1DVPA 5CEAA 4HI8A 3RIBA 4B94A 3ONKA 4JA7A 3AG3E 3UXGA 3EHMA 3B7UX 1IQRA 3BEEA 3E32A 1D8DA 2I2OA 4U07A 4EPZA 2PM6A 2GRNB 2FO7A 3W9GA 5G04C 4NQ0A 2XEHA 3ML9A 5T4YA 3DXKG 3E33A 3B95A 4F6RD 3ZYLA 1OWOA 4KVOA 3OTNA 4G2VA 4R7LA 1U3DA 5BV1A 1BPOA 1YMPA 4KMOA 3RK6A 4U04A 2KXPC 3D9PA 3EHRA 2I9CA 1MX4A 1IHGA 3C3RA 2WXLA 3JCKC 1JWGA 4BETA 4J0UA 3CVXA 2Y69E 2V4HC 2DZOA 1Y6IA 3G2WA 4L9PA 2VYIA 2ZGDA 4NACA 1E8XA 5G55A 3AU4A 1H2TC 1EYHA 3DWLG 3LXUX 4G23A 3IHVA 3ZXPA 2ZISA 3TG4A 3CVQA 3Q78A 5AQ7A 2ONDA 1YA0A 2QC9A 3O48A 4KZCA 5ANRA 2YHCA 5BV0A 1NL4A 5CMYA 4U8HA 5HKPA 3G2UA 2DBAA 4HORA 1MX2A 3FFLA 3TWQA 3SFXA 1DNPA 2XRZA 2XQ0A 1S63A 4EZJA 4HRNA 5LP0A 5DIZA 2YHEA 1FT2A 3ZRHA 4KXKB 2GRMA 3FUMA 3SI5A 4PH4B 3ZYQA 4P29A 4EZLA 5KNHD 2C0LA 2GW1A 3U4TA 1ELKA 1OY3D 3CHOA 2E2EA 3C5RA 1EPUA 4GMJA 4GTPA 3V2XA 1H19A 3AU5A 3T5VA 3UM3A 4CYMD 2IY0C 3T8KA 3ZEFA 2KZTA 3PUJA 1QBQA 5ENSD 3CV0A 2EIJE 3DSXA 4U95D 2AXVA 1PC2A 4MS6A 2JEKA 4J8YA 4KYOB 3PS6A 4DLQA 1AWCB 3ZGQA 4EQFA 1IKND 3CK9A 4AY5A 3ZPJA 3ZXSA 5B3SE 2R05A 3ASHA 3AS5A 1W3BA 1ELRA 3FTXA 1HZ4A 2LXMA 2LUHA 4GTRA 3UM0A 1OCZE 4UQXA 4ANVA 2EIKE 3ASNE 3CK8A 2FF4A 4RG6A 5D0QD 2IU1A 3CHRA 4CT4A 5EX0A 1WY6A 3G2VA 5B1AE 3UKRG 2WXHA 4DI3A 4PDXA 4OAVB 5EIDA 3V2OA 1BI8B 1NA3A 4CDMA 4BTBA 2Q7FA 3SBSA 4GZCA 3L54A 1RW2A 2VQ2A 1HX8A 3B7RL 5AYWD 4Q94A 1H0AA 3FTVA 4XI0A 2MYOA 4H7YA 4ME2A 1U3CA 5ARGA 2AXUA 2YINA 5BT1A 4JD2G 3UMVA 5EILA 2CFZA 3C3OA 2DWZA 3FU6A 3ZYKA 4B93B 5FQ6A 2J08A 2XEEA 1O1TA 4WUYA 3JUEA 4K5CA 1VDYA 3MKQA 4N5CA 1TR4A 4UWGA 2WXNA 3FY4A 4LUNU 4ATZD 4B0ZA 4U96D 4GA0A 1KT0A 2ZU6B 3G2SA 4I6EA 2E0IA 5FQ7A 3FH5A 3L22A 3TL5A 2X6HA 5BW8C 3QAQA 1WG0A 4LNUD 1INZA 4U0UA 2QY7A 5KCMA 3TGOA 1HG5A 2VGYA 3ABME 3CSTA 5JJTA 3HXBA 5CECB 3TJPA 1EDUA 5ENRD 3HDXA 1OWNA 1MQSA 4GZDA 4J6IA 2WXQA 1XGWA 1O1SA 2LSUA 3Q9UC 2XPIA 1HF8A 4ILGA 3DSSA 3SF4A 4CRWA 2WXPA 4GTSA 3UM2A 4ANWA 3L08A 3U64A 4U7EB 4O6FA 1AP7A 5J08A 2PM7A 3FTSA 2MRIA 3RRNB 4X8QA 3PZ2A 5JMND 4AXHA 2OVBA 5C2YA 2P58C 3CVYA 2RD0A 2QZAA 3B7SA 3KSQA 4UWLA 3IV0A 3CVUA 3E37A 3SO8A 4XIFA 3FULA 3PZ1A 5HQ8A 1L5JA 3UIPC 4N39A 5FWQA 5BXUA 3N71A 5FZQA 2AVPA 4K0RA 4DI4A 1TN8A 4O1OA 5LFAA 2VSNA 3G2TA 3FTZA 1HU3A 2WXOA 1MJ0A 2HM8A 3UM1A 4HBDA 4JW1A 2RFAA 3PZ3A 1LD7A 3QDNA 3L17A 5AQBA 3JQ0A 2PL2A 3VTYA 2DYRE 1QNFA 2WQHA 3D9LA 3PRZA 3CSFA 2KATA 4CGWA 2Y4UA 4DLOA 2LO6A 2XS1A 4UWKA 3ESKA 4OVUA 3LYAA 2OV8A 4I6JA 1ZB1A 3NAWA 3ULYA 1JWFA 2XEVA 3L9TA 4CDRA 3RRUA 4GCOA 2F37A 3EU9A 3UT8A 4I9EA 3Q49B 2R02A 1TJCA 4GCNA 3ASOE 2XZDG 2IO3C 3ZW3A 4TXRA 1OWMA 5B1BE 2LAIA 2XZTG 4DRXE 3FWVA 3PNLB 2WXMA 5CBOA 4GTMA 3CGHA 2J8SD 2P9UG 4F3VA 1N94A 3PE3A 3FUFA 3ZIMA 3RKVA 2IO2C 3ZYMA 1E8ZA 3OXFA 3U3WA 