2Y6JA

X-2 engineered mutated cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
b'MLVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSLDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
total genus 42
structure length 167
sequence length 167
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y6jA00
3JXSA 1XNAA 1NX9A 3J7HA 2VO5A 3ACFA 4Z2AA 3BGAA 4CU8A 3I2JA 2W91A 3T09A 3ZM8A 4DXRA 1J84A 1UX7A 2YB7A 3A23A 2BGPA 4QPWA 4GZ9A 4JHZA 2WABA 2VZUA 1GQPA 1UYYA 4ARYA 2QQNA 3K4AA 4JX0A 3UETA 2LW8A 3UESA 1GUIA 5A1AA 5J1XA 2XQXA 3U37A 3A21A 2WAAA 5DQ0A 2VZ1A 1PMHX 4CUAA 4QB2A 4GWJA 3IAQA 5DN2A 1CX1A 1H6YA 2ORXA 3FHAA 4W50A 5I0DA 4KI5M 3LPGA 2V5DA 3T2PA 3NJVA 2VTFA 5LA2A 2KD7A 4CUBA 5IFTA 2W92A 2W94A 2VC9A 1JZ6A 4XZUG 3D3AA 3WEZA 3OGSA 4XUQA 1UYZA 2Y6GA 3IB3A 4XURA 3C7GA 2E26A 4LPLA 4AG4A 3A22A 4QX0A 5LA0A 1US3A 2RJ2A 4BXSV 1ULOA 1UWWA 3ABZA 1OF4A 2VZTA 1UY1A 1CZTA 2E31A 5C7GA 1XNTA 2WO1A 2B9VA 4BJ0A 3UNPA 4JKMA 5IFPA 3I97A 3I2IA 3HPNA 1UXXX 5EJ1B 1O59A 5IHRA 1CZSA 2VOTA 3C7FA 4CUCA 4BK5A 5C70A 4ET7A 3VD7A 3WNLA 1D7PM 3IIIA 1TG7A 2Y6HA 3I2FA 4W8JA 2ID4A 3HNBM 3WQBA 2W1WA 2XOMA 4A41A 4QX2A 2VZRA 1GOFA 2J7MA 3CIHA 1DYOA 2B4KA 1MPXA 4UOJA 4RN5A 4A6OA 3LPFA 2J1SA 4CVUA 3BN6A 2WDBA 2C26A 3MO4A 1UMIA 3LE0A 5B4XA 2W5FA 4RYDA 3HJRA 3I2GA 3I2HA 1L7RA 2Y64A 3VDAA 1UZ0A 1CIYA 2X09A 4OUEA 3LQCA 1JZ3A 4KWUA 4MO3M 3T0AA 2XONA 2VR4A 3NQHA 4YPJA 1OH4A 2VZQA 2BERA 2EIEA 1DP0A 1PX4A 4UI9L 4QDQA 2VMFA 3K77A 4QB6A 3WF4A 3WNOA 2QQLA 4P00B 4XUOA 4BDVB 2RVAA 1KGYA 3VD3A 3W5NA 4OZOA 1K12A 2VZVA 3WNKA 2W1QA 1ULPA 1DLCA 3MUY1 5DPNA 3SKVA 3CQOA 2VCBA 5EIYB 1JU3A 1W9WA 2W46A 1NUKA 2VM9A 3AC0A 3THCA 2ZEWA 3OGVA 2JE8A 1UY0A 3PUIA 4PQQA 3SEEA 4XVHA 2WAOA 4ZZ8A 3WF3A 4QX1A 1JYXA 3CDZB 5JXIA 3T08A 2WBKA 3FL7A 2VCCA 4A4AA 3DECA 3VDCA 2Y6KA 5G04L 1JYVA 4LKSA 4A42A 3C7OA 2W87A 3A7QA 1BHGA 2WN3A 3I3EA 3GXUA 4E8DA 5FUIA 1W9TA 3I2KA 2VQTA 2J22A 3P1IA 4GWIA 2W1UA 1F4HA 2V72A 2VZOA 2Y6LA 3GM8A 1WKYA 1NKGA 1JZ8A 2J1RA 1J83A 1H6XA 2ORZA 3OGRA 4LHSA 5JXJA 1GOHA 4CU7A 1L7QA 2VZ3A 4DUVA 5JUVA 1O8PA 2ZEYA 2VMEA 3I3BA 2ZEZA 4QX3A 3HN3A 1OD3A 3LEIA 3VD5A 1UXZA 4DUWA 2X05A 2WO2A 1EUTA 3T2QA 3OEAA 3OG2A 4E8CA 2VMCA 3K46A 3SEPA 3WF0A 2EIDA 5JXGA 1GU3A 2JD9A 2OKXA 4A44A 2QQMA 2WZEA 2DDUA 4TTGA 3HNMA 1UYXA 4M4RA 2YFUA 3IAPA 4JKLA 4XUNA 3CMGA 2W95A 4D8MA 1T2XA 1GMMA 2WUHA 4ARXA 5C71A 3K75B 1GOGA 2QQKA 1YQ2A 2W9XA 4D0QA 4PF1A 1HN1A 2VZPA 4DXSA 1W9SA 5HPOA 2XHNA 5LCWL 4TXWA 1JHJA 4CU6A 4OMDA 1PMJX 2J1TA 5G05L 3SKJE 4MGSA 2V4VA 4PT6A 1JU4A 2J1AA 2HLEA 1RYYA 4OYUA 2DCJA 2YG0A 3ETPA 1SHWB 3OEBA 5LA1A 3T0DA 4UAPA 3K4ZA 2VL4A 1JZ5A 2QBXA 2JDAA 4JKKA 3T0BA 1LNSA 2WN2A 2BZDA 4L0PA 2BGOA 2R7EB 4P5YA 4KMQA 1UY3A 1CZVA 5DMYA 1EUUA 1UY2A 2W47A 3WF2A 3ACGA 2WYSA 4CU9A 3C7HA 3IDAA 1GNYA 1K45A 1JZ2A 3MUZ1 2E33A 2QQOA 3NRUA 4A3ZA 3ECQA 4P02B 3VD4A 3HNYM 1I5PA 2C4XA 2VMDA 3MV01 2WZ8A 2VZSA 3WF1A 1O8SA 3OB8A 3EB7A 3ACHA 4FI9A 4QDSA 4DUXA 2VJXA 2X10A 4W4ZA 5CZKA 3F2ZA 2VQUA 2VCAA 3GGLA 4XUPA 4BK4A 2J1VA 5EJZB 2CDPA 5F7UA 3PUHA 5JMOA 3LEKA 4A45A 3VDBA 5HXMA 3CKHA 2J1EA 5IJRA 2ZXQA 2PQSA 1IQDC 1W99A 3WSOA 3I3DA 2Z4FA 4ZXEA 3HEIA 5CYYA 2EICA 3CZUA 3OBAA 2Y8KA 3ACIA 3MV11 3FN9A 1UMHA 4QDRA 4DEVA 1KEXA 2WO3A 3WNNA 3CZJA 1K42A 2EIBA 2L9LA 3FHQA 3P6BA 3WNPA 5JXHA 4AAXA 5B4NA 2JKXA 4QB1A 1W0NA 2E32A 4HG6B 3C8XA 4MGQA 1PX3A 2ZEXA 4ZZ5A 2YC4A 1F4AA 1XC6A 2RV9A 3K4DA 1JYNA 2Y6JA 1TVGA 1NAEA 3HOBA 1XPWA 2QQIA 1OT5A 5JR2A 2YC2A 1WCQA 2BBAA 2LS6A 1SDDB 3T2OA 1JYWA 3C7EA 2QQJA 4QAWA 3EYPA 3E1F1 4DXTA 4MADA 1R64A 3DYPA 4DEQA 2HYXA 1US2A 1SG3A 3MBWA 1JZ4A 1W8NA 1OF3A 2J1UA 2YFZA 3LEGA 4XUTA 4P08A 2CDOA 4MOAA 3NNGA 4OMCA 4ZY9A 4IUGA 3DYOA 1JI6A 3GDBA 3DYMA 4LQRA 5IYYA 4M4PA 1P8JA 2DCKA 1K3IA 1W8OA 3THDA 3WNMA 2WQ8A 2W3JA 3NJXA 1UY4A 2C9KA 3W5MA 3VD9A 1JZ7A 2W1SA
chains in the Genus database with same CATH superfamily
1LOAA 1NLQA 3E5XA 1DGWX 4XXAA 4A7ZA 1AR72 4ISRA 4Z2AA 2G9FA 4XFCA 2FDFA 3BGAA 3LWCA 4XFFA 4LO5B 2W91A 4DXRA 4XF3A 2FD8A 2H0BA 1OURA 4EN9B 4PI0A 4AAPA 4JHZA 2WABA 4FQ4A 4JDOA 1UYYA 5K0UC 4ARYA 1O91A 2QQNA 4JGYB 4PDWC 4Q4X1 3K4AA 1SLCA 2NLRA 4TSVA 3UETA 3UGGA 3BTXA 5FMCA 5J1XA 1D4M3 4K1YA 3U37A 3WXPA 2YU2A 3PVNA 4INDA 5A32B 3TEXA 5JOXA 2ILMA 1VBA3 2Y6FA 4AVSA 5GZDA 4BIFA 4YG3A 1PVC3 1Y9GA 2XR4A 1VE0A 4FCAA 1PO13 3MI8A 1MACA 1WA6X 4MH0E 4COYA 4DY3A 2D43A 4IE0A 3CU7A 1SMVA 2H6BA 3FLRA 3RI8A 4XFIA 4QQHA 4YRDA 2UWCA 1WBLA 1SBFA 4W50A 4AYUA 4IGOA 4FPYA 4KI5M 3LPGA 5D8AA 1GICA 1QH7A 1PHMA 1REDA 4QKNA 5DZGA 2FBEA 3VDDC 3LIGA 3NJVA 1NE6A 5FBJA 5FP7A 2PHUA 5FZMA 4Q1PA 4AGGA 2KD7A 4PIZA 4CUBA 1EV12 4AI2A 1VMFA 4EWEA 3DGTA 4FAHA 2VOVA 3ZMOA 5FPUA 4BISA 1H2KA 3ZFFC 2KM2A 4OHZA 5B2GB 5FZ7A 3O1SA 4PI2A 5FY4A 2E26A 1G9BA 4LPLA 2ZX0A 1EAH2 4LHLA 4IE5A 2BU9A 2HWC3 4XPVA 4AGRA 3N9OA 1US3A 1QHDA 2RJ2A 1ULOA 2GN7A 3PJQA 5C33A 4XIKA 5F5IA 4YNIA 1OPMA 2VZTA 3ZSKA 4CE8A 1CZTA 2XLAA 4F3JA 1XNTA 1POV3 3PL0A 1BYHA 3SH5A 3J8F1 2WO1A 1K5JA 3CHXA 4JKMA 3PVEA 4UFMA 1Q8VA 3I97A 3I2IA 1IHMA 1UXXX 2PLV3 2ADDA 1NA1A 4TWTA 5GLTA 2Y60A 5JZGA 1NT0A 1SDWA 1ZZBA 2VOTA 2QDNA 3FLPA 2MHFA 4BK5A 5C8CC 5C70A 4WM7B 5T5PA 5IVFA 1DZQA 1Z0HA 1FAYA 3IIIA 3POGA 3OJBA 5T5LA 1AR61 2B39A 4CDQB 3OYWB 1UU5A 4UW5A 4Y1ZA 4IEOA 4A41A 4QPIC 4N53C 4YSFA 1QOSA 2FCTA 3I59B 1F31A 5I0TA 2UURA 3KSCA 1D2SA 1ZZ6A 2JIJA 2VXRA 3AXDA 3OPWA 4IV1A 1PNFA 3IIAA 1MPXA 4UOJA 3RMXA 5BNNC 2BGCA 4GKYA 4OQ8A 2J1SA 4HK8A 1OVSA 2EXIA 4CVUA 5JLVA 3I2DA 3MO4A 2F17A 1V0AA 1TEIA 1UMIA 4QHOA 5A80A 5AVAA 2W5FA 1F2NA 4FPCA 2EAKA 1LOFC 3UJOA 1RUJ2 1X50A 4LBQD 3O0WA 4NAOA 5FY7A 3ZXGA 1LHUA 1L7RA 3H9AA 1C8NA 1EPWA 1FPN1 1UW8A 3KVAA 1YC61 4PQ9A 5HCBA 2HWE2 4CA9A 3JB8A 1J59A 2X09A 4DY5A 4KH9A 4XIOA 3LQCA 1CAUB 4NPRA 1QXRA 1XE8A 4CDXA 2D5HA 3ZDSA 5IK5A 4GJZA 4GMP0 1OFSA 4ISQA 2JG9C 2R042 1HRV2 3USSA 3WT3A 4CCEA 2EIEA 1DP0A 4S2FA 3GALA 1LHOA 1OQDA 1CQ9A 4AEDC 3BTAA 4QDQA 4DMIA 4META 4Q4X3 2VMFA 1S0CA 1ULFA 3WF4A 1Q43A 2Q4SA 4WVMB 4XJUA 3PDQA 4G4FA 5L9VA 4P00B 1JOJA 1O5UA 4COZA 5FXVA 1B35C 1CJDA 3AKQA 1HKDA 4IV3A 3W5NA 