2Y6JA

X-2 engineered mutated cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
MLVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSLDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
molecule keywords XYLANASE
total genus 42
structure length 167
sequence length 167
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y6jA00
4P5YA 1GMMA 3WQBA 1PX3A 3OGVA 3GM8A 4TXWA 5C70A 1JYXA 1OF4A 1GOFA 4BJ0A 3GXUA 1UY0A 2Y6HA 2VQTA 4M4PA 3A21A 2C4XA 1XPWA 2YC2A 3MV11 3VD3A 3K77A 4JHZA 3FHAA 2XONA 3T2OA 4MGSA 2VZ3A 1NX9A 5IFPA 3E1F1 5JUVA 3VD7A 1RYYA 1IQDC 3T09A 1TG7A 3C7GA 4QB1A 3T2PA 5IHRA 4A6OA 3IB3A 2ORXA 3ACGA 1JHJA 2VJXA 1NKGA 5DN2A 4LHSA 3EYPA 3UESA 1W9SA 1YQ2A 3DECA 1KGYA 5LCWL 3I2HA 3HN3A 5CZKA 4XUOA 3T0AA 3VDAA 5JXHA 4PT6A 5JR2A 3WNLA 1BHGA 4QB6A 5IYYA 4JKMA 4QX0A 3C7FA 3I3EA 3WSOA 5G05L 4UI9L 2JKXA 3WF3A 2W1SA 4DXRA 4CU6A 4DEVA 4ZY9A 2R7EB 2V5DA 2LS6A 1PX4A 3JXSA 2WUHA 4QX3A 3ZM8A 3A23A 2J1EA 3OEAA 2VZ1A 3NQHA 4MADA 3WNOA 4QAWA 3IDAA 4GZ9A 4W50A 3K75B 1XC6A 3I2FA 1UYZA 3SKJE 3BN6A 3C7HA 2B4KA 3EB7A 1UX7A 1P8JA 3LEKA 2E33A 1CX1A 4DUWA 3WEZA 1K3IA 5JXJA 3GGLA 4ZZ5A 2EIDA 1DP0A 5I0DA 1XNAA 2ZXQA 3NNGA 2W91A 3NJXA 2J1UA 1KEXA 3LPGA 2J1AA 2W3JA 5EJZB 2QQNA 1PMHX 2VOTA 4QDRA 1DLCA 3IAQA 4D0QA 3WF4A 2WO2A 2KD7A 3CZUA 1K45A 1MPXA 5B4XA 1T2XA 4QX2A 5HPOA 1O59A 2QQOA 2VZVA 3PUIA 1LNSA 2J1SA 2E31A 2HYXA 5IJRA 3NRUA 2WBKA 3SEEA 4M4RA 4RN5A 4XUQA 2L9LA 1JZ7A 4LKSA 3D3AA 3I2GA 3HEIA 2E32A 4ET7A 2VZRA 1JZ6A 1TVGA 1EUUA 2WZ8A 4P00B 4E8DA 4LPLA 2EICA 1UY2A 4PQQA 2VZQA 3ACIA 4JKKA 2VZSA 3WF0A 2W1UA 3DYPA 1EUTA 1CZVA 1O8SA 4CU8A 1GU3A 1W9WA 2DDUA 2RV9A 2WZEA 3U37A 2J1RA 4BDVB 3SEPA 3LEGA 1JYNA 3A22A 2DCJA 2QQMA 2WAAA 3HNBM 3C7OA 2VZUA 1W9TA 1CZSA 1J84A 2QQJA 2VC9A 4QPWA 2VO5A 2Y64A 4ZZ8A 1HN1A 4PF1A 1UY3A 2E26A 4XURA 4E8CA 1UYYA 2WQ8A 2Y6LA 4QX1A 3J7HA 2YG0A 4GWJA 3THDA 5LA1A 2QQIA 4QDSA 1UXZA 4MOAA 5FUIA 1F4HA 3I3BA 4DXSA 1PMJX 3IIIA 1I5PA 5JXIA 2W9XA 2VZPA 3A7QA 3I97A 3OBAA 5J1XA 2W94A 1DYOA 3OB8A 3WF2A 3HOBA 2BBAA 5EJ1B 2VZTA 2VZOA 4L0PA 3GDBA 3CMGA 4CU7A 2ORZA 4P08A 4JX0A 4A44A 5A1AA 3CIHA 1UWWA 2W1WA 1US2A 2WO3A 2Z4FA 4TTGA 2VTFA 1XNTA 1UXXX 2X09A 4KMQA 3CZJA 3BGAA 3ETPA 3T0BA 1ULPA 4A45A 5IFTA 1R64A 3WF1A 3WNMA 2B9VA 4Z2AA 1WKYA 2YC4A 2X10A 5F7UA 2RVAA 2CDOA 2ZEXA 4ARYA 2LW8A 2WDBA 2W95A 3VD4A 4XUNA 2C26A 5DMYA 3PUHA 3W5MA 3P1IA 3FHQA 2Y6KA 1OF3A 2VMDA 3I3DA 3OGRA 1JU3A 2BGOA 2BZDA 5C71A 1UY4A 4QB2A 3ABZA 4AG4A 1JZ2A 2WYSA 4KI5M 2JE8A 2OKXA 4OYUA 3WNPA 3AC0A 1GOHA 4MO3M 4BK4A 4KWUA 3MV01 1K42A 4YPJA 2EIBA 5CYYA 2QQLA 4A3ZA 3VD9A 3VDCA 4OUEA 2VR4A 2J1VA 4XUPA 4CUBA 3P6BA 2Y8KA 5LA2A 4BK5A 2CDPA 2VL4A 1WCQA 2VMCA 1JZ3A 3ECQA 2W46A 1K12A 3CQOA 2W5FA 2XOMA 3T08A 2WN3A 3UETA 4CVUA 3FL7A 2YB7A 3CDZB 1US3A 2W47A 4W8JA 2YFZA 3MUY1 4XUTA 1SDDB 1JU4A 1W0NA 2QBXA 2W92A 3LQCA 2WAOA 2PQSA 3F2ZA 4OZOA 3I2JA 3HNYM 2V4VA 4ZXEA 2ID4A 1CZTA 5DQ0A 2ZEYA 2BGPA 3MO4A 3MUZ1 3LPFA 4MGQA 2X05A 4RYDA 1UY1A 2VQUA 2WN2A 1O8PA 4DUXA 1NAEA 3VDBA 3OGSA 4FI9A 4A41A 1ULOA 4IUGA 2VM9A 1SG3A 4CUCA 4A42A 4CUAA 2W1QA 2J7MA 1GUIA 4UAPA 2C9KA 3LEIA 5C7GA 1UYXA 2HLEA 3C8XA 3WNNA 2VCCA 1W8NA 4OMDA 2WABA 1GNYA 2J1TA 4DXTA 3LE0A 1UMHA 1OD3A 4XVHA 2J22A 1GQPA 1NUKA 3DYMA 3K4ZA 2VCBA 4QDQA 4W4ZA 2ZEWA 4UOJA 2Y6JA 2VMEA 4DEQA 3K4DA 1JZ8A 2XHNA 1F4AA 3T2QA 2V72A 4XZUG 4AAXA 3DYOA 2WO1A 3HJRA 3CKHA 2QQKA 1JYWA 1H6YA 4D8MA 5LA0A 4ARXA 3VD5A 2W87A 2DCKA 3HNMA 1SHWB 3WNKA 1UZ0A 3FN9A 1CIYA 3THCA 3OEBA 3ACFA 1H6XA 4DUVA 3ACHA 2RJ2A 1D7PM 2Y6GA 1W99A 2JD9A 3K4AA 3MBWA 5JMOA 4LQRA 3I2IA 1JZ4A 1OT5A 3T0DA 1J83A 3IAPA 5G04L 1JI6A 3K46A 2YFUA 4GWIA 4BXSV 4P02B 1L7QA 3HPNA 1W8OA 3C7EA 5DPNA 2XQXA 1JZ5A 2ZEZA 1JYVA 2BERA 1L7RA 1GOGA 2EIEA 1UMIA 4CU9A 3NJVA 2VMFA 4HG6B 2JDAA 1OH4A 4A4AA 5B4NA 3OG2A 4OMCA 3UNPA 5EIYB 4JKLA 3I2KA 3SKVA 3W5NA 2VCAA 5HXMA 5JXGA
chains in the Genus database with same CATH superfamily
3LA3A 2PLV3 2B7YA 2SLIA 5DDJ1 1FV2A 5CB7A 3V65A 4AEDA 5BYNA 1POV0 3ZO0B 1X50A 2CSGA 4R8HA 4TXWA 5JI9A 5M0TA 3PJQA 3PU3A 1S2KA 1V70A 1YJLA 2OVUA 3FWEA 3GBGA 4XJWA 1VAVA 3IBMA 4RQPC 1RUH3 1JYXA 1OF4A 1GOFA 5LASA 4BZ4A 4CDWC 1Z78A 1V6NA 5BNPA 1OMIA 1ZRFA 4GMP3 4Q4X3 1KFXL 2K0GA 4O61A 3J7NA 4IV1A 3N35A 2YC2A 4S2GA 4YYOA 3X29B 3RZHA 3FUQA 5CU1A 1HRV2 3VD3A 4JHZA 4P9LA 2YBKA 3VHRA 2VZ3A 4J25A 5IFPA 3VD7A 4AGVA 1IQDC 1HW5A 4UFMA 5IK7A 4MHUA 3H8XA 4NWVA 3Q8AA 4AHYA 4LBMA 3J7MA 2LROA 2FMDA 1G9DA 2VXRA 1S55A 4BIOA 3N9PA 3AMPA 1XE8A 3LIGA 1QNYA 1RUG1 5F9TA 3DXTA 1PZ7A 1Y9MA 4NPMA 1RUD2 2YHJA 5CFDA 4YZ2A 4ZONA 1W9SA 3DECA 5FZBA 1KGYA 4HSJA 3O1OA 4IERA 4KU7A 4UW5A 2ZZJA 5GJ6A 4AF9A 1AL23 4XUOA 5FY8A 3T0AA 3VDAA 1UPSA 5JXHA 4PT6A 3WDVA 1WGPA 5JR2A 2VPVA 3AKSA 1PO12 4QX0A 3WSOA 5IK4A 1W2NA 3WF3A 5E88A 1W2AX 4DXRA 3WDXA 2VOVA 4CU6A 2ZGNA 4GA9A 1MQTC 1C57A 1VBA1 2B45X 2DWRA 3LIHA 4XJUA 4YG3A 2P3KA 4BMBA 4IQPA 1H8TC 1AJKA 1PX4A 2LS6A 3AYAA 2Q8CA 3PTYA 4QKFA 4HSLA 1UMZA 4QX3A 2BVBA 3HT2A 2CY6A 3EXUA 4HKLA 2JG9B 1JOPA 2DBNA 3QD6A 1W2UA 3CBNA 4QPGA 3MLKA 4B4RA 1C5IA 3AYEA 4TLFA 1NLRA 4NRPA 4N53B 3ALQA 4GB31 4Y5Z0 1RUOA 3GCXA 5B2GB 3BPSA 4HZFA 1NXD1 1JBCA 1JYCA 3BB6A 4Y4RA 5FZEA 4GZ9A 2CL2A 2HEWF 1YFUA 1FMD3 1B35C 3U11A 4F8AA 3WP6A 3OYWB 1SCSA 2B4KA 1P8JA 1ZRRA 1J3QA 5AVPA 3KF3A 4NN0A 2UYAA 4MVTA 1O3TA 4QX8A 2E33A 1V0AA 1D4M2 1IQAA 1CN1A 1JUIA 2VQ0A 5FMCA 4INDA 1W8ZA 4F83A 4KG8A 2F17A 5JXJA 5H9RA 1MS3A 1FMD2 1X36A 2JX9A 4OHWA 3S5AA 1LOAA 1W03A 1UNBA 1XNAA 2BNMA 4LK6A 3MW4A 3G6JB 4XTPA 2J1UA 4IEWA 3WUCA 2DFBA 5HCHA 3J7LA 3TYJA 3CJXA 2A73B 3LPGA 1RINA 3POFA 4COVA 2W3JA 5CVRA 1S0EA 3AZWA 3OPZA 3GCWA 3PU8A 1PMHX 2QNKA 4V2VA 5HCFA 5FY4A 1C28A 3VBOC 5GALA 4QDRA 4QXBA 5FO8B 4AQSA 5F3IA 4D0QA 3I8TA 3WF4A 5A3WA 4YW7A 1RGSA 2C0ZA 5HXVA 4IEOA 4GJYA 5A33B 3VDDB 5B4XA 1UU6A 3H1WA 3KCCA 3OCPA 1T2XA 2WO7A 3H3ZA 3V0BA 4LIVA 5C3RA 1D2QA 5AVAA 4KG0A 4R52A 2RS32 3E5QA 2J1SA 2PN5A 2E31A 5J7MA 4XF4A 1RXFA 3LOBA 1UZZA 3KV6A 5FPXA 3NRUA 4PDWA 2WBKA 3SEEA 5FPBA 4QQHA 1GFF2 4QWNA 2BNNA 2L9LA 3QH7A 1DGWA 2XL7A 3ZYGA 1JZ7A 2VUAA 2FZ2A 1SLTA 2WYFA 2R1DA 4IV3B 2A7AA 4Y1YA 4QQ2A 2GC1A 1W0PA 1H4HA 2F4LA 3HQUA 3D3AA 2ZAHA 3DGTA 3HEIA 3I2GA 4QGLA 3UJOA 2NMNA 4QGMA 2VZRA 4UFHA 5F2SA 1AR91 1JZ6A 3OBZA 5IVEA 1UD1A 1YFYA 4P00B 3USUB 5BNOC 3OD4A 1OKOA 2VAUA 1UY2A 3I2OA 1POV3 1BEV3 4IV3A 2IVIB 1YLLA 5EXOA 4KWJA 1FPN2 3DYPA 3LFIA 3ZDSA 4META 4E2SA 4BISA 4I02A 1CX4A 1W9WA 1EPWA 2EXKA 3E6DA 4AW7A 4EN0A 2IFRA 1WD4A 2RV9A 2WZEA 4I0BA 4RHV2 1QQP2 1ENRA 2ZHLA 4UF0B 3TN91 4FFGA 2QJVA 1B35A 3HVDA 3SEPA 4BQ4A 4EWAA 1AHSA 3UGFA 1BEV2 4XFAA 2WS91 3DV8A 3HNBM 2A6VA 3JBG3 4QU2A 2OW4A 4D3WA 2WT1A 4QPWA 5FZ6A 3SCGA 4ZZ8A 5FMBA 1BEV1 2XJPA 3O1PA 4AI2A 2AH2A 4XURA 1JYIA 4CCMA 4E8CA 2XG3A 4QX1A 3J7HA 3MW3A 4YSFA 5LA1A 5H9QA 4RR3C 2QQIA 2R32A 3AKRA 3N9QA 2V4AA 3F95A 3POWA 5GKAC 4EZ4A 4IW3A 2I07B 5FWEA 1OQDA 4YGEA 3I3BA 2RG4A 1H30A 5JXIA 1ZA7A 2G9FA 4PF5A 3M4FA 1W6PB 1WUVA 5IVYA 1OBNA 3IDCB 5C3PA 4FTEA 3OTFA 5A7WA 5JSOA 4JRAA 2GU9A 2Z42A 3KVBA 3ZKYA 4DY3A 3HOBA 4YVWB 3O0WA 5FP7A 1R1A3 2Y60A 3CEWA 4AHZA 4NUBA 3OGJA 5BNNB 1NCRC 5FZ3A 2ORZA 3EHKA 4AGGA 1KQRA 2RS51 3WDYA 4JX0A 3D4KA 1H4GA 1QNWA 4DFSA 2CWSA 3CIHA 3RVHA 2CV6A 4CEWB 2I2SA 2W1WA 2V73A 2R0HA 2WO3A 2G4IA 2Z4FA 2ZGPA 3L9JT 4FP2A 5LWBA 1XNTA 1UXXX 2AACA 2JEMA 1SLLA 3PDQA 3CZJA 3GJBA 4MHRA 5FOBB 4CDXC 3VHPA 2PAMA 1DQ0A 1GZWA 4MXWB 4WM7C 1QJU1 2VUCA 2QQVA 3NJZA 1H8TB 1GQHA 1OHFA 2C5DA 1MVQA 5TSWA 3ZFFA 2WZR3 2ZABA 4RQPA 3WF1A 4JGZA 1WLWA 3MICA 3B5LB 1WKYA 3NNJA 4MSVA 5A3MA 1QJX3 4W6XA 4LTAA 3UYJA 1FNZA 2CDOA 4GAZA 4FPLA 1EP0A 3RWKX 3RG0A 3ENRA 2ERFA 4L11A 5A6QA 1DQ1A 4OVEA 1YIFA 2C26A 4O9GA 1D4M1 4RA0A 3H0OA 1MR5A 3W5MA 3VDDA 1QWRA 1ND2C 1ASJ1 4PLMA 1CR7A 4C8DA 4Q4V2 1AX1A 2XHKA 4Y1VA 1K5JA 4M01A 3J9SA 1JU3A 1NCQB 3AXDA 4X8NA 5CIRA 3HN1A 2BGOA 1JMUB 2BZDA 2VY0A 4MGIE 4ISRA 4UBGA 5FZLA 1C1LA 1HIXA 2XJTA 5FP3A 2D3SA 3VZLA 3AJZA 1J58A 1F35A 2OKXA 2RR13 3S7IA 1CAWB 4IE5A 3POBA 1NZIA 3SC7X 4DPNA 1FMD1 3FMGA 3AC0A 5IK8A 3AL6A 4AL9A 2DBIA 4EN8B 2ZHKA 3RDIA 2CAUA 3JQXA 4KWUA 2ZGRA 3B02A 3IWZA 4XJAA 4CP2A 2JIJA 2ZX4A 3RMYA 2DYCA 2ADEA 4A3ZA 5C9AB 5J09A 1JH5A 3AZVA 3R05A 1DZRA 3INAA 3NSTA 1VE0A 3GBFA 3VDCA 5ACA2 4ES8A 4LHNA 2J1VA 2BQPA 3NKGA 1RVF2 4FOVA 5DG2A 2FDIA 2EALA 2WNUA 4JTOA 2JB4A 2CDPA 5EYXA 4WVVA 1DF0A 1LOGA 2F6BA 4JDNA 3EMRA 4CCCA 4BQYA 2VMCA 1OFNA 2BWCA 4HN0A 2CU5A 1JZ3A 4QHOA 3ZYRA 1K12A 3R4SA 5IAVA 2PELA 1AR82 4BXFA 1G7YA 2JDPA 1RVF3 2YBSA 1Q5OA 2WN3A 1R093 3K3OA 3FL7A 4HVRA 1SPPB 5T54A 5K8SA 3CDZB 2D93A 4XF0A 1V9U1 1LOFC 4CPBA 1SLIA 4ES9A 1WA6X 5DXDA 3MUY1 4XDOA 1TME1 2QBXA 4E9KA 1VP6A 4PIXA 1JHNA 1TNRA 1W90A 2VTXA 2VULA 1LEMA 4M3CF 4BLIA 4LKEA 5FYVA 1NE4A 2XUEA 3JU9A 4Y24A 1LGCA 1R092 3O1SA 1S0IA 1PO23 1S0CA 4QPIB 4YGDA 2R49A 3POJA 4QX7A 2PA7A 2YDEA 4HLTA 1HRI2 2V4VA 5FCCA 2EF6A 2VOWA 2ID4A 3LD8A 4JDMA 3ZN4A 4Y22A 2B42B 3LDKA 5DAQA 4BOWA 2D44A 2RHPA 5LZ6A 3E6CC 1FOD3 2PQQA 3V0AA 2X05A 3ZPOA 1NY71 1RXGA 3M3OA 4DRVA 3M3EA 2GSYA 1UY1A 2GMEA 3KS7A 3VKFC 2WN2A 5DZFA 4YZ3A 1O8PA 1NAEA 2IXJA 5KXBA 1TME2 3IT8A 4PI2A 3OGSA 2JDKA 4XQDA 5K0UA 4FI9A 4Q4Y2 1HRV1 1O5UA 1HQWA 1R1ZA 2VM9A 3GNEA 3PIGA 2LUWA 4IUGA 3ZXJA 5ABJA 1IOAA 1UF2C 1F5JA 3ZYPA 3H7YA 3MIDA 2HWC3 1VIWB 2Z69A 3NAPB 3LA7A 4AE2A 5FWJA 4W6YA 1XOYA 2ARXA 2C9KA 4FXGB 4JDOA 5C7GA 2EA7A 4AEJA 3CU7A 2WABA 1LEDA 1XYNA 5D8AB 3NNMA 5FBZA 5FK7A 1R082 4FFFA 3WOGA 4BA6A 3N9LA 1V6JA 1OD3A 2WLPA 2XVKA 1JUHA 3AZZA 3RPQA 4AVTA 2PMWB 2ZGTA 4XVHA 4EROA 4G9SB 2YBPA 4W4ZA 2HWC2 3OUIA 3M2MA 4AI8A 1GQGA 5FPAA 2VH9A 3H7JA 3WW1A 1DCSA 2WNVA 4YW5A 2B8MA 2VMEA 1TMF1 4I01A 4DEQA 1PNFA 1XE7A 2ZGQA 3K4DA 5BNNC 2ZX1A 1O4TA 2XHNA 4OI1A 1RJ7A 5FLJA 1F4AA 1H2KA 2ZOEB 1XQNA 4LUKA 2V09A 1S0BA 5FZCA 4Q4X1 3LDRA 3DL3A 1PIV2 1JYWA 5LATA 2Y0OA 1Y7BA 3MW2A 5LK5A 4W65A 3DPRB 4CXXA 3VD5A 2W87A 4ZHNA 1WLDA 1OQEA 2QQWA 1IG3A 2BWAA 3B01A 3NV1A 5KR7A 3OEBA 3ACFA 3PIJA 4FOWA 1AR81 1OLMA 3B7MA 5LK7B 1AYM1 4I09A 2JG9C 4HK8A 4I0AA 2HWC1 5BNOA 4UFLA 3U78A 3TEWA 4Q1PA 3Q8CA 2V5YA 3MBWA 5FZ7A 2A3XA 3ZXEA 1NA1A 5LRSA 3MYXA 4ISQA 2D5HA 4LQRA 5ANNA 1JZ4A 1UIJA 1ND2B 3O5SA 3T0DA 3UKTA 4LORA 5G04L 1OSGA 5F32A 4EN7B 1JW6A 4BXSV 4FO9A 4P02B 1ALYA 5FY0A 4LO8A 1XRUA 1VALA 4CEWA 1I1EA 4NPRA 2XLAA 4PDWC 3AKPA 1W8OA 1G8WA 5DPNA 1PGSA 1ULDA 3LSEA 1O4ZA 1RUF2 1TMF3 2X8KA 4CRQA 1LCLA 2BERA 5I8YA 1GOGA 5FMOS 1X7NA 5I0UA 3VKOA 4AVCA 4CU9A 3NJVA 3Q8BA 1NCRB 5IVCA 3SCFA 1W6MB 2R063 4LBNA 4V1PA 1OOPC 1RUI3 4FQZA 4XPVA 