5DBKA 5ENTD 1H2UA 3MJWA 3X2QE 3CQCB 4BT9A 3RSEG 3T9KA 4CEMA 3DRAA 4URKA 1QQEA 2GGFA 3FUJA 4M7CA 4K5AB 3GW4A 3ZU7B 3BG0B 3UPVA 4XKCA 3GYZA 2OCCE 5FT9A 3Q9NC 2Y4TA 4GTQA 2X6FA 1MHQA 2VGXA 1WM5A 1JPLA 4GYWA 4FLBA 4JHKA 1TYQG 4CCAA 3JXJA 2V0PA 4UWHA 2J49A 1LD8A 3DSUA 4XE0A 4LNGA 4NRHB 3ULEG 4HRMB 3ESLA 4AIFA 3CVWA 5EIBE 3UIOC 4LNBA 5A23A 3D3MA 3HHMA 4U8YD 3VLEA 3EJNA 3APFA 5EX3A 4NURA 1BI7B 1NZNA 2IEJA 3QARA 4HOTA 2LXLA 5ITZF 3L6AA 1K1AA 5A6CA 2BEDA 4GU5A 4GZ6A 3CR3A 4TUUA 2I1KA 2HYZA 2DZNA 3LS8A 3FDHA 4GYYA 3FUNA 3RU0A 4GPMA 3UX4A 5M72A 2BTDA 3FEYA 4XZ4A 1E8WA 2IQCA 3V31A 1N54A 1N0QA 4Z68A 2XPZA 3QWWA 1E8YA 2GROB 3L16A 2CG2A 4A1GA 2NXPA 2A5UA 4EBAA 3FEXA 2H6HA 3HXCA 3HG0D 2PZIA 5CCLA 4WWNA 3SQVA 4N3AA 4AM9A 4I9CA 3KEAA 4L2YA 3T8MA 3D9NA 3TAXA 4I1OB 3I3NA 3Q7FA 4V3IA 3FP3A 3E30A 3NF1A 4LG6A 4I43A 4MRUA 4FJZA 4JC8A 4MBGA 3DPYA 2ETCA 4QQIA 2VTBB 3RJVA 1DC2A 3UQ3A 3UINC 4ABNA 2MOWA 4TXPA 4O1PA 3QK0A 4GTTA 3UT4A 3JUIA 3QJZA 1XNFA 2B6CA 3VLFA 1LF8A 3JQ1A 3IEGA 2QYUA 3MEKA 4NIKA 2HO1A 5CBNA 4HI9A 4MLPA 2XCCA 3C72A 5G05J 4H7XA 5E75A 4F7AA 4KVMA 2QYJA 3U66A 3URZA 4ILHB 3FUDA 3TWWA 1ZBPA 3SY2A 1N4QA 3UKUG 1MX6A 1OCCE 2R17C 1QZ2A 3VLDA 1FT1A 4Q69A 3I4RB 3Q79A 5LCWJ 3V79K 4I1AA 1Y8MA 3DEPA 3ZNGA 2IFUA 3ONLA 4UWFA 4A63B 3QC1A 4BY6A 2V8SE 2H6FA 3Q15A 3Q7AA 3SFZA 2XHEA 1ZU2A 4IYPA 4L7TA 1OT8A 2WQ6A 3FUEA 4A55A 2R5SA 1KLXA 3SFYA 1N9AA 3LVRE 4UI9J 1KT1A 3SNXA 2VGEA 3FUIA 5LOZA 4A1SA 3PE4A 3MX3A 4FHKA 4AVXA 1JUQA 2FEZA 3HXFA 3D9MA 3GZ1A 4G25A 4RVBA 4ZHBA 2GRLA 5AARA 1UN8A 2BF0X 1LTXA 1Z3XA 4RLYA 2GRPB 2KC7A 4AY6A 2IOLA 4C0EA 2OEVA 4WNGA 1KPSB 1IXVA 4DX5D 2CFUA 4HNAD 2ETAA 2IONA 3HYMB 4ACKA 3QNKA 1N4SA 3C98A 4FA6A 3WG7E 2NSZA 3LVQE 2KCKA 3PEUB 3AS8A 2L6BA 2FO1E 5CRUA 3IBEA 1SZAA 3UTMA 2RG8A 4YDWA 3NZSA 2VJ8A 4CGVA 2CHZA 2L0IA 2EIME 4M3OA 4HXIA 4OAUC 3UT7A 5HRYA 4CZ2D 4FULA 2AXZA 1BD8A 3JYSA 4BX8A 3J5PA 4XKBA 4E85A 3DEOA 4K03A 3MYVA 3TWSA 1D8EA 4GMRA 5G2NA 1EF1C 3CVLA 4HQDA 4PS3A 1WDYA 5EDSA 4JZYA 3CKBA 4XX5A 5A7DB 1TNZA 2OOEA 4HRLA 3MKRA 3CHQA 1UJKA 4HS2A 4N3CA 1TEZA 2V5QC 5CHEE 3S2AA 4UUCA 1K1BA 4BTAA 4AJWA 3D9OA 4G24A 4EHMA 5D0OD 3TWTA 1Z5SC 4EZKA 3S7DA 4APFA 3QKYA 3O4ZA 4DX2A 2MHKA 3SGHA 3MKQB 2UY1A 4F1SA 1O5MA 2P9IG 5FTPA 2DIWA 1SQMA 4I2ZA 3FU3A 3NOGD 2WPVA 4A3VA 2B0OE 2BKGA 3ASGA 4JL0A 4I2WA 5FJYA 3I5PA 3LDZA 2CHWA 3D9IA 4RQIA 4JEUA 3CIAA 5CERB 3TWXA 4DX1A 2KBXA 4CT0A 1TNBA 4DK5A 3PNTB 1TN6A 4UI9K 3BU8A 1MZCA 2P2CP 5BUZA 2P9KG 4RG9A 1Z6TA 4JXTA 4HLLA 2WXGA 4EECA 1V55E 3MA5A 4N2SA 3ASFA 3ASDA 2L0TB 2VSYA 3Q4AB 2H6IA 3BG1B 3AG4E 1JCQA 2OVFA 3MV2B 3IKOB 4B89A 4MKTA 3Q73A 3FTWA 2XGSA 4WWOA 4L1BA 1OCRE 3FTUA 1QYMA 5BPPA 1HFAA 3ZFWA 4HLEA 1TNOA 