2ARAA 3LD8A 1K12A 2VZVA 2W1QA 1O4YA 4H7MA 1ULPA 2UY8A 5I0UA 1T6GC 2YGMA 2GALA 3MUY1 4AW7A 1JYIA 1IS3A 2V4AA 2WNUB 3JD72 4CCLA 2VCBA 5L7OB 1JU3A 5FBZA 4UWDA 3EJKA 4GH4A 2V73A 1HJFA 2DYCA 5CFCB 3WNXA 2ES3A 2YY1A 4FFIA 1QJX3 1FT9A 5K0UA 5EZWA 5FZFA 1UY0A 3MW4A 1DYPA 3PUIA 4W65A 4PQQA 2F4PA 2A75A 1YNAA 4QKFA 1PMIA 1YRZA 4YM0A 3TN91 4CP1A 4EWDA 3I2OA 1PZ8A 2BBVA 3Q8AA 4RQPC 5GKAC 4XABA 4L92A 5C5TA 1HDKA 1CAVB 5DAQA 4I01A 3ZYGA 1C1FA 4BCUA 4YFZA 3DF0A 3NV4A 1R1A1 5FZ4A 3T08A 2VCCA 2LUWA 2VXJA 5T50A 2I74A 4A4AA 3DECA 2X8KA 3VDCA 4CDUB 2AZ5A 1ULGA 1JYVA 1VBD2 5FUNA 3C7OA 4CEWB 1ODNA 1OHFA 2W87A 4BQWA 1BHGA 2ZAHA 1S55A 4PBOA 3OGJA 1C57A 2Q8EA 4HN0A 4UT5A 2ZS6B 4EE2A 2XB6C 3GXUA 1ZRRA 3BU0A 3MW3A 1KDMA 3V0AA 1L7LA 3NWKA 4PCRA 3M3OA 5E16A 1I3HA 2CSGA 1ZBA1 2HEWF 3VDDA 4ZPIA 5HCHA 4FPOB 2UWAA 3IDCB 2E7TA 1GWKA 2VZOA 3H0OA 4Y5TA 4CEYA 5ABJC 1PGW1 1R082 1WKYA 1XYOA 3ZFFA 5EV7A 4CCKA 3NV2A 3GYDA 5FZEA 4MYEA 1X8EA 4URAA 2A6WA 3OGRA 2CGPA 4FFFA 1RUOA 1MQTA 3ME2A 1GOHA 2WZR3 4CU7A 3ZVXA 4Z1VA 2BRTA 2VZ3A 1Q56A 4DUVA 2XH6A 1YFYA 4Q27A 4WM8B 3MEPA 2VMEA 1VPHA 1V70A 2YMZA 1OD3A 1BBT1 5E8AA 3VKOA 1RUD1 1VB4A 2HWB2 3HQRA 2WYFA 1UXZA 4HPKA 4A7KA 1AXZA 1K5MC 3H7YA 2BWCA 1VRH2 3H1YA 4Z2WA 1CPMA 1AZDA 3BIWE 2XJTA 1QJEA 5JI9A 4YWAA 4LMFA 1EUTA 2SBAA 3GCXA 5FZ8A 2DBNA 3N9NA 2LALA 3J7NA 1Z7S1 1BXHA 1FI2A 1R092 2YHJA 5CBLA 2A6XA 4D7TA 5FPAA 3POIA 4L97A 4ZONA 1BK1A 1OLMA 2GNTA 3AMMA 2UY9A 5DAWA 3VBRC 3SEPA 2EIDA 1PIV2 3AP5A 4N43C 4BE3A 1RUE1 1RUI3 2DVGA 2ZHLA 1W9FA 3R0RA 4IXLA 1GANA 5ERLA 2OKXA 1S2KA 3MZHA 1LGBA 3VV1A 1AF9A 2XJUA 3T1MA 4PLMA 4XQWA 4TTGA 1WMXA 4QPIA 4M4RA 4QM8A 3LFMA 3V0BB 3KMHA 4MZUA 4JKLA 4WZFA 5HV4A 4CP2A 5FREA 1RUF1 3O7OA 1G6NA 1T2XA 4V2WA 2WUHA 3LZZA 4ATEA 5FO8B 1H1MA 2ZBJA 1ACCA 2VY0A 2GN3A 5A1FA 3UGFA 1OA4A 2PA7A 4EN7B 1O3SA 2YUEA 4EZHA 1R1ZA 2N7GA 4PF1A 2IXCA 4UFIA 5FY0A 3WG2A 2KXLA 5KBFA 1KRIA 3FFQA 3P3PA 3J4UH 1FMD3 1SBDA 4DXSA 2HJIA 1W9SA 4XETA 3I3QA 1MVQA 1RUC1 4TXWA 4AQ2A 4I09A 1PMJX 3VHNA 3H3UA 4YZ1A 2V4VA 5C8WA 1AYN1 3MICA 3O5SA 4PT6A 4KL1A 1COV3 4BWOA 2EAAA 1VAVA 1RYYA 1VAKA 4RR3C 5A3OA 1C1LA 2JG9A 1E5HA 1FOD3 2WQ4A 1Y3TA 4KG0A 2XUEA 5E1RA 1DBNA 2YG0A 4ES9A 1SHWB 1NY71 3K4ZA 2VL4A 4WM7A 1T6BX 3JQXA 4X8PA 3VHPA 4AHZA 5FYYA 4A2UA 3H42B 1OSGA 1VB2A 3OSDA 4GWMA 4P9YA 3SCHA 1H8VA 5I93A 2DF7A 4C90A 2BGOA 1B35A 1GFF2 3W9AA 1UY3A 4FSJA 1TNRA 1ZZ8A 2VBBA 1CZVA 2NN8A 2XGXA 4HN1A 5DMYA 4BQ1A 4C1XA 1W05A 3DKWA 4GWNA 3ACGA 2WYSA 2HWD3 4QGLA 1X9TA 1GNYA 5EFUA 1UOBA 2HWF2 1JZ2A 2E33A 4O9GA 4A3ZA 1W2OA 5T5JA 4YW4A 4D6QA 1PZ7A 3LEMA 4YW5A 5DDJ3 4FAGA 2A71A 3KV5A 2BV4A 4DQAA 1QY4A 2O8QA 1BQPA 1XSRA 2WZ8A 2BDRA 3RYRA 1KFUL 4AVTA 4LITA 4COWA 4NIIA 5C9AC 1CAXB 4FI9A 3MHZA 1ZBA3 1I6XA 4P9XA 3WDWA 4RQPA 1GBGA 3GGLA 2VTXJ 4NO4A 4BK4A 3ZLIA 4YW2A 4AI0A 5EJZB 1W6PA 1UIJA 2FQPA 4M01A 5F7UA 3O1OA 3BPZA 3PUHA 4QGNA 5JMOA 1YQ8A 4LO8A 3RYPA 1RVF1 4IEXA 4YG6A 3D8CA 2JDKA 1BMV1 1C8M1 2XBO1 4XQDA 3OOXA 4S2DA 5HXMA 3BKZA 5I8SA 1LOBA 1AX1A 4LK7A 2ZXQA 3URFA 4AFCA 4FTSA 5FZ1A 3WSOA 4R9AA 3ZFEB 3I3DA 3U1XA 5FPXA 2Z4FA 4TN7A 1H8TC 4ZXEA 3J9SA 4GULA 3SC7X 3N36A 1ZBE1 5FZOB 5L36A 2EICA 3ZSLA 5ABJA 1CVNA 2VQ0A 3VL8A 1MS8A 5CFDC 3ZXKA 1HLCA 1PGSA 4AF9A 4OVEA 3ACLA 2GC0A 1LCLA 1RMU1 3OBRA 4DEVA 4OHYA 1KEXA 3WCSA 3WNNA 1AXYA 3M3QA 3KWVA 4RGAA 1K42A 2VNVA 4W6XA 3IBMA 1YI7A 2NPIA 1UCXA 2MEV1 3NNJA 4M0HA 1ASJ2 3FHQA 5LK7B 2D98A 2YBKA 2RR12 5BNOC 2BNOA 3LDRA 4O65A 5DXDA 1K5MA 4CCCA 3MIFA 4KGQA 4HG6B 3Q8CA 2RS52 5A3NA 1STMA 4JHTA 5CKMA 1RUF3 4FPFA 3O1PA 4R8HA 1RUG1 3VZNA 3B3QE 5EPAA 4ZZ5A 4EWAA 3JB4C 2TBVA 2VW0A 5JMCA 4OQ9A 3LFIA 3RS6A 4CCMA 1W6NB 1WLCA 1ZRFA 1AR92 1PO23 1ULEA 1W8FA 1NCRB 3DXTA 2VE1A 4Q4W3 1TVGA 1TME1 5DAXA 1NAEA 2QUOA 4ITCA 1G7YA 5LBEA 4OFGA 2Z2SB 2ZA9A 2ZZJA 2YC2A 4IEWA 2P6CA 2R063 1A8DA 5LASA 5LY1A 3CJXA 4XYXA 2R071 4O61A 3E1F1 1LHVA 2RJKA 1XNDA 1HX6A 1TMF1 2HYXA 3NJYA 2B7YA 1DLLA 1X9PA 3AVSA 3AYDA 1AL22 4CDWA 2E7AA 1V6IA 3MBWA 1WLWA 4Y1XA 4ZXKA 4LBMA 4BQ4A 1W8NA 3POFA 3RVHA 1NCQB 4HBNA 3TNPB 4CXWA 2JEMA 3VGIA 1W6MB 4GB31 2J1UA 3U07A 3TRSB 5ANQA 3MYXA 5FY9A 4IEUA 2Y0IA 2JDYA 1H4HA 2Q5TA 4FXKB 1RUNA 1GSLA 1OVPA 3GZTB 1AR83 2WR9A 4IUGA 3GDBA 3UKNA 2UU8A 1J58A 4Y1VA 2XL9A 4Q4V2 5IYYA 5J3UA 5SV8A 4QX7A 1WCSA 2FDIA 1P8JA 1UU6A 1MVEA 3PUQA 2DCKA 3KCXA 1M4WA 3O12A 3QH7A 2Z69A 3WG4A 5A3TA 2ZMLA 2PFWA 4UBHA 2B42B 2OPKA 1PK6B 3KM5A 4R4ZA 3U14A 1IKQA 2RM21 2ARCA 3OPTA 4IL7A 4MGIE 1JZ7A 3M1HA 3RI9A 4EQVA 2DVDA 1Y4WA 3JXSA 1MEC1 4HANA 3VBOB 3VBFA 1WA4A 1ZRCA 5EHDA 4FPLA 3KS7A 2WS91 2BFUS 4ES8A 3I2JA 3ZM8A 4J1XA 1J84A 1UX7A 1V6NA 4AK3A 2UYAA 1QNYA 2GU9A 1W6OB 3JBG3 3OBTA 4M3CA 5BNQA 4YW3A 1IG0A 1GQPA 1D2QA 1W2NA 3AMQA 5FP4A 4E4HA 1H2LA 5FUPA 3JCIA 3VBSB 4X8NA 3ES4A 2ENRA 2XBO3 3UESA 3GCWA 4LIVA 3S57A 4LULA 2UWBA 1W28A 2XQXA 3BALA 4IQPA 5EWSA 4FFGA 1UPSA 2P17A 2WT1A 4X6RB 1QU0A 4FPJA 5EYYA 1IS5A 5K4LA 1OOPC 2JDZA 3QLQA 4XBNA 1PMHX 3U0ZA 1VR3A 4XAAA 3VZOA 5GZFA 3AP4A 1SZBA 3ZYRA 2VUAA 1D4M1 1WW6A 2RS13 1CX1A 1BVVA 1AYM1 4QWNA 5DG1A 4LNVA 2ORXA 2WFF2 4XDOA 4K7JA 5BYNA 3FHAA 1VBA1 4Q4Y3 4YYOA 4LBOA 3BIEA 4Y1UA 2JXAA 4B7EA 1PVC1 4QU1A 2OUHA 3ZYFA 3U78A 1PO11 3ZIWA 5AVPA 3T2PA 1DHKB 3WR0A 4IEYA 4TLGA 5J7MA 2VTFA 4NOTA 1LEDA 4OI1A 4Q29A 3VKFC 5IFTA 4MXVA 1HRI2 2D6PA 4U36A 5JI7A 1YJKA 1CAWA 4N7UA 4XUQA 2NM1A 4Y33A 1O3TA 5IATA 3O1VA 1UYZA 2Y6GA 1H8TA 3RRDA 3CO2A 3WDUA 2EIGA 4HLTA 1ND2A 2XPJA 3HQXA 1QNWA 1U5YA 3A0KA 4UFJA 5A6XA 3HT2A 2ZGOA 4BXSV 5IT6A 5CFDA 4IEVA 5HXVA 5IVVA 3ABZA 4MG2A 4DXZA 2Y0OA 5BNPA 1JODA 4FVVA 3ZXLA 3S7IA 5C7GA 3OD0A 2ZACA 4CP9B 1DQ4A 4Q8KA 3TYJA 1DCSA 2GMEA 3LAGA 5FPVA 1TME3 2HWC1 2B9VA 4BJ0A 3BCWA 1N1VA 4IDZA 1YLLA 5FZBA 4Q4X2 5FLIA 1FXZA 3HPNA 1GNHA 2OYZA 2NYYA 5EJ1B 1O59A 5IHRA 2R0FA 4CUCA 4JC1A 5KR7A 1POV1 1I9RA 2ZX3A 3T4HB 4ET7A 2Y26A 3VD7A 4GIQA 5A33B 4XZPA 4IV1C 2PLV1 4W8JA 5FJKA 3LIHA 5F5QA 4E2GA 1CWPA 3WQBA 4AVVA 2W1WA 4Y3OA 1ULDA 4P9IA 4P9GA 5FZDA 1PZ9A 2VZRA 3H50A 4Y5Z0 1KXGA 2J7MA 4HL0A 1DYOA 2R0HA 5JWPA 2B4KA 3BI3A 3S5AA 1V6MA 1HXS2 3ZFEA 5A6ZA 1XE0A 3BN6A 2WL1A 