3WQ0A 3ZYFA 5B4NA 1IZ3A 3UNPA 4Y5TA 5LEJA 1M4WA 3RRDA 1UYPA 4W6WA 1STMA 4UW3A 4CDWA 3MFAA 5FK8A 2LRPA 1WZXA 3IDEA 3BTXA 1DLLA 2RMU2 2VCAA 1D2SA 2P3IA 1URXA 4CP0A 3ST7A 4XBNA 5FY9A 1XNDA 5IW0A 3CL1A 4IEPA 5ABJB 3BTYA 2R062 1RUI2 3OGVA 4UWDA 1AR61 5FOJB 1HX6A 3WR0A 1QJX1 1DU3D 2B46X 1AYM2 3UK9A 1VR3A 1ZYBA 5FZFA 1H2LA 5IATA 4JTNA 4NVPA 4H7LA 2ZGSA 1MS8A 4NIIA 1MVEA 1QJY1 5FZKA 1W6OB 2AREA 2C4XA 3A21A 1QDCA 3BPZA 3URFA 2RM23 1W04A 3JBG1 3APBA 4SBVA 2VNOA 2RS12 3NNFA 2B39A 1JYTA 3T09A 2WKKA 1TG7A 3C7GA 4RGAA 3T2PA 4AFCA 3J8F1 5T5JA 2OUJA 3IB3A 2XR4A 2ORXA 1REFA 5L73A 2VMIA 5E89A 5DZGA 2P6HA 5BNOB 5FO9B 5H9PA 1L3JA 1MS9A 2WNVB 2XVLA 3EYPA 3UESA 1GSLA 2ILMA 5FZ0A 3I54A 1ZVFA 1YO8A 3O14A 4HT1T 1GR3A 1H8TA 2XJRA 1N3OA 1RUE1 5CZKA 5A33A 3PUAA 3ON7A 2YU1A 4YW2A 3T3YA 4DQAA 1PZ9A 3H50A 5C4WC 3B00A 2WFF3 2BBVA 5IYYA 1BK0A 2W39A 3MIGA 3BI3A 4FTSA 3WQ7A 4UI9L 1OI6A 1XYPA 2IWGB 2W1SA 4UW6A 2BOJA 3LGRA 4OULA 4I3PA 2R7EB 4GXLA 4LOTA 3ZXFA 3ZN6A 3VZOA 4OI2A 1SMVA 3VDDC 2WFF2 2J42A 1SFNA 4A7ZA 5C8CB 1WA4A 4MADA 3OPWA 3N9MA 2QE3A 3V64A 2XB6C 5HV0A 4IEZA 1CVNA 1GNZA 1AF9A 4XE9A 4BQXA 1A8DA 3IDAA 2JXAA 3AK0A 4KGGA 2R30A 4NRMA 3E5UA 3WG2A 2Y6FA 1KD7A 3JZVA 4YLZA 5BV6A 3IMNA 2XKPA 3BYWA 3K51A 1ENQA 3SKJE 1SLAA 3NNLA 3AX4A 3C7HA 3CO2A 4JGZC 3EB7A 1UX7A 5FZOB 1Z7S2 5BXXA 3N3HA 1PK6B 2D6LX 2MHFA 4FPYA 4N43A 1M06G 3WEZA 3ZYHA 4PI0A 4EN6B 3GGLA 3KHBA 5FUPA 5A80A 3RNSA 4QQOA 1RMU1 1D0HA 1NCQA 3LCPA 3GZAA 3VLBB 2H0BA 2ZXQA 3NNGA 5HBAA 3NJXA 4QPIC 3IM0A 1KEXA 1GZWB 4MXWA 4QPYA 4CUGA 5ISLA 1HRV3 4XXPA 5CBLA 5EJZB 1Y3TA 4CCJA 5I8TA 5C8CC 1VBB1 3ZN5A 4YGBA 3WG3A 4HN1A 1W8FA 1N1TA 1J59A 2BP6A 5FP9A 5T3NA 2VXJA 4PIYA 1X8EA 1SBDA 2XJQA 3KT1A 3IIAA 1MPXA 2OYZA 2HWE2 1CAUA 4PBOA 4QPGB 5FPVA 1RMU3 4QX2A 1E5SA 3OOXA 5HPOA 1RUD3 3V0BB 2WZPP 5BNQA 2VTXJ 2ET7A 4KBBA 2HYXA 4ZU4A 5A3PA 4RR3A 3AMNA 1VBC2 3FZ3A 2YGLA 3TWIA 5F1RA 4RN5A 2HH9A 1E5HA 4GH4A 2QCSB 1NE6A 3N7MA 2A6YA 5I8SA 4C1XA 4K8FA 5FZ8A 2IFWA 4GALA 4BU2A 5LBEA 1XYOA 2HYKA 1XSRA 1VBC1 1WWYA 4WM7A 5E16A 1OOPA 1VBE2 1CJDA 3RYPA 1TVGA 4CDXA 1EUUA 3UKVA 4E4HA 4NHLA 2EICA 2X5IC 3HR9A 1B09A 4Q29A 2UY9A 1YJKA 5BNPB 5IK5A 3ACIA 3WCRA 1KXGA 2VZSA 2TBVA 3GF6A 3WF0A 5FYTA 1PM4A 1EUTA 2I74A 1CGPA 4QT6A 4CYDA 1I3HA 1GU3A 2HWB1 3VZMA 4CP1A 4LBQD 5F3CA 1HJGA 1W05A 4CEWC 3A4UA 5F2WA 4BDVB 3LEMA 3O1VA 2D5FA 1NT0A 2O1QA 4PLNA 1CESA 3A22A 4S2FA 2DCJA 2QQMA 3SMHA 3WW4A 2WAAA 5C8CA 2ZBJA 3LDBA 3N7JA 3KCYA 5A7OA 1W9TA 3WDWA 5JOWA 4L9BA 5DUXA 3ZSJA 3VL8A 1H9WA 2VC9A 2D6NA 4MG2A 1YFWA 1UZYA 3M1HA 5HI0A 2VO5A 2Y64A 1D4M3 4RS5B 1MS5A 1S0FA 5FLHA 1CJPA 1UY3A 2BU9A 2AC1A 2PAKA 2R0FA 4HKWA 2JG9A 4PBPA 4FP3A 4X6QB 3WNXA 1N3QA 2WQ8A 1AYN3 5GZEA 2YG0A 5C9AC 2PFWA 2WSUA 1HV0A 1YEWA 2DU0A 2GN3A 1OLRA 3HWJA 1HB2A 4DNYA 2DTYA 1PGL1 1AXZA 2P3YA 2D6OX 4DXSA 1KDKA 3S7EA 4YGCA 3IIIA 1TEIA 2C9AA 1XXNA 4DS0A 2VBDA 4BQ3A 1C3HA 1RTVA 2ZGLA 4R4XA 3KMHA 5FZAA 2AENA 1PK6A 2PLV1 3AKQA 1S2BA 3H3UA 1CD3G 3IN9A 5J1XA 2QQPA 2VVDA 3OB8A 1W8HA 1LHUA 2B9UA 1SBFA 1QXRA 2TEPA 3MPBA 2PHWA 1MEC3 2VUJA 5JZGC 4ZS2A 3ZFFC 5FPLA 2PHUA 2C24A 2RS33 3CMGA 4CU7A 1ENXA 1W6OA 1NZCA 2Q0AA 4A44A 3PUQA 5A1AA 4K6BA 3T4VA 4BYYA 1UWWA 4AFDA 1OVSA 4TTGA 2B5HA 2QKDA 1LULA 3B94A 4ONUA 4EZHA 3CJIA 4YW3A 3WG1A 4KMQA 3S6PA 2PHDA 3BGAA 1ZZCA 1DG6A 3DXUA 2JE9A 3VZKA 1IS5A 2AEYA 3U14A 2R041 2CWMA 4A45A 1W06A 2UY8A 4CXWA 4FQ4A 4U36A 4I2OA 4LBQA 5KC5A 1OC1A 4Z2AA 4CEYC 1ZZ6A 2YC4A 3B9CA 5CG9A 2TUNA 3FFQA 1FXZA 4RR3B 3CNAA 5FBJA 4TSVA 2QQUA 5FZMA 1U5IA 1VMJA 2ZEXA 4AI9A 4AK3A 4BIFA 4NIAA 1FI2A 3ETQA 2WC2A 3ES1A 1ST8A 1UZVA 4RHV1 2JWPA 1LOEA 1ACCA 3U07A 1YQ8A 2HWB2 1VBA3 5LBFA 1W8TA 1GLHA 2ZACA 5DUUA 5JZGA 4BHPA 1N1SA 4Q8LA 3ZFGB 5C5TA 5CFCB 2D40A 2FHRA 3ABZA 1JZ2A 3B93A 2WYSA 5E6HA 2W0XA 5A7NA 4KI5M 3RJ2X 4RFT0 1C4RA 1NA1B 4KL1A 1VBA2 3VBRC 3WW2A 1LODA 4QMAA 1HDKA 1TZOA 5FZDA 2A1XA 4H2AA 5KC6A 1W28A 4BK4A 3ZYJB 3AFGA 2FQPA 2R16A 2EAKA 3KM5A 3M3IA 1Q8QA 4YPJA 2EIBA 3B3QE 4IGOA 2QQLA 1ZX5A 3P3NA 3JD72 1HQLA 3VD9A 1QXPA 4OUEA 1VBD1 4GMP1 4JGYC 4RL7A 2WQZC 2VR4A 3ZYBA 2WR9A 2ZJCA 4LJHA 4CUBA 1R1A2 3P6BA 1VB2A 1XU2A 2HEVF 1QJX2 5LA2A 4M0HA 3TN92 4BK5A 2VL4A 4D7YA 4LKFA 1QMJA 5IVFA 5JI7A 1DGRA 1EAH2 3UGHA 3ATGA 4K20A 1APNA 2VNVA 4TWTA 4XHBA 1CIWA 5EP9A 2W46A 1R081 1XE0A 2D6PA 1NLQA 5K9YA 1F2NA 5FV3A 4KQ7A 5D8AC 1RUH2 4L97A 2BFUL 2XOMA 3S5QA 4E2QA 5FYBA 1SCRA 2IXKA 2FCVA 4YARA 1BVP1 4YZ1A 4GWNA 1ZRIA 4OCTA 4QGNA 5FZOA 1EAH3 2FMYA 2W47A 1EYBA 1ZBA1 2C6SA 2FCTA 2G19A 3DF0A 3J8F2 1SDDB 1MZ6A 1JU4A 2GDFA 2X5IB 5L9VA 4COUA 1W0NA 2W92A 4GKYA 1PGW1 4RFRB 3RZLA 1FX5A 4LNVA 1DQ5A 3PL0A 3WG4A 4NIDA 1PVC2 3HBKA 4GWMA 2RR12 1OLME 1ZBA2 1E57A 2PQSA 3KQRA 3KSCA 4HL0A 4XILA 4AEDB 3IKWA 4YW6A 2R1BA 2XGXA 2DVDA 3F2ZA 3I2JA 3HNYM 3R4DB 3J8F3 1QDOA 3ZKUA 5CFDC 3UGGA 2P17A 3R0RA 4BQ5A 1Y9GA 3RZJA 5IT6A 1ZRCA 4BCUA 4FVVA 2VW1A 5LBCA 5FO7B 4FT8A 1AR62 1HXS1 4Q4W3 3AKTA 3MO4A 1GV9A 1AL22 4L99A 5DUWA 1ZBA3 4MGQA 1QHDA 5KHIA 2KXLA 5A3LA 4RYDA 3POSA 4HBNA 3MZHA 1PO13 2WQ4A 1HQNA 3NL1A 4IXLA 1WCKA 1ZZ8A 4YZ4A 4CPBD 1S2EA 2Q8EA 3VDBA 4J1XA 3MI8A 2VD7A 1GBGA 1ZZ7A 1SBEA 2WFF1 2YGMA 1ULOA 4EYUA 4FOQA 4XJZA 3BIWE 4Q4W2 2RDQA 5FY1A 1SDWA 3MHZA 3DKQA 2OT7A 2XMLA 1GUIA 4JZRA 4UAPA 4QXHA 4NE9A 2HLEA 2Y33A 1UU4A 3C8XA 2VCCA 3WNNA 4WM8A 3VBSA 1XU1A 1GNYA 2CNAA 3Q8FA 2UWBA 3LB9A 4XZPA 5I0RA 4H55A 2UYBA 5JMCA 3V56A 2DVGA 3Q9OA 3IDBB 3W20A 1CAVB 1LGBA 4I30A 1FOD1 4LBOA 3D0JA 3VUOA 1QF3A 3WY6A 2VCBA 5A7PA 5ACA3 3OY8A 4CCOA 5IAXA 1OA3A 2RDRA 2Y6JA 4LBQB 3G7DA 5J98B 4IGPA 4AHXA 3NAPA 1J3RA 2OX0A 4JAAA 4XFIA 3JD71 4Y20B 2HWF3 2V72A 1RUC1 1HRI3 3WCSA 2WLQA 4DMIA 4NRQA 1VRBA 3CKHA 3KZ4C 2QQKA 2PYTA 2X29A 4XFBA 3MGUA 3N9NA 4D8MA 1R1A1 1WCUA 2OQ6A 5LA0A 2YY1A 2GNDA 5F37A 5GZCA 4XIKA 2UU8A 4XDQA 1YFXA 2GP5A 3KF5A 3T1LA 2GMPA 1UZ0A 4Y26A 3POYA 5JPMB 4PJYA 1CIYA 1KFUL 4IESA 5FXVA 3VBOA 4Y3OA 3ROUA 5FJKA 2D6MA 2R072 2QTWB 3PVEA 1SEFA 3ACHA 2RJ2A 4YW1A 4URTA 1C1FA 3UV9A 2JD9A 2R042 1V6LA 3AZXA 4GQ7A 3W58A 1DGRN 5DDJ2 4OI0A 1ULEA 1OT5A 3RZKA 4GIQA 3VKMA 4ATFA 1AL0G 1EPZA 1ZBE2 1DQ6A 4GWIA 1WW6A 5LEKA 4GULA 1H8VA 1ZM1A 2Z2SB 4HMZA 3ZIXA 5ACA1 1AR73 1DIWA 1ONAA 2YUEA 2XQRA 4RGKA 3GZEA 1C8NA 1PGL2 4UW4A 1FOD2 2XQXA 4UXAA 1OLQA 2R043 2DUQA 1RHI3 2TNFA 2ZEZA 4XDPA 1QJU3 2OA2A 3N7KA 4DO0A 5AFBA 2XPJA 1DDLA 1VRH2 4WVWA 1JYVA 2OZJA 3ELNA 2EIEA 2OQ7A 4D7TA 1UMIA 3VBFB 2MPFA 3MIFA 2BV4A 2JD4A 3VKLA 3PTRB 4BE3A 2JDAA 1G9FA 1OH4A 1FATA 3POEA 2ARCA 4X8PA 3VKNA 5LY1A 2LTNA 5L7OC 2E7TA 4H7MA 4XCAA 3ZYIB 1REDA 4ZU7A 4Q4Y1 2F4PA 2WL1A 5EIYB 5JDBA 1GANA 3PNAA 4FPKA 4B1LA 2DVAA 1IS4A 4AWDA 2WWUA 4IE7A 1QGLA 4D6RA 2BVVA 1FPN3 5HXMA 5JXGA 3AMHA 3PMEA 4DB5A 4IL7A 1UOFA 2BNOA 1LKNA 3IZOA 2WJSA 2D6KA 4HK9A 2DV9A 4P5YA 4LHLA 4XJ8A 1FNYA 1XNBA 2P5BA 1H2MA 4XABA 1S0GA 4RHV3 4C0HA 5C70A 1AXYA 2XL9A 3GJAA 2GNBA 1U12A 4M3CE 4QD2A 3BTAA 3GXUA 3VBRA 3WINE 3AP5A 5EWSA 5F39A 1PM7A 2XJVA 4LBLA 1H1IA 4KNCA 5EV7A 4Z1VA 2Q4SA 5A6ZA 2ZHMA 2ZGMA 2NYYA 3MV11 4K3UA 1YQCA 3KVAA 4FFHA 4Y4YA 5FLIA 2XONA 1VJ2A 4MGSA 4Q1RA 3T2TA 4K21A 1BCXA 1PIV3 1UKRA 4AXOA 3AJYA 4N53C 2C1FA 4QB1A 2RDSA 4IEQA 5IHRA 1VMHA 4A6OA 5A7WB 3HT1A 1NG0A 4R9CA 2XLFA 4LOSA 3ACGA 1Q8VA 4NROA 5ERLA 3U1XA 1BMV2 2VBPA 2WNUC 3GZUC 1AYN1 1MZFA 2DVBA 2G9GA 3N9OA 1JHJA 2VJXA 4XF1A 1NKGA 2D7FA 2Z79A 2EXHA 3BODA 3OSDA 4MV2A 1UW8A 1U5ZA 2ZCWA 3QCWA 4D69A 1CAUB 2RM21 4AVVA 5F5AA 4CCKA 3HN3A 2JKBA 3R6SA 3AP6A 3TNQA 3WNLA 2VNGA 4QB6A 4JKMA 3C7FA 3DKWA 1K5MA 2Y0IA 3T1MA 3JQWA 4I0WB 1V6OA 3O1TA 1LB2A 2ZGUA 5CKQA 2FDGA 4DEVA 4R9AA 3S0MA 1ODNA 1VBD2 1WBFA 2Q8OA 3HQRA 4AEDC 1AX2A 3ACLA 2FD8A 2JG8C 3JXSA 2WWSA 1XNKA 5FR3A 1OURA 2ZZQA 2WUHA 4IE4A 3ZM8A 1PHMA 3A23A 2J1EA 2BW8A 5JIUA 4EWEA 2VZ1A 4E27A 3O1MA 3NQHA 1W2OA 5FYSA 3WNOA 4FSJA 3SISA 5CKMA 4QAWA 5APAA 4PDWB 1A78A 3JCIA 4IDZA 4KU8A 3ZIWA 4ZKTB 3ZR6A 2WINB 3RYRA 1V9U2 5F5CA 3VBHC 4YNIA 2NQYA 3FFZA 4YZ5A 2IXLA 5C33A 5LRRA 3O0VA 3I2FA 1U5XA 2VCMA 3M3CA 1V6IA 4FAHA 1GP5A 3RI9A 4QQLA 1MS1A 2RS52 1ZNPA 1ASJ2 3GHMA 1FT9A 1SFPA 5FQ0B 1FV3A 4M3CA 3DPRA 3O1UA 4LHKA 1CX1A 1LOCA 2PHXA 3PURA 4DUWA 4H14A 3DN7A 4AVBA 4R9BA 2EIDA 3WP4A 3ZFGA 2XLGA 1DFQA 4FAGA 3LWCA 2YPJA 4RS5A 1WMFA 1JOJA 5K4LA 1W3XA 1I6XA 2ZGOA 1SLBA 2ZTNA 4WM7B 5FYZA 1RUJ1 2A6ZA 5JVVA 4CXYA 2P6CA 1H9PA 1ND3A 3H8RA 2RS13 3W21A 2VOTA 1XJAA 4N7UA 4YFZA 5I91A 3AMMA 5D2AA 1DYPA 3B9IA 3ZXGA 1AXKA 1QJZA 1DLCA 5A32A 4YM0A 4DOUA 3I3MA 3IPVA 1SQ4A 5FYCA 3UJQA 3W9AA 4XTMA 4AFMA 4CCLA 3CZUA 2ZMKA 3BUCA 2JIGA 5L9RA 5K0UC 4V2WA 4P14A 2CGNA 3SLIA 1B35B 4XF9A 2KR2A 2VZVA 3LF7A 3PUIA 2GH8A 1LNSA 1RUC3 1R091 1OA4A 1C8M3 1IS6A 5HCBA 1WW4A 5FPUA 4TN7A 3U4XA 4XACA 4XUQA 4UFIA 2YXSA 4LKSA 4AVSA 1TE1B 2LM3A 4X6RB 4DXZA 1X9PA 4GH4B 2GC0A 5FZHA 4BMEA 1BBT3 1J1TA 4YG0A 5FP4A 2RDNA 3TRSB 2E32A 4N43C 1N1VA 3D6EA 4MXVA 3BALA 3ZFGC 1QJFA 2UWAA 4XXAA 1EY2A 3FLTA 4PQQA 4LULA 1TNFA 2QFEA 4GD4A 2AYHA 1AR83 4RD7A 4BLJA 4JKKA 1RL3A 1RUJ3 3VB9A 1O8SA 2DF7A 2BDRA 1BBT2 4UBHA 1D4VB 4Y1ZA 4AR2A 4CU8A 4ZXKA 2HWD2 4UFKA 1C8M1 3AFKA 3OBTA 3VHOA 1SACA 1QEXA 3U37A 1IHMA 1IGOA 2DCYA 2FDJA 3LEGA 5FZ4A 1JYNA 2UWCA 3I7DA 4YVWA 2VZUA 1QH7A 5AFEA 3USUA 2GALA 3LSDA 2MEV2 2NZ9A 1ULGA 1CZSA 1J84A 4UT5A 3MPPG 4YWAA 1RITA 4AAPA 1G86A 2Y38A 2JDNA 2DFCA 1AR71 2YYOA 3KV9A 1MZEA 2KM2A 5F6LB 1T6BX 3AB0A 4N90A 3SH5A 2BRTA 1E5RA 3USSA 2Y6LA 5IWFA 2DUOA 5BPXA 1UIKA 1VBC3 1AR92 2NLRA 1BBT1 3LFMA 4MOAA 1BJQA 3NAPC 5FUIA 3H8OA 4B29A 3FBMA 5CKNA 1GWLA 1Y43B 3NO8A 2ETEA 1F4HA 1JOBA 1DGWX 3PUSA 3RFRA 4CDWB 3GBWA 1JXNA 1I5PA 4Q4Y3 1YCIA 2DCZA 1Y9QA 2D97A 2OPKA 3A7QA 2FDKA 1NOVA 3QBQA 1W6PA 1AZDA 5KXEA 2WRAA 3WF2A 2P37A 2HWE3 3J4UH 4JVAA 1RMU2 2BBAA 2NM1A 5EJ1B 1W6NB 2VZTA 4SLIA 2VZOA 2IVJA 1GWKA 1UOJA 2XJSA 3GDBA 2E53A 4L0PA 5EZWA 1I5ZA 1UKGA 3ZN6B 3WD5A 1QY4A 2HWD1 3H3LA 3AZYA 4AQTA 5L36A 2RJLA 5CG8A 3PVBB 4N53A 5JSPA 4QHBA 4YW4A 1MS4A 1GZTA 1GYKA 2GN7A 2VTFA 1O7FA 4NWWA 1CPMA 4XEZA 5GM0A 4EQVA 3BKZA 4A2UA 2H6BA 5FXZA 1H0BA 2X09A 2WZR1 4QU1A 4M3CB 2O14A 2IUWA 1JODA 3WLUA 3RZZA 3T0BA 3VL9A 3KHCA 5I0TA 4YM1A 3WX5A 3LOIA 5IVBA 1W3VA 2VG9A 3HAGA 4K8RB 1R64A 1XBFA 3WT3A 3D0SA 3WNMA 2B9VA 5DUVA 2W2IA 2R071 1OPOA 4CDUC 4CCEA 2X10A 4LE3A 5DZEA 3MLLA 5F7UA 2K46A 4L8QA 4ASKA 2AUYA 2IC1A 2IXHA 4AZZA 4O7XA 4TYSA 2BGCA 4OHZA 3LKJA 4E4DX 2W95A 3RMXA 2XVGA 1O3RA 3S57A 1D0GA 2HWE1 5DMYA 3PUHA 1WMXA 5EPAA 3ZSLA 4CZSA 5FYIA 4XYXA 1WMEA 4QKNA 4ATEA 3RGBA 3POGA 3W5NA 3RZGA 3I3DA 1RUE2 3NV4A 3HMYA 2YZ4A 1HN0A 3EQEA 1NCRA 1IG0A 