3LY9A 1MYOA 4BSZB 2BKKB 2WXFA 3EU5A 4Q96A 4C0MA 2XCBA 1A17A 3KS2A 5G05C 3E34A 2BUGA 1SVXA 1FPPA 1V54E 4FJYA 5D2MC 3FU0A 2FI7A 4LEUA 2I1JA 4ANXA 4U8VD 4GB9A 1N0RA 3R9AB 4W9RA 2UY1B 4JVSA 5AQ9A 3AG2E 2WXJA 4HOQA 5EYLA 4N3BA 2P9PG 1DCQA 1UJJA 4UI9C 1FVFA 4AOFA 1SA4A 5EN5D 2ZGGA 4BERA 3DXMG 4A3TA 5ENOD 3KEZA 4FU3A 5CRVA 1H6KA 1FCHA 4J8FA 2VSXE 2LNIA 3BQOA 4FC8A 3K9IA 4DX6D 5HS0A 4J7WA 3PZDA 3HXEA 4F1PA 3CHPA 2WQ7A 1OWPA 5AJLA 1D9SA 3CHSA 4CDNA 3GZSA 3ULQA 1E96B 2M63A 2X3MA 2P9LG 3DSVA 1PAQA 3EUVA 2J09A 4AP2A 2V5FA 4U63A 2DVWA 4OYSA 3KD7A 3S7BA 1IYGA 4GA2A 4KT6B 1E7VA 2R2LA 3L82A 4ACLA 4LRZA 2ILRA 4XI9A 4BEPA 4WNEA 3IHYA 2IJGX 3TWUA 2WXKA 4UQYA 3AG1E 4GAAA 2Y3AA 4JB8P 5JJ6A 2WMOA 5FIOA 1UN9A 3P1UA 5FINA 3WXXA 1KZOA 4HVBA 5BXOA 1E7UA 4Y6WA 1UG3A 4TUMA 2L9BA 2J9QA 3RAUA 4WAFA 2A5EA 3D9JA 3CLJA 4LERA 1H6OA 1X5BA 4IN3B 2WXRA 3LJNA 3HVEB 1TNYA 3B7BA 5FQ4A 3T5XA 4IULA 4KZ0A 1KZPA 2X38A 4K5BA 5BNWA 1PY1A 3D9HA 2JABA 2GRRB 3B7TA 3OXGA 5FQ8A 4HOSA 3DSTA 3S7FA 4BX9A 3AS4A 2Y0BG 4YDEA 4J8SA 1SA5A 3ZHEB 4TRQA 1JCRA 1HG2A 1G3NB 5AJDA 1GW6A 2X6IA 2C0MA 2Y1LE 1YYHA 4B8AA 3QWPA 5KJNA 5AN8A 3TG5A 2WVIA 3PH0C 2HR2A 2IOSA 5AENA 2AWIA 3FU5A 1N11A 4C9BB 3PDNA 1JCSA 1UW4B 4AEZC 1NP7A 4ZFHA 3NQPA 4BT8A 5LX8A 2F8XK 2FULA 3KAEA 1TJFA 2C2LA 4TV3A 3HVEA 3ML8A 4HFGA 2WXIA 3OXLA 3W9FA 3R9MA 5KBAA 5ARFA 3BUAA 2QFCA 3I4GA 4DJAA 3OAWA 4FADA 3DBSA 5AAOA 4EBAG 3UI2A 3LKUA 4Y6CA 1FVHA 2I6HA 5ENQD 3CVNA 2EINE 3ZUVB 2VSOE 5EKQD 3EHNA 1K3ZD 3EIQC 3D9KA 1TN7A 4I1MA 3CVVA 2GRQB 5FZSA 4GZ3A 3TWVA 5H7PA 4N2QA 3R7RA 4O60A 4I6GA 4APOA 2X6JA 1NFIE 4I17A 1OXJA 2V4LA 3ZN3A 5ANLA 4JPSA 1BLXB 2ETBA 4OVVA 3P2BA 4JHJA 3FH7A 4YVQC 1Q2ZA 3CVPA 4AV7A 5EYPF 1BU9A 3LJ3A 3HIZA 2CG3A 4U0SA 3IXEA 2A4ZA 3VTXA 5HI7A 3Q5MA 5IY5E 3V30A 3CEQA 1SZ9A 2KCLA 4BESA 4B8CB 3Q75A 2F0YA 4GTVA 3ABKE 4DX7D 2P9SG 1B89A 3JXIA 5KJLA 1HH8A 4JHRA 2F8YA 3QWVA 2NC9A 2XS8A 1HXIA 1IHBA 1OCOE 2LAHA 4XEIG 2L6JA 4HB5A 1YCSB 1H6PA 4ATGA
chains in the Genus database with same CATH topology
3ABLE 3ABKE 2OCCE 1OCZE 2DYRE 3AG4E 2Y69E 3X2QE 3AG1E 2EILE 2EIKE 3ASNE 3AG2E 1OCCE 5B3SE 2EIME 1OCOE 1V55E 3WG7E 1V54E 3AG3E 5IY5E 2ZXWE 2EIJE 1OCRE 3ASOE 2DYSE 3ABME 5B1BE 5B1AE 2EINE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABL E;  3ABK E;  2OCC E;  1OCZ E;  2DYR E;  3AG4 E;  2Y69 E;  3X2Q E;  3AG1 E;  2EIL E;  2EIK E;  3ASN E;  3AG2 E;  1OCC E;  5B3S E;  2EIM E;  1OCO E;  1V55 E;  3WG7 E;  1V54 E;  3AG3 E;  5IY5 E;  2ZXW E;  2EIJ E;  1OCR E;  3ASO E;  2DYS E;  3ABM E;  5B1B E;  5B1A E;  2EIN E; 
#chains in the Genus database with same CATH topology