3LGRA 4AGVA 5JIUA 1W0PA 2WNVB 1IKPA 2MPFA 2ZGQA 2ERFA 1OUXA 4I0WB 3USUB 4AEKA 2C6SA 4AI1A 4RYDA 4RL7A 2V09A 4MXWA 4Y26A 3WVJA 4LXLA 1H1AA 4AWDA 4PF5A 4CDXC 2K9ZA 4ONUA 3ZN6A 5A7NA 4LBKA 1UZ0A 1JW6A 4PDWB 3INAA 3VLBB 1MEC3 4LEJA 1AL0G 3OY8A 5FJHA 3ZO0B 4AI9A 1X7NA 1YFUA 2E63A 2IUWA 2OVUA 2P2KA 3D6EA 3QCWA 4XACA 2HEYF 4KWUA 5FP8A 3WQ0A 4C91A 1JZ3A 2WLQA 3LOIA 4AHYA 4E4ZA 2XONA 3OUJA 3WW3A 2VR4A 4YPJA 3J8F2 1EY2A 2D40A 5FXWA 2DU0A 2VZQA 2BERA 5DUXA 3APBA 3WDVA 5C4WB 1PX4A 1VP6A 4AOCA 4UI9L 5GZEA 2TEPA 2QNKA 1VLNA 2IXLA 4I2OA 3K77A 3U4XA 1OLRA 1QEXA 4NPMA 2QQPA 1OQEA 3WY6A 3ELNA 3ZXFA 4NPLA 4XUOA 2WQZC 2A3WA 1SLAA 4LO7A 5KXDA 4ZU5A 1W8WA 4GH4C 2SLIA 4OZOA 2G9ZA 1DLCA 1QJFA 1AR62 1RJ7A 1O6UA 1VBC3 5H9QA 3CQOA 1RUH1 4AI3A 4TYSA 1SQ4A 1W9WA 4H55A 4LO6B 5FMBA 1AYM3 3ZXAC 3GHNA 1CGPA 2ZX4A 2FZ2A 5FMOS 4BH9A 4HK9A 1WW4A 3SNMA 2VVDA 4GA9A 3THCA 4YM3A 1W90A 5F39A 4YFWA 3EXUA 5ACA1 5HV0A 2A6ZA 3SEEA 5BV6A 5I8TA 4AZZA 1NCQA 3AFGA 3WW1A 3KHBA 1JYXA 2HEVF 3Q8FA 3ZSJA 3IT8A 2R1DA 4FOYA 4KBBA 5JXIA 1H9PA 1QJX1 1DGLA 2WIIB 4LBQA 1OOPA 2QFEA 3AFKA 4QXKA 1MZEA 1Q8PA 3J7MA 3WUCA 4G3YC 1HIXA 1FPN2 5G04L 1OLME 4LKSA 1N1YA 4KGGA 4XHBA 4A42A 1QXJA 3M2MA 4ASMB 1GNZA 2QVSB 1VBB3 3HIFA 5EXOA 3RQ0A 3VHRA 5FOJB 4CEYC 4XEZA 1DGRA 4E2QA 1HV0A 2DCYA 5KWRA 2D7FA 1PGL1 5KXCA 1WZXA 1LB2A 3I2KA 1YWKA 5C8CB 1FNYA 3VZJA 1SLIA 4UF0A 4I3PA 4GWIA 4N8MA 1MQTC 1F4HA 2A3YA 3M3IA 1RL3A 4QM9A 3GM8A 3KT1A 1MZFA 3BB6A 3CJIA 5A7SA 3LOBA 4LUMA 2ZGSA 4N53B 5T55A 1G8WA 3M70A 2OUJA 2VOKA 1BKZA 4K40A 5FK7A 5JXJA 4C8DA 5L19A 3VBHB 5FXZA 4D6RA 1W8ZA 2AEZA 1QGLA 3RJ2X 1W6OA 2I07B 1N1SA 4LHKA 5BNNB 1HV1A 4R9CA 3TOJA 1MS5A 4LIUA 5CISA 1RXFA 4IEQA 4PHZA 5FO7B 5F2WA 4QPGB 4SBVA 3VHOA 3VD5A 5LBBA 2WZR1 5L73A 1LECA 3KCCA 3NV3A 4CXYA 5FP3A 3HD8B 1EP0A 4IE4A 1DGWA 2FMYA 1NXMA 3NKGA 4N9IA 2ZHMA 4XF1A 4YVWA 5FYVA 5IVYA 5A7WA 3TN92 3ZPOA 5AFBA 1SEFA 3CL1A 3PMSA 2GC1A 4GD4A 3KGLA 1BEV1 3WF0A 2FZ1A 4XFBA 3NO8A 3RZMA 5FYTA 1GU3A 2JD9A 1R1A2 2VMHA 5J09A 1WW7A 2QQMA 1GV9A 4LORA 2VNGA 2D3PA 3O1MA 2VQAA 2ZOEB 3HNMA 4DPNA 1L3JA 4RGGA 4AEDB 2YFUA 2VAUA 4XCAA 2OQ7A 3AVRA 4XUNA 1Z78A 3AL5A 5FZ0A 3A4UA 1O3RA 2WSUA 1RUI1 1GMMA 3ALQA 2LROA 4OULA 5C71A 4Y4YA 3K75B 1UL9A 1DZRA 4XXPA 5ANNA 2R6QA 3VBUB 3AZWA 4HMZA 2QQKA 5DUWA 3UV9A 3D5OA 3W59A 2PQQA 1PNGA 2BUKA 1GZWB 3IMNA 3LCPA 3MGUA 3IKWA 4ZU7A 1IGOA 1W9YA 3HMYA 1LU2A 1RTVA 3T1LA 5F37A 1JUHA 3I3MA 1UX6A 1V9U1 3H7JA 1JHNA 4Q0UA 5A1LA 4UYBA 1WUVA 2G9GA 3AP7A 2EVXA 5LCWL 4BLIA 3N9QA 3IMMA 3ZN5A 1JHJA 4CU6A 5LRRA 1QXPA 1NZIA 1W03A 2AC1A 4MGSA 4WM7C 4P9JA 4Q8LA 3NAPA 1F5FA 1OXCA 5C3PA 1RUH3 1BBT2 2J1AA 3K48A 4U2AA 4COVA 1RUD2 1UMZA 3I8TA 2DCJA 1FMD1 4FPEA 4OYUA 5IWFA 5L9BA 5LRSA 5CB7A 5LA9A 5LA1A 3T0DA 4HZFA 1JZ5A 2QBXA 3R4DB 2JDAA 3DPRB 4BHPA 3T0BA 4IEZA 3O14A 5JOYA 1GZCA 1Z7S2 1GR3A 1AJKA 2PHRA 1COV1 2WLPA 2WN2A 3WP3A 3ZPYA 2JDUA 2R7EB 3W20A 1FOD1 5FDBA 3D0SA 4XC9A 4HXCA 4OI0A 4QHZA 1RUE2 4B7KA 1B09A 2HBTA 4K6BA 2YPJA 3WF2A 2XUMA 2KA3A 3MUZ1 1D0HA 2QQOA 2HYKA 3VD4A 3ZFGB 4B1LA 4LK6A 2BVVA 3N7LA 4BPZA 1NYWA 2VMDA 1UQXA 3K51A 5JSOA 4PJYA 3H1MA 1RUF2 1F8VA 2VZSA 4CPBD 3WG1A 1O8SA 1LOGA 2CWMA 2HWD1 3ACHA 1OFNA 4LOSA 2VJXA 2X10A 1S0BA 2WNEA 3E5UA 3M7AA 2A73B 5DDJ1 3H1WA 2GDFA 2CDPA 4P9WA 4R9DA 3V56A 4RS5B 1C4RA 5HCFA 1JUIA 4OUMA 3EMRA 4M3CF 4YZ2A 1XYNA 2FDHA 1RUC2 1ND3B 4DO0A 3BOWA 4NHXA 2ADEA 1UOJA 4YM1A 4LT5A 2CWSA 4V1PA 1AYN2 4H7LA 4DRRA 3ETQA 3TAYA 5F5AA 3POBA 2MNGA 5AC93 1IQDC 1W99A 2X5IB 4JZRA 1ZZ7A 3VBRB 4BLJA 1DQ5A 3FX3A 3WCRA 5KHJA 1N47A 1OC1A 1OMIA 3HEIA 4B4RA 2WNUC 4N43B 2IXIA 1J3PA 2OIIA 1NY72 3ZN4A 4QXHA 4XJZA 3OPZA 4YGBA 5IK8A 4QX8A 5KHKA 4P14A 2WFPA 2A6VA 4XF4A 5F3GA 2OT7A 4F8AA 2ZGMA 2RS33 4JGYA 5ACA3 3MV11 2WINB 3FN9A 3IZOA 2NP0A 3KF5A 1DIWA 2YYOA 3FFZA 5CKNA 5KC5A 4MHRA 2Q30A 1CESA 1KQRA 1BEV3 1PVXA 2D6LX 2F4LA 2RDNA 4NHKA 4XQ4A 3RMYA 2EIBA 2L9LA 4YGCA 5A32A 2EXKA 5D2AA 1W3VA 1Q8QA 2DTWA 2E6VA 1AR73 3SH4A 3BVCA 3TWIA 5DZEA 2YPDA 3AP9A 2B46X 1BCXA 3FHIB 3POYA 3E6DA 4UBGA 4UFLA 4BM8A 4CEWC 1QQP1 1SCSA 2FCUA 1RGSA 1PX3A 2ZEXA 4FO9A 3K3OA 1YJLA 2ZGTA 3EBRA 3ILFA 2RDSA 3NKTA 1XC6A 4HKWA 1BVP1 1JYNA 3LA2A 2PMWB 2QKDA 4XCBA 4HVQA 3IN9A 2WRAA 3HOBA 3LDKA 4RR3B 1JTZX 1V9U3 1WLTA 2BFUL 2DVAA 1RVF2 4Y22B 4OZXA 4DFSA 3ZYJB 1C8M2 4CDWC 3MLLA 1SDDB 3FZ3A 3C7EA 3N7MA 2RDRA 4QAWA 4FXGB 4MADA 5IVCA 1PO21 2ZGPA 1WD3A 4M3CE 4KQ7A 2PHFA 5B4NA 1US2A 4Q4W1 1MR5A 1SG3A 1F15A 4BA6A 4XTPA 1MS4A 4XF0A 5IK7A 4MHUA 2E51A 1ZBE2 2R061 3TBDA 4NN0A 3C2UA 1EV13 4Q0QA 5FZCA 2YROA 2ZMNA 4P08A 1GP4A 3VBHA 3WOGA 1BJQA 1CN1A 3D4KA 4ATFA 4EZ4A 2IFRA 3HQUA 4YVSB 5FY8A 2A6YA 4ZY9A 2G4IA 1LJ7A 4NWVA 1RMU2 2G1MA 1JI6A 2FCVA 2Y33A 3DYMA 5C3RA 2C1FA 3ITQA 1EAH3 5GZGA 4M4PA 5LY2A 5A6YA 1LGCA 1KDKA 5C9AB 2MEV2 2W2IA 4Q5OA 3BTZA 1W8OA 5C6CA 1ZVFA 3THDA 1YYNA 4OLLA 3WNMA 3VBFC 5F1RA 3B7MA 1UOFA 2XMLA 1VALA 1AR81 1RC6A 4CDQA 4HOOA 1BK0A 5CADA 4Z82A 3OYWA 1H2MA 3CNAA 2RMU1 2YV8A 4IE7A 2VVFA 3I59A 2W1SA 1RUG2 4S2GA 5IAVA 2Q8DA 4B3NA 1NX9A 5FO9B 1SFPA 2JWPA 2XVLA 2VO5A 4Q0VA 4RA0A 5FKBA 4XF9A 5A7PA 2A5ZA 2ZGUA 3P3NA 3R4SA 3T09A 4IGQA 4L2NA 3UK9A 3V65A 2YB7A 2WT0A 4OHXA 4QPWA 2YC0A 3AZYA 1OUSA 1POQA 1TME2 5BXXA 3AL6A 4M0NA 3AMPA 2VZUA 3GZAA 2GMMA 1W0OA 5CAZA 5FLHA 1CONA 5FZ9A 2D6KA 3K3NA 2Y38A 4K21A 4K8RB 4URTA 2R072 2LW8A 1F5JA 3POWA 1E5IA 1GUIA 4M00A 5A1AA 3DN7A 1GQHA 1XSQA 1UOGA 1TMF2 2P4EA 3S6PA 2WAAA 1DDLA 3JBG1 4FOWA 2RDQA 4LLOA 3NJZA 2P3JA 5LBFA 1CAUA 3EHKA 1URXA 4QB2A 4GB32 5DN2A 1NOVA 3WP5A 4H14A 1QIQA 3E6BA 5J37A 1ZA7A 5A7OA 1H6YA 4QGMA 1UPIA 5DAPA 5BNOB 2PAEA 4Y20B 4A7YA 5D1IA 4IERA 3UYJA 5A3LA 1TQ5A 3EQEA 1REEA 4NHLA 4WVMA 3DKQA 5DUVA 3VZLA 5JR7B 5A6QA 1ND2C 2VTXA 2NMOA 1XNKA 2BEOA 2HWE3 2B8MA 2W92A 2RS11 4RHV1 2VU9A 5LBCA 2VUDA 1JZ6A 4XZUG 4MV2A 1LULA 4Q4Y1 2XJPA 3OGSA 4PLOA 3MW2A 2XJSA 3PMEA 4N90A 1UKGA 4P5HA 2ZGNA 4G9SB 5BNPC 2WNUA 2ETEA 2RM22 3C7GA 4N9HA 5L7OA 2NQYA 1HB4A 2R043 3A22A 1HRV3 3WLUA 1TNFA 5CFCA 2ZGLA 1QQP3 2PHWA 3HN1A 1MEC2 5LA0A 1W6QB 4FPGA 3OF1A 2WT2A 4XFHA 5IK4A 4GKXA 2WS92 4NHMA 5K8SA 1O5LA 2YXSA 