1T6GC 4LUMA 5C71A 3GYDA 1YRZA 4OHVA 1IPJA 2RJKA 1YI9A 4N43B 1GWMA 5FZGA 2JE8A 3ORJA 5F5QA 1W2TA 4Z92B 3P5BA 5KHKA 4AQ2A 2HBUA 3ILRA 1OA2A 3CHXA 4UFJA 5C5UA 4UYBA 3WNPA 4JRLA 1YNAA 1O5LA 4U2AA 2LALA 4MO3M 3WP5A 2FCUA 4HPKB 3OGGA 1OUSA 2AGSA 2YPDA 5E1RA 1J3PA 4IE0A 1K42A 4Q0UA 3SCHA 5GZGA 2JG8B 1OQ1A 2XWBB 3U75A 4KH9A 1CAXA 4J1WA 5K0UB 4IEUA 1LHNA 4XUPA 1MEC2 1ULCA 1VBB3 3VZJA 3ZFEB 3H8UA 1HB1A 4MZUA 1OH3A 3NKTA 1MZ5A 3NV2A 4JC1A 4LA2A 4Q2FA 4S2DA 5DAVA 1WCQA 4WVZA 5A3OA 1RUF1 2ENRA 3E97A 1RHI1 1GP6A 3VBHB 1FPN1 3BIEA 4DXTA 1I9RA 1BKZA 3NVCA 2HEYF 1X82A 5FFOC 3CQOA 1AYM3 5E8AA 2W5FA 2VOKA 2WSVA 4QM8A 5JZGB 1VAMA 1K5MC 5FTTC 2FDFA 2ZGKA 2CTVA 3OPTA 4KBZA 2O0OA 4HVQA 2UURA 4W8JA 4BPZA 5T5LA 4XUTA 5JSRA 5FP8A 5FZIA 2VE1A 1UQXA 3NW4A 4NHMA 1N3PA 4HXCA 5KWRA 5C8WA 2W68A 2WAOA 3OF1A 3BOWA 3JBG2 4LEJA 4D6SA 4FBFA 2E9QA 3L2HA 4NPLA 3TOJA 4YFWA 4HVOA 4OQ8A 1LHWA 1EV12 4XAEA 4DY5A 1C5HA 2ZA9A 1S0JA 4B4PA 2G9ZA 4ZXEA 3I59B 2YU2A 4MUVA 5F5IA 2JICA 4M00A 3FLRA 4JV4A 4NOTA 1ODMA 3AYCA 2BGPA 3KGLA 3TB0A 1OPMA 2ZX3A 4COWA 4DINB 3BU0A 2HWB3 3WUDA 1WD3A 1LHVA 3VV1A 1HXS2 5FDBA 2JDYA 2AZ5A 4JGYB 3RI8A 2VQUA 5A6XA 1N47A 2DCTA 1LAJA 2I45A 1YWKA 5FRAA 4OUMA 3QOPA 1PZ8A 2WNEA 2VUDA 1COV2 4LT5A 2XH6A 3PHMA 2ZKNA 4K9SA 4LO4B 2G1MA 4QKBA 2WA4A 5H9SA 1A6CA 4XCBA 3ZXAC 2CGPA 2J7MA 1KITA 2BYVE 4K7JA 2Y34A 1HXS3 2PTMA 3LEIA 1UYXA 5D8AA 4B8EA 1CWPA 1W8NA 1AX0A 4XC9A 4Y22B 4CDUB 1MS0A 2Q30A 4LXLA 4YM3A 3U10A 3PMSA 2E7AA 2EXJA 4TZDA 3HIFA 1Q3EA 4EJRA 1W9YA 2ZKLA 4GKXA 1GQPA 3K4ZA 3M8LA 4FPJA 4XAAA 4Y5SA 4QDQA 3MFCA 3TNPB 3ZSKA 2EVXA 4E2GA 4EV0A 5FYMA 2ZEWA 5FY7A 4UOJA 4Y33A 1KJRA 4JGYA 3THTA 2ZMNA 4R4ZA 1NXMA 1JZ8A 2JENA 4IV1C 4IV1B 2KA3A 3T2QA 1Z7S3 5C6CA 4XZUG 4AAXA 2E63A 1PNGA 2RMU1 4P9IA 5FPZA 1MEC1 4FOYA 3EJKA 5LA9A 3TBDA 4AVAA 4Y1UA 5FMOL 4ARXA 4NO4A 1UZWA 4MYEA 4IEVA 2ZX2A 4MH0E 5HV4A 1SHWB 3WNKA 2PLV2 2WFPA 5LBBA 3FN9A 2EXIA 4XHXA 4A3XA 4YVSA 3K3NA 5FIXA 3SH3A 3ZFEA 1O6UA 2FZ1A 4Q8KA 2Y6GA 3FLPA 1PVC3 3M7AA 4QX5A 3K4AA 3DCQA 4AI0A 2VMGA 1NYWA 4ITCA 4XW3A 4AI3A 4C91A 5C9AA 4HONA 4OZXA 5JMOA 2HWF1 3I2IA 5IUQA 2GH2A 3ZMNA 1J83A 3ZPYA 4ZU5A 3I2DA 4P9XA 1MQTA 5CFCA 5A3NA 1JI6A 2CGOA 2YFUA 3TAYA 3ZFEC 1RUH1 4HPKA 4YVSC 1L7QA 3BOPA 5C3QA 4AHWA 1HLCA 1ZBE1 2NPIA 2EIGA 4LLFA 1GZCA 1CAWA 3C7EA 1AJOA 3OUJA 5T52A 1PO21 4URAA 2VMHA 3RQ0A 4CEYA 1IS3A 2GAUA 3EBRA 4K40A 1L7RA 4NMIA 5GZFA 3Q8EA 3FE5A 2RS11 5BY5A 4OLLA 3SHRA 4NIHA 1YUDA 4HG6B 1QIQA 4A4AA 3WVJA 1VBE3 4OMCA 4Z2WA 4F3JA 3KWVA 4CDQC 4XFHA 2P34A 4WM8C 3VBSC 1DQ2A 4P5HA 3SKVA 4LE4A 3VBOB 1MQTB 1YQ5A 2ZAAA 3IMMA 4GJZA 1G9BA 4D6QA 1DBNA 4Q4V1 1RJ8A 2JDHA 1GMMA 3WQBA 2R073 1PX3A 1Q43A 1TQ5A 4R9DA 3KT7A 4RS5C 1PVC1 2A75A 3GM8A 4IEYA 4ASLA 1U5YA 1PMIA 2NN8A 2RE9A 4XBQA 4BJ0A 3KT4A 4WVMA 1O3QA 4LO5B 2EAAA 3PVNA 1UY0A 2Y6HA 3ZR5A 5JOYA 3QLQA 2VQTA 4M4PA 1XPWA 1CPNA 3PLQA 5FXWA 1ZBE3 1YXWA 3K77A 3T2OA 3FHAA 2YMZA 1NX9A 2ES3A 2BJSA 3E1F1 3I59A 4WV8A 2ZS6B 1RYYA 4MGZE 5FYHA 5JUVA 5F3EA 4NIGA 2ZMLA 5L19A 4UF0A 2ATFA 4KWLA 2XBO2 4N9IA 4WBBA 5A70A 1QQP1 1RHI2 1QJU2 1A8MA 3EO6A 2PXJA 1UPIA 1UOBA 5FYUA 3WV6A 4A7YA 1LU1A 3QH6A 4COZA 5DN2A 5SV5A 4LHSA 2NP0A 5FXXA 5FZ9A 5LCWL 1YQ2A 5A7QA 1CAXB 3RJRA 2O8OA 3I2HA 1EV11 3UL2A 2XBO3 1JN2P 1PK6C 1QOSA 3CLPA 2OS2A 2QUOA 1EAH1 3VBUB 2Q5TA 1BHGA 3ZXLA 2MNGA 3I3EA 3K2OA 1RC6A 4DIQA 5G05L 5A6YA 2JKXA 1ZZBA 3KQ4B 5J3UA 1RUNA 2OUHA 2W52A 2Q1MA 3CF6E 1AR72 4ZY9A 4LIUA 2V5DA 3JB8A 3U0ZA 2VU9A 5FY5A 3RWNA 4A6SA 5CISA 2Z5WA 1RB8G 5FREA 1DQ4A 1COV1 2E7QA 3OBRA 2PHLA 3OEAA 5IVJA 1KRIA 1PIV1 2WA3A 1PGW2 4FXKB 4GMP0 1AVBA 5KXDA 5T5OA 3MIHA 1IPKA 4Q0VA 5GLWA 2Q1ZB 1Q8OA 2P1BA 5D1IA 1POQA 5DG1A 5FQ0A 3ES4A 1QQP3 4YG6A 4B3NA 4W50A 4CDUA 1VPHA 3K75B 4GH4C 4OI4A 3BTZA 3VZNA 1XC6A 4OHXA 4COYA 3FUOA 1UYZA 3NJYA 3BN6A 4PIZA 5T5PA 1GKBA 2OIIA 4LLOA 4CTEA 3LEKA 3AP9A 2X53S 2RR11 1WW7A 3AP7A 3UT0A 4J6GA 4P9GA 1K3IA 2OPWA 3JUUA 4NHXA 2CHHA 4K1YA 3MDPA 1KDMA 4LBKA 4ZZ5A 1DP0A 3WHUA 5I0DA 3L2YA 4XQ4A 5J48A 3LA2A 5IVVA 2GC2A 4NAOA 3O0XA 1NLSA 3H1MA 2W91A 4TLGA 3AXEA 4LKDA 1LHOA 2JJ6A 4Q0PA 3KB5A 2J1AA 4AOCA 4QQPA 2ET1A 1H2NA 2QQNA 4MLOA 4RSUA 5JR7B 1VBD3 3JB4C 3H1YA 4CP9B 2CYFA 1LU2A 4CE8A 2XKOA 3BU7A 4XFFA 3IAQA 3SQOA 4QPIA 1F31A 1YHFA 2E6VA 2WO2A 2KD7A 1K45A 4LBJA 2QVSB 2DU1A 5F3GA 1XNCA 2HBTA 5A3UA 5BNNA 4B7EA 3KD4A 1O59A 2VVFA 4RQPB 3T30A 4IEXA 1LR5A 3THPA 1Y4WA 2QQOA 4ASMB 4D94A 5J36A 1V9U3 1Z7S1 3I4IA 5IJRA 3FX3A 5EQUA 2BFUS 3JD73 3AYDA 3D82A 4C1WA 4M4RA 4FPFA 3D5OA 5GLTA 5FZ1A 4AFAA 2O8QA 2ZHNA 1BQPA 2VNRA 5J96B 2BPA2 3KV5A 1U0AA 2VBBA 4QKDA 3CJIC 4FPEA 3VHNA 3WW3A 1AUYA 3J26N 1F9KA 3TN93 3BVCA 4P9YA 2QZ2A 4ET7A 2IXIA 4G3YC 1BZWA 1ULFA 4NJ4A 3FJSA 5FMDA 2WZ8A 1OOPB 2WS93 4E8DA 4LPLA 2D3RA 3GHNA 2WWJA 2WZR2 2WNUB 1NCQC 3TEZA 5ANQA 4DRRA 4YVWC 1LESA 2GMMA 2QZ3A 2VZQA 1LECA 1Q8SA 2WT0A 1H1MA 1PVXA 2RMU3 2W1UA 1OD5A 2ZPXA 1HB4A 4AQ6A 5CAZA 1CZVA 2GNTA 2H6CA 4O65A 3VBUA 3OD0A 2JECA 3C2UA 4CDQB 2DDUA 3KV4A 5A32B 1RIRA 2WS92 1JS9A 1HJFA 2J1RA 1QU0A 1RUG3 2VVEA 5L9BA 1ZRDA 4OFGA 4AEMA 1GP4A 2YC0A 1PO11 3P3PA 1YI7A 2A6XA 2PHFA 3C7OA 3VBUC 5DAXA 4CDXB 4AGRA 2RS53 1DZTA 2QQJA 1IPSA 3NMBA 1OXCA 2RM22 3O7OA 4YRDA 1HN1A 1OUXA 1YIPA 3RZMA 4PF1A 5LW9A 3ZX7A 2VW2A 1GNHA 4A7KA 2E26A 1RUG2 1UU5A 1UYYA 1LOBA 2IZWA 1CONA 4I3GA 1AR63 4XETA 3WZ1A 1C8M2 4OUSA 4GWJA 3THDA 3ZDVA 4QXKA 4QDSA 4BQWA 2XDVA 1UXZA 2BEOA 2OXBA 4JQTA 1W8UA 1XSQA 4FPHA 1PMJX 2WNOA 4FFIA 3WQ1A 5JAXA 2FBEA 1K5MB 4LA3A 5GLUA 1A34A 2K9ZA 2K2SA 1YC61 2W9XA 2VZPA 3I97A 4CSWA 3OBAA 3GZTB 1HB3A 4LK7A 5KBFA 2W94A 1DYOA 2RS31 4OQ9A 4AI1A 4Q4V3 1KJLA 4IV3C 3ASIA 4JGZB 1REEA 3WDTA 2Y26A 5CADA 1FAYA 3M70A 5GLVA 4FCAA 5F6KA 4CDQA 4Q5OA 2XWJB 1RUC2 4P08A 1G9CA 1LJ7A 5JIAA 2DUPA 3SITA 5JLVA 1CQ9A 4Q0QA 1US2A 1Z0HA 5FJHA 1NQJA 1ZA4A 5A1FA 5AC91 1W8WA 5T50A 1ND3B 2NMOA 2MEV3 2WT2A 1IKQA 1DGLA 4B7KA 4N9HA 4BQ2A 3ETPA 4LITA 2HWF2 1ULPA 1BK1A 1GZ9A 4OHYA 4Y20A 5A1LA 1HKDA 5FYYA 3ZVXA 5LY2A 2ADDA 1LTEA 5IFTA 1BLZA 4HANA 4HETA 1WBLA 2IXCA 2JDMA 5DAPA 4IE6A 4CCNA 4MGKE 3AM2A 1RUJ2 1WCDJ 4L2NA 1PO22 4BM8A 4FTBA 2VOXA 2RVAA 1CAVA 2HWD3 4LR4A 5C3OA 2DURA 4C90A 4ARYA 1BXHA 3N7LA 3ZMOA 2W08A 2XBO1 2LW8A 3DEMA 4BB3A 1KS5A 1Q56A 2WDBA 4JCKA 1UCXA 3VD4A 4XUNA 4LO7A 3UKNA 2BOIA 1UN1A 2VQAA 5CNAA 1O4YA 1DHKB 3SNMA 3FC0A 2SBAA 2BTVC 3OUHA 3P1IA 2R061 1WLTA 3E5XA 2Y6KA 3FHQA 2E51A 1OF3A 1YQ6A 1LENA 2ARBA 2VMDA 3B69A 3BCWA 4FPGA 5DDJ3 1V6MA 1F8VA 1IKPA 1LOFA 1BVVA 2BUKA 2D98A 3LZZA 1SPPA 1VLNA 2CAVA 2P4EA 3CJIB 3OGRA 4Z8BA 3O12A 3QACA 4XMAA 5EFUA 1W6QB 1ENSA 3M3QA 4PCRA 5KXCA 1UY4A 4QB2A 4AG4A 1DZQA 1XB9A 3VBHA 5C4WB 5KHGA 5K7PA 3KGZA 3MF6A 1AR93 4F7ZA 1VMFA 5I93A 4XF3A 5BNPC 4OYUA 2GC3A 2JDUA 3OYWA 1VRH3 2YROA 4XIOA 1L7LA 4EE2A 4WVMB 4XFGA 1GOHA 3VBFC 4MGTA 2JE7A 1W39A 2A5ZA 2H0VA 3MV01 5GZDA 3DPRC 3FBYA 5L7OB 4XQWA 4L92A 3HBZA 3K48A 4MX3A 5CYYA 5F8PA 3SH4A 3W59A 3ZOIA 4Q27A 1F15A 2JG8A 1X8MA 3ME2A 3ITQA 4BH9A 2A70A 5T55A 4CP9A 4QPGC 4AYUA 3KLSA 4XOGA 5D21A 5EHDA 1V00A 5FUNA 2GP3A 2Y8KA 2N7GA 2AEZA 4QXCA 1TME3 5SV8A 1NY72 3DUIA 5I0SA 2GNMA 3AMQA 1AL21 3VGIA 4N8MA 1W6MA 3ECQA 4HFSA 4P9WA 1ZZ9A 3T08A 3UETA 4CVUA 1WLCA 4FPOB 2YB7A 4H3WA 4PHZA 5CA6A 1LRHA 3RS6A 3WHTA 1RUE3 1R083 4KWKA 1US3A 1VBE1 3T4HB 4NHKA 2YFZA 4AEKA 2P3JA 3WP3A 3VBRB 1GICA 1UOGA 4B1MA 4C0BA 3N4MA 3LQCA 2WIIB 4LMFA 2XJUA 5DAWA 2R6QA 5EYYA 1VRH1 2JDZA 1G6NA 4DZGA 5JOXA 1ZREA 4LO6B 2XUMA 2A6WA 4Q26A 5J37A 4GB33 1KS4A 1DYKA 4N7IA 3E6BA 3IPVB 4E4SA 3MIBA 5KHJA 2PAEA 1X9TA 4M0NA 2VGDA 4ORFA 4OZOA 2D3PA 3ZXDA 1UAIA 2Q8DA 3MIEA 1LGNA 1CZTA 4WM8B 3VBSB 4O9EA 1AYN2 3TEXA 3WDUA 5DQ0A 2ZEYA 1W0OA 1HV1A 1WCSA 3TEYA 3V0AB 1FYUA 5ABJC 1RUF3 3MUZ1 3ZSEA 5A3TA 3LPFA 2ZX0A 4GB32 5KHHA 5C4WA 3A0NA 1YYNA 1VBB2 4IGQA 4RGGA 3POIA 4Y1XA 1WW5A 4DUXA 1UO9A 1OFSA 1QKQA 4A41A 3AL5A 3AVRA 2QDNA 3H42B 4BWOA 4PLOA 4EWDA 1SG3A 4BQ1A 1JTZX 4B4QA 4CUCA 4A42A 4CUAA 2A71A 5L7OA 2W1QA 4E4ZA 2A3YA 5BUVA 1UL9A 3A0KA 1OVPA 3H9AA 3U4SA 1S4CA 4OMDA 3AP4A 2J1TA 5FKCA 4EN9B 4YVSB 5JCTA 3KCXA 3ZLIA 3LE0A 1UMHA 4WZCA 2JB8A 4S2HA 2FDHA 3WXPA 3MF9A 3C3VA 2J22A 4HOOA 1NUKA 2PHRA 3DYMA 3VN4A 5JOZA 1O3SA 1TMF2 3MLJA 1W6QA 1W9FA 5C3SA 1WMDA 1RUD1 2QDRA 3O1RA 2DVFA 4P9JA 5CFDB 1N1YA 4PQ9A 1NQDA 4HKOA 3ZSMA 5LB6A 1ASJ3 3ILFA 4KGQA 3HD8B 4XJ9A 4Q0SA 3GALA 3DYOA 2WO1A 3HJRA 5JWPA 5FAXA 2HKXA 4YM2A 1V6KA 2OZ6A 1H6YA 1OKQA 1A3KA 4WZFA 1X33A 1MACA 1HRI1 1SFYA 1VAKA 4CEYB 1QXJA 1S1AA 2DCKA 3HNMA 1BYHA 3NWKA 4IETA 3PVOA 1SZBA 4Z07A 3THCA 3LAGA 1QOOA 2A3WA 2HJIA 2Q1FA 1H6XA 3RYKA 1ND3C 2AR6A 3S30A 4CCDA 4DUVA 2D43A 4XMIA 1POV1 1Q8PA 2GZWA 3ZXKA 5DABA 4ZS3A 2X5IA 4QM9A 1D7PM 1QH6A 4NHYA 2VECA 1RUI1 1E5IA 1W99A 4ZPIA 5JPNB 1ND2A 3N36A 4G4FA 5A7SA 3R4UA 1UX6A 1F5FA 3IAPA 3RSJA 1EV13 4FPCA 5HCAA 3K46A 2P2KA 4JQRA 5CEHA 3AVSA 2YV8A 5AC92 4K1ZA 4MGYE 1BMV1 4JHTA 3HPNA 1SLCA 3ZFFB 1QJY3 4Z82A 3SXWA 1VB4A 4NR1A 1QOTA 3FHIB 4QHZA 1JZ5A 2MEV1 1NA1C 3MEPA 3OJBA 3NV3A 4XFCA 1G9AA 1H1AA 3ILNA 3VBFA 2WNVC 5CFCC 4CA9A 1J1LA 1RVF1 3OY8B 2XXZA 5GLZA 3HQXA 5FKBA 2VMFA 1COV3 3D8CA 5AC93 4Q4W1 2ARAA 2VW0A 3I3QA 3OG2A 4D7SA 1QJY2 1O91A 1QJEA 4AFBA 5EJ3A 3I49A 4JKLA 3I2KA 1W6NA 1S0DA 3PJYA 4NAMA 4Q4X2 2DTWA 2PHTA 4XBLA
chains in the Genus database with same CATH topology