 3ABL E;  2KZT B;  2R03 A;  3RO3 A;  4QFV A;  3FHE A;  3R7Q A;  4PUC A;  3B13 A;  4WNF A;  1H2V C;  1E90 A;  2FBN A;  3L13 A;  2RKK A;  4L2L A;  3LY7 A;  3FUK A;  2XEN A;  3UUX A;  4YND A;  4F53 A;  4GTO A;  1HO8 A;  3LEW A;  2XPY A;  2XGM A;  5D66 A;  4FLH A;  4BWR A;  1N95 A;  3FH8 A;  2PQR A;  5CMW A;  4UQZ A;  3HXD A;  3NOC D;  3MZL B;  1S70 B;  2XGO A;  4LCT A;  3E4B A;  4GPK A;  5E76 A;  4IRU A;  1HE8 A;  4GYO A;  4L23 A;  2WM9 A;  1OWL A;  2CHX A;  3SZ7 A;  3ZKJ A;  1K8K G;  1N4P A;  5CCM A;  3HRA A;  2J4B A;  2EIL E;  3NB2 A;  4BFR A;  1N52 A;  3APD A;  3U9W A;  5J90 A;  2P9N G;  4G8K A;  4YVO A;  1TNU A;  3RRM B;  4FP7 A;  3FUH A;  4J8E A;  1U2V G;  5JHA A;  1O1R A;  3CK7 A;  1WAO 1;  3TXN A;  4YDY A;  3SBT B;  2VTB A;  1S64 A;  2AW6 A;  3PVL A;  1SW6 A;  2ZXW E;  3RO2 A;  2DYS E;  4BSX A;  4YDO A;  4G1T A;  2UWJ G;  4HOU A;  5FZR A;  5ENN A;  2J07 A;  4DUI A;  5ENP D;  3ENE A;  4G8L A;  4GZ5 A;  2WMN A;  1RZ4 A;  2XRY A;  3QB2 A;  3ISM C;  5JJ7 A;  4PS7 A;  2YQ8 A;  2JLB A;  3J5Q B;  3PRE A;  3CKC A;  4WWP A;  3SHF A;  3ZHE A;  3MGB A;  3APC A;  3FTY A;  3EHQ A;  4WND A;  3AAA C;  4DPR A;  3TXM A;  4G11 A;  3Q47 B;  4D10 C;  4GA1 A;  3S7J A;  5JA4 D;  4JA9 A;  3PZ4 A;  4J8D A;  3EIJ A;  1P5Q A;  2ZIR A;  3AJI A;  4GML A;  4ANU A;  4ILI A;  3CHM A;  2KCV A;  4JEH A;  1A5E A;  4LSZ E;  2AJA A;  4G26 A;  5T8I A;  2PQN A;  5G04 J;  3NZU A;  3SD5 A;  3F6Q A;  4RSY A;  2H6G A;  2RFM A;  5KNG A;  1DCE A;  3LCA A;  3DSW A;  3EDT B;  1IQU A;  5KJM A;  4TXQ A;  2DCP A;  1NA0 A;  3DPD A;  3MV3 B;  2NYJ A;  3QOU A;  1Z3Y A;  3MCX A;  1N4R A;  5C1D A;  2J4D A;  2LSV A;  2KM4 A;  5KJK A;  2PNN A;  1ELW A;  2X6K A;  2WB2 A;  4N5Q A;  3NBN B;  2EQX A;  1NI1 A;  5JHB A;  1UOH A;  3PUK A;  4E6H A;  2VGX B;  4FHJ A;  3C3Q A;  3TWR A;  3KSL A;  5T3R A;  1HS6 A;  3ZVV A;  3LPZ A;  5LCW C;  4KBQ A;  3PEV B;  4PS8 A;  2YNQ A;  5AQA A;  2IF4 A;  1OUV A;  2R59 A;  5AIJ A;  4U0Z A;  4C48 B;  1S0P A;  5CED B;  2HE0 A;  3GZ2 A;  3LY8 A;  5KWD A;  2OEW A;  1X81 A;  3CQG B;  1DVP A;  5CEA A;  4HI8 A;  3RIB A;  4B94 A;  3ONK A;  4JA7 A;  3AG3 E;  3UXG A;  3EHM A;  3B7U X;  1IQR A;  3BEE A;  3E32 A;  1D8D A;  2I2O A;  4U07 A;  4EPZ A;  2PM6 A;  2GRN B;  2FO7 A;  3W9G A;  5G04 C;  4NQ0 A;  2XEH A;  3ML9 A;  5T4Y A;  3DXK G;  3E33 A;  3B95 A;  4F6R D;  3ZYL A;  1OWO A;  4KVO A;  3OTN A;  4G2V A;  4R7L A;  1U3D A;  5BV1 A;  1BPO A;  1YMP A;  4KMO A;  3RK6 A;  4U04 A;  2KXP C;  3D9P A;  3EHR A;  2I9C A;  1MX4 A;  1IHG A;  3C3R A;  2WXL A;  3JCK C;  1JWG A;  4BET A;  4J0U A;  3CVX A;  2Y69 E;  2V4H C;  2DZO A;  1Y6I A;  3G2W A;  4L9P A;  2VYI A;  2ZGD A;  4NAC A;  1E8X A;  5G55 A;  3AU4 A;  1H2T C;  1EYH A;  