1OF4A 2FDKA 2JB8A 1UY1A 5FPLA 2E31A 1W39A 4R9BA 1OH3A 2DCTA 2PN5A 5C3QA 5FQ0B 3UNPA 1S0FA 4FPKA 2QQUA 1SPPB 2PXJA 1CAVA 1GYKA 1YEWA 3GF6A 3UGHA 2PHXA 3JD73 3KT7A 3B00A 4JDNA 1CZSA 1ST8A 1ZZ9A 2GH2A 2WA3A 3C7FA 1PM7A 4CDUA 1SACA 4CEWA 2VUCA 3SXWA 1NG0A 1C5IA 1D7PM 1TG7A 2Y6HA 3I2FA 2ID4A 2JDMA 2P3YA 3HNBM 4AQ6A 5KC6A 2GSYA 1D4M2 2XOMA 3ZFEC 2YGLA 4FP2A 1AYM2 1OKOA 4JCKA 2DUOA 4KNCA 3SHRA 2PHLA 1VBA2 2LM3A 3KCYA 2EALA 3QD6A 5FYCA 3TEYA 3PHMA 4FOVA 4K1ZA 5E6HA 5L9RA 1PVC2 4OI4A 2XLFA 1PO12 1YUDA 2VVEA 3KF3A 3BUCA 3LPFA 5JOWA 4NAMA 4E2SA 4JVAA 1LU1A 3OUIA 3KQ4B 4XBLA 3ZXEA 2D6MA 1VBD3 1X33A 2C26A 4YW6A 5FMOL 3ENRA 5H9RA 1UN1A 2ZABA 4WM8A 1LHWA 1REFA 4CCDA 5FZKA 1JXNA 3I2GA 3I2HA 4LKDA 2YBSA 2VULA 2EXHA 3SISA 2RMU3 3VDAA 1CIYA 2CY6A 3MIGA 1JH5A 4XHXA 3ZR6A 1JZ4A 4OUEA 1R083 1OA2A 1G9AA 1LAJA 3HT1A 4UW3A 5CG9A 1XOYA 1Q8SA 1BLZA 3RJRA 1MS0A 3T0AA 4Q1RA 1VJ2A 4NIAA 4LUKA 3NQHA 3ZKUA 3N9PA 2HWC2 3N3HA 1HJGA 4LBLA 4Q26A 5FTTC 2DURA 2DV9A 1NCRC 5D8AB 3O1TA 1H4GA 2XKPA 4LBJA 4AVBA 3ZOIA 3KZ4C 1QJU1 3KLSA 4KWLA 5IUQA 2VMIA 4BDVB 4EV0A 2D97A 2RVAA 1KGYA 3M8LA 3PU3A 5JAXA 4MGZE 3RZZA 4D3WA 1VRH3 2ZTNA 3V0BA 5DG2A 3FUQA 2PLV2 4V2VA 4E9KA 2H0VA 1QOTA 2YU1A 1R093 4CTEA 5EIYB 3AM2A 1RHI1 2QJVA 1AXKA 1NCQC 1TE1B 5A70A 2ARBA 2JKBA 1FV3A 4RD7A 4FOQA 3AC0A 5FY1A 5FWJA 1HW5A 3B9IA 2JE8A 2ARXA 4ASKA 3IDBB 3FMGA 3KVBA 4A6SA 4XFGA 1QOOA 1VBC1 1OI6A 4B8EA 4XVHA 3FJSA 4ZS2A 3VUOA 2WAOA 2XDVA 1YQ6A 3AKPA 4JGZB 5FYZA 3FWEA 3VL9A 4RHV3 4ZZ8A 3K2OA 1HQWA 1U5XA 1YFWA 2C0ZA 2IVIB 4EJRA 1Q5OA 3ORJA 3SH3A 1NA1B 1HQNA 5JZGB 2WBKA 2ATFA 2JG8B 1UYPA 3FL7A 3LSDA 4KBZA 5F9TA 3BTYA 1XU2A 4LHNA 3NNLA 3U10A 1S4CA 2O8OA 3O1UA 3N9MA 3WP4A 1AR91 1KITA 4GALA 2WN3A 1JS9A 3I3EA 3AYCA 5FYMA 4E8DA 2GNMA 3HR9A 5FUIA 3CJIC 4CCOA 2BW8A 1QF3A 3I4IA 1LODA 1YFXA 4MLOA 3E97A 3RG0A 2XHKA 2V72A 5FKCA 1RB8G 4IV1B 1VBB1 1UKRA 2Y6LA 3IM0A 3PURA 4AQTA 3N4MA 1AUYA 1NKGA 4AFAA 2XWBB 5JOZA 3N7KA 4AR2A 3AB0A 1H6XA 4Z8BA 5CG8A 4JAAA 4LHSA 4BMEA 5GALA 4J25A 4BQ5A 3AK0A 1L7QA 1EYBA 1GLHA 3ATGA 3KB5A 2KR2A 5JUVA 4D6SA 2ZEYA 2ZJCA 2WO7A 3I3BA 1RUH2 4QX3A 1CAXA 3I54A 4YVWC 1VAMA 3HN3A 1QJY1 3D0JA 5LB6A 3IDEA 3UJQA 4LKEA 5FZIA 1WW5A 3H8UA 1CPNA 4N7IA 2VNOA 1IPJA 4CDXB 1DG6A 2RJLA 3U75A 5FR3A 3NNMA 4UW6A 2HWF3 1SFYA 1YO8A 3ZSMA 3OEAA 3E6CC 1AHSA 3A0NA 2VMCA 1V6JA 3K46A 4LTAA 2OPWA 4NVPA 4WZCA 4DZGA 4AL9A 2VGDA 1QJX2 3NNFA 4DINB 4BZ4A 1E5SA 1QH6A 4P9LA 2VW2A 2ZAAA 3IPVB 4I0AA 4QQPA 1UZZA 2W39A 3CEWA 2WZEA 4YZ3A 2DDUA 1CJPA 1POV0 4Z07A 5I0SA 2DVFA 1WMDA 4IV3B 3L2YA 3L2HA 1J1TA 1X36A 1UD1A 5FZOA 2DUPA 3NW4A 3IAPA 2JX9A 1LENA 2VD7A 4WVWA 3CMGA 2W95A 4D8MA 1PGL2 2QQVA 2WA4A 2DUQA 4ARXA 3DXUA 1FNZA 4YGEA 4GH4B 2A3XA 1XRUA 3LA7A 3MIBA 4UXAA 5K0UB 2ZGRA 2W9XA 1ENQA 4D0QA 2JDNA 1V00A 4NE9A 2P3IA 3OTFA 1O3QA 4QKDA 3NAPC 2JECA 1QJU3 2GMPA 3KHCA 3AYEA 3AMHA 1NLRA 5HPOA 2AH2A 2HBUA 2XHNA 2Z42A 4OMDA 4X6QB 2J1TA 1IS4A 4RSUA 2GH8A 5SV5A 2WFF1 3SLIA 3KQRA 2AUYA 1SPPA 4KWKA 5T54A 1LEMA 2HLEA 2ZX2A 4GXLA 1RHI3 4XW3A 3SQOA 3VZMA 2WZR2 3HBZA 2Q1ZB 1W6NA 2OW4A 3ETPA 3OEBA 2DU1A 1NCRA 3TB0A 3V0AB 2GNDA 4JKKA 1YQCA 1ASJ3 1LNSA 1XE7A 3VDDB 3AJYA 4L11A 2BZDA 2CU5A 3GBFA 4L0PA 2RR13 3SCFA 1YIPA 5AFEA 4J6GA 4NRMA 1QKQA 1RINA 4CEYB 1W8UA 5FYIA 5JPNB 1UY2A 2RS53 2WNVC 3ZFFB 3RWKX 2K0GA 3GBGA 1Y7BA 3N35A 3QBQA 4AHXA 3IDAA 4UFHA 5FWEA 2PELA 4EN8B 3ECQA 1H1IA 1MQTB 4BB3A 4P02B 1I1EA 5F3CA 3ZX7A 2O1QA 1I5PA 3RZGA 1AR93 3WHUA 1W6MA 2OS2A 1GWLA 2WWUA 4CUGA 3MV01 1RUI2 2PAMA 4I02A 3WDXA 3OB8A 2BJSA 2E9QA 5LEJA 1OA3A 2R49A 4QDSA 5CZKA 4DUXA 1LOCA 2GNBA 2VH9A 3AX4A 3FUOA 4HPKB 5K7PA 2VCAA 2AREA 4PIXA 4XUPA 5I0RA 1D0GA 4XILA 4CZSA 3PIJA 2CAVA 4B4QA 4BOWA 1SLTA 5FYHA 1V9U2 5GZCA 5LK5A 5C4WC 1AL23 1KJLA 4IETA 3B01A 4K9SA 1RXGA 1PK6A 5GLUA 2YZ4A 4E4DX 2P5BA 1SCRA 1W2TA 3WQ1A 2BWAA 1VBE1 3JU9A 2A70A 4FP3A 2CAUA 3RFRA 3VDBA 3CKHA 2WC2A 5F3IA 4F7ZA 3AZXA 4CP0A 4H3WA 5A3UA 2PQSA 1N3OA 4PBPA 3VBOA 2VBPA 4AVAA 4IW3A 2FHRA 1BMV2 3MLKA 1XB9A 2CL2A 1FMD2 1QJY3 1Y9MA 1HXS1 2BTVC 3B02A 2BVBA 3C3VA 4JGYC 4QPIB 4Y1YA 3ILRA 3BPSA 4Q4V3 4AFDA 2IXHA 3THPA 3WW4A 4OI2A 3AMNA 1HQLA 3Q8EA 2DTYA 4RGKA 2X29A 4XJ8A 2XG3A 4J1WA 1COV2 2GAUA 2Y8KA 3WDTA 4AFBA 3VBSA 5FAXA 4FTEA 5AC91 1UMHA 1FOD2 3RNSA 3I49A 2WO3A 5GLWA 3MFCA 4BYYA 2WWJA 5A7QA 3RZLA 3QOPA 2Y34A 1G9DA 5FRAA 2Z5WA 3P6BA 2D44A 3WNPA 4GQ7A 4CCNA 1HN0A 3ZKYA 2JKXA 2IWGB 3MIEA 2RS31 1SFNA 5H9PA 3GNEA 4D69A 4ZKTB 3LB9A 1W0NA 3MLJA 5IAXA 4JGZA 4CPBA 1UZYA 3C8XA 3V64A 1UZVA 4KU7A 4MGQA 3VN4A 5FCCA 2JDPA 2HWD2 3NV1A 1GKBA 1AR71 2JG8A 2JG9B 2OA2A 2YC4A 3P5BA 1JMUB 4XMIA 4COUA 5FLJA 1HB2A 2B45X 1NQJA 5I91A 5DDJ2 2CGOA 3MDPA 3MPBA 4JTOA 1ZX5A 2NMNA 3GBWA 1S0IA 1XPWA 2QQIA 1OT5A 3LDBA 2J42A 2DWRA 4HFSA 1ZBA2 4XJAA 1YQ5A 1B35B 3D82A 4XDQA 1JYWA 3SCGA 3EYPA 5FY5A 4DXTA 5A3MA 4QKBA 4LLFA 4B4PA 1R64A 5FZ6A 3DYPA 5JIAA 1PGW2 2C24A 2WFF3 3POJA 3VBHC 4HETA 1AX2A 1JOPA 1MZ6A 4SLIA 1W3XA 4YW1A 3G7DA 1QMJA 4FT8A 4FPHA 4DOUA 3UL2A 1OF3A 5T5OA 1LOEA 5HI0A 2D3RA 1OQ1A 1CX4A 4QPGC 1LKNA 5FZGA 4CP9A 2CNAA 5FOBB 4GMP1 1ONAA 4XUTA 3LKJA 2A7AA 2CDOA 1HRI3 3NNGA 5C5UA 3DL3A 4I0BA 3LA3A 2YDEA 2WKKA 1FV2A 4ASLA 1WBFA 5KXEA 4FTBA 3DYOA 1HB3A 2ET1A 1I5ZA 4RQPB 2AGSA 1N3QA 4NWWA 1KFXL 3ZMNA 4CDQC 3NSTA 1W6PB 1EV11 3MPPG 2JE7A 1K3IA 1W8TA 1KD7A 3HAGA 4Q0PA 1QDCA 4QT6A 1DQ0A 2P37A 2WQ8A 2W3JA 4NMIA 5A33A 4YARA 2B5HA 1MZ5A 3MFAA 3W21A 1ALYA 2C9KA 3W5MA 1EAH1 5FPBA 4UW4A 3VD9A 1QQP2 3OD4A 1LHNA 1FATA 1XNAA 3H8RA 3J7HA 4MGYE 3X29B 3ACFA 3VKNA 4CRQA 1ENSA 3IPVA 2JE9A 4CU8A 4DNYA 4Y4RA 2C9AA 5ABJB 3T30A 3A23A 2BGPA 3I7DA 4GZ9A 3DCQA 4XTMA 5FIXA 2FDGA 3VBUC 4AG4A 2WNVA 4QD2A 1GZ9A 1G9CA 2PHTA 1WD4A 2VPVA 2WSVA 2CGNA 3USUA 4NROA 4EROA 5LW9A 4JX0A 5E88A 4AFMA 5CEHA 1H0BA 4IGPA 4QMAA 3VZKA 1PO22 1YIFA 1VBE3 1D4VB 3A21A 3S0MA 4Q4W2 5DQ0A 2PAKA 3UKTA 3ZDVA 4PDWA 2TNFA 1IQAA 2VZ1A 2XJVA 4AEMA 1S1AA 4B1MA 2R30A 1U12A 3AZZA 2FDJA 2QTWB 2R062 4QXCA 1HXS3 1DQ1A 4YZ4A 4WBBA 4GWJA 3IAQA 1UU4A 1K5MB 3BOPA 2GP3A 2LTNA 3GJAA 5JSPA 4K8FA 2RHPA 3DUIA 5C3SA 1QWRA 3ZR5A 4C0HA 1JYTA 4ZU4A 