4P5YA 1GMMA 3WQBA 1PX3A 3OGVA 3GM8A 4TXWA 5C70A 1JYXA 1OF4A 1GOFA 4BJ0A 3GXUA 1UY0A 2Y6HA 2VQTA 4M4PA 3A21A 2C4XA 1XPWA 2YC2A 3MV11 3VD3A 3K77A 4JHZA 3FHAA 2XONA 3T2OA 4MGSA 2VZ3A 1NX9A 5IFPA 3E1F1 5JUVA 3VD7A 1RYYA 1IQDC 3T09A 1TG7A 3C7GA 4QB1A 3T2PA 5IHRA 4A6OA 3IB3A 2ORXA 3ACGA 1JHJA 2VJXA 1NKGA 5DN2A 4LHSA 3EYPA 3UESA 1W9SA 1YQ2A 3DECA 1KGYA 5LCWL 3I2HA 3HN3A 5CZKA 4XUOA 3T0AA 3VDAA 5JXHA 4PT6A 5JR2A 3WNLA 1BHGA 4QB6A 5IYYA 4JKMA 4QX0A 3C7FA 3I3EA 3WSOA 5G05L 4UI9L 2JKXA 3WF3A 2W1SA 4DXRA 4CU6A 4DEVA 4ZY9A 2R7EB 2V5DA 2LS6A 1PX4A 3JXSA 2WUHA 4QX3A 3ZM8A 3A23A 2J1EA 3OEAA 2VZ1A 3NQHA 4MADA 3WNOA 4QAWA 3IDAA 4GZ9A 4W50A 3K75B 1XC6A 3I2FA 1UYZA 3SKJE 3BN6A 3C7HA 2B4KA 3EB7A 1UX7A 1P8JA 3LEKA 2E33A 1CX1A 4DUWA 3WEZA 1K3IA 5JXJA 3GGLA 4ZZ5A 2EIDA 1DP0A 5I0DA 1XNAA 2ZXQA 3NNGA 2W91A 3NJXA 2J1UA 1KEXA 3LPGA 2J1AA 2W3JA 5EJZB 2QQNA 1PMHX 2VOTA 4QDRA 1DLCA 3IAQA 4D0QA 3WF4A 2WO2A 2KD7A 3CZUA 1K45A 1MPXA 5B4XA 1T2XA 4QX2A 5HPOA 1O59A 2QQOA 2VZVA 3PUIA 1LNSA 2J1SA 2E31A 2HYXA 5IJRA 3NRUA 2WBKA 3SEEA 4M4RA 4RN5A 4XUQA 2L9LA 1JZ7A 4LKSA 3D3AA 3I2GA 3HEIA 2E32A 4ET7A 2VZRA 1JZ6A 1TVGA 1EUUA 2WZ8A 4P00B 4E8DA 4LPLA 2EICA 1UY2A 4PQQA 2VZQA 3ACIA 4JKKA 2VZSA 3WF0A 2W1UA 3DYPA 1EUTA 1CZVA 1O8SA 4CU8A 1GU3A 1W9WA 2DDUA 2RV9A 2WZEA 3U37A 2J1RA 4BDVB 3SEPA 3LEGA 1JYNA 3A22A 2DCJA 2QQMA 2WAAA 3HNBM 3C7OA 2VZUA 1W9TA 1CZSA 1J84A 2QQJA 2VC9A 4QPWA 2VO5A 2Y64A 4ZZ8A 1HN1A 4PF1A 1UY3A 2E26A 4XURA 4E8CA 1UYYA 2WQ8A 2Y6LA 4QX1A 3J7HA 2YG0A 4GWJA 3THDA 5LA1A 2QQIA 4QDSA 1UXZA 4MOAA 5FUIA 1F4HA 3I3BA 4DXSA 1PMJX 3IIIA 1I5PA 5JXIA 2W9XA 2VZPA 3A7QA 3I97A 3OBAA 5J1XA 2W94A 1DYOA 3OB8A 3WF2A 3HOBA 2BBAA 5EJ1B 2VZTA 2VZOA 4L0PA 3GDBA 3CMGA 4CU7A 2ORZA 4P08A 4JX0A 4A44A 5A1AA 3CIHA 1UWWA 2W1WA 1US2A 2WO3A 2Z4FA 4TTGA 2VTFA 1XNTA 1UXXX 2X09A 4KMQA 3CZJA 3BGAA 3ETPA 3T0BA 1ULPA 4A45A 5IFTA 1R64A 3WF1A 3WNMA 2B9VA 4Z2AA 1WKYA 2YC4A 2X10A 5F7UA 2RVAA 2CDOA 2ZEXA 4ARYA 2LW8A 2WDBA 2W95A 3VD4A 4XUNA 2C26A 5DMYA 3PUHA 3W5MA 3P1IA 3FHQA 2Y6KA 1OF3A 2VMDA 3I3DA 3OGRA 1JU3A 2BGOA 2BZDA 5C71A 1UY4A 4QB2A 3ABZA 4AG4A 1JZ2A 2WYSA 4KI5M 2JE8A 2OKXA 4OYUA 3WNPA 3AC0A 1GOHA 4MO3M 4BK4A 4KWUA 3MV01 1K42A 4YPJA 2EIBA 5CYYA 2QQLA 4A3ZA 3VD9A 3VDCA 4OUEA 2VR4A 2J1VA 4XUPA 4CUBA 3P6BA 2Y8KA 5LA2A 4BK5A 2CDPA 2VL4A 1WCQA 2VMCA 1JZ3A 3ECQA 2W46A 1K12A 3CQOA 2W5FA 2XOMA 3T08A 2WN3A 3UETA 4CVUA 3FL7A 2YB7A 3CDZB 1US3A 2W47A 4W8JA 2YFZA 3MUY1 4XUTA 1SDDB 1JU4A 1W0NA 2QBXA 2W92A 3LQCA 2WAOA 2PQSA 3F2ZA 4OZOA 3I2JA 3HNYM 2V4VA 4ZXEA 2ID4A 1CZTA 5DQ0A 2ZEYA 2BGPA 3MO4A 3MUZ1 3LPFA 4MGQA 2X05A 4RYDA 1UY1A 2VQUA 2WN2A 1O8PA 4DUXA 1NAEA 3VDBA 3OGSA 4FI9A 4A41A 1ULOA 4IUGA 2VM9A 1SG3A 4CUCA 4A42A 4CUAA 2W1QA 2J7MA 1GUIA 4UAPA 2C9KA 3LEIA 5C7GA 1UYXA 2HLEA 3C8XA 3WNNA 2VCCA 1W8NA 4OMDA 2WABA 1GNYA 2J1TA 4DXTA 3LE0A 1UMHA 1OD3A 4XVHA 2J22A 1GQPA 1NUKA 3DYMA 3K4ZA 2VCBA 4QDQA 4W4ZA 2ZEWA 4UOJA 2Y6JA 2VMEA 4DEQA 3K4DA 1JZ8A 2XHNA 1F4AA 3T2QA 2V72A 4XZUG 4AAXA 3DYOA 2WO1A 3HJRA 3CKHA 2QQKA 1JYWA 1H6YA 4D8MA 5LA0A 4ARXA 3VD5A 2W87A 2DCKA 3HNMA 1SHWB 3WNKA 1UZ0A 3FN9A 1CIYA 3THCA 3OEBA 3ACFA 1H6XA 4DUVA 3ACHA 2RJ2A 1D7PM 2Y6GA 1W99A 2JD9A 3K4AA 3MBWA 5JMOA 4LQRA 3I2IA 1JZ4A 1OT5A 3T0DA 1J83A 3IAPA 5G04L 1JI6A 3K46A 2YFUA 4GWIA 4BXSV 4P02B 1L7QA 3HPNA 1W8OA 3C7EA 5DPNA 2XQXA 1JZ5A 2ZEZA 1JYVA 2BERA 1L7RA 1GOGA 2EIEA 1UMIA 4CU9A 3NJVA 2VMFA 4HG6B 2JDAA 1OH4A 4A4AA 5B4NA 3OG2A 4OMCA 3UNPA 5EIYB 4JKLA 3I2KA 3SKVA 3W5NA 2VCAA 5HXMA 5JXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5Y A;  1GMM A;  3WQB A;  1PX3 A;  3OGV A;  3GM8 A;  4TXW A;  5C70 A;  1JYX A;  1OF4 A;  1GOF A;  4BJ0 A;  3GXU A;  1UY0 A;  2Y6H A;  2VQT A;  4M4P A;  3A21 A;  2C4X A;  1XPW A;  2YC2 A;  3MV1 1;  3VD3 A;  3K77 A;  4JHZ A;  3FHA A;  2XON A;  3T2O A;  4MGS A;  2VZ3 A;  1NX9 A;  5IFP A;  3E1F 1;  5JUV A;  3VD7 A;  1RYY A;  1IQD C;  3T09 A;  1TG7 A;  3C7G A;  4QB1 A;  3T2P A;  5IHR A;  4A6O A;  3IB3 A;  2ORX A;  3ACG A;  1JHJ A;  2VJX A;  1NKG A;  5DN2 A;  4LHS A;  3EYP A;  3UES A;  1W9S A;  1YQ2 A;  3DEC A;  1KGY A;  5LCW L;  3I2H A;  3HN3 A;  5CZK A;  4XUO A;  3T0A A;  3VDA A;  5JXH A;  4PT6 A;  5JR2 A;  3WNL A;  1BHG A;  4QB6 A;  5IYY A;  4JKM A;  4QX0 A;  3C7F A;  3I3E A;  3WSO A;  5G05 L;  4UI9 L;  2JKX A;  3WF3 A;  2W1S A;  4DXR A;  4CU6 A;  4DEV A;  4ZY9 A;  2R7E B;  2V5D A;  2LS6 A;  1PX4 A;  3JXS A;  2WUH A;  4QX3 A;  3ZM8 A;  3A23 A;  2J1E A;  3OEA A;  2VZ1 A;  3NQH A;  4MAD A;  3WNO A;  4QAW A;  3IDA A;  4GZ9 A;  4W50 A;  3K75 B;  1XC6 A;  3I2F A;  1UYZ A;  3SKJ E;  3BN6 A;  3C7H A;  2B4K A;  3EB7 A;  1UX7 A;  1P8J A;  3LEK A;  2E33 A;  1CX1 A;  4DUW A;  3WEZ A;  1K3I A;  5JXJ A;  3GGL A;  4ZZ5 A;  2EID A;  1DP0 A;  5I0D A;  1XNA A;  2ZXQ A;  3NNG A;  2W91 A;  3NJX A;  2J1U A;  1KEX A;  3LPG A;  2J1A A;  2W3J A;  5EJZ B;  2QQN A;  1PMH X;  2VOT A;  4QDR A;  1DLC A;  3IAQ A;  4D0Q A;  3WF4 A;  2WO2 A;  2KD7 A;  3CZU A;  1K45 A;  1MPX A;  5B4X A;  1T2X A;  4QX2 A;  5HPO A;  1O59 A;  2QQO A;  2VZV A;  3PUI A;  1LNS A;  2J1S A;  2E31 A;  2HYX A;  5IJR A;  3NRU A;  2WBK A;  3SEE A;  4M4R A;  4RN5 A;  4XUQ A;  2L9L A;  1JZ7 A;  4LKS A;  3D3A A;  3I2G A;  3HEI A;  2E32 A;  4ET7 A;  2VZR A;  1JZ6 A;  1TVG A;  1EUU A;  2WZ8 A;  4P00 B;  4E8D A;  4LPL A;  2EIC A;  1UY2 A;  4PQQ A;  2VZQ A;  3ACI A;  4JKK A;  2VZS A;  3WF0 A;  2W1U A;  3DYP A;  1EUT A;  1CZV A;  1O8S A;  4CU8 A;  1GU3 A;  1W9W A;  2DDU A;  2RV9 A;  2WZE A;  3U37 A;  2J1R A;  4BDV B;  3SEP A;  3LEG A;  1JYN A;  3A22 A;  2DCJ A;  2QQM A;  2WAA A;  3HNB M;  3C7O A;  2VZU A;  1W9T A;  1CZS A;  1J84 A;  2QQJ A;  2VC9 A;  4QPW A;  2VO5 A;  2Y64 A;  4ZZ8 A;  1HN1 A;  4PF1 A;  1UY3 A;  2E26 A;  4XUR A;  4E8C A;  1UYY A;  2WQ8 A;  2Y6L A;  4QX1 A;  3J7H A;  2YG0 A;  4GWJ A;  3THD A;  5LA1 A;  2QQI A;  4QDS A;  1UXZ A;  4MOA A;  5FUI A;  1F4H A;  3I3B A;  4DXS A;  1PMJ X;  3III A;  1I5P A;  5JXI A;  2W9X A;  2VZP A;  3A7Q A;  3I97 A;  3OBA A;  5J1X A;  2W94 A;  1DYO A;  3OB8 A;  3WF2 A;  3HOB A;  2BBA A;  5EJ1 B;  2VZT A;  2VZO A;  4L0P A;  3GDB A;  3CMG A;  4CU7 A;  2ORZ A;  4P08 A;  4JX0 A;  4A44 A;  5A1A A;  3CIH A;  1UWW A;  2W1W A;  1US2 A;  2WO3 A;  2Z4F A;  4TTG A;  2VTF A;  1XNT A;  1UXX X;  2X09 A;  4KMQ A;  3CZJ A;  3BGA A;  3ETP A;  3T0B A;  1ULP A;  4A45 A;  5IFT A;  1R64 A;  3WF1 A;  3WNM A;  2B9V A;  4Z2A A;  1WKY A;  2YC4 A;  2X10 A;  5F7U A;  2RVA A;  2CDO A;  2ZEX A;  4ARY A;  2LW8 A;  2WDB A;  2W95 A;  3VD4 A;  4XUN A;  2C26 A;  5DMY A;  3PUH A;  3W5M A;  3P1I A;  3FHQ A;  2Y6K A;  1OF3 A;  2VMD A;  3I3D A;  3OGR A;  1JU3 A;  2BGO A;  2BZD A;  5C71 A;  1UY4 A;  4QB2 A;  3ABZ A;  4AG4 A;  1JZ2 A;  2WYS A;  4KI5 M;  2JE8 A;  2OKX A;  4OYU A;  3WNP A;  3AC0 A;  1GOH A;  4MO3 M;  4BK4 A;  4KWU A;  3MV0 1;  1K42 A;  4YPJ A;  2EIB A;  5CYY A;  2QQL A;  4A3Z A;  3VD9 A;  3VDC A;  4OUE A;  2VR4 A;  2J1V A;  4XUP A;  4CUB A;  3P6B A;  2Y8K A;  5LA2 A;  4BK5 A;  2CDP A;  2VL4 A;  1WCQ A;  2VMC A;  1JZ3 A;  3ECQ A;  2W46 A;  1K12 A;  3CQO A;  2W5F A;  2XOM A;  3T08 A;  2WN3 A;  3UET A;  4CVU A;  3FL7 A;  2YB7 A;  3CDZ B;  1US3 A;  2W47 A;  4W8J A;  2YFZ A;  3MUY 1;  4XUT A;  1SDD B;  1JU4 A;  1W0N A;  2QBX A;  2W92 A;  3LQC A;  2WAO A;  2PQS A;  3F2Z A;  4OZO A;  3I2J A;  3HNY M;  2V4V A;  4ZXE A;  2ID4 A;  1CZT A;  5DQ0 A;  2ZEY A;  2BGP A;  3MO4 A;  3MUZ 1;  3LPF A;  4MGQ A;  2X05 A;  4RYD A;  1UY1 A;  2VQU A;  2WN2 A;  1O8P A;  4DUX A;  1NAE A;  3VDB A;  3OGS A;  4FI9 A;  4A41 A;  1ULO A;  4IUG A;  2VM9 A;  1SG3 A;  4CUC A;  4A42 A;  4CUA A;  2W1Q A;  2J7M A;  1GUI A;  4UAP A;  2C9K A;  3LEI A;  5C7G A;  1UYX A;  2HLE A;  3C8X A;  3WNN A;  2VCC A;  1W8N A;  4OMD A;  2WAB A;  1GNY A;  2J1T A;  4DXT A;  3LE0 A;  1UMH A;  1OD3 A;  4XVH A;  2J22 A;  1GQP A;  1NUK A;  3DYM A;  3K4Z A;  2VCB A;  4QDQ A;  4W4Z A;  2ZEW A;  4UOJ A;  2Y6J A;  2VME A;  4DEQ A;  3K4D A;  1JZ8 A;  2XHN A;  1F4A A;  3T2Q A;  2V72 A;  4XZU G;  4AAX A;  3DYO A;  2WO1 A;  3HJR A;  3CKH A;  2QQK A;  1JYW A;  1H6Y A;  4D8M A;  5LA0 A;  4ARX A;  3VD5 A;  2W87 A;  2DCK A;  3HNM A;  1SHW B;  3WNK A;  1UZ0 A;  3FN9 A;  1CIY A;  3THC A;  3OEB A;  3ACF A;  1H6X A;  4DUV A;  3ACH A;  2RJ2 A;  1D7P M;  2Y6G A;  1W99 A;  2JD9 A;  3K4A A;  3MBW A;  5JMO A;  4LQR A;  3I2I A;  1JZ4 A;  1OT5 A;  3T0D A;  1J83 A;  3IAP A;  5G04 L;  1JI6 A;  3K46 A;  2YFU A;  4GWI A;  4BXS V;  4P02 B;  1L7Q A;  3HPN A;  1W8O A;  3C7E A;  5DPN A;  2XQX A;  1JZ5 A;  2ZEZ A;  1JYV A;  2BER A;  1L7R A;  1GOG A;  2EIE A;  1UMI A;  4CU9 A;  3NJV A;  2VMF A;  4HG6 B;  2JDA A;  1OH4 A;  4A4A A;  5B4N A;  3OG2 A;  4OMC A;  3UNP A;  5EIY B;  4JKL A;  3I2K A;  3SKV A;  3W5N A;  2VCA A;  5HXM A;  5JXG A; 
#chains in the Genus database with same CATH topology
 3LA3 A;  2PLV 3;  2B7Y A;  2SLI A;  5DDJ 1;  1FV2 A;  5CB7 A;  3V65 A;  4AED A;  5BYN A;  1POV 0;  3ZO0 B;  1X50 A;  2CSG A;  4R8H A;  4TXW A;  5JI9 A;  5M0T A;  3PJQ A;  3PU3 A;  1S2K A;  1V70 A;  1YJL A;  2OVU A;  3FWE A;  3GBG A;  4XJW A;  1VAV A;  3IBM A;  4RQP C;  1RUH 3;  1JYX A;  1OF4 A;  1GOF A;  5LAS A;  4BZ4 A;  4CDW C;  1Z78 A;  1V6N A;  5BNP A;  1OMI A;  1ZRF A;  4GMP 3;  4Q4X 3;  1KFX L;  2K0G A;  4O61 A;  3J7N A;  4IV1 A;  3N35 A;  2YC2 A;  4S2G A;  4YYO A;  3X29 B;  3RZH A;  3FUQ A;  5CU1 A;  1HRV 2;  3VD3 A;  4JHZ A;  4P9L A;  2YBK A;  3VHR A;  2VZ3 A;  4J25 A;  5IFP A;  3VD7 A;  4AGV A;  1IQD C;  1HW5 A;  4UFM A;  5IK7 A;  4MHU A;  3H8X A;  4NWV A;  3Q8A A;  4AHY A;  4LBM A;  3J7M A;  2LRO A;  2FMD A;  1G9D A;  2VXR A;  1S55 A;  4BIO A;  3N9P A;  3AMP A;  1XE8 A;  3LIG A;  1QNY A;  1RUG 1;  5F9T A;  3DXT A;  1PZ7 A;  1Y9M A;  4NPM A;  1RUD 2;  2YHJ A;  5CFD A;  4YZ2 A;  4ZON A;  1W9S A;  3DEC A;  5FZB A;  1KGY A;  4HSJ A;  3O1O A;  4IER A;  4KU7 A;  4UW5 A;  2ZZJ A;  5GJ6 A;  4AF9 A;  1AL2 3;  4XUO A;  5FY8 A;  3T0A A;  3VDA A;  1UPS A;  5JXH A;  4PT6 A;  3WDV A;  1WGP A;  5JR2 A;  2VPV A;  3AKS A;  1PO1 2;  4QX0 A;  3WSO A;  5IK4 A;  1W2N A;  3WF3 A;  5E88 A;  1W2A X;  4DXR A;  3WDX A;  2VOV A;  4CU6 A;  2ZGN A;  4GA9 A;  1MQT C;  1C57 A;  1VBA 1;  2B45 X;  2DWR A;  3LIH A;  4XJU A;  4YG3 A;  2P3K A;  4BMB A;  4IQP A;  1H8T C;  1AJK A;  1PX4 A;  2LS6 A;  3AYA A;  2Q8C A;  3PTY A;  4QKF A;  4HSL A;  1UMZ A;  4QX3 A;  2BVB A;  3HT2 A;  2CY6 A;  3EXU A;  4HKL A;  2JG9 B;  1JOP A;  2DBN A;  3QD6 A;  1W2U A;  3CBN A;  4QPG A;  3MLK A;  4B4R A;  1C5I A;  3AYE A;  4TLF A;  1NLR A;  4NRP A;  4N53 B;  3ALQ A;  4GB3 1;  4Y5Z 0;  1RUO A;  3GCX A;  5B2G B;  3BPS A;  4HZF A;  1NXD 1;  1JBC A;  1JYC A;  3BB6 A;  4Y4R A;  5FZE A;  4GZ9 A;  2CL2 A;  2HEW F;  1YFU A;  1FMD 3;  1B35 C;  3U11 A;  4F8A A;  3WP6 A;  3OYW B;  1SCS A;  2B4K A;  1P8J A;  1ZRR A;  1J3Q A;  5AVP A;  3KF3 A;  4NN0 A;  2UYA A;  4MVT A;  1O3T A;  4QX8 A;  2E33 A;  1V0A A;  1D4M 2;  1IQA A;  1CN1 A;  1JUI A;  2VQ0 A;  5FMC A;  4IND A;  1W8Z A;  4F83 A;  4KG8 A;  2F17 A;  5JXJ A;  5H9R A;  1MS3 A;  1FMD 2;  1X36 A;  2JX9 A;  4OHW A;  3S5A A;  1LOA A;  1W03 A;  1UNB A;  1XNA A;  2BNM A;  4LK6 A;  3MW4 A;  3G6J B;  4XTP A;  2J1U A;  4IEW A;  3WUC A;  2DFB A;  5HCH A;  3J7L A;  3TYJ A;  3CJX A;  2A73 B;  3LPG A;  1RIN A;  3POF A;  4COV A;  2W3J A;  5CVR A;  1S0E A;  3AZW A;  3OPZ A;  3GCW A;  3PU8 A;  1PMH X;  2QNK A;  4V2V A;  5HCF A;  5FY4 A;  1C28 A;  3VBO C;  5GAL A;  4QDR A;  4QXB A;  5FO8 B;  4AQS A;  5F3I A;  4D0Q A;  3I8T A;  3WF4 A;  5A3W A;  4YW7 A;  1RGS A;  2C0Z A;  5HXV A;  4IEO A;  4GJY A;  5A33 B;  3VDD B;  5B4X A;  1UU6 A;  