3DWL G;  3LXU X;  4G23 A;  3IHV A;  3ZXP A;  2ZIS A;  3TG4 A;  3CVQ A;  3Q78 A;  5AQ7 A;  2OND A;  1YA0 A;  2QC9 A;  3O48 A;  4KZC A;  5ANR A;  2YHC A;  5BV0 A;  1NL4 A;  5CMY A;  4U8H A;  5HKP A;  3G2U A;  2DBA A;  4HOR A;  1MX2 A;  3FFL A;  3TWQ A;  3SFX A;  1DNP A;  2XRZ A;  2XQ0 A;  1S63 A;  4EZJ A;  4HRN A;  5LP0 A;  5DIZ A;  2YHE A;  1FT2 A;  3ZRH A;  4KXK B;  2GRM A;  3FUM A;  3SI5 A;  4PH4 B;  3ZYQ A;  4P29 A;  4EZL A;  5KNH D;  2C0L A;  2GW1 A;  3U4T A;  1ELK A;  1OY3 D;  3CHO A;  2E2E A;  3C5R A;  1EPU A;  4GMJ A;  4GTP A;  3V2X A;  1H19 A;  3AU5 A;  3T5V A;  3UM3 A;  4CYM D;  2IY0 C;  3T8K A;  3ZEF A;  2KZT A;  3PUJ A;  1QBQ A;  5ENS D;  3CV0 A;  2EIJ E;  3DSX A;  4U95 D;  2AXV A;  1PC2 A;  4MS6 A;  2JEK A;  4J8Y A;  4KYO B;  3PS6 A;  4DLQ A;  1AWC B;  3ZGQ A;  4EQF A;  1IKN D;  3CK9 A;  4AY5 A;  3ZPJ A;  3ZXS A;  5B3S E;  2R05 A;  3ASH A;  3AS5 A;  1W3B A;  1ELR A;  3FTX A;  1HZ4 A;  2LXM A;  2LUH A;  4GTR A;  3UM0 A;  1OCZ E;  4UQX A;  4ANV A;  2EIK E;  3ASN E;  3CK8 A;  2FF4 A;  4RG6 A;  5D0Q D;  2IU1 A;  3CHR A;  4CT4 A;  5EX0 A;  1WY6 A;  3G2V A;  5B1A E;  3UKR G;  2WXH A;  4DI3 A;  4PDX A;  4OAV B;  5EID A;  3V2O A;  1BI8 B;  1NA3 A;  4CDM A;  4BTB A;  2Q7F A;  3SBS A;  4GZC A;  3L54 A;  1RW2 A;  2VQ2 A;  1HX8 A;  3B7R L;  5AYW D;  4Q94 A;  1H0A A;  3FTV A;  4XI0 A;  2MYO A;  4H7Y A;  4ME2 A;  1U3C A;  5ARG A;  2AXU A;  2YIN A;  5BT1 A;  4JD2 G;  3UMV A;  5EIL A;  2CFZ A;  3C3O A;  2DWZ A;  3FU6 A;  3ZYK A;  4B93 B;  5FQ6 A;  2J08 A;  2XEE A;  1O1T A;  4WUY A;  3JUE A;  4K5C A;  1VDY A;  3MKQ A;  4N5C A;  1TR4 A;  4UWG A;  2WXN A;  3FY4 A;  4LUN U;  4ATZ D;  4B0Z A;  4U96 D;  4GA0 A;  1KT0 A;  2ZU6 B;  3G2S A;  4I6E A;  2E0I A;  5FQ7 A;  3FH5 A;  3L22 A;  3TL5 A;  2X6H A;  5BW8 C;  3QAQ A;  1WG0 A;  4LNU D;  1INZ A;  4U0U A;  2QY7 A;  5KCM A;  3TGO A;  1HG5 A;  2VGY A;  3ABM E;  3CST A;  5JJT A;  3HXB A;  5CEC B;  3TJP A;  1EDU A;  5ENR D;  3HDX A;  1OWN A;  1MQS A;  4GZD A;  4J6I A;  2WXQ A;  1XGW A;  1O1S A;  2LSU A;  3Q9U C;  2XPI A;  1HF8 A;  4ILG A;  3DSS A;  3SF4 A;  4CRW A;  2WXP A;  4GTS A;  3UM2 A;  4ANW A;  3L08 A;  3U64 A;  4U7E B;  4O6F A;  1AP7 A;  5J08 A;  2PM7 A;  3FTS A;  2MRI A;  3RRN B;  4X8Q A;  3PZ2 A;  5JMN D;  4AXH A;  2OVB A;  5C2Y A;  2P58 C;  3CVY A;  2RD0 A;  2QZA A;  3B7S A;  3KSQ A;  4UWL A;  3IV0 A;  3CVU A;  3E37 A;  3SO8 A;  4XIF A;  3FUL A;  3PZ1 A;  5HQ8 A;  1L5J A;  3UIP C;  4N39 A;  5FWQ A;  5BXU A;  3N71 A;  5FZQ A;  2AVP A;  4K0R A;  4DI4 A;  1TN8 A;  4O1O A;  5LFA A;  2VSN A;  3G2T A;  3FTZ A;  1HU3 A;  2WXO A;  1MJ0 A;  2HM8 A;  3UM1 A;  4HBD A;  4JW1 A;  2RFA A;  