5I0DA 5C4WA 1ULCA 4CXXA 2V5DA 4L99A 3DPRC 1AJOA 3BYWA 3PVOA 2CHHA 3AZVA 1V6LA 2JENA 3PTRB 2P1BA 3QACA 5LA2A 1MS9A 2YBPA 2QZ3A 3TNQA 5L7OC 2W94A 2VC9A 4FQZA 5CFCC 3D3AA 3WEZA 4DS0A 4QU2A 1WCDJ 4XAEA 3T3YA 2XLGA 1C3HA 1AR82 1U0AA 5A3PA 2F6BA 3IB3A 3NL1A 1RUJ1 4XURA 2VBDA 3QH6A 5FYSA 5TSWA 3J8F3 1ZA4A 2RMU2 4NR1A 4WV8A 2OXBA 2XJQA 4QX0A 1UO9A 3M3EA 3ZFGC 1G9FA 2HWE1 1LR5A 2PHDA 2XKOA 1LTEA 2VECA 4CDWB 1UWWA 3SITA 2W52A 3RGBA 4BQ2A 1TZOA 2G19A 1Y43B 2AR6A 3E5QA 1IS6A 4I3GA 2R041 4CDUC 3AXEA 1FX5A 1HRV1 5LZ6A 3UT0A 5IFPA 1C28A 4WVZA 4YW7A 3PJYA 3S7EA 1XJAA 5LWBA 1AR63 4RS5C 4DB5A 1OBNA 1EPZA 5HCAA 2BNMA 3JQWA 1XNCA 4CUAA 3UKVA 2OX0A 4XBQA 5EJ3A 2R1BA 4E27A 1DQ6A 1LESA 3JBG2 1ND3C 2D3SA 2GP5A 2DBIA 3TEWA 4JTNA 3Q9OA 4QQOA 3WNLA 2Q8OA 1ZNPA 3WINE 3ON7A 4YM2A 4XDPA 2GC3A 1G86A 2XBO2 3JD71 3SMHA 2X5IC 5C8CA 4QX2A 5CIRA 3FC0A 4GMP3 5FMDA 1GOFA 4WVVA 4K20A 3VBFB 2ZGKA 1CIWA 2XVGA 3CIHA 4DRVA 3GJBA 3WD5A 2VG9A 4OHWA 4A6OA 4RN5A 2UYBA 2OZ6A 4WM8C 5JDBA 2BOIA 1KJRA 4N53A 3H8OA 1FPN3 3N7JA 2WDBA 4M3CB 4RHV2 2RS12 1GZTA 1VMJA 3LE0A 1LGNA 3OUHA 5B4XA 2ZPXA 5K9YA 2E53A 4Q4Y2 4D94A 2QQWA 2W08A 3R05A 5H9SA 4D7SA 4GJYA 5BNNA 2I45A 3HJRA 2IXJA 1E5RA 1KS4A 1RITA 3FBMA 1MS1A 1U5ZA 4QPGA 5BUVA 2H6CA 2K46A 4AXOA 4LE4A 2Y64A 1VBD1 2Q8CA 4OUSA 5JCTA 1BZWA 1GQGA 3VKLA 3GZEA 1LOFA 2EA7A 4FFHA 4L9BA 1GWMA 5CU1A 4AE2A 5APAA 5F5CA 2IXKA 2AYHA 4MO3M 2DFBA 1VRBA 3ZXDA 1OH4A 1OLQA 3PVBB 3AKSA 3ZYHA 5GJ6A 2ZHKA 3OCPA 4Y5SA 4LBNA 3WX5A 1LRHA 4OHVA 1R081 5F3EA 4QB6A 2XQRA 2P6HA 3WNOA 1S2BA 2QQLA 2ET7A 2WNOA 4EYUA 4JRAA 2QZ2A 5T52A 2P3KA 3VD3A 1OKQA 1XQNA 4ZS3A 4JQRA 3WNKA 4AEDA 4LO4B 4D7YA 4MSVA 4BU2A 1WCKA 4QPYA 1CAWB 1S0JA 1ZREA 1W2UA 2D5FA 5FZAA 1A8MA 5DPNA 1ENRA 1H8TB 1QJZA 4XFAA 3SKVA 1A6CA 2ZX1A 1ND2B 1ZM1A 3OBZA 4K3UA 3TN93 4CYDA 3DEMA 3NMBA 4C0BA 5FV3A 2W46A 2D6NA 4RFRB 3VBUA 2XL7A 1YI9A 2HWB1 1WMFA 2BNNA 3H8XA 1NUKA 2VM9A 5CFDB 4HVRA 1VRH1 2ZEWA 1GZWA 1R1A3 3OGVA 5BNPB 2GZWA 4MGTA 5KHGA 4HVOA 4W6YA 4JQTA 4YVSC 4LA3A 1R091 3PNAA 5D21A 2R16A 4KU8A 5F2SA 3WF3A 3AKTA 4QX1A 3CDZB 1PIV1 3PUAA 1MS3A 4YG0A 3AYAA 3WV6A 1DGRN 4QQLA 3S30A 1RUJ3 2AENA 4C1WA 4BXFA 1IPSA 2VOXA 2Y6KA 1U5IA 3WQ7A 2IFWA 3MIHA 3A7QA 1NXD1 4XMAA 3R6SA 3CLPA 4JRLA 2EXJA 4H2AA 4F83A 5DZFA 5BY5A 4BIOA 4R52A 5F32A 4LJHA 2ZZQA 3DPRA 2WZPP 1F35A 1W9TA 3ZIXA 2E7QA 2VQTA 5GM0A 2QDRA 2J22A 2QCSB 3JZVA 3P1IA 4Q2FA 3VKMA 2W1UA 2JJ6A 4MX3A 1J1LA 2ZKLA 5F6LB 2EF6A 1JZ8A 2J1RA 1J83A 3LF7A 1QJU2 2PYTA 1BBT3 1W04A 2CYFA 1RUD3 2VNRA 2ORZA 4XE9A 3POSA 4O7XA 1WMEA 5FZ3A 5IW0A 3RPQA 3ZFGA 1DQ2A 4O9EA 5GLVA 4KWJA 3N9LA 1O8PA 1F9KA 1W8HA 4MXWB 4BMBA 3B93A 4LA2A 1Z7S3 1XBFA 4HKOA 2ZEZA 1RHI2 3ZN6B 2Z79A 1XYPA 3PLQA 5DABA 4TLFA 3LEIA 2DCZA 1JOBA 3OGGA 4DUWA 1WGPA 2ZHNA 1RUE3 3OY8B 4EN0A 2VOWA 4DIQA 2X05A 2WO2A 3HWJA 4OCTA 4RS5A 3U11A 3AP6A 3T2QA 4FBFA 1VBC2 1J3RA 3W58A 5FXXA 1S0EA 2BOJA 2DVBA 3OG2A 4E8CA 4HSJA 4HSLA 3FBYA 2VCMA 3MF6A 1ND3A 3M4FA 2Q1FA 5JSRA 1A34A 4YGDA 1X82A 1YHFA 5JXGA 2CTVA 2P34A 1H9WA 2XWJB 3FLTA 4GAZA 3ZYBA 2BYVE 4A44A 4B29A 1O4ZA 5M0TA 2HWF1 2X5IA 3VBRA 5DAVA 1UYXA 1M06G 1XXNA 1H2NA 1VMHA 4N43A 2XXZA 3KV9A 1APNA 4LOTA 1CR7A 2XVKA 3O0XA 3CBNA 3R4UA 5KXBA 2O14A 3O0VA 4UFKA 3B94A 3FE5A 1GOGA 3F95A 1RUC3 4AQSA 4S2HA 1YQ2A 1VBB2 4W6WA 2BQPA 2RE9A 4XOGA 3WP6A 1AYN3 5LEKA 5FFOC 5J96B 4I30A 1OD5A 4HT1T 1HN1A 2VZPA 1DF0A 1AVBA 3PTYA 3THTA 4YZ5A 3ZYIB 1RIRA 5FK8A 4LR4A 2BPA2 4NIGA 3L9JT 3T4VA 1PM4A 5G05L 3ILNA 3SKJE 4QX5A 3J26N 1OOPB 4JDMA 4LBQB 4BQ3A 1JU4A 5IVEA 2W0XA 2ZMKA 1QJY2 3RDIA 3KGZA 4MUVA 2IC1A 2ZCWA 2HKXA 1S0GA 2HWB3 1S2EA 2Q0AA 2NZ9A 3RZJA 4UAPA 1N3PA 3PUSA 4NRQA 2JICA 3WZ1A 5FYBA 1VIWB 4RR3A 4NIDA 1DYKA 1HB1A 4UF0B 4Y22A 5DUUA 1XNBA 5EYXA 4P5YA 5FPZA 4KMQA 5FYUA 1NLSA 5EP9A 2R32A 1EUUA 5F6KA 1ZRIA 3B9CA 1E57A 1PIV3 2OQ6A 2JB4A 3CJIB 2W47A 5FZLA 5J36A 4AVCA 1H30A 4CU9A 3C7HA 1K45A 4Q0SA 1ASJ1 4PIYA 1FYUA 1UIKA 3NRUA 5J48A 2VUJA 1V6OA 2RR11 3ZSEA 3HNYM 2C4XA 1SLBA 2IZWA 4HONA 2RS51 3WF1A 4AI8A 4CCJA 2HH9A 3EB7A 1ZZCA 3ES1A 1ZRDA 1RVF3 4YVSA 1DZTA 1C8M3 4W4ZA 1PK6C 2VQUA 3F2ZA 3S5QA 1SLLA 2J1VA 3B5LB 2A1XA 1IG3A 1WLDA 5C9AA 4YVWB 5A7WB 3NVCA 3RZKA 2TUNA 5JVVA 4YLZA 5D8AC 4A3XA 5CA6A 4IE6A 3VBOC 5F8PA 3LEKA 5HBAA 1ZBE3 4JV4A 1NZCA 3POEA 2AEYA 1JYCA 2Q1MA 1O4TA 3LSEA 3ZYPA 4A45A 5JPMB 3RYKA 5FP9A 3BU7A 2J1EA 3WG3A 5CKQA 5GLZA 3IWZA 5IJRA 2DFCA 4BQYA 3WUDA 2VMGA 2W68A 4XJ9A 4TZDA 2RG4A 1A78A 1AL21 1RMU3 4E4SA 4NHYA 1Q3EA 3VBSC 3TEZA 5CYYA 1DFQA 3T2TA 1UZWA 3WDYA 3CZUA 4ZHNA 3M3CA 4IEPA 1NE4A 2MEV3 4NJ4A 3Q8BA 3OBAA 1ENXA 3KV4A 5IVBA 1SBEA 2BP6A 3ACIA 3MF9A 4KG8A 5A3WA 3AKRA 3DV8A 4QDRA 5CVRA 1V6KA 1IOAA 1NQDA 3B69A 1JBCA 3ZXJA 3CZJA 1AX0A 4Q4V1 2O0OA 3BODA 4JGZC 1IZ3A 1RUG3 4LE3A 3KV6A 5EQUA 3RWNA 3HVDA 5JXHA 4AAXA 2PTMA 1NA1C 4QB1A 2X53S 5JZGC 2JG8C 1ODMA 3J7LA 3MIDA 1UAIA 1UNBA 1KS5A 2E32A 5IVJA 3NAPB 4QXBA 2IVJA 2WJSA 3RSJA 1JN2P 4BQXA 3H3LA 5BNOA 1W2AX 2QE3A 4Y20A 1YXWA 4NIHA 2R073 3ROUA 1F4AA 2RV9A 3K4DA 1S0DA 1TMF3 4RFT0 2Y6JA 4ORFA 1YCIA 1GP6A 1X8MA 3WW2A 2LRPA 1O7FA 5JR2A 3JUUA 3VB9A 4PLNA 1UF2C 5I8YA 5ISLA 1WCQA 2BBAA 2LS6A 1GP5A 4HKLA 3T2OA 4GB33 1XU1A 1Y9QA 2QQJA 3G6JB 2OZJA 1VBE2 3KD4A 2FMDA 4IESA 4L8QA 4MVTA 5KHIA 5CNAA 5E89A 3AJZA 5BPXA 4DEQA 3CF6E 4XJWA 3O1RA 3EO6A 3ST7A 1W6QA 2C5DA 5ACA2 1RJ8A 5FZHA 5LATA 4EN6B 1ZYBA 1OPOA 2K2SA 1DU3D 2JIGA 2I2SA 4Z92B 2YFZA 3LEGA 3WHTA 1A3KA 4LKFA 4MOAA 3KT4A 3PU8A 2B9UA 2V5YA 4Y24A 5FQ0A 4OMCA 3GHMA 1CD3G 2CV6A 5AC92 1N1TA 1IPKA 1W06A 2RM23 2VW1A 4LQRA 3H3ZA 1Q8OA 5KHHA 4NUBA 5T3NA 1QDOA 2JD4A 4MGKE 3PIGA 4AEJA 1HRI1 1WCUA 3HBKA 2JDHA 4NRPA 3GZUC 2WS93 4AHWA 5C3OA 1WWYA 1J3QA 2RS32 4QHBA 4QQ2A 2AACA 4R4XA 3U4SA 2WWSA 3NJXA 4CSWA 1UY4A 2ZKNA 1BEV2 2D6OX 2GC2A 2XJRA 4IV3C 3ASIA 1C5HA 5J98B 2D93A 3RZHA
chains in the Genus database with same CATH topology