3H1W A;  3KCC A;  3OCP A;  1T2X A;  2WO7 A;  3H3Z A;  3V0B A;  4LIV A;  5C3R A;  1D2Q A;  5AVA A;  4KG0 A;  4R52 A;  2RS3 2;  3E5Q A;  2J1S A;  2PN5 A;  2E31 A;  5J7M A;  4XF4 A;  1RXF A;  3LOB A;  1UZZ A;  3KV6 A;  5FPX A;  3NRU A;  4PDW A;  2WBK A;  3SEE A;  5FPB A;  4QQH A;  1GFF 2;  4QWN A;  2BNN A;  2L9L A;  3QH7 A;  1DGW A;  2XL7 A;  3ZYG A;  1JZ7 A;  2VUA A;  2FZ2 A;  1SLT A;  2WYF A;  2R1D A;  4IV3 B;  2A7A A;  4Y1Y A;  4QQ2 A;  2GC1 A;  1W0P A;  1H4H A;  2F4L A;  3HQU A;  3D3A A;  2ZAH A;  3DGT A;  3HEI A;  3I2G A;  4QGL A;  3UJO A;  2NMN A;  4QGM A;  2VZR A;  4UFH A;  5F2S A;  1AR9 1;  1JZ6 A;  3OBZ A;  5IVE A;  1UD1 A;  1YFY A;  4P00 B;  3USU B;  5BNO C;  3OD4 A;  1OKO A;  2VAU A;  1UY2 A;  3I2O A;  1POV 3;  1BEV 3;  4IV3 A;  2IVI B;  1YLL A;  5EXO A;  4KWJ A;  1FPN 2;  3DYP A;  3LFI A;  3ZDS A;  4MET A;  4E2S A;  4BIS A;  4I02 A;  1CX4 A;  1W9W A;  1EPW A;  2EXK A;  3E6D A;  4AW7 A;  4EN0 A;  2IFR A;  1WD4 A;  2RV9 A;  2WZE A;  4I0B A;  4RHV 2;  1QQP 2;  1ENR A;  2ZHL A;  4UF0 B;  3TN9 1;  4FFG A;  2QJV A;  1B35 A;  3HVD A;  3SEP A;  4BQ4 A;  4EWA A;  1AHS A;  3UGF A;  1BEV 2;  4XFA A;  2WS9 1;  3DV8 A;  3HNB M;  2A6V A;  3JBG 3;  4QU2 A;  2OW4 A;  4D3W A;  2WT1 A;  4QPW A;  5FZ6 A;  3SCG A;  4ZZ8 A;  5FMB A;  1BEV 1;  2XJP A;  3O1P A;  4AI2 A;  2AH2 A;  4XUR A;  1JYI A;  4CCM A;  4E8C A;  2XG3 A;  4QX1 A;  3J7H A;  3MW3 A;  4YSF A;  5LA1 A;  5H9Q A;  4RR3 C;  2QQI A;  2R32 A;  3AKR A;  3N9Q A;  2V4A A;  3F95 A;  3POW A;  5GKA C;  4EZ4 A;  4IW3 A;  2I07 B;  5FWE A;  1OQD A;  4YGE A;  3I3B A;  2RG4 A;  1H30 A;  5JXI A;  1ZA7 A;  2G9F A;  4PF5 A;  3M4F A;  1W6P B;  1WUV A;  5IVY A;  1OBN A;  3IDC B;  5C3P A;  4FTE A;  3OTF A;  5A7W A;  5JSO A;  4JRA A;  2GU9 A;  2Z42 A;  3KVB A;  3ZKY A;  4DY3 A;  3HOB A;  4YVW B;  3O0W A;  5FP7 A;  1R1A 3;  2Y60 A;  3CEW A;  4AHZ A;  4NUB A;  3OGJ A;  5BNN B;  1NCR C;  5FZ3 A;  2ORZ A;  3EHK A;  4AGG A;  1KQR A;  2RS5 1;  3WDY A;  4JX0 A;  3D4K A;  1H4G A;  1QNW A;  4DFS A;  2CWS A;  3CIH A;  3RVH A;  2CV6 A;  4CEW B;  2I2S A;  2W1W A;  2V73 A;  2R0H A;  2WO3 A;  2G4I A;  2Z4F A;  2ZGP A;  3L9J T;  4FP2 A;  5LWB A;  1XNT A;  1UXX X;  2AAC A;  2JEM A;  1SLL A;  3PDQ A;  3CZJ A;  3GJB A;  4MHR A;  5FOB B;  4CDX C;  3VHP A;  2PAM A;  1DQ0 A;  1GZW A;  4MXW B;  4WM7 C;  1QJU 1;  2VUC A;  2QQV A;  3NJZ A;  1H8T B;  1GQH A;  1OHF A;  2C5D A;  1MVQ A;  5TSW A;  3ZFF A;  2WZR 3;  2ZAB A;  4RQP A;  3WF1 A;  4JGZ A;  1WLW A;  3MIC A;  3B5L B;  1WKY A;  3NNJ A;  4MSV A;  5A3M A;  1QJX 3;  4W6X A;  4LTA A;  3UYJ A;  1FNZ A;  2CDO A;  4GAZ A;  4FPL A;  1EP0 A;  3RWK X;  3RG0 A;  3ENR A;  2ERF A;  4L11 A;  5A6Q A;  1DQ1 A;  4OVE A;  1YIF A;  2C26 A;  4O9G A;  1D4M 1;  4RA0 A;  3H0O A;  1MR5 A;  3W5M A;  3VDD A;  1QWR A;  1ND2 C;  1ASJ 1;  4PLM A;  1CR7 A;  4C8D A;  4Q4V 2;  1AX1 A;  2XHK A;  4Y1V A;  1K5J A;  4M01 A;  3J9S A;  1JU3 A;  1NCQ B;  3AXD A;  4X8N A;  5CIR A;  3HN1 A;  2BGO A;  1JMU B;  2BZD A;  2VY0 A;  4MGI E;  4ISR A;  4UBG A;  5FZL A;  1C1L A;  1HIX A;  2XJT A;  5FP3 A;  2D3S A;  3VZL A;  3AJZ A;  1J58 A;  1F35 A;  2OKX A;  2RR1 3;  3S7I A;  1CAW B;  4IE5 A;  3POB A;  1NZI A;  3SC7 X;  4DPN A;  1FMD 1;  3FMG A;  3AC0 A;  5IK8 A;  3AL6 A;  4AL9 A;  2DBI A;  4EN8 B;  2ZHK A;  3RDI A;  2CAU A;  3JQX A;  4KWU A;  2ZGR A;  3B02 A;  3IWZ A;  4XJA A;  4CP2 A;  2JIJ A;  2ZX4 A;  3RMY A;  2DYC A;  2ADE A;  4A3Z A;  5C9A B;  5J09 A;  1JH5 A;  3AZV A;  3R05 A;  1DZR A;  3INA A;  3NST A;  1VE0 A;  3GBF A;  3VDC A;  5ACA 2;  4ES8 A;  4LHN A;  2J1V A;  2BQP A;  3NKG A;  1RVF 2;  4FOV A;  5DG2 A;  2FDI A;  2EAL A;  2WNU A;  4JTO A;  2JB4 A;  2CDP A;  5EYX A;  4WVV A;  1DF0 A;  1LOG A;  2F6B A;  4JDN A;  3EMR A;  4CCC A;  4BQY A;  2VMC A;  1OFN A;  2BWC A;  4HN0 A;  2CU5 A;  1JZ3 A;  4QHO A;  3ZYR A;  1K12 A;  3R4S A;  5IAV A;  2PEL A;  1AR8 2;  4BXF A;  1G7Y A;  2JDP A;  1RVF 3;  2YBS A;  1Q5O A;  2WN3 A;  1R09 3;  3K3O A;  3FL7 A;  4HVR A;  1SPP B;  5T54 A;  5K8S A;  3CDZ B;  2D93 A;  4XF0 A;  1V9U 1;  1LOF C;  4CPB A;  1SLI A;  4ES9 A;  1WA6 X;  5DXD A;  3MUY 1;  4XDO A;  1TME 1;  2QBX A;  4E9K A;  1VP6 A;  4PIX A;  1JHN A;  1TNR A;  1W90 A;  2VTX A;  2VUL A;  1LEM A;  4M3C F;  4BLI A;  4LKE A;  5FYV A;  1NE4 A;  2XUE A;  3JU9 A;  4Y24 A;  1LGC A;  1R09 2;  3O1S A;  1S0I A;  1PO2 3;  1S0C A;  4QPI B;  4YGD A;  2R49 A;  3POJ A;  4QX7 A;  2PA7 A;  2YDE A;  4HLT A;  1HRI 2;  2V4V A;  5FCC A;  2EF6 A;  2VOW A;  2ID4 A;  3LD8 A;  4JDM A;  3ZN4 A;  4Y22 A;  2B42 B;  3LDK A;  5DAQ A;  4BOW A;  2D44 A;  2RHP A;  5LZ6 A;  3E6C C;  1FOD 3;  2PQQ A;  3V0A A;  2X05 A;  3ZPO A;  1NY7 1;  1RXG A;  3M3O A;  4DRV A;  3M3E A;  2GSY A;  1UY1 A;  2GME A;  3KS7 A;  3VKF C;  2WN2 A;  5DZF A;  4YZ3 A;  1O8P A;  1NAE A;  2IXJ A;  5KXB A;  1TME 2;  3IT8 A;  4PI2 A;  3OGS A;  2JDK A;  4XQD A;  5K0U A;  4FI9 A;  4Q4Y 2;  1HRV 1;  1O5U A;  1HQW A;  1R1Z A;  2VM9 A;  3GNE A;  3PIG A;  2LUW A;  4IUG A;  3ZXJ A;  5ABJ A;  1IOA A;  1UF2 C;  1F5J A;  3ZYP A;  3H7Y A;  3MID A;  2HWC 3;  1VIW B;  2Z69 A;  3NAP B;  3LA7 A;  4AE2 A;  5FWJ A;  4W6Y A;  1XOY A;  2ARX A;  2C9K A;  4FXG B;  4JDO A;  5C7G A;  2EA7 A;  4AEJ A;  3CU7 A;  2WAB A;  1LED A;  1XYN A;  5D8A B;  3NNM A;  5FBZ A;  5FK7 A;  1R08 2;  4FFF A;  3WOG A;  4BA6 A;  3N9L A;  1V6J A;  1OD3 A;  2WLP A;  2XVK A;  1JUH A;  3AZZ A;  3RPQ A;  4AVT A;  2PMW B;  2ZGT A;  4XVH A;  4ERO A;  4G9S B;  2YBP A;  4W4Z A;  2HWC 2;  3OUI A;  3M2M A;  4AI8 A;  1GQG A;  5FPA A;  2VH9 A;  3H7J A;  3WW1 A;  1DCS A;  2WNV A;  4YW5 A;  2B8M A;  2VME A;  1TMF 1;  4I01 A;  4DEQ A;  1PNF A;  1XE7 A;  2ZGQ A;  3K4D A;  5BNN C;  2ZX1 A;  1O4T A;  2XHN A;  4OI1 A;  1RJ7 A;  5FLJ A;  1F4A A;  1H2K A;  2ZOE B;  1XQN A;  4LUK A;  2V09 A;  1S0B A;  5FZC A;  4Q4X 1;  3LDR A;  3DL3 A;  1PIV 2;  1JYW A;  5LAT A;  2Y0O A;  1Y7B A;  3MW2 A;  5LK5 A;  4W65 A;  3DPR B;  4CXX A;  3VD5 A;  2W87 A;  4ZHN A;  1WLD A;  1OQE A;  2QQW A;  1IG3 A;  2BWA A;  3B01 A;  3NV1 A;  5KR7 A;  3OEB A;  3ACF A;  3PIJ A;  4FOW A;  1AR8 1;  1OLM A;  3B7M A;  5LK7 B;  1AYM 1;  4I09 A;  2JG9 C;  4HK8 A;  4I0A A;  2HWC 1;  5BNO A;  4UFL A;  3U78 A;  3TEW A;  4Q1P A;  3Q8C A;  2V5Y A;  3MBW A;  5FZ7 A;  2A3X A;  3ZXE A;  1NA1 A;  5LRS A;  3MYX A;  4ISQ A;  2D5H A;  4LQR A;  5ANN A;  1JZ4 A;  1UIJ A;  1ND2 B;  3O5S A;  3T0D A;  3UKT A;  4LOR A;  5G04 L;  1OSG A;  5F32 A;  4EN7 B;  1JW6 A;  4BXS V;  4FO9 A;  4P02 B;  1ALY A;  5FY0 A;  4LO8 A;  1XRU A;  1VAL A;  4CEW A;  1I1E A;  4NPR A;  2XLA A;  4PDW C;  3AKP A;  1W8O A;  1G8W A;  5DPN A;  1PGS A;  1ULD A;  3LSE A;  1O4Z A;  1RUF 2;  1TMF 3;  2X8K A;  4CRQ A;  1LCL A;  2BER A;  5I8Y A;  1GOG A;  5FMO S;  1X7N A;  5I0U A;  3VKO A;  4AVC A;  4CU9 A;  3NJV A;  3Q8B A;  1NCR B;  5IVC A;  3SCF A;  1W6M B;  2R06 3;  4LBN A;  4V1P A;  1OOP C;  1RUI 3;  4FQZ A;  4XPV A;  3WQ0 A;  3ZYF A;  5B4N A;  1IZ3 A;  3UNP A;  4Y5T A;  5LEJ A;  1M4W A;  3RRD A;  1UYP A;  4W6W A;  1STM A;  4UW3 A;  4CDW A;  3MFA A;  5FK8 A;  2LRP A;  1WZX A;  3IDE A;  3BTX A;  1DLL A;  2RMU 2;  2VCA A;  1D2S A;  2P3I A;  1URX A;  4CP0 A;  3ST7 A;  4XBN A;  5FY9 A;  1XND A;  5IW0 A;  3CL1 A;  4IEP A;  5ABJ B;  3BTY A;  2R06 2;  1RUI 2;  3OGV A;  4UWD A;  1AR6 1;  5FOJ B;  1HX6 A;  3WR0 A;  1QJX 1;  1DU3 D;  2B46 X;  1AYM 2;  3UK9 A;  1VR3 A;  1ZYB A;  5FZF A;  1H2L A;  5IAT A;  4JTN A;  4NVP A;  4H7L A;  2ZGS A;  1MS8 A;  4NII A;  1MVE A;  1QJY 1;  5FZK A;  1W6O B;  2ARE A;  2C4X A;  3A21 A;  1QDC A;  3BPZ A;  3URF A;  2RM2 3;  1W04 A;  3JBG 1;  3APB A;  4SBV A;  2VNO A;  2RS1 2;  3NNF A;  2B39 A;  1JYT A;  3T09 A;  2WKK A;  1TG7 A;  3C7G A;  4RGA A;  3T2P A;  4AFC A;  3J8F 1;  5T5J A;  2OUJ A;  3IB3 A;  2XR4 A;  2ORX A;  1REF A;  5L73 A;  2VMI A;  5E89 A;  5DZG A;  2P6H A;  5BNO B;  5FO9 B;  5H9P A;  1L3J A;  1MS9 A;  2WNV B;  2XVL A;  3EYP A;  3UES A;  1GSL A;  2ILM A;  5FZ0 A;  3I54 A;  1ZVF A;  1YO8 A;  3O14 A;  4HT1 T;  1GR3 A;  1H8T A;  2XJR A;  1N3O A;  1RUE 1;  5CZK A;  5A33 A;  3PUA A;  3ON7 A;  2YU1 A;  4YW2 A;  3T3Y A;  4DQA A;  1PZ9 A;  3H50 A;  5C4W C;  3B00 A;  2WFF 3;  2BBV A;  5IYY A;  1BK0 A;  2W39 A;  3MIG A;  3BI3 A;  4FTS A;  3WQ7 A;  4UI9 L;  1OI6 A;  1XYP A;  2IWG B;  2W1S A;  4UW6 A;  2BOJ A;  3LGR A;  4OUL A;  4I3P A;  2R7E B;  4GXL A;  4LOT A;  3ZXF A;  3ZN6 A;  3VZO A;  4OI2 A;  1SMV A;  3VDD C;  2WFF 2;  2J42 A;  1SFN A;  4A7Z A;  5C8C B;  1WA4 A;  4MAD A;  3OPW A;  3N9M A;  2QE3 A;  3V64 A;  2XB6 C;  5HV0 A;  4IEZ A;  1CVN A;  1GNZ A;  1AF9 A;  4XE9 A;  4BQX A;  1A8D A;  3IDA A;  2JXA A;  3AK0 A;  4KGG A;  2R30 A;  4NRM A;  3E5U A;  3WG2 A;  2Y6F A;  1KD7 A;  3JZV A;  4YLZ A;  5BV6 A;  3IMN A;  2XKP A;  3BYW A;  3K51 A;  1ENQ A;  3SKJ E;  1SLA A;  3NNL A;  3AX4 A;  3C7H A;  3CO2 A;  4JGZ C;  3EB7 A;  1UX7 A;  5FZO B;  1Z7S 2;  5BXX A;  3N3H A;  1PK6 B;  2D6L X;  2MHF A;  4FPY A;  4N43 A;  1M06 G;  3WEZ A;  3ZYH A;  4PI0 A;  4EN6 B;  3GGL A;  3KHB A;  5FUP A;  5A80 A;  3RNS A;  4QQO A;  1RMU 1;  1D0H A;  1NCQ A;  3LCP A;  3GZA A;  3VLB B;  2H0B A;  2ZXQ A;  3NNG A;  5HBA A;  3NJX A;  4QPI C;  3IM0 A;  1KEX A;  1GZW B;  4MXW A;  4QPY A;  4CUG A;  5ISL A;  1HRV 3;  4XXP A;  5CBL A;  5EJZ B;  1Y3T A;  4CCJ A;  5I8T A;  5C8C C;  1VBB 1;  3ZN5 A;  4YGB A;  3WG3 A;  4HN1 A;  1W8F A;  1N1T A;  1J59 A;  2BP6 A;  5FP9 A;  5T3N A;  2VXJ A;  4PIY A;  1X8E A;  1SBD A;  2XJQ A;  3KT1 A;  3IIA A;  1MPX A;  2OYZ A;  2HWE 2;  1CAU A;  4PBO A;  4QPG B;  5FPV A;  1RMU 3;  4QX2 A;  1E5S A;  3OOX A;  5HPO A;  1RUD 3;  3V0B B;  2WZP P;  5BNQ A;  2VTX J;  2ET7 A;  4KBB A;  2HYX A;  4ZU4 A;  5A3P A;  4RR3 A;  3AMN A;  1VBC 2;  3FZ3 A;  2YGL A;  3TWI A;  5F1R A;  4RN5 A;  2HH9 A;  1E5H A;  4GH4 A;  2QCS B;  1NE6 A;  3N7M A;  2A6Y A;  5I8S A;  4C1X A;  4K8F A;  5FZ8 A;  2IFW A;  4GAL A;  4BU2 A;  5LBE A;  1XYO A;  2HYK A;  1XSR A;  1VBC 1;  1WWY A;  4WM7 A;  5E16 A;  1OOP A;  1VBE 2;  1CJD A;  3RYP A;  1TVG A;  4CDX A;  1EUU A;  3UKV A;  4E4H A;  4NHL A;  2EIC A;  2X5I C;  3HR9 A;  1B09 A;  4Q29 A;  2UY9 A;  1YJK A;  5BNP B;  5IK5 A;  3ACI A;  3WCR A;  1KXG A;  2VZS A;  2TBV A;  3GF6 A;  3WF0 A;  5FYT A;  1PM4 A;  1EUT A;  2I74 A;  1CGP A;  4QT6 A;  4CYD A;  1I3H A;  1GU3 A;  2HWB 1;  3VZM A;  4CP1 A;  4LBQ D;  5F3C