3PZ3 A;  1LD7 A;  3QDN A;  3L17 A;  5AQB A;  3JQ0 A;  2PL2 A;  3VTY A;  2DYR E;  1QNF A;  2WQH A;  3D9L A;  3PRZ A;  3CSF A;  2KAT A;  4CGW A;  2Y4U A;  4DLO A;  2LO6 A;  2XS1 A;  4UWK A;  3ESK A;  4OVU A;  3LYA A;  2OV8 A;  4I6J A;  1ZB1 A;  3NAW A;  3ULY A;  1JWF A;  2XEV A;  3L9T A;  4CDR A;  3RRU A;  4GCO A;  2F37 A;  3EU9 A;  3UT8 A;  4I9E A;  3Q49 B;  2R02 A;  1TJC A;  4GCN A;  3ASO E;  2XZD G;  2IO3 C;  3ZW3 A;  4TXR A;  1OWM A;  5B1B E;  2LAI A;  2XZT G;  4DRX E;  3FWV A;  3PNL B;  2WXM A;  5CBO A;  4GTM A;  3CGH A;  2J8S D;  2P9U G;  4F3V A;  1N94 A;  3PE3 A;  3FUF A;  3ZIM A;  3RKV A;  2IO2 C;  3ZYM A;  1E8Z A;  3OXF A;  3U3W A;  5DBK A;  5ENT D;  1H2U A;  3MJW A;  3X2Q E;  3CQC B;  4BT9 A;  3RSE G;  3T9K A;  4CEM A;  3DRA A;  4URK A;  1QQE A;  2GGF A;  3FUJ A;  4M7C A;  4K5A B;  3GW4 A;  3ZU7 B;  3BG0 B;  3UPV A;  4XKC A;  3GYZ A;  2OCC E;  5FT9 A;  3Q9N C;  2Y4T A;  4GTQ A;  2X6F A;  1MHQ A;  2VGX A;  1WM5 A;  1JPL A;  4GYW A;  4FLB A;  4JHK A;  1TYQ G;  4CCA A;  3JXJ A;  2V0P A;  4UWH A;  2J49 A;  1LD8 A;  3DSU A;  4XE0 A;  4LNG A;  4NRH B;  3ULE G;  4HRM B;  3ESL A;  4AIF A;  3CVW A;  5EIB E;  3UIO C;  4LNB A;  5A23 A;  3D3M A;  3HHM A;  4U8Y D;  3VLE A;  3EJN A;  3APF A;  5EX3 A;  4NUR A;  1BI7 B;  1NZN A;  2IEJ A;  3QAR A;  4HOT A;  2LXL A;  5ITZ F;  3L6A A;  1K1A A;  5A6C A;  2BED A;  4GU5 A;  4GZ6 A;  3CR3 A;  4TUU A;  2I1K A;  2HYZ A;  2DZN A;  3LS8 A;  3FDH A;  4GYY A;  3FUN A;  3RU0 A;  4GPM A;  3UX4 A;  5M72 A;  2BTD A;  3FEY A;  4XZ4 A;  1E8W A;  2IQC A;  3V31 A;  1N54 A;  1N0Q A;  4Z68 A;  2XPZ A;  3QWW A;  1E8Y A;  2GRO B;  3L16 A;  2CG2 A;  4A1G A;  2NXP A;  2A5U A;  4EBA A;  3FEX A;  2H6H A;  3HXC A;  3HG0 D;  2PZI A;  5CCL A;  4WWN A;  3SQV A;  4N3A A;  4AM9 A;  4I9C A;  3KEA A;  4L2Y A;  3T8M A;  3D9N A;  3TAX A;  4I1O B;  3I3N A;  3Q7F A;  4V3I A;  3FP3 A;  3E30 A;  3NF1 A;  4LG6 A;  4I43 A;  4MRU A;  4FJZ A;  4JC8 A;  4MBG A;  3DPY A;  2ETC A;  4QQI A;  2VTB B;  3RJV A;  1DC2 A;  3UQ3 A;  3UIN C;  4ABN A;  2MOW A;  4TXP A;  4O1P A;  3QK0 A;  4GTT A;  3UT4 A;  3JUI A;  3QJZ A;  1XNF A;  2B6C A;  3VLF A;  1LF8 A;  3JQ1 A;  3IEG A;  2QYU A;  3MEK A;  4NIK A;  2HO1 A;  5CBN A;  4HI9 A;  4MLP A;  2XCC A;  3C72 A;  5G05 J;  4H7X A;  5E75 A;  4F7A A;  4KVM A;  2QYJ A;  3U66 A;  3URZ A;  4ILH B;  3FUD A;  3TWW A;  1ZBP A;  3SY2 A;  1N4Q A;  3UKU G;  1MX6 A;  1OCC E;  2R17 C;  1QZ2 A;  3VLD A;  1FT1 A;  4Q69 A;  3I4R B;  3Q79 A;  5LCW J;  3V79 K;  4I1A A;  1Y8M A;  3DEP A;  3ZNG A;  2IFU A;  3ONL A;  4UWF A;  4A63 B;  3QC1 A;  4BY6 A;  2V8S E;  2H6F A;  3Q15 A;  3Q7A A;  3SFZ A;  2XHE A;  1ZU2 A;  4IYP