3JXSA 1XNAA 1NX9A 3J7HA 2VO5A 3ACFA 4Z2AA 3BGAA 4CU8A 3I2JA 2W91A 3T09A 3ZM8A 4DXRA 1J84A 1UX7A 2YB7A 3A23A 2BGPA 4QPWA 4GZ9A 4JHZA 2WABA 2VZUA 1GQPA 1UYYA 4ARYA 2QQNA 3K4AA 4JX0A 3UETA 2LW8A 3UESA 1GUIA 5A1AA 5J1XA 2XQXA 3U37A 3A21A 2WAAA 5DQ0A 2VZ1A 1PMHX 4CUAA 4QB2A 4GWJA 3IAQA 5DN2A 1CX1A 1H6YA 2ORXA 3FHAA 4W50A 5I0DA 4KI5M 3LPGA 2V5DA 3T2PA 3NJVA 2VTFA 5LA2A 2KD7A 4CUBA 5IFTA 2W92A 2W94A 2VC9A 1JZ6A 4XZUG 3D3AA 3WEZA 3OGSA 4XUQA 1UYZA 2Y6GA 3IB3A 4XURA 3C7GA 2E26A 4LPLA 4AG4A 3A22A 4QX0A 5LA0A 1US3A 2RJ2A 4BXSV 1ULOA 1UWWA 3ABZA 1OF4A 2VZTA 1UY1A 1CZTA 2E31A 5C7GA 1XNTA 2WO1A 2B9VA 4BJ0A 3UNPA 4JKMA 5IFPA 3I97A 3I2IA 3HPNA 1UXXX 5EJ1B 1O59A 5IHRA 1CZSA 2VOTA 3C7FA 4CUCA 4BK5A 5C70A 4ET7A 3VD7A 3WNLA 1D7PM 3IIIA 1TG7A 2Y6HA 3I2FA 4W8JA 2ID4A 3HNBM 3WQBA 2W1WA 2XOMA 4A41A 4QX2A 2VZRA 1GOFA 2J7MA 3CIHA 1DYOA 2B4KA 1MPXA 4UOJA 4RN5A 4A6OA 3LPFA 2J1SA 4CVUA 3BN6A 2WDBA 2C26A 3MO4A 1UMIA 3LE0A 5B4XA 2W5FA 4RYDA 3HJRA 3I2GA 3I2HA 1L7RA 2Y64A 3VDAA 1UZ0A 1CIYA 2X09A 4OUEA 3LQCA 1JZ3A 4KWUA 4MO3M 3T0AA 2XONA 2VR4A 3NQHA 4YPJA 1OH4A 2VZQA 2BERA 2EIEA 1DP0A 1PX4A 4UI9L 4QDQA 2VMFA 3K77A 4QB6A 3WF4A 3WNOA 2QQLA 4P00B 4XUOA 4BDVB 2RVAA 1KGYA 3VD3A 3W5NA 4OZOA 1K12A 2VZVA 3WNKA 2W1QA 1ULPA 1DLCA 3MUY1 5DPNA 3SKVA 3CQOA 2VCBA 5EIYB 1JU3A 1W9WA 2W46A 1NUKA 2VM9A 3AC0A 3THCA 2ZEWA 3OGVA 2JE8A 1UY0A 3PUIA 4PQQA 3SEEA 4XVHA 2WAOA 4ZZ8A 3WF3A 4QX1A 1JYXA 3CDZB 5JXIA 3T08A 2WBKA 3FL7A 2VCCA 4A4AA 3DECA 3VDCA 2Y6KA 5G04L 1JYVA 4LKSA 4A42A 3C7OA 2W87A 3A7QA 1BHGA 2WN3A 3I3EA 3GXUA 4E8DA 5FUIA 1W9TA 3I2KA 2VQTA 2J22A 3P1IA 4GWIA 2W1UA 1F4HA 2V72A 2VZOA 2Y6LA 3GM8A 1WKYA 1NKGA 1JZ8A 2J1RA 1J83A 1H6XA 2ORZA 3OGRA 4LHSA 5JXJA 1GOHA 4CU7A 1L7QA 2VZ3A 4DUVA 5JUVA 1O8PA 2ZEYA 2VMEA 3I3BA 2ZEZA 4QX3A 3HN3A 1OD3A 3LEIA 3VD5A 1UXZA 4DUWA 2X05A 2WO2A 1EUTA 3T2QA 3OEAA 3OG2A 4E8CA 2VMCA 3K46A 3SEPA 3WF0A 2EIDA 5JXGA 1GU3A 2JD9A 2OKXA 4A44A 2QQMA 2WZEA 2DDUA 4TTGA 3HNMA 1UYXA 4M4RA 2YFUA 3IAPA 4JKLA 4XUNA 3CMGA 2W95A 4D8MA 1T2XA 1GMMA 2WUHA 4ARXA 5C71A 3K75B 1GOGA 2QQKA 1YQ2A 2W9XA 4D0QA 4PF1A 1HN1A 2VZPA 4DXSA 1W9SA 5HPOA 2XHNA 5LCWL 4TXWA 1JHJA 4CU6A 4OMDA 1PMJX 2J1TA 5G05L 3SKJE 4MGSA 2V4VA 4PT6A 1JU4A 2J1AA 2HLEA 1RYYA 4OYUA 2DCJA 2YG0A 3ETPA 1SHWB 3OEBA 5LA1A 3T0DA 4UAPA 3K4ZA 2VL4A 1JZ5A 2QBXA 2JDAA 4JKKA 3T0BA 1LNSA 2WN2A 2BZDA 4L0PA 2BGOA 2R7EB 4P5YA 4KMQA 1UY3A 1CZVA 5DMYA 1EUUA 1UY2A 2W47A 3WF2A 3ACGA 2WYSA 4CU9A 3C7HA 3IDAA 1GNYA 1K45A 1JZ2A 3MUZ1 2E33A 2QQOA 3NRUA 4A3ZA 3ECQA 4P02B 3VD4A 3HNYM 1I5PA 2C4XA 2VMDA 3MV01 2WZ8A 2VZSA 3WF1A 1O8SA 3OB8A 3EB7A 3ACHA 4FI9A 4QDSA 4DUXA 2VJXA 2X10A 4W4ZA 5CZKA 3F2ZA 2VQUA 2VCAA 3GGLA 4XUPA 4BK4A 2J1VA 5EJZB 2CDPA 5F7UA 3PUHA 5JMOA 3LEKA 4A45A 3VDBA 5HXMA 3CKHA 2J1EA 5IJRA 2ZXQA 2PQSA 1IQDC 1W99A 3WSOA 3I3DA 2Z4FA 4ZXEA 3HEIA 5CYYA 2EICA 3CZUA 3OBAA 2Y8KA 3ACIA 3MV11 3FN9A 1UMHA 4QDRA 4DEVA 1KEXA 2WO3A 3WNNA 3CZJA 1K42A 2EIBA 2L9LA 3FHQA 3P6BA 3WNPA 5JXHA 4AAXA 5B4NA 2JKXA 4QB1A 1W0NA 2E32A 4HG6B 3C8XA 4MGQA 1PX3A 2ZEXA 4ZZ5A 2YC4A 1F4AA 1XC6A 2RV9A 3K4DA 1JYNA 2Y6JA 1TVGA 1NAEA 3HOBA 1XPWA 2QQIA 1OT5A 5JR2A 2YC2A 1WCQA 2BBAA 2LS6A 1SDDB 3T2OA 1JYWA 3C7EA 2QQJA 4QAWA 3EYPA 3E1F1 4DXTA 4MADA 1R64A 3DYPA 4DEQA 2HYXA 1US2A 1SG3A 3MBWA 1JZ4A 1W8NA 1OF3A 2J1UA 2YFZA 3LEGA 4XUTA 4P08A 2CDOA 4MOAA 3NNGA 4OMCA 4ZY9A 4IUGA 3DYOA 1JI6A 3GDBA 3DYMA 4LQRA 5IYYA 4M4PA 1P8JA 2DCKA 1K3IA 1W8OA 3THDA 3WNMA 2WQ8A 2W3JA 3NJXA 1UY4A 2C9KA 3W5MA 3VD9A 1JZ7A 2W1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXS A;  1XNA A;  1NX9 A;  3J7H A;  2VO5 A;  3ACF A;  4Z2A A;  3BGA A;  4CU8 A;  3I2J A;  2W91 A;  3T09 A;  3ZM8 A;  4DXR A;  1J84 A;  1UX7 A;  2YB7 A;  3A23 A;  2BGP A;  4QPW A;  4GZ9 A;  4JHZ A;  2WAB A;  2VZU A;  1GQP A;  1UYY A;  4ARY A;  2QQN A;  3K4A A;  4JX0 A;  3UET A;  2LW8 A;  3UES A;  1GUI A;  5A1A A;  5J1X A;  2XQX A;  3U37 A;  3A21 A;  2WAA A;  5DQ0 A;  2VZ1 A;  1PMH X;  4CUA A;  4QB2 A;  4GWJ A;  3IAQ A;  5DN2 A;  1CX1 A;  1H6Y A;  2ORX A;  3FHA A;  4W50 A;  5I0D A;  4KI5 M;  3LPG A;  2V5D A;  3T2P A;  3NJV A;  2VTF A;  5LA2 A;  2KD7 A;  4CUB A;  5IFT A;  2W92 A;  2W94 A;  2VC9 A;  1JZ6 A;  4XZU G;  3D3A A;  3WEZ A;  3OGS A;  4XUQ A;  1UYZ A;  2Y6G A;  3IB3 A;  4XUR A;  3C7G A;  2E26 A;  4LPL A;  4AG4 A;  3A22 A;  4QX0 A;  5LA0 A;  1US3 A;  2RJ2 A;  4BXS V;  1ULO A;  1UWW A;  3ABZ A;  1OF4 A;  2VZT A;  1UY1 A;  1CZT A;  2E31 A;  5C7G A;  1XNT A;  2WO1 A;  2B9V A;  4BJ0 A;  3UNP A;  4JKM A;  5IFP A;  3I97 A;  3I2I A;  3HPN A;  1UXX X;  5EJ1 B;  1O59 A;  5IHR A;  1CZS A;  2VOT A;  3C7F A;  4CUC A;  4BK5 A;  5C70 A;  4ET7 A;  3VD7 A;  3WNL A;  1D7P M;  3III A;  1TG7 A;  2Y6H A;  3I2F A;  4W8J A;  2ID4 A;  3HNB M;  3WQB A;  2W1W A;  2XOM A;  4A41 A;  4QX2 A;  2VZR A;  1GOF A;  2J7M A;  3CIH A;  1DYO A;  2B4K A;  1MPX A;  4UOJ A;  4RN5 A;  4A6O A;  3LPF A;  2J1S A;  4CVU A;  3BN6 A;  2WDB A;  2C26 A;  3MO4 A;  1UMI A;  3LE0 A;  5B4X A;  2W5F A;  4RYD A;  3HJR A;  3I2G A;  3I2H A;  1L7R A;  2Y64 A;  3VDA A;  1UZ0 A;  1CIY A;  2X09 A;  4OUE A;  3LQC A;  1JZ3 A;  4KWU A;  4MO3 M;  3T0A A;  2XON A;  2VR4 A;  3NQH A;  4YPJ A;  1OH4 A;  2VZQ A;  2BER A;  2EIE A;  1DP0 A;  1PX4 A;  4UI9 L;  4QDQ A;  2VMF A;  3K77 A;  4QB6 A;  3WF4 A;  3WNO A;  2QQL A;  4P00 B;  4XUO A;  4BDV B;  2RVA A;  1KGY A;  3VD3 A;  3W5N A;  4OZO A;  1K12 A;  2VZV A;  3WNK A;  2W1Q A;  1ULP A;  1DLC A;  3MUY 1;  5DPN A;  3SKV A;  3CQO A;  2VCB A;  5EIY B;  1JU3 A;  1W9W A;  2W46 A;  1NUK A;  2VM9 A;  3AC0 A;  3THC A;  2ZEW A;  3OGV A;  2JE8 A;  1UY0 A;  3PUI A;  4PQQ A;  3SEE A;  4XVH A;  2WAO A;  4ZZ8 A;  3WF3 A;  4QX1 A;  1JYX A;  3CDZ B;  5JXI A;  3T08 A;  2WBK A;  3FL7 A;  2VCC A;  4A4A A;  3DEC A;  3VDC A;  2Y6K A;  5G04 L;  1JYV A;  4LKS A;  4A42 A;  3C7O A;  2W87 A;  3A7Q A;  1BHG A;  2WN3 A;  3I3E A;  3GXU A;  4E8D A;  5FUI A;  1W9T A;  3I2K A;  2VQT A;  2J22 A;  3P1I A;  4GWI A;  2W1U A;  1F4H A;  2V72 A;  2VZO A;  2Y6L A;  3GM8 A;  1WKY A;  1NKG A;  1JZ8 A;  2J1R A;  1J83 A;  1H6X A;  2ORZ A;  3OGR A;  4LHS A;  5JXJ A;  1GOH A;  4CU7 A;  1L7Q A;  2VZ3 A;  4DUV A;  5JUV A;  1O8P A;  2ZEY A;  2VME A;  3I3B A;  2ZEZ A;  4QX3 A;  3HN3 A;  1OD3 A;  3LEI A;  3VD5 A;  1UXZ A;  