A;  1HJG A;  1W05 A;  4CEW C;  3A4U A;  5F2W A;  4BDV B;  3LEM A;  3O1V A;  2D5F A;  1NT0 A;  2O1Q A;  4PLN A;  1CES A;  3A22 A;  4S2F A;  2DCJ A;  2QQM A;  3SMH A;  3WW4 A;  2WAA A;  5C8C A;  2ZBJ A;  3LDB A;  3N7J A;  3KCY A;  5A7O A;  1W9T A;  3WDW A;  5JOW A;  4L9B A;  5DUX A;  3ZSJ A;  3VL8 A;  1H9W A;  2VC9 A;  2D6N A;  4MG2 A;  1YFW A;  1UZY A;  3M1H A;  5HI0 A;  2VO5 A;  2Y64 A;  1D4M 3;  4RS5 B;  1MS5 A;  1S0F A;  5FLH A;  1CJP A;  1UY3 A;  2BU9 A;  2AC1 A;  2PAK A;  2R0F A;  4HKW A;  2JG9 A;  4PBP A;  4FP3 A;  4X6Q B;  3WNX A;  1N3Q A;  2WQ8 A;  1AYN 3;  5GZE A;  2YG0 A;  5C9A C;  2PFW A;  2WSU A;  1HV0 A;  1YEW A;  2DU0 A;  2GN3 A;  1OLR A;  3HWJ A;  1HB2 A;  4DNY A;  2DTY A;  1PGL 1;  1AXZ A;  2P3Y A;  2D6O X;  4DXS A;  1KDK A;  3S7E A;  4YGC A;  3III A;  1TEI A;  2C9A A;  1XXN A;  4DS0 A;  2VBD A;  4BQ3 A;  1C3H A;  1RTV A;  2ZGL A;  4R4X A;  3KMH A;  5FZA A;  2AEN A;  1PK6 A;  2PLV 1;  3AKQ A;  1S2B A;  3H3U A;  1CD3 G;  3IN9 A;  5J1X A;  2QQP A;  2VVD A;  3OB8 A;  1W8H A;  1LHU A;  2B9U A;  1SBF A;  1QXR A;  2TEP A;  3MPB A;  2PHW A;  1MEC 3;  2VUJ A;  5JZG C;  4ZS2 A;  3ZFF C;  5FPL A;  2PHU A;  2C24 A;  2RS3 3;  3CMG A;  4CU7 A;  1ENX A;  1W6O A;  1NZC A;  2Q0A A;  4A44 A;  3PUQ A;  5A1A A;  4K6B A;  3T4V A;  4BYY A;  1UWW A;  4AFD A;  1OVS A;  4TTG A;  2B5H A;  2QKD A;  1LUL A;  3B94 A;  4ONU A;  4EZH A;  3CJI A;  4YW3 A;  3WG1 A;  4KMQ A;  3S6P A;  2PHD A;  3BGA A;  1ZZC A;  1DG6 A;  3DXU A;  2JE9 A;  3VZK A;  1IS5 A;  2AEY A;  3U14 A;  2R04 1;  2CWM A;  4A45 A;  1W06 A;  2UY8 A;  4CXW A;  4FQ4 A;  4U36 A;  4I2O A;  4LBQ A;  5KC5 A;  1OC1 A;  4Z2A A;  4CEY C;  1ZZ6 A;  2YC4 A;  3B9C A;  5CG9 A;  2TUN A;  3FFQ A;  1FXZ A;  4RR3 B;  3CNA A;  5FBJ A;  4TSV A;  2QQU A;  5FZM A;  1U5I A;  1VMJ A;  2ZEX A;  4AI9 A;  4AK3 A;  4BIF A;  4NIA A;  1FI2 A;  3ETQ A;  2WC2 A;  3ES1 A;  1ST8 A;  1UZV A;  4RHV 1;  2JWP A;  1LOE A;  1ACC A;  3U07 A;  1YQ8 A;  2HWB 2;  1VBA 3;  5LBF A;  1W8T A;  1GLH A;  2ZAC A;  5DUU A;  5JZG A;  4BHP A;  1N1S A;  4Q8L A;  3ZFG B;  5C5T A;  5CFC B;  2D40 A;  2FHR A;  3ABZ A;  1JZ2 A;  3B93 A;  2WYS A;  5E6H A;  2W0X A;  5A7N A;  4KI5 M;  3RJ2 X;  4RFT 0;  1C4R A;  1NA1 B;  4KL1 A;  1VBA 2;  3VBR C;  3WW2 A;  1LOD A;  4QMA A;  1HDK A;  1TZO A;  5FZD A;  2A1X A;  4H2A A;  5KC6 A;  1W28 A;  4BK4 A;  3ZYJ B;  3AFG A;  2FQP A;  2R16 A;  2EAK A;  3KM5 A;  3M3I A;  1Q8Q A;  4YPJ A;  2EIB A;  3B3Q E;  4IGO A;  2QQL A;  1ZX5 A;  3P3N A;  3JD7 2;  1HQL A;  3VD9 A;  1QXP A;  4OUE A;  1VBD 1;  4GMP 1;  4JGY C;  4RL7 A;  2WQZ C;  2VR4 A;  3ZYB A;  2WR9 A;  2ZJC A;  4LJH A;  4CUB A;  1R1A 2;  3P6B A;  1VB2 A;  1XU2 A;  2HEV F;  1QJX 2;  5LA2 A;  4M0H A;  3TN9 2;  4BK5 A;  2VL4 A;  4D7Y A;  4LKF A;  1QMJ A;  5IVF A;  5JI7 A;  1DGR A;  1EAH 2;  3UGH A;  3ATG A;  4K20 A;  1APN A;  2VNV A;  4TWT A;  4XHB A;  1CIW A;  5EP9 A;  2W46 A;  1R08 1;  1XE0 A;  2D6P A;  1NLQ A;  5K9Y A;  1F2N A;  5FV3 A;  4KQ7 A;  5D8A C;  1RUH 2;  4L97 A;  2BFU L;  2XOM A;  3S5Q A;  4E2Q A;  5FYB A;  1SCR A;  2IXK A;  2FCV A;  4YAR A;  1BVP 1;  4YZ1 A;  4GWN A;  1ZRI A;  4OCT A;  4QGN A;  5FZO A;  1EAH 3;  2FMY A;  2W47 A;  1EYB A;  1ZBA 1;  2C6S A;  2FCT A;  2G19 A;  3DF0 A;  3J8F 2;  1SDD B;  1MZ6 A;  1JU4 A;  2GDF A;  2X5I B;  5L9V A;  4COU A;  1W0N A;  2W92 A;  4GKY A;  1PGW 1;  4RFR B;  3RZL A;  1FX5 A;  4LNV A;  1DQ5 A;  3PL0 A;  3WG4 A;  4NID A;  1PVC 2;  3HBK A;  4GWM A;  2RR1 2;  1OLM E;  1ZBA 2;  1E57 A;  2PQS A;  3KQR A;  3KSC A;  4HL0 A;  4XIL A;  4AED B;  3IKW A;  4YW6 A;  2R1B A;  2XGX A;  2DVD A;  3F2Z A;  3I2J A;  3HNY M;  3R4D B;  3J8F 3;  1QDO A;  3ZKU A;  5CFD C;  3UGG A;  2P17 A;  3R0R A;  4BQ5 A;  1Y9G A;  3RZJ A;  5IT6 A;  1ZRC A;  4BCU A;  4FVV A;  2VW1 A;  5LBC A;  5FO7 B;  4FT8 A;  1AR6 2;  1HXS 1;  4Q4W 3;  3AKT A;  3MO4 A;  1GV9 A;  1AL2 2;  4L99 A;  5DUW A;  1ZBA 3;  4MGQ A;  1QHD A;  5KHI A;  2KXL A;  5A3L A;  4RYD A;  3POS A;  4HBN A;  3MZH A;  1PO1 3;  2WQ4 A;  1HQN A;  3NL1 A;  4IXL A;  1WCK A;  1ZZ8 A;  4YZ4 A;  4CPB D;  1S2E A;  2Q8E A;  3VDB A;  4J1X A;  3MI8 A;  2VD7 A;  1GBG A;  1ZZ7 A;  1SBE A;  2WFF 1;  2YGM A;  1ULO A;  4EYU A;  4FOQ A;  4XJZ A;  3BIW E;  4Q4W 2;  2RDQ A;  5FY1 A;  1SDW A;  3MHZ A;  3DKQ A;  2OT7 A;  2XML A;  1GUI A;  4JZR A;  4UAP A;  4QXH A;  4NE9 A;  2HLE A;  2Y33 A;  1UU4 A;  3C8X A;  2VCC A;  3WNN A;  4WM8 A;  3VBS A;  1XU1 A;  1GNY A;  2CNA A;  3Q8F A;  2UWB A;  3LB9 A;  4XZP A;  5I0R A;  4H55 A;  2UYB A;  5JMC A;  3V56 A;  2DVG A;  3Q9O A;  3IDB B;  3W20 A;  1CAV B;  1LGB A;  4I30 A;  1FOD 1;  4LBO A;  3D0J A;  3VUO A;  1QF3 A;  3WY6 A;  2VCB A;  5A7P A;  5ACA 3;  3OY8 A;  4CCO A;  5IAX A;  1OA3 A;  2RDR A;  2Y6J A;  4LBQ B;  3G7D A;  5J98 B;  4IGP A;  4AHX A;  3NAP A;  1J3R A;  2OX0 A;  4JAA A;  4XFI A;  3JD7 1;  4Y20 B;  2HWF 3;  2V72 A;  1RUC 1;  1HRI 3;  3WCS A;  2WLQ A;  4DMI A;  4NRQ A;  1VRB A;  3CKH A;  3KZ4 C;  2QQK A;  2PYT A;  2X29 A;  4XFB A;  3MGU A;  3N9N A;  4D8M A;  1R1A 1;  1WCU A;  2OQ6 A;  5LA0 A;  2YY1 A;  2GND A;  5F37 A;  5GZC A;  4XIK A;  2UU8 A;  4XDQ A;  1YFX A;  2GP5 A;  3KF5 A;  3T1L A;  2GMP A;  1UZ0 A;  4Y26 A;  3POY A;  5JPM B;  4PJY A;  1CIY A;  1KFU L;  4IES A;  5FXV A;  3VBO A;  4Y3O A;  3ROU A;  5FJK A;  2D6M A;  2R07 2;  2QTW B;  3PVE A;  1SEF A;  3ACH A;  2RJ2 A;  4YW1 A;  4URT A;  1C1F A;  3UV9 A;  2JD9 A;  2R04 2;  1V6L A;  3AZX A;  4GQ7 A;  3W58 A;  1DGR N;  5DDJ 2;  4OI0 A;  1ULE A;  1OT5 A;  3RZK A;  4GIQ A;  3VKM A;  4ATF A;  1AL0 G;  1EPZ A;  1ZBE 2;  1DQ6 A;  4GWI A;  1WW6 A;  5LEK A;  4GUL A;  1H8V A;  1ZM1 A;  2Z2S B;  4HMZ A;  3ZIX A;  5ACA 1;  1AR7 3;  1DIW A;  1ONA A;  2YUE A;  2XQR A;  4RGK A;  3GZE A;  1C8N A;  1PGL 2;  4UW4 A;  1FOD 2;  2XQX A;  4UXA A;  1OLQ A;  2R04 3;  2DUQ A;  1RHI 3;  2TNF A;  2ZEZ A;  4XDP A;  1QJU 3;  2OA2 A;  3N7K A;  4DO0 A;  5AFB A;  2XPJ A;  1DDL A;  1VRH 2;  4WVW A;  1JYV A;  2OZJ A;  3ELN A;  2EIE A;  2OQ7 A;  4D7T A;  1UMI A;  3VBF B;  2MPF A;  3MIF A;  2BV4 A;  2JD4 A;  3VKL A;  3PTR B;  4BE3 A;  2JDA A;  1G9F A;  1OH4 A;  1FAT A;  3POE A;  2ARC A;  4X8P A;  3VKN A;  5LY1 A;  2LTN A;  5L7O C;  2E7T A;  4H7M A;  4XCA A;  3ZYI B;  1RED A;  4ZU7 A;  4Q4Y 1;  2F4P A;  2WL1 A;  5EIY B;  5JDB A;  1GAN A;  3PNA A;  4FPK A;  4B1L A;  2DVA A;  1IS4 A;  4AWD A;  2WWU A;  4IE7 A;  1QGL A;  4D6R A;  2BVV A;  1FPN 3;  5HXM A;  5JXG A;  3AMH A;  3PME A;  4DB5 A;  4IL7 A;  1UOF A;  2BNO A;  1LKN A;  3IZO A;  2WJS A;  2D6K A;  4HK9 A;  2DV9 A;  4P5Y A;  4LHL A;  4XJ8 A;  1FNY A;  1XNB A;  2P5B A;  1H2M A;  4XAB A;  1S0G A;  4RHV 3;  4C0H A;  5C70 A;  1AXY A;  2XL9 A;  3GJA A;  2GNB A;  1U12 A;  4M3C E;  4QD2 A;  3BTA A;  3GXU A;  3VBR A;  3WIN E;  3AP5 A;  5EWS A;  5F39 A;  1PM7 A;  2XJV A;  4LBL A;  1H1I A;  4KNC A;  5EV7 A;  4Z1V A;  2Q4S A;  5A6Z A;  2ZHM A;  2ZGM A;  2NYY A;  3MV1 1;  4K3U A;  1YQC A;  3KVA A;  4FFH A;  4Y4Y A;  5FLI A;  2XON A;  1VJ2 A;  4MGS A;  4Q1R A;  3T2T A;  4K21 A;  1BCX A;  1PIV 3;  1UKR A;  4AXO A;  3AJY A;  4N53 C;  2C1F A;  4QB1 A;  2RDS A;  4IEQ A;  5IHR A;  1VMH A;  4A6O A;  5A7W B;  3HT1 A;  1NG0 A;  4R9C A;  2XLF A;  4LOS A;  3ACG A;  1Q8V A;  4NRO A;  5ERL A;  3U1X A;  1BMV 2;  2VBP A;  2WNU C;  3GZU C;  1AYN 1;  1MZF A;  2DVB A;  2G9G A;  3N9O A;  1JHJ A;  2VJX A;  4XF1 A;  1NKG A;  2D7F A;  2Z79 A;  2EXH A;  3BOD A;  3OSD A;  4MV2 A;  1UW8 A;  1U5Z A;  2ZCW A;  3QCW A;  4D69 A;  1CAU B;  2RM2 1;  4AVV A;  5F5A A;  4CCK A;  3HN3 A;  2JKB A;  3R6S A;  3AP6 A;  3TNQ A;  3WNL A;  2VNG A;  4QB6 A;  4JKM A;  3C7F A;  3DKW A;  1K5M A;  2Y0I A;  3T1M A;  3JQW A;  4I0W B;  1V6O A;  3O1T A;  1LB2 A;  2ZGU A;  5CKQ A;  2FDG A;  4DEV A;  4R9A A;  3S0M A;  1ODN A;  1VBD 2;  1WBF A;  2Q8O A;  3HQR A;  4AED C;  1AX2 A;  3ACL A;  2FD8 A;  2JG8 C;  3JXS A;  2WWS A;  1XNK A;  5FR3 A;  1OUR A;  2ZZQ A;  2WUH A;  4IE4 A;  3ZM8 A;  1PHM A;  3A23 A;  2J1E A;  2BW8 A;  5JIU A;  4EWE A;  2VZ1 A;  4E27 A;  3O1M A;  3NQH A;  1W2O A;  5FYS A;  3WNO A;  4FSJ A;  3SIS A;  5CKM A;  4QAW A;  5APA A;  4PDW B;  1A78 A;  3JCI A;  4IDZ A;  4KU8 A;  3ZIW A;  4ZKT B;  3ZR6 A;  2WIN B;  3RYR A;  1V9U 2;  5F5C A;  3VBH C;  4YNI A;  2NQY A;  3FFZ A;  4YZ5 A;  2IXL A;  5C33 A;  5LRR A;  3O0V A;  3I2F A;  1U5X A;  2VCM A;  3M3C A;  1V6I A;  4FAH A;  1GP5 A;  3RI9 A;  4QQL A;  1MS1 A;  2RS5 2;  1ZNP A;  1ASJ 2;  3GHM A;  1FT9 A;  1SFP A;  5FQ0 B;  1FV3 A;  4M3C A;  3DPR A;  3O1U A;  4LHK A;  1CX1 A;  1LOC A;  2PHX A;  3PUR A;  4DUW A;  4H14 A;  3DN7 A;  4AVB A;  4R9B A;  2EID A;  3WP4 A;  3ZFG A;  2XLG A;  1DFQ A;  4FAG A;  3LWC A;  2YPJ A;  4RS5 A;  1WMF A;  1JOJ A;  5K4L A;  1W3X A;  1I6X A;  2ZGO A;  1SLB A;  2ZTN A;  4WM7 B;  5FYZ A;  1RUJ 1;  2A6Z A;  5JVV A;  4CXY A;  2P6C A;  1H9P A;  1ND3 A;  3H8R A;  2RS1 3;  3W21 A;  2VOT A;  1XJA A;  4N7U A;  4YFZ A;  5I91 A;  3AMM A;  5D2A A;  1DYP A;  3B9I A;  3ZXG A;  1AXK A;  1QJZ A;  1DLC A;  5A32 A;  4YM0 A;  4DOU A;  3I3M A;  3IPV A;  1SQ4 A;  5FYC A;  3UJQ A;  3W9A A;  4XTM A;  4AFM A;  4CCL A;  3CZU A;  2ZMK A;  3BUC A;  2JIG A;  5L9R A;  5K0U C;  4V2W A;  4P14 A;  2CGN A;  3SLI A;  1B35 B;  4XF9 A;  2KR2 A;  2VZV A;  3LF7 A;  3PUI A;  2GH8 A;  1LNS A;  1RUC 3;  1R09 1;  1OA4 A;  1C8M 3;  1IS6 A;  5HCB A;  1WW4 A;  5FPU A;  4TN7 A;  3U4X A;  4XAC A;  4XUQ A;  4UFI A;  2YXS A;  4LKS A;  4AVS A;  1TE1 B;  2LM3 A;  4X6R B;  4DXZ A;  1X9P A;  4GH4 B;  2GC0 A;  5FZH A;  4BME A;  1BBT 3;  1J1T A;  4YG0 A;  5FP4 A;  2RDN A;  3TRS B;  2E32 A;  4N43 C;  1N1V A;  3D6E A;  4MXV A;  3BAL A;  3ZFG C;  1QJF A;  2UWA A;  4XXA A;  1EY2 A;  3FLT A;  4PQQ A;  4LUL A;  1TNF A;  2QFE A;  4GD4 A;  2AYH A;  1AR8 3;  4RD7 A;  4BLJ A;  4JKK A;  1RL3 A;  1RUJ 3;  3VB9 A;  1O8S A;  2DF7 A;  2BDR A;  1BBT 2;  4UBH A;  1D4V B;  4Y1Z A;  4AR2 A;  4CU8 A;  4ZXK A;  2HWD 2;  4UFK A;  1C8M 1;  3AFK A;  3OBT A;  3VHO A;  1SAC A;  1QEX A;  3U37 A;  1IHM A;  1IGO A;  2DCY A;  2FDJ A;  3LEG A;  5FZ4 A;  1JYN A;  2UWC A;  3I7D A;  4YVW A;  2VZU A;  1QH7 A;  5AFE A;  3USU A;  2GAL A;  3LSD A;  2MEV 2;  2NZ9 A;  1ULG A;  1CZS A;  1J84 A;  4UT5 A;  3MPP G;  4YWA A;  1RIT A;  4AAP A;  1G86 A;  2Y38 A;  2JDN A;  2DFC A;  1AR7 1;  2YYO A;  3KV9 A;  1MZE A;  2KM2 A;  5F6L B;  1T6B X;  3AB0 A;  