A;  4L7T A;  1OT8 A;  2WQ6 A;  3FUE A;  4A55 A;  2R5S A;  1KLX A;  3SFY A;  1N9A A;  3LVR E;  4UI9 J;  1KT1 A;  3SNX A;  2VGE A;  3FUI A;  5LOZ A;  4A1S A;  3PE4 A;  3MX3 A;  4FHK A;  4AVX A;  1JUQ A;  2FEZ A;  3HXF A;  3D9M A;  3GZ1 A;  4G25 A;  4RVB A;  4ZHB A;  2GRL A;  5AAR A;  1UN8 A;  2BF0 X;  1LTX A;  1Z3X A;  4RLY A;  2GRP B;  2KC7 A;  4AY6 A;  2IOL A;  4C0E A;  2OEV A;  4WNG A;  1KPS B;  1IXV A;  4DX5 D;  2CFU A;  4HNA D;  2ETA A;  2ION A;  3HYM B;  4ACK A;  3QNK A;  1N4S A;  3C98 A;  4FA6 A;  3WG7 E;  2NSZ A;  3LVQ E;  2KCK A;  3PEU B;  3AS8 A;  2L6B A;  2FO1 E;  5CRU A;  3IBE A;  1SZA A;  3UTM A;  2RG8 A;  4YDW A;  3NZS A;  2VJ8 A;  4CGV A;  2CHZ A;  2L0I A;  2EIM E;  4M3O A;  4HXI A;  4OAU C;  3UT7 A;  5HRY A;  4CZ2 D;  4FUL A;  2AXZ A;  1BD8 A;  3JYS A;  4BX8 A;  3J5P A;  4XKB A;  4E85 A;  3DEO A;  4K03 A;  3MYV A;  3TWS A;  1D8E A;  4GMR A;  5G2N A;  1EF1 C;  3CVL A;  4HQD A;  4PS3 A;  1WDY A;  5EDS A;  4JZY A;  3CKB A;  4XX5 A;  5A7D B;  1TNZ A;  2OOE A;  4HRL A;  3MKR A;  3CHQ A;  1UJK A;  4HS2 A;  4N3C A;  1TEZ A;  2V5Q C;  5CHE E;  3S2A A;  4UUC A;  1K1B A;  4BTA A;  4AJW A;  3D9O A;  4G24 A;  4EHM A;  5D0O D;  3TWT A;  1Z5S C;  4EZK A;  3S7D A;  4APF A;  3QKY A;  3O4Z A;  4DX2 A;  2MHK A;  3SGH A;  3MKQ B;  2UY1 A;  4F1S A;  1O5M A;  2P9I G;  5FTP A;  2DIW A;  1SQM A;  4I2Z A;  3FU3 A;  3NOG D;  2WPV A;  4A3V A;  2B0O E;  2BKG A;  3ASG A;  4JL0 A;  4I2W A;  5FJY A;  3I5P A;  3LDZ A;  2CHW A;  3D9I A;  4RQI A;  4JEU A;  3CIA A;  5CER B;  3TWX A;  4DX1 A;  2KBX A;  4CT0 A;  1TNB A;  4DK5 A;  3PNT B;  1TN6 A;  4UI9 K;  3BU8 A;  1MZC A;  2P2C P;  5BUZ A;  2P9K G;  4RG9 A;  1Z6T A;  4JXT A;  4HLL A;  2WXG A;  4EEC A;  1V55 E;  3MA5 A;  4N2S A;  3ASF A;  3ASD A;  2L0T B;  2VSY A;  3Q4A B;  2H6I A;  3BG1 B;  3AG4 E;  1JCQ A;  2OVF A;  3MV2 B;  3IKO B;  4B89 A;  4MKT A;  3Q73 A;  3FTW A;  2XGS A;  4WWO A;  4L1B A;  1OCR E;  3FTU A;  1QYM A;  5BPP A;  1HFA A;  3ZFW A;  4HLE A;  1TNO A;  3LY9 A;  1MYO A;  4BSZ B;  2BKK B;  2WXF A;  3EU5 A;  4Q96 A;  4C0M A;  2XCB A;  1A17 A;  3KS2 A;  5G05 C;  3E34 A;  2BUG A;  1SVX A;  1FPP A;  1V54 E;  4FJY A;  5D2M C;  3FU0 A;  2FI7 A;  4LEU A;  2I1J A;  4ANX A;  4U8V D;  4GB9 A;  1N0R A;  3R9A B;  4W9R A;  2UY1 B;  4JVS A;  5AQ9 A;  3AG2 E;  2WXJ A;  4HOQ A;  5EYL A;  4N3B A;  2P9P G;  1DCQ A;  1UJJ A;  4UI9 C;  1FVF A;  4AOF A;  1SA4 A;  5EN5 D;  2ZGG A;  4BER A;  3DXM G;  4A3T A;  5ENO D;  3KEZ A;  4FU3 A;  5CRV A;  1H6K A;  1FCH A;  4J8F A;  2VSX E;  2LNI A;  3BQO A;  4FC8 A;  3K9I A;  4DX6 D;  5HS0 A;  4J7W A;  3PZD A;  3HXE A;  4F1P A;  3CHP A;  2WQ7 A;  1OWP A;  5AJL