4DUW A;  2X05 A;  2WO2 A;  1EUT A;  3T2Q A;  3OEA A;  3OG2 A;  4E8C A;  2VMC A;  3K46 A;  3SEP A;  3WF0 A;  2EID A;  5JXG A;  1GU3 A;  2JD9 A;  2OKX A;  4A44 A;  2QQM A;  2WZE A;  2DDU A;  4TTG A;  3HNM A;  1UYX A;  4M4R A;  2YFU A;  3IAP A;  4JKL A;  4XUN A;  3CMG A;  2W95 A;  4D8M A;  1T2X A;  1GMM A;  2WUH A;  4ARX A;  5C71 A;  3K75 B;  1GOG A;  2QQK A;  1YQ2 A;  2W9X A;  4D0Q A;  4PF1 A;  1HN1 A;  2VZP A;  4DXS A;  1W9S A;  5HPO A;  2XHN A;  5LCW L;  4TXW A;  1JHJ A;  4CU6 A;  4OMD A;  1PMJ X;  2J1T A;  5G05 L;  3SKJ E;  4MGS A;  2V4V A;  4PT6 A;  1JU4 A;  2J1A A;  2HLE A;  1RYY A;  4OYU A;  2DCJ A;  2YG0 A;  3ETP A;  1SHW B;  3OEB A;  5LA1 A;  3T0D A;  4UAP A;  3K4Z A;  2VL4 A;  1JZ5 A;  2QBX A;  2JDA A;  4JKK A;  3T0B A;  1LNS A;  2WN2 A;  2BZD A;  4L0P A;  2BGO A;  2R7E B;  4P5Y A;  4KMQ A;  1UY3 A;  1CZV A;  5DMY A;  1EUU A;  1UY2 A;  2W47 A;  3WF2 A;  3ACG A;  2WYS A;  4CU9 A;  3C7H A;  3IDA A;  1GNY A;  1K45 A;  1JZ2 A;  3MUZ 1;  2E33 A;  2QQO A;  3NRU A;  4A3Z A;  3ECQ A;  4P02 B;  3VD4 A;  3HNY M;  1I5P A;  2C4X A;  2VMD A;  3MV0 1;  2WZ8 A;  2VZS A;  3WF1 A;  1O8S A;  3OB8 A;  3EB7 A;  3ACH A;  4FI9 A;  4QDS A;  4DUX A;  2VJX A;  2X10 A;  4W4Z A;  5CZK A;  3F2Z A;  2VQU A;  2VCA A;  3GGL A;  4XUP A;  4BK4 A;  2J1V A;  5EJZ B;  2CDP A;  5F7U A;  3PUH A;  5JMO A;  3LEK A;  4A45 A;  3VDB A;  5HXM A;  3CKH A;  2J1E A;  5IJR A;  2ZXQ A;  2PQS A;  1IQD C;  1W99 A;  3WSO A;  3I3D A;  2Z4F A;  4ZXE A;  3HEI A;  5CYY A;  2EIC A;  3CZU A;  3OBA A;  2Y8K A;  3ACI A;  3MV1 1;  3FN9 A;  1UMH A;  4QDR A;  4DEV A;  1KEX A;  2WO3 A;  3WNN A;  3CZJ A;  1K42 A;  2EIB A;  2L9L A;  3FHQ A;  3P6B A;  3WNP A;  5JXH A;  4AAX A;  5B4N A;  2JKX A;  4QB1 A;  1W0N A;  2E32 A;  4HG6 B;  3C8X A;  4MGQ A;  1PX3 A;  2ZEX A;  4ZZ5 A;  2YC4 A;  1F4A A;  1XC6 A;  2RV9 A;  3K4D A;  1JYN A;  2Y6J A;  1TVG A;  1NAE A;  3HOB A;  1XPW A;  2QQI A;  1OT5 A;  5JR2 A;  2YC2 A;  1WCQ A;  2BBA A;  2LS6 A;  1SDD B;  3T2O A;  1JYW A;  3C7E A;  2QQJ A;  4QAW A;  3EYP A;  3E1F 1;  4DXT A;  4MAD A;  1R64 A;  3DYP A;  4DEQ A;  2HYX A;  1US2 A;  1SG3 A;  3MBW A;  1JZ4 A;  1W8N A;  1OF3 A;  2J1U A;  2YFZ A;  3LEG A;  4XUT A;  4P08 A;  2CDO A;  4MOA A;  3NNG A;  4OMC A;  4ZY9 A;  4IUG A;  3DYO A;  1JI6 A;  3GDB A;  3DYM A;  4LQR A;  5IYY A;  4M4P A;  1P8J A;  2DCK A;  1K3I A;  1W8O A;  3THD A;  3WNM A;  2WQ8 A;  2W3J A;  3NJX A;  1UY4 A;  2C9K A;  3W5M A;  3VD9 A;  1JZ7 A;  2W1S A; 
#chains in the Genus database with same CATH topology
 1LOA A;  1NLQ A;  3E5X A;  1DGW X;  4XXA A;  4A7Z A;  1AR7 2;  4ISR A;  4Z2A A;  2G9F A;  4XFC A;  2FDF A;  3BGA A;  3LWC A;  4XFF A;  4LO5 B;  2W91 A;  4DXR A;  4XF3 A;  2FD8 A;  2H0B A;  1OUR A;  4EN9 B;  4PI0 A;  4AAP A;  4JHZ A;  2WAB A;  4FQ4 A;  4JDO A;  1UYY A;  5K0U C;  4ARY A;  1O91 A;  2QQN A;  4JGY B;  4PDW C;  4Q4X 1;  3K4A A;  1SLC A;  2NLR A;  4TSV A;  3UET A;  3UGG A;  3BTX A;  5FMC A;  5J1X A;  1D4M 3;  4K1Y A;  3U37 A;  3WXP A;  2YU2 A;  3PVN A;  4IND A;  5A32 B;  3TEX A;  5JOX A;  2ILM A;  1VBA 3;  2Y6F A;  4AVS A;  5GZD A;  4BIF A;  4YG3 A;  1PVC 3;  1Y9G A;  2XR4 A;  1VE0 A;  4FCA A;  1PO1 3;  3MI8 A;  1MAC A;  1WA6 X;  4MH0 E;  4COY A;  4DY3 A;  2D43 A;  4IE0 A;  3CU7 A;  1SMV A;  2H6B A;  3FLR A;  3RI8 A;  4XFI A;  4QQH A;  4YRD A;  2UWC A;  1WBL A;  1SBF A;  4W50 A;  4AYU A;  4IGO A;  4FPY A;  4KI5 M;  3LPG A;  5D8A A;  1GIC A;  1QH7 A;  1PHM A;  1RED A;  4QKN A;  5DZG A;  2FBE A;  3VDD C;  3LIG A;  3NJV A;  1NE6 A;  5FBJ A;  5FP7 A;  2PHU A;  5FZM A;  4Q1P A;  4AGG A;  2KD7 A;  4PIZ A;  4CUB A;  1EV1 2;  4AI2 A;  1VMF A;  4EWE A;  3DGT A;  4FAH A;  2VOV A;  3ZMO A;  5FPU A;  4BIS A;  1H2K A;  3ZFF C;  2KM2 A;  4OHZ A;  5B2G B;  5FZ7 A;  3O1S A;  4PI2 A;  5FY4 A;  2E26 A;  1G9B A;  4LPL A;  2ZX0 A;  1EAH 2;  4LHL A;  4IE5 A;  2BU9 A;  2HWC 3;  4XPV A;  4AGR A;  3N9O A;  1US3 A;  1QHD A;  2RJ2 A;  1ULO A;  2GN7 A;  3PJQ A;  5C33 A;  4XIK A;  5F5I A;  4YNI A;  1OPM A;  2VZT A;  3ZSK A;  4CE8 A;  1CZT A;  2XLA A;  4F3J A;  1XNT A;  1POV 3;  3PL0 A;  1BYH A;  3SH5 A;  3J8F 1;  2WO1 A;  1K5J A;  3CHX A;  4JKM A;  3PVE A;  4UFM A;  1Q8V A;  3I97 A;  3I2I A;  1IHM A;  1UXX X;  2PLV 3;  2ADD A;  1NA1 A;  4TWT A;  5GLT A;  2Y60 A;  5JZG A;  1NT0 A;  1SDW A;  1ZZB A;  2VOT A;  2QDN A;  3FLP A;  2MHF A;  4BK5 A;  5C8C C;  5C70 A;  4WM7 B;  5T5P A;  5IVF A;  1DZQ A;  1Z0H A;  1FAY A;  3III A;  3POG A;  3OJB A;  5T5L A;  1AR6 1;  2B39 A;  4CDQ B;  3OYW B;  1UU5 A;  4UW5 A;  4Y1Z A;  4IEO A;  4A41 A;  4QPI C;  4N53 C;  4YSF A;  1QOS A;  2FCT A;  3I59 B;  1F31 A;  5I0T A;  2UUR A;  3KSC A;  1D2S A;  1ZZ6 A;  2JIJ A;  2VXR A;  3AXD A;  3OPW A;  4IV1 A;  1PNF A;  3IIA A;  1MPX A;  4UOJ A;  3RMX A;  5BNN C;  2BGC A;  4GKY A;  4OQ8 A;  2J1S A;  4HK8 A;  1OVS A;  2EXI A;  4CVU A;  5JLV A;  3I2D A;  3MO4 A;  2F17 A;  1V0A A;  1TEI A;  1UMI A;  4QHO A;  5A80 A;  5AVA A;  2W5F A;  1F2N A;  4FPC A;  2EAK A;  1LOF C;  3UJO A;  1RUJ 2;  1X50 A;  4LBQ D;  3O0W A;  4NAO A;  5FY7 A;  3ZXG A;  1LHU A;  1L7R A;  3H9A A;  1C8N A;  1EPW A;  1FPN 1;  1UW8 A;  3KVA A;  1YC6 1;  4PQ9 A;  5HCB A;  2HWE 2;  4CA9 A;  3JB8 A;  1J59 A;  2X09 A;  4DY5 A;  4KH9 A;  4XIO A;  3LQC A;  1CAU B;  4NPR A;  1QXR A;  1XE8 A;  4CDX A;  2D5H A;  3ZDS A;  5IK5 A;  4GJZ A;  4GMP 0;  1OFS A;  4ISQ A;  2JG9 C;  2R04 2;  1HRV 2;  3USS A;  3WT3 A;  4CCE A;  2EIE A;  1DP0 A;  4S2F A;  3GAL A;  1LHO A;  1OQD A;  1CQ9 A;  4AED C;  3BTA A;  4QDQ A;  4DMI A;  4MET A;  4Q4X 3;  2VMF A;  1S0C A;  1ULF A;  3WF4 A;  1Q43 A;  2Q4S A;  4WVM B;  4XJU A;  3PDQ A;  4G4F A;  5L9V A;  4P00 B;  1JOJ A;  1O5U A;  4COZ A;  5FXV A;  1B35 C;  1CJD A;  3AKQ A;  1HKD A;  4IV3 A;  3W5N A;  2ARA A;  3LD8 A;  1K12 A;  2VZV A;  2W1Q A;  1O4Y A;  4H7M A;  1ULP A;  2UY8 A;  5I0U A;  1T6G C;  2YGM A;  2GAL A;  3MUY 1;  4AW7 A;  1JYI A;  1IS3 A;  2V4A A;  2WNU B;  3JD7 2;  4CCL A;  2VCB A;  5L7O B;  1JU3 A;  5FBZ A;  4UWD