4N90 A;  3SH5 A;  2BRT A;  1E5R A;  3USS A;  2Y6L A;  5IWF A;  2DUO A;  5BPX A;  1UIK A;  1VBC 3;  1AR9 2;  2NLR A;  1BBT 1;  3LFM A;  4MOA A;  1BJQ A;  3NAP C;  5FUI A;  3H8O A;  4B29 A;  3FBM A;  5CKN A;  1GWL A;  1Y43 B;  3NO8 A;  2ETE A;  1F4H A;  1JOB A;  1DGW X;  3PUS A;  3RFR A;  4CDW B;  3GBW A;  1JXN A;  1I5P A;  4Q4Y 3;  1YCI A;  2DCZ A;  1Y9Q A;  2D97 A;  2OPK A;  3A7Q A;  2FDK A;  1NOV A;  3QBQ A;  1W6P A;  1AZD A;  5KXE A;  2WRA A;  3WF2 A;  2P37 A;  2HWE 3;  3J4U H;  4JVA A;  1RMU 2;  2BBA A;  2NM1 A;  5EJ1 B;  1W6N B;  2VZT A;  4SLI A;  2VZO A;  2IVJ A;  1GWK A;  1UOJ A;  2XJS A;  3GDB A;  2E53 A;  4L0P A;  5EZW A;  1I5Z A;  1UKG A;  3ZN6 B;  3WD5 A;  1QY4 A;  2HWD 1;  3H3L A;  3AZY A;  4AQT A;  5L36 A;  2RJL A;  5CG8 A;  3PVB B;  4N53 A;  5JSP A;  4QHB A;  4YW4 A;  1MS4 A;  1GZT A;  1GYK A;  2GN7 A;  2VTF A;  1O7F A;  4NWW A;  1CPM A;  4XEZ A;  5GM0 A;  4EQV A;  3BKZ A;  4A2U A;  2H6B A;  5FXZ A;  1H0B A;  2X09 A;  2WZR 1;  4QU1 A;  4M3C B;  2O14 A;  2IUW A;  1JOD A;  3WLU A;  3RZZ A;  3T0B A;  3VL9 A;  3KHC A;  5I0T A;  4YM1 A;  3WX5 A;  3LOI A;  5IVB A;  1W3V A;  2VG9 A;  3HAG A;  4K8R B;  1R64 A;  1XBF A;  3WT3 A;  3D0S A;  3WNM A;  2B9V A;  5DUV A;  2W2I A;  2R07 1;  1OPO A;  4CDU C;  4CCE A;  2X10 A;  4LE3 A;  5DZE A;  3MLL A;  5F7U A;  2K46 A;  4L8Q A;  4ASK A;  2AUY A;  2IC1 A;  2IXH A;  4AZZ A;  4O7X A;  4TYS A;  2BGC A;  4OHZ A;  3LKJ A;  4E4D X;  2W95 A;  3RMX A;  2XVG A;  1O3R A;  3S57 A;  1D0G A;  2HWE 1;  5DMY A;  3PUH A;  1WMX A;  5EPA A;  3ZSL A;  4CZS A;  5FYI A;  4XYX A;  1WME A;  4QKN A;  4ATE A;  3RGB A;  3POG A;  3W5N A;  3RZG A;  3I3D A;  1RUE 2;  3NV4 A;  3HMY A;  2YZ4 A;  1HN0 A;  3EQE A;  1NCR A;  1IG0 A;  1T6G C;  4LUM A;  5C71 A;  3GYD A;  1YRZ A;  4OHV A;  1IPJ A;  2RJK A;  1YI9 A;  4N43 B;  1GWM A;  5FZG A;  2JE8 A;  3ORJ A;  5F5Q A;  1W2T A;  4Z92 B;  3P5B A;  5KHK A;  4AQ2 A;  2HBU A;  3ILR A;  1OA2 A;  3CHX A;  4UFJ A;  5C5U A;  4UYB A;  3WNP A;  4JRL A;  1YNA A;  1O5L A;  4U2A A;  2LAL A;  4MO3 M;  3WP5 A;  2FCU A;  4HPK B;  3OGG A;  1OUS A;  2AGS A;  2YPD A;  5E1R A;  1J3P A;  4IE0 A;  1K42 A;  4Q0U A;  3SCH A;  5GZG A;  2JG8 B;  1OQ1 A;  2XWB B;  3U75 A;  4KH9 A;  1CAX A;  4J1W A;  5K0U B;  4IEU A;  1LHN A;  4XUP A;  1MEC 2;  1ULC A;  1VBB 3;  3VZJ A;  3ZFE B;  3H8U A;  1HB1 A;  4MZU A;  1OH3 A;  3NKT A;  1MZ5 A;  3NV2 A;  4JC1 A;  4LA2 A;  4Q2F A;  4S2D A;  5DAV A;  1WCQ A;  4WVZ A;  5A3O A;  1RUF 1;  2ENR A;  3E97 A;  1RHI 1;  1GP6 A;  3VBH B;  1FPN 1;  3BIE A;  4DXT A;  1I9R A;  1BKZ A;  3NVC A;  2HEY F;  1X82 A;  5FFO C;  3CQO A;  1AYM 3;  5E8A A;  2W5F A;  2VOK A;  2WSV A;  4QM8 A;  5JZG B;  1VAM A;  1K5M C;  5FTT C;  2FDF A;  2ZGK A;  2CTV A;  3OPT A;  4KBZ A;  2O0O A;  4HVQ A;  2UUR A;  4W8J A;  4BPZ A;  5T5L A;  4XUT A;  5JSR A;  5FP8 A;  5FZI A;  2VE1 A;  1UQX A;  3NW4 A;  4NHM A;  1N3P A;  4HXC A;  5KWR A;  5C8W A;  2W68 A;  2WAO A;  3OF1 A;  3BOW A;  3JBG 2;  4LEJ A;  4D6S A;  4FBF A;  2E9Q A;  3L2H A;  4NPL A;  3TOJ A;  4YFW A;  4HVO A;  4OQ8 A;  1LHW A;  1EV1 2;  4XAE A;  4DY5 A;  1C5H A;  2ZA9 A;  1S0J A;  4B4P A;  2G9Z A;  4ZXE A;  3I59 B;  2YU2 A;  4MUV A;  5F5I A;  2JIC A;  4M00 A;  3FLR A;  4JV4 A;  4NOT A;  1ODM A;  3AYC A;  2BGP A;  3KGL A;  3TB0 A;  1OPM A;  2ZX3 A;  4COW A;  4DIN B;  3BU0 A;  2HWB 3;  3WUD A;  1WD3 A;  1LHV A;  3VV1 A;  1HXS 2;  5FDB A;  2JDY A;  2AZ5 A;  4JGY B;  3RI8 A;  2VQU A;  5A6X A;  1N47 A;  2DCT A;  1LAJ A;  2I45 A;  1YWK A;  5FRA A;  4OUM A;  3QOP A;  1PZ8 A;  2WNE A;  2VUD A;  1COV 2;  4LT5 A;  2XH6 A;  3PHM A;  2ZKN A;  4K9S A;  4LO4 B;  2G1M A;  4QKB A;  2WA4 A;  5H9S A;  1A6C A;  4XCB A;  3ZXA C;  2CGP A;  2J7M A;  1KIT A;  2BYV E;  4K7J A;  2Y34 A;  1HXS 3;  2PTM A;  3LEI A;  1UYX A;  5D8A A;  4B8E A;  1CWP A;  1W8N A;  1AX0 A;  4XC9 A;  4Y22 B;  4CDU B;  1MS0 A;  2Q30 A;  4LXL A;  4YM3 A;  3U10 A;  3PMS A;  2E7A A;  2EXJ A;  4TZD A;  3HIF A;  1Q3E A;  4EJR A;  1W9Y A;  2ZKL A;  4GKX A;  1GQP A;  3K4Z A;  3M8L A;  4FPJ A;  4XAA A;  4Y5S A;  4QDQ A;  3MFC A;  3TNP B;  3ZSK A;  2EVX A;  4E2G A;  4EV0 A;  5FYM A;  2ZEW A;  5FY7 A;  4UOJ A;  4Y33 A;  1KJR A;  4JGY A;  3THT A;  2ZMN A;  4R4Z A;  1NXM A;  1JZ8 A;  2JEN A;  4IV1 C;  4IV1 B;  2KA3 A;  3T2Q A;  1Z7S 3;  5C6C A;  4XZU G;  4AAX A;  2E63 A;  1PNG A;  2RMU 1;  4P9I A;  5FPZ A;  1MEC 1;  4FOY A;  3EJK A;  5LA9 A;  3TBD A;  4AVA A;  4Y1U A;  5FMO L;  4ARX A;  4NO4 A;  1UZW A;  4MYE A;  4IEV A;  2ZX2 A;  4MH0 E;  5HV4 A;  1SHW B;  3WNK A;  2PLV 2;  2WFP A;  5LBB A;  3FN9 A;  2EXI A;  4XHX A;  4A3X A;  4YVS A;  3K3N A;  5FIX A;  3SH3 A;  3ZFE A;  1O6U A;  2FZ1 A;  4Q8K A;  2Y6G A;  3FLP A;  1PVC 3;  3M7A A;  4QX5 A;  3K4A A;  3DCQ A;  4AI0 A;  2VMG A;  1NYW A;  4ITC A;  4XW3 A;  4AI3 A;  4C91 A;  5C9A A;  4HON A;  4OZX A;  5JMO A;  2HWF 1;  3I2I A;  5IUQ A;  2GH2 A;  3ZMN A;  1J83 A;  3ZPY A;  4ZU5 A;  3I2D A;  4P9X A;  1MQT A;  5CFC A;  5A3N A;  1JI6 A;  2CGO A;  2YFU A;  3TAY A;  3ZFE C;  1RUH 1;  4HPK A;  4YVS C;  1L7Q A;  3BOP A;  5C3Q A;  4AHW A;  1HLC A;  1ZBE 1;  2NPI A;  2EIG A;  4LLF A;  1GZC A;  1CAW A;  3C7E A;  1AJO A;  3OUJ A;  5T52 A;  1PO2 1;  4URA A;  2VMH A;  3RQ0 A;  4CEY A;  1IS3 A;  2GAU A;  3EBR A;  4K40 A;  1L7R A;  4NMI A;  5GZF A;  3Q8E A;  3FE5 A;  2RS1 1;  5BY5 A;  4OLL A;  3SHR A;  4NIH A;  1YUD A;  4HG6 B;  1QIQ A;  4A4A A;  3WVJ A;  1VBE 3;  4OMC A;  4Z2W A;  4F3J A;  3KWV A;  4CDQ C;  4XFH A;  2P34 A;  4WM8 C;  3VBS C;  1DQ2 A;  4P5H A;  3SKV A;  4LE4 A;  3VBO B;  1MQT B;  1YQ5 A;  2ZAA A;  3IMM A;  4GJZ A;  1G9B A;  4D6Q A;  1DBN A;  4Q4V 1;  1RJ8 A;  2JDH A;  1GMM A;  3WQB A;  2R07 3;  1PX3 A;  1Q43 A;  1TQ5 A;  4R9D A;  3KT7 A;  4RS5 C;  1PVC 1;  2A75 A;  3GM8 A;  4IEY A;  4ASL A;  1U5Y A;  1PMI A;  2NN8 A;  2RE9 A;  4XBQ A;  4BJ0 A;  3KT4 A;  4WVM A;  1O3Q A;  4LO5 B;  2EAA A;  3PVN A;  1UY0 A;  2Y6H A;  3ZR5 A;  5JOY A;  3QLQ A;  2VQT A;  4M4P A;  1XPW A;  1CPN A;  3PLQ A;  5FXW A;  1ZBE 3;  1YXW A;  3K77 A;  3T2O A;  3FHA A;  2YMZ A;  1NX9 A;  2ES3 A;  2BJS A;  3E1F 1;  3I59 A;  4WV8 A;  2ZS6 B;  1RYY A;  4MGZ E;  5FYH A;  5JUV A;  5F3E A;  4NIG A;  2ZML A;  5L19 A;  4UF0 A;  2ATF A;  4KWL A;  2XBO 2;  4N9I A;  4WBB A;  5A70 A;  1QQP 1;  1RHI 2;  1QJU 2;  1A8M A;  3EO6 A;  2PXJ A;  1UPI A;  1UOB A;  5FYU A;  3WV6 A;  4A7Y A;  1LU1 A;  3QH6 A;  4COZ A;  5DN2 A;  5SV5 A;  4LHS A;  2NP0 A;  5FXX A;  5FZ9 A;  5LCW L;  1YQ2 A;  5A7Q A;  1CAX B;  3RJR A;  2O8O A;  3I2H A;  1EV1 1;  3UL2 A;  2XBO 3;  1JN2 P;  1PK6 C;  1QOS A;  3CLP A;  2OS2 A;  2QUO A;  1EAH 1;  3VBU B;  2Q5T A;  1BHG A;  3ZXL A;  2MNG A;  3I3E A;  3K2O A;  1RC6 A;  4DIQ A;  5G05 L;  5A6Y A;  2JKX A;  1ZZB A;  3KQ4 B;  5J3U A;  1RUN A;  2OUH A;  2W52 A;  2Q1M A;  3CF6 E;  1AR7 2;  4ZY9 A;  4LIU A;  2V5D A;  3JB8 A;  3U0Z A;  2VU9 A;  5FY5 A;  3RWN A;  4A6S A;  5CIS A;  2Z5W A;  1RB8 G;  5FRE A;  1DQ4 A;  1COV 1;  2E7Q A;  3OBR A;  2PHL A;  3OEA A;  5IVJ A;  1KRI A;  1PIV 1;  2WA3 A;  1PGW 2;  4FXK B;  4GMP 0;  1AVB A;  5KXD A;  5T5O A;  3MIH A;  1IPK A;  4Q0V A;  5GLW A;  2Q1Z B;  1Q8O A;  2P1B A;  5D1I A;  1POQ A;  5DG1 A;  5FQ0 A;  3ES4 A;  1QQP 3;  4YG6 A;  4B3N A;  4W50 A;  4CDU A;  1VPH A;  3K75 B;  4GH4 C;  4OI4 A;  3BTZ A;  3VZN A;  1XC6 A;  4OHX A;  4COY A;  3FUO A;  1UYZ A;  3NJY A;  3BN6 A;  4PIZ A;  5T5P A;  1GKB A;  2OII A;  4LLO A;  4CTE A;  3LEK A;  3AP9 A;  2X53 S;  2RR1 1;  1WW7 A;  3AP7 A;  3UT0 A;  4J6G A;  4P9G A;  1K3I A;  2OPW A;  3JUU A;  4NHX A;  2CHH A;  4K1Y A;  3MDP A;  1KDM A;  4LBK A;  4ZZ5 A;  1DP0 A;  3WHU A;  5I0D A;  3L2Y A;  4XQ4 A;  5J48 A;  3LA2 A;  5IVV A;  2GC2 A;  4NAO A;  3O0X A;  1NLS A;  3H1M A;  2W91 A;  4TLG A;  3AXE A;  4LKD A;  1LHO A;  2JJ6 A;  4Q0P A;  3KB5 A;  2J1A A;  4AOC A;  4QQP A;  2ET1 A;  1H2N A;  2QQN A;  4MLO A;  4RSU A;  5JR7 B;  1VBD 3;  3JB4 C;  3H1Y A;  4CP9 B;  2CYF A;  1LU2 A;  4CE8 A;  2XKO A;  3BU7 A;  4XFF A;  3IAQ A;  3SQO A;  4QPI A;  1F31 A;  1YHF A;  2E6V A;  2WO2 A;  2KD7 A;  1K45 A;  4LBJ A;  2QVS B;  2DU1 A;  5F3G A;  1XNC A;  2HBT A;  5A3U A;  5BNN A;  4B7E A;  3KD4 A;  1O59 A;  2VVF A;  4RQP B;  3T30 A;  4IEX A;  1LR5 A;  3THP A;  1Y4W A;  2QQO A;  4ASM B;  4D94 A;  5J36 A;  1V9U 3;  1Z7S 1;  3I4I A;  5IJR A;  3FX3 A;  5EQU A;  2BFU S;  3JD7 3;  3AYD A;  3D82 A;  4C1W A;  4M4R A;  4FPF A;  3D5O A;  5GLT A;  5FZ1 A;  4AFA A;  2O8Q A;  2ZHN A;  1BQP A;  2VNR A;  5J96 B;  2BPA 2;  3KV5 A;  1U0A A;  2VBB A;  4QKD A;  3CJI C;  4FPE A;  3VHN A;  3WW3 A;  1AUY A;  3J26 N;  1F9K A;  3TN9 3;  3BVC A;  4P9Y A;  2QZ2 A;  4ET7 A;  2IXI A;  4G3Y C;  1BZW A;  1ULF A;  4NJ4 A;  3FJS A;  5FMD A;  2WZ8 A;  1OOP B;  2WS9 3;  4E8D A;  4LPL A;  2D3R A;  3GHN A;  2WWJ A;  2WZR 2;  2WNU B;  1NCQ C;  3TEZ A;  5ANQ A;  4DRR A;  4YVW C;  1LES A;  2GMM A;  2QZ3 A;  2VZQ A;  1LEC A;  1Q8S A;  2WT0 A;  1H1M A;  1PVX A;  2RMU 3;  2W1U A;  1OD5 A;  2ZPX A;  1HB4 A;  4AQ6 A;  5CAZ A;  1CZV A;  2GNT A;  2H6C A;  4O65 A;  3VBU A;  3OD0 A;  2JEC A;  3C2U A;  4CDQ B;  2DDU A;  3KV4 A;  5A32 B;  1RIR A;  2WS9 2;  1JS9 A;  1HJF A;  2J1R A;  1QU0 A;  1RUG 3;  2VVE A;  5L9B A;  1ZRD A;  4OFG A;  4AEM A;  1GP4 A;  2YC0 A;  1PO1 1;  3P3P A;  1YI7 A;  2A6X A;  2PHF A;  3C7O A;  3VBU C;  5DAX A;  4CDX B;  4AGR A;  2RS5 3;  1DZT A;  2QQJ A;  1IPS A;  3NMB A;  1OXC A;  2RM2 2;  3O7O A;  4YRD A;  1HN1 A;  1OUX A;  1YIP A;  3RZM A;  4PF1 A;  5LW9 A;  3ZX7 A;  2VW2 A;  1GNH A;  4A7K A;  2E26 A;  1RUG 2;  1UU5 A;  1UYY A;  1LOB A;  2IZW A;  1CON A;  4I3G A;  1AR6 3;  4XET A;  3WZ1 A;  1C8M 2;  4OUS A;  4GWJ A;  3THD A;  3ZDV A;  4QXK A;  4QDS A;  4BQW A;  2XDV A;  1UXZ A;  2BEO A;  2OXB A;  4JQT A;  1W8U A;  1XSQ A;  4FPH A;  1PMJ X;  2WNO A;  4FFI A;  3WQ1 A;  5JAX A;  2FBE A;  1K5M B;  4LA3 A;  5GLU A;  1A34 A;  2K9Z A;  2K2S A;  1YC6 1;  2W9X A;  2VZP A;  3I97 A;  4CSW A;  3OBA A;  3GZT B;  1HB3 A;  4LK7 A;  5KBF A;  2W94 A;  1DYO A;  2RS3 1;  4OQ9 A;  4AI1 A;  4Q4V 3;  1KJL A;  4IV3 C;  3ASI A;  4JGZ B;  1REE A;  3WDT A;  2Y26 A;  5CAD A;  1FAY A;  3M70 A;  5GLV A;  4FCA A;  5F6K A;  4CDQ A;  4Q5O A;  2XWJ B;  1RUC 2;  4P08 A;  1G9C A;  1LJ7 A;  5JIA A;  2DUP A;  3SIT A;  5JLV A;  1CQ9 A;  4Q0Q A;  1US2 A;  1Z0H A;  5FJH A;  1NQJ A;  1ZA4 A;  