A;  1D9S A;  3CHS A;  4CDN A;  3GZS A;  3ULQ A;  1E96 B;  2M63 A;  2X3M A;  2P9L G;  3DSV A;  1PAQ A;  3EUV A;  2J09 A;  4AP2 A;  2V5F A;  4U63 A;  2DVW A;  4OYS A;  3KD7 A;  3S7B A;  1IYG A;  4GA2 A;  4KT6 B;  1E7V A;  2R2L A;  3L82 A;  4ACL A;  4LRZ A;  2ILR A;  4XI9 A;  4BEP A;  4WNE A;  3IHY A;  2IJG X;  3TWU A;  2WXK A;  4UQY A;  3AG1 E;  4GAA A;  2Y3A A;  4JB8 P;  5JJ6 A;  2WMO A;  5FIO A;  1UN9 A;  3P1U A;  5FIN A;  3WXX A;  1KZO A;  4HVB A;  5BXO A;  1E7U A;  4Y6W A;  1UG3 A;  4TUM A;  2L9B A;  2J9Q A;  3RAU A;  4WAF A;  2A5E A;  3D9J A;  3CLJ A;  4LER A;  1H6O A;  1X5B A;  4IN3 B;  2WXR A;  3LJN A;  3HVE B;  1TNY A;  3B7B A;  5FQ4 A;  3T5X A;  4IUL A;  4KZ0 A;  1KZP A;  2X38 A;  4K5B A;  5BNW A;  1PY1 A;  3D9H A;  2JAB A;  2GRR B;  3B7T A;  3OXG A;  5FQ8 A;  4HOS A;  3DST A;  3S7F A;  4BX9 A;  3AS4 A;  2Y0B G;  4YDE A;  4J8S A;  1SA5 A;  3ZHE B;  4TRQ A;  1JCR A;  1HG2 A;  1G3N B;  5AJD A;  1GW6 A;  2X6I A;  2C0M A;  2Y1L E;  1YYH A;  4B8A A;  3QWP A;  5KJN A;  5AN8 A;  3TG5 A;  2WVI A;  3PH0 C;  2HR2 A;  2IOS A;  5AEN A;  2AWI A;  3FU5 A;  1N11 A;  4C9B B;  3PDN A;  1JCS A;  1UW4 B;  4AEZ C;  1NP7 A;  4ZFH A;  3NQP A;  4BT8 A;  5LX8 A;  2F8X K;  2FUL A;  3KAE A;  1TJF A;  2C2L A;  4TV3 A;  3HVE A;  3ML8 A;  4HFG A;  2WXI A;  3OXL A;  3W9F A;  3R9M A;  5KBA A;  5ARF A;  3BUA A;  2QFC A;  3I4G A;  4DJA A;  3OAW A;  4FAD A;  3DBS A;  5AAO A;  4EBA G;  3UI2 A;  3LKU A;  4Y6C A;  1FVH A;  2I6H A;  5ENQ D;  3CVN A;  2EIN E;  3ZUV B;  2VSO E;  5EKQ D;  3EHN A;  1K3Z D;  3EIQ C;  3D9K A;  1TN7 A;  4I1M A;  3CVV A;  2GRQ B;  5FZS A;  4GZ3 A;  3TWV A;  5H7P A;  4N2Q A;  3R7R A;  4O60 A;  4I6G A;  4APO A;  2X6J A;  1NFI E;  4I17 A;  1OXJ A;  2V4L A;  3ZN3 A;  5ANL A;  4JPS A;  1BLX B;  2ETB A;  4OVV A;  3P2B A;  4JHJ A;  3FH7 A;  4YVQ C;  1Q2Z A;  3CVP A;  4AV7 A;  5EYP F;  1BU9 A;  3LJ3 A;  3HIZ A;  2CG3 A;  4U0S A;  3IXE A;  2A4Z A;  3VTX A;  5HI7 A;  3Q5M A;  5IY5 E;  3V30 A;  3CEQ A;  1SZ9 A;  2KCL A;  4BES A;  4B8C B;  3Q75 A;  2F0Y A;  4GTV A;  3ABK E;  4DX7 D;  2P9S G;  1B89 A;  3JXI A;  5KJL A;  1HH8 A;  4JHR A;  2F8Y A;  3QWV A;  2NC9 A;  2XS8 A;  1HXI A;  1IHB A;  1OCO E;  2LAH A;  4XEI G;  2L6J A;  4HB5 A;  1YCS B;  1H6P A;  4ATG A; 
#chains in the Genus database with same CATH homology
 3ABL E;  3ABK E;  2OCC E;  1OCZ E;  2DYR E;  3AG4 E;  2Y69 E;  3X2Q E;  3AG1 E;  2EIL E;  2EIK E;  3ASN E;  3AG2 E;  1OCC E;  5B3S E;  2EIM E;  1OCO E;  1V55 E;  3WG7 E;  1V54 E;  3AG3 E;  5IY5 E;  2ZXW E;  2EIJ E;  1OCR E;  3ASO E;  2DYS E;  3ABM E;  5B1B E;  5B1A E;  2EIN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...