A;  3EJK A;  4GH4 A;  2V73 A;  1HJF A;  2DYC A;  5CFC B;  3WNX A;  2ES3 A;  2YY1 A;  4FFI A;  1QJX 3;  1FT9 A;  5K0U A;  5EZW A;  5FZF A;  1UY0 A;  3MW4 A;  1DYP A;  3PUI A;  4W65 A;  4PQQ A;  2F4P A;  2A75 A;  1YNA A;  4QKF A;  1PMI A;  1YRZ A;  4YM0 A;  3TN9 1;  4CP1 A;  4EWD A;  3I2O A;  1PZ8 A;  2BBV A;  3Q8A A;  4RQP C;  5GKA C;  4XAB A;  4L92 A;  5C5T A;  1HDK A;  1CAV B;  5DAQ A;  4I01 A;  3ZYG A;  1C1F A;  4BCU A;  4YFZ A;  3DF0 A;  3NV4 A;  1R1A 1;  5FZ4 A;  3T08 A;  2VCC A;  2LUW A;  2VXJ A;  5T50 A;  2I74 A;  4A4A A;  3DEC A;  2X8K A;  3VDC A;  4CDU B;  2AZ5 A;  1ULG A;  1JYV A;  1VBD 2;  5FUN A;  3C7O A;  4CEW B;  1ODN A;  1OHF A;  2W87 A;  4BQW A;  1BHG A;  2ZAH A;  1S55 A;  4PBO A;  3OGJ A;  1C57 A;  2Q8E A;  4HN0 A;  4UT5 A;  2ZS6 B;  4EE2 A;  2XB6 C;  3GXU A;  1ZRR A;  3BU0 A;  3MW3 A;  1KDM A;  3V0A A;  1L7L A;  3NWK A;  4PCR A;  3M3O A;  5E16 A;  1I3H A;  2CSG A;  1ZBA 1;  2HEW F;  3VDD A;  4ZPI A;  5HCH A;  4FPO B;  2UWA A;  3IDC B;  2E7T A;  1GWK A;  2VZO A;  3H0O A;  4Y5T A;  4CEY A;  5ABJ C;  1PGW 1;  1R08 2;  1WKY A;  1XYO A;  3ZFF A;  5EV7 A;  4CCK A;  3NV2 A;  3GYD A;  5FZE A;  4MYE A;  1X8E A;  4URA A;  2A6W A;  3OGR A;  2CGP A;  4FFF A;  1RUO A;  1MQT A;  3ME2 A;  1GOH A;  2WZR 3;  4CU7 A;  3ZVX A;  4Z1V A;  2BRT A;  2VZ3 A;  1Q56 A;  4DUV A;  2XH6 A;  1YFY A;  4Q27 A;  4WM8 B;  3MEP A;  2VME A;  1VPH A;  1V70 A;  2YMZ A;  1OD3 A;  1BBT 1;  5E8A A;  3VKO A;  1RUD 1;  1VB4 A;  2HWB 2;  3HQR A;  2WYF A;  1UXZ A;  4HPK A;  4A7K A;  1AXZ A;  1K5M C;  3H7Y A;  2BWC A;  1VRH 2;  3H1Y A;  4Z2W A;  1CPM A;  1AZD A;  3BIW E;  2XJT A;  1QJE A;  5JI9 A;  4YWA A;  4LMF A;  1EUT A;  2SBA A;  3GCX A;  5FZ8 A;  2DBN A;  3N9N A;  2LAL A;  3J7N A;  1Z7S 1;  1BXH A;  1FI2 A;  1R09 2;  2YHJ A;  5CBL A;  2A6X A;  4D7T A;  5FPA A;  3POI A;  4L97 A;  4ZON A;  1BK1 A;  1OLM A;  2GNT A;  3AMM A;  2UY9 A;  5DAW A;  3VBR C;  3SEP A;  2EID A;  1PIV 2;  3AP5 A;  4N43 C;  4BE3 A;  1RUE 1;  1RUI 3;  2DVG A;  2ZHL A;  1W9F A;  3R0R A;  4IXL A;  1GAN A;  5ERL A;  2OKX A;  1S2K A;  3MZH A;  1LGB A;  3VV1 A;  1AF9 A;  2XJU A;  3T1M A;  4PLM A;  4XQW A;  4TTG A;  1WMX A;  4QPI A;  4M4R A;  4QM8 A;  3LFM A;  3V0B B;  3KMH A;  4MZU A;  4JKL A;  4WZF A;  5HV4 A;  4CP2 A;  5FRE A;  1RUF 1;  3O7O A;  1G6N A;  1T2X A;  4V2W A;  2WUH A;  3LZZ A;  4ATE A;  5FO8 B;  1H1M A;  2ZBJ A;  1ACC A;  2VY0 A;  2GN3 A;  5A1F A;  3UGF A;  1OA4 A;  2PA7 A;  4EN7 B;  1O3S A;  2YUE A;  4EZH A;  1R1Z A;  2N7G A;  4PF1 A;  2IXC A;  4UFI A;  5FY0 A;  3WG2 A;  2KXL A;  5KBF A;  1KRI A;  3FFQ A;  3P3P A;  3J4U H;  1FMD 3;  1SBD A;  4DXS A;  2HJI A;  1W9S A;  4XET A;  3I3Q A;  1MVQ A;  1RUC 1;  4TXW A;  4AQ2 A;  4I09 A;  1PMJ X;  3VHN A;  3H3U A;  4YZ1 A;  2V4V A;  5C8W A;  1AYN 1;  3MIC A;  3O5S A;  4PT6 A;  4KL1 A;  1COV 3;  4BWO A;  2EAA A;  1VAV A;  1RYY A;  1VAK A;  4RR3 C;  5A3O A;  1C1L A;  2JG9 A;  1E5H A;  1FOD 3;  2WQ4 A;  1Y3T A;  4KG0 A;  2XUE A;  5E1R A;  1DBN A;  2YG0 A;  4ES9 A;  1SHW B;  1NY7 1;  3K4Z A;  2VL4 A;  4WM7 A;  1T6B X;  3JQX A;  4X8P A;  3VHP A;  4AHZ A;  5FYY A;  4A2U A;  3H42 B;  1OSG A;  1VB2 A;  3OSD A;  4GWM A;  4P9Y A;  3SCH A;  1H8V A;  5I93 A;  2DF7 A;  4C90 A;  2BGO A;  1B35 A;  1GFF 2;  3W9A A;  1UY3 A;  4FSJ A;  1TNR A;  1ZZ8 A;  2VBB A;  1CZV A;  2NN8 A;  2XGX A;  4HN1 A;  5DMY A;  4BQ1 A;  4C1X A;  1W05 A;  3DKW A;  4GWN A;  3ACG A;  2WYS A;  2HWD 3;  4QGL A;  1X9T A;  1GNY A;  5EFU A;  1UOB A;  2HWF 2;  1JZ2 A;  2E33 A;  4O9G A;  4A3Z A;  1W2O A;  5T5J A;  4YW4 A;  4D6Q A;  1PZ7 A;  3LEM A;  4YW5 A;  5DDJ 3;  4FAG A;  2A71 A;  3KV5 A;  2BV4 A;  4DQA A;  1QY4 A;  2O8Q A;  1BQP A;  1XSR A;  2WZ8 A;  2BDR A;  3RYR A;  1KFU L;  4AVT A;  4LIT A;  4COW A;  4NII A;  5C9A C;  1CAX B;  4FI9 A;  3MHZ A;  1ZBA 3;  1I6X A;  4P9X A;  3WDW A;  4RQP A;  1GBG A;  3GGL A;  2VTX J;  4NO4 A;  4BK4 A;  3ZLI A;  4YW2 A;  4AI0 A;  5EJZ B;  1W6P A;  1UIJ A;  2FQP A;  4M01 A;  5F7U A;  3O1O A;  3BPZ A;  3PUH A;  4QGN A;  5JMO A;  1YQ8 A;  4LO8 A;  3RYP A;  1RVF 1;  4IEX A;  4YG6 A;  3D8C A;  2JDK A;  1BMV 1;  1C8M 1;  2XBO 1;  4XQD A;  3OOX A;  4S2D A;  5HXM A;  3BKZ A;  5I8S A;  1LOB A;  1AX1 A;  4LK7 A;  2ZXQ A;  3URF A;  4AFC A;  4FTS A;  5FZ1 A;  3WSO A;  4R9A A;  3ZFE B;  3I3D A;  3U1X A;  5FPX A;  2Z4F A;  4TN7 A;  1H8T C;  4ZXE A;  3J9S A;  4GUL A;  3SC7 X;  3N36 A;  1ZBE 1;  5FZO B;  5L36 A;  2EIC A;  3ZSL A;  5ABJ A;  1CVN A;  2VQ0 A;  3VL8 A;  1MS8 A;  5CFD C;  3ZXK A;  1HLC A;  1PGS A;  4AF9 A;  4OVE A;  3ACL A;  2GC0 A;  1LCL A;  1RMU 1;  3OBR A;  4DEV A;  4OHY A;  1KEX A;  3WCS A;  3WNN A;  1AXY A;  3M3Q A;  3KWV A;  4RGA A;  1K42 A;  2VNV A;  4W6X A;  3IBM A;  1YI7 A;  2NPI A;  1UCX A;  2MEV 1;  3NNJ A;  4M0H A;  1ASJ 2;  3FHQ A;  5LK7 B;  2D98 A;  2YBK A;  2RR1 2;  5BNO C;  2BNO A;  3LDR A;  4O65 A;  5DXD A;  1K5M A;  4CCC A;  3MIF A;  4KGQ A;  4HG6 B;  3Q8C A;  2RS5 2;  5A3N A;  1STM A;  4JHT A;  5CKM A;  1RUF 3;  4FPF A;  3O1P A;  4R8H A;  1RUG 1;  3VZN A;  3B3Q E;  5EPA A;  4ZZ5 A;  4EWA A;  3JB4 C;  2TBV A;  2VW0 A;  5JMC A;  4OQ9 A;  3LFI A;  3RS6 A;  4CCM A;  1W6N B;  1WLC A;  1ZRF A;  1AR9 2;  1PO2 3;  1ULE A;  1W8F A;  1NCR B;  3DXT A;  2VE1 A;  4Q4W 3;  1TVG A;  1TME 1;  5DAX A;  1NAE A;  2QUO A;  4ITC A;  1G7Y A;  5LBE A;  4OFG A;  2Z2S B;  2ZA9 A;  2ZZJ A;  2YC2 A;  4IEW A;  2P6C A;  2R06 3;  1A8D A;  5LAS A;  5LY1 A;  3CJX A;  4XYX A;  2R07 1;  4O61 A;  3E1F 1;  1LHV A;  2RJK A;  1XND A;  1HX6 A;  1TMF 1;  2HYX A;  3NJY A;  2B7Y A;  1DLL A;  1X9P A;  3AVS A;  3AYD A;  1AL2 2;  4CDW A;  2E7A A;  1V6I A;  3MBW A;  1WLW A;  4Y1X A;  4ZXK A;  4LBM A;  4BQ4 A;  1W8N A;  3POF A;  3RVH A;  1NCQ B;  4HBN A;  3TNP B;  4CXW A;  2JEM A;  3VGI A;  1W6M B;  4GB3 1;  2J1U A;  3U07 A;  3TRS B;  5ANQ A;  3MYX A;  5FY9 A;  4IEU A;  2Y0I A;  2JDY A;  1H4H A;  2Q5T A;  4FXK B;  1RUN A;  1GSL A;  1OVP A;  3GZT B;  1AR8 3;  2WR9 A;  4IUG A;  3GDB A;  3UKN A;  