5A1F A;  5AC9 1;  1W8W A;  5T50 A;  1ND3 B;  2NMO A;  2MEV 3;  2WT2 A;  1IKQ A;  1DGL A;  4B7K A;  4N9H A;  4BQ2 A;  3ETP A;  4LIT A;  2HWF 2;  1ULP A;  1BK1 A;  1GZ9 A;  4OHY A;  4Y20 A;  5A1L A;  1HKD A;  5FYY A;  3ZVX A;  5LY2 A;  2ADD A;  1LTE A;  5IFT A;  1BLZ A;  4HAN A;  4HET A;  1WBL A;  2IXC A;  2JDM A;  5DAP A;  4IE6 A;  4CCN A;  4MGK E;  3AM2 A;  1RUJ 2;  1WCD J;  4L2N A;  1PO2 2;  4BM8 A;  4FTB A;  2VOX A;  2RVA A;  1CAV A;  2HWD 3;  4LR4 A;  5C3O A;  2DUR A;  4C90 A;  4ARY A;  1BXH A;  3N7L A;  3ZMO A;  2W08 A;  2XBO 1;  2LW8 A;  3DEM A;  4BB3 A;  1KS5 A;  1Q56 A;  2WDB A;  4JCK A;  1UCX A;  3VD4 A;  4XUN A;  4LO7 A;  3UKN A;  2BOI A;  1UN1 A;  2VQA A;  5CNA A;  1O4Y A;  1DHK B;  3SNM A;  3FC0 A;  2SBA A;  2BTV C;  3OUH A;  3P1I A;  2R06 1;  1WLT A;  3E5X A;  2Y6K A;  3FHQ A;  2E51 A;  1OF3 A;  1YQ6 A;  1LEN A;  2ARB A;  2VMD A;  3B69 A;  3BCW A;  4FPG A;  5DDJ 3;  1V6M A;  1F8V A;  1IKP A;  1LOF A;  1BVV A;  2BUK A;  2D98 A;  3LZZ A;  1SPP A;  1VLN A;  2CAV A;  2P4E A;  3CJI B;  3OGR A;  4Z8B A;  3O12 A;  3QAC A;  4XMA A;  5EFU A;  1W6Q B;  1ENS A;  3M3Q A;  4PCR A;  5KXC A;  1UY4 A;  4QB2 A;  4AG4 A;  1DZQ A;  1XB9 A;  3VBH A;  5C4W B;  5KHG A;  5K7P A;  3KGZ A;  3MF6 A;  1AR9 3;  4F7Z A;  1VMF A;  5I93 A;  4XF3 A;  5BNP C;  4OYU A;  2GC3 A;  2JDU A;  3OYW A;  1VRH 3;  2YRO A;  4XIO A;  1L7L A;  4EE2 A;  4WVM B;  4XFG A;  1GOH A;  3VBF C;  4MGT A;  2JE7 A;  1W39 A;  2A5Z A;  2H0V A;  3MV0 1;  5GZD A;  3DPR C;  3FBY A;  5L7O B;  4XQW A;  4L92 A;  3HBZ A;  3K48 A;  4MX3 A;  5CYY A;  5F8P A;  3SH4 A;  3W59 A;  3ZOI A;  4Q27 A;  1F15 A;  2JG8 A;  1X8M A;  3ME2 A;  3ITQ A;  4BH9 A;  2A70 A;  5T55 A;  4CP9 A;  4QPG C;  4AYU A;  3KLS A;  4XOG A;  5D21 A;  5EHD A;  1V00 A;  5FUN A;  2GP3 A;  2Y8K A;  2N7G A;  2AEZ A;  4QXC A;  1TME 3;  5SV8 A;  1NY7 2;  3DUI A;  5I0S A;  2GNM A;  3AMQ A;  1AL2 1;  3VGI A;  4N8M A;  1W6M A;  3ECQ A;  4HFS A;  4P9W A;  1ZZ9 A;  3T08 A;  3UET A;  4CVU A;  1WLC A;  4FPO B;  2YB7 A;  4H3W A;  4PHZ A;  5CA6 A;  1LRH A;  3RS6 A;  3WHT A;  1RUE 3;  1R08 3;  4KWK A;  1US3 A;  1VBE 1;  3T4H B;  4NHK A;  2YFZ A;  4AEK A;  2P3J A;  3WP3 A;  3VBR B;  1GIC A;  1UOG A;  4B1M A;  4C0B A;  3N4M A;  3LQC A;  2WII B;  4LMF A;  2XJU A;  5DAW A;  2R6Q A;  5EYY A;  1VRH 1;  2JDZ A;  1G6N A;  4DZG A;  5JOX A;  1ZRE A;  4LO6 B;  2XUM A;  2A6W A;  4Q26 A;  5J37 A;  4GB3 3;  1KS4 A;  1DYK A;  4N7I A;  3E6B A;  3IPV B;  4E4S A;  3MIB A;  5KHJ A;  2PAE A;  1X9T A;  4M0N A;  2VGD A;  4ORF A;  4OZO A;  2D3P A;  3ZXD A;  1UAI A;  2Q8D A;  3MIE A;  1LGN A;  1CZT A;  4WM8 B;  3VBS B;  4O9E A;  1AYN 2;  3TEX A;  3WDU A;  5DQ0 A;  2ZEY A;  1W0O A;  1HV1 A;  1WCS A;  3TEY A;  3V0A B;  1FYU A;  5ABJ C;  1RUF 3;  3MUZ 1;  3ZSE A;  5A3T A;  3LPF A;  2ZX0 A;  4GB3 2;  5KHH A;  5C4W A;  3A0N A;  1YYN A;  1VBB 2;  4IGQ A;  4RGG A;  3POI A;  4Y1X A;  1WW5 A;  4DUX A;  1UO9 A;  1OFS A;  1QKQ A;  4A41 A;  3AL5 A;  3AVR A;  2QDN A;  3H42 B;  4BWO A;  4PLO A;  4EWD A;  1SG3 A;  4BQ1 A;  1JTZ X;  4B4Q A;  4CUC A;  4A42 A;  4CUA A;  2A71 A;  5L7O A;  2W1Q A;  4E4Z A;  2A3Y A;  5BUV A;  1UL9 A;  3A0K A;  1OVP A;  3H9A A;  3U4S A;  1S4C A;  4OMD A;  3AP4 A;  2J1T A;  5FKC A;  4EN9 B;  4YVS B;  5JCT A;  3KCX A;  3ZLI A;  3LE0 A;  1UMH A;  4WZC A;  2JB8 A;  4S2H A;  2FDH A;  3WXP A;  3MF9 A;  3C3V A;  2J22 A;  4HOO A;  1NUK A;  2PHR A;  3DYM A;  3VN4 A;  5JOZ A;  1O3S A;  1TMF 2;  3MLJ A;  1W6Q A;  1W9F A;  5C3S A;  1WMD A;  1RUD 1;  2QDR A;  3O1R A;  2DVF A;  4P9J A;  5CFD B;  1N1Y A;  4PQ9 A;  1NQD A;  4HKO A;  3ZSM A;  5LB6 A;  1ASJ 3;  3ILF A;  4KGQ A;  3HD8 B;  4XJ9 A;  4Q0S A;  3GAL A;  3DYO A;  2WO1 A;  3HJR A;  5JWP A;  5FAX A;  2HKX A;  4YM2 A;  1V6K A;  2OZ6 A;  1H6Y A;  1OKQ A;  1A3K A;  4WZF A;  1X33 A;  1MAC A;  1HRI 1;  1SFY A;  1VAK A;  4CEY B;  1QXJ A;  1S1A A;  2DCK A;  3HNM A;  1BYH A;  3NWK A;  4IET A;  3PVO A;  1SZB A;  4Z07 A;  3THC A;  3LAG A;  1QOO A;  2A3W A;  2HJI A;  2Q1F A;  1H6X A;  3RYK A;  1ND3 C;  2AR6 A;  3S30 A;  4CCD A;  4DUV A;  2D43 A;  4XMI A;  1POV 1;  1Q8P A;  2GZW A;  3ZXK A;  5DAB A;  4ZS3 A;  2X5I A;  4QM9 A;  1D7P M;  1QH6 A;  4NHY A;  2VEC A;  1RUI 1;  1E5I A;  1W99 A;  4ZPI A;  5JPN B;  1ND2 A;  3N36 A;  4G4F A;  5A7S A;  3R4U A;  1UX6 A;  1F5F A;  3IAP A;  3RSJ A;  1EV1 3;  4FPC A;  5HCA A;  3K46 A;  2P2K A;  4JQR A;  5CEH A;  3AVS A;  2YV8 A;  5AC9 2;  4K1Z A;  4MGY E;  1BMV 1;  4JHT A;  3HPN A;  1SLC A;  3ZFF B;  1QJY 3;  4Z82 A;  3SXW A;  1VB4 A;  4NR1 A;  1QOT A;  3FHI B;  4QHZ A;  1JZ5 A;  2MEV 1;  1NA1 C;  3MEP A;  3OJB A;  3NV3 A;  4XFC A;  1G9A A;  1H1A A;  3ILN A;  3VBF A;  2WNV C;  5CFC C;  4CA9 A;  1J1L A;  1RVF 1;  3OY8 B;  2XXZ A;  5GLZ A;  3HQX A;  5FKB A;  2VMF A;  1COV 3;  3D8C A;  5AC9 3;  4Q4W 1;  2ARA A;  2VW0 A;  3I3Q A;  3OG2 A;  4D7S A;  1QJY 2;  1O91 A;  1QJE A;  4AFB A;  5EJ3 A;  3I49 A;  4JKL A;  3I2K A;  1W6N A;  1S0D A;  3PJY A;  4NAM A;  4Q4X 2;  2DTW A;  2PHT A;  4XBL A; 
#chains in the Genus database with same CATH homology
 4P5Y A;  1GMM A;  3WQB A;  1PX3 A;  3OGV A;  3GM8 A;  4TXW A;  5C70 A;  1JYX A;  1OF4 A;  1GOF A;  4BJ0 A;  3GXU A;  1UY0 A;  2Y6H A;  2VQT A;  4M4P A;  3A21 A;  2C4X A;  1XPW A;  2YC2 A;  3MV1 1;  3VD3 A;  3K77 A;  4JHZ A;  3FHA A;  2XON A;  3T2O A;  4MGS A;  2VZ3 A;  1NX9 A;  5IFP A;  3E1F 1;  5JUV A;  3VD7 A;  1RYY A;  1IQD C;  3T09 A;  1TG7 A;  3C7G A;  4QB1 A;  3T2P A;  5IHR A;  4A6O A;  3IB3 A;  2ORX A;  3ACG A;  1JHJ A;  2VJX A;  1NKG A;  5DN2 A;  4LHS A;  3EYP A;  3UES A;  1W9S A;  1YQ2 A;  3DEC A;  1KGY A;  5LCW L;  3I2H A;  3HN3 A;  5CZK A;  4XUO A;  3T0A A;  3VDA A;  5JXH A;  4PT6 A;  5JR2 A;  3WNL A;  1BHG A;  4QB6 A;  5IYY A;  4JKM A;  4QX0 A;  3C7F A;  3I3E A;  3WSO A;  5G05 L;  4UI9 L;  2JKX A;  3WF3 A;  2W1S A;  4DXR A;  4CU6 A;  4DEV A;  4ZY9 A;  2R7E B;  2V5D A;  2LS6 A;  1PX4 A;  3JXS A;  2WUH A;  4QX3 A;  3ZM8 A;  3A23 A;  2J1E A;  3OEA A;  2VZ1 A;  3NQH A;  4MAD A;  3WNO A;  4QAW A;  3IDA A;  4GZ9 A;  4W50 A;  3K75 B;  1XC6 A;  3I2F A;  1UYZ A;  3SKJ E;  3BN6 A;  3C7H A;  2B4K A;  3EB7 A;  1UX7 A;  1P8J A;  3LEK A;  2E33 A;  1CX1 A;  4DUW A;  3WEZ A;  1K3I A;  5JXJ A;  3GGL A;  4ZZ5 A;  2EID A;  1DP0 A;  5I0D A;  1XNA A;  2ZXQ A;  3NNG A;  2W91 A;  3NJX A;  2J1U A;  1KEX A;  3LPG A;  2J1A A;  2W3J A;  5EJZ B;  2QQN A;  1PMH X;  2VOT A;  4QDR A;  1DLC A;  3IAQ A;  4D0Q A;  3WF4 A;  2WO2 A;  2KD7 A;  3CZU A;  1K45 A;  1MPX A;  5B4X A;  1T2X A;  4QX2 A;  5HPO A;  1O59 A;  2QQO A;  2VZV A;  3PUI A;  1LNS A;  2J1S A;  2E31 A;  2HYX A;  5IJR A;  3NRU A;  2WBK A;  3SEE A;  4M4R A;  4RN5 A;  4XUQ A;  2L9L A;  1JZ7 A;  4LKS A;  3D3A A;  3I2G A;  3HEI A;  2E32 A;  4ET7 A;  2VZR A;  1JZ6 A;  1TVG A;  1EUU A;  2WZ8 A;  4P00 B;  4E8D A;  4LPL A;  2EIC A;  1UY2 A;  4PQQ A;  2VZQ A;  3ACI A;  4JKK A;  2VZS A;  3WF0 A;  2W1U A;  3DYP A;  1EUT A;  1CZV A;  1O8S A;  4CU8 A;  1GU3 A;  1W9W A;  2DDU A;  2RV9 A;  2WZE A;  3U37 A;  2J1R A;  4BDV B;  3SEP A;  3LEG A;  1JYN A;  3A22 A;  2DCJ A;  2QQM A;  2WAA A;  3HNB M;  3C7O A;  2VZU A;  1W9T A;  1CZS A;  1J84 A;  2QQJ A;  2VC9 A;  4QPW A;  2VO5 A;  2Y64 A;  4ZZ8 A;  1HN1 A;  4PF1 A;  1UY3 A;  2E26 A;  4XUR A;  4E8C A;  1UYY A;  2WQ8 A;  2Y6L A;  4QX1 A;  3J7H A;  2YG0 A;  4GWJ A;  3THD A;  5LA1 A;  2QQI A;  4QDS A;  1UXZ A;  4MOA A;  5FUI A;  1F4H A;  3I3B A;  4DXS A;  1PMJ X;  3III A;  1I5P A;  5JXI A;  2W9X A;  2VZP A;  3A7Q A;  3I97 A;  3OBA A;  5J1X A;  2W94 A;  1DYO A;  3OB8 A;  3WF2 A;  3HOB A;  2BBA A;  5EJ1 B;  2VZT A;  2VZO A;  4L0P A;  3GDB A;  3CMG A;  4CU7 A;  2ORZ A;  4P08 A;  4JX0 A;  4A44 A;  5A1A A;  3CIH A;  1UWW A;  2W1W A;  1US2 A;  2WO3 A;  2Z4F A;  4TTG A;  2VTF A;  1XNT A;  1UXX X;  2X09 A;  4KMQ A;  3CZJ A;  3BGA A;  3ETP A;  3T0B A;  1ULP A;  4A45 A;  5IFT A;  1R64 A;  3WF1 A;  3WNM A;  2B9V A;  4Z2A A;  1WKY A;  2YC4 A;  2X10 A;  5F7U A;  2RVA A;  2CDO A;  2ZEX A;  4ARY A;  2LW8 A;  2WDB A;  2W95 A;  3VD4 A;  4XUN A;  2C26 A;  5DMY A;  3PUH A;  3W5M A;  3P1I A;  3FHQ A;  2Y6K A;  1OF3 A;  2VMD A;  3I3D A;  3OGR A;  1JU3 A;  2BGO A;  2BZD A;  5C71 A;  1UY4 A;  4QB2 A;  3ABZ A;  4AG4 A;  1JZ2 A;  2WYS A;  4KI5 M;  2JE8 A;  2OKX A;  4OYU A;  3WNP A;  3AC0 A;  1GOH A;  4MO3 M;  4BK4 A;  4KWU A;  3MV0 1;  1K42 A;  4YPJ A;  2EIB A;  5CYY A;  2QQL A;  4A3Z A;  3VD9 A;  3VDC A;  4OUE A;  2VR4 A;  2J1V A;  4XUP A;  4CUB A;  3P6B A;  2Y8K A;  5LA2 A;  4BK5 A;  2CDP A;  2VL4 A;  1WCQ A;  2VMC A;  1JZ3 A;  3ECQ A;  2W46 A;  1K12 A;  3CQO A;  2W5F A;  2XOM A;  3T08 A;  2WN3 A;  3UET A;  4CVU A;  3FL7 A;  2YB7 A;  3CDZ B;  1US3 A;  2W47 A;  4W8J A;  2YFZ A;  3MUY 1;  4XUT A;  1SDD B;  1JU4 A;  1W0N A;  2QBX A;  2W92 A;  3LQC A;  2WAO A;  2PQS A;  3F2Z A;  4OZO A;  3I2J A;  3HNY M;  2V4V A;  4ZXE A;  2ID4 A;  1CZT A;  5DQ0 A;  2ZEY A;  2BGP A;  3MO4 A;  3MUZ 1;  3LPF A;  4MGQ A;  2X05 A;  4RYD A;  1UY1 A;  2VQU A;  2WN2 A;  1O8P A;  4DUX A;  1NAE A;  3VDB A;  3OGS A;  4FI9 A;  4A41 A;  1ULO A;  4IUG A;  2VM9 A;  1SG3 A;  4CUC A;  4A42 A;  4CUA A;  2W1Q A;  2J7M A;  1GUI A;  4UAP A;  2C9K A;  3LEI A;  5C7G A;  1UYX A;  2HLE A;  3C8X A;  3WNN A;  2VCC A;  1W8N A;  4OMD A;  2WAB A;  1GNY A;  2J1T A;  4DXT A;  3LE0 A;  1UMH A;  1OD3 A;  4XVH A;  2J22 A;  1GQP A;  1NUK A;  3DYM A;  3K4Z A;  2VCB A;  4QDQ A;  4W4Z A;  2ZEW A;  4UOJ A;  2Y6J A;  2VME A;  4DEQ A;  3K4D A;  1JZ8 A;  2XHN A;  1F4A A;  3T2Q A;  2V72 A;  4XZU G;  4AAX A;  3DYO A;  2WO1 A;  3HJR A;  3CKH A;  2QQK A;  1JYW A;  1H6Y A;  4D8M A;  5LA0 A;  4ARX A;  3VD5 A;  2W87 A;  2DCK A;  3HNM A;  1SHW B;  3WNK A;  1UZ0 A;  3FN9 A;  1CIY A;  3THC A;  3OEB A;  3ACF A;  1H6X A;  4DUV A;  3ACH A;  2RJ2 A;  1D7P M;  2Y6G A;  1W99 A;  2JD9 A;  3K4A A;  3MBW A;  5JMO A;  4LQR A;  3I2I A;  1JZ4 A;  1OT5 A;  3T0D A;  1J83 A;  3IAP A;  5G04 L;  1JI6 A;  3K46 A;  2YFU A;  4GWI A;  4BXS V;  4P02 B;  1L7Q A;  3HPN A;  1W8O A;  3C7E A;  5DPN A;  2XQX A;  1JZ5 A;  2ZEZ A;  1JYV A;  2BER A;  1L7R A;  1GOG A;  2EIE A;  1UMI A;  4CU9 A;  3NJV A;  2VMF A;  4HG6 B;  2JDA A;  1OH4 A;  4A4A A;  5B4N A;  3OG2 A;  4OMC A;  3UNP A;  5EIY B;  4JKL A;  3I2K A;  3SKV A;  3W5N A;  2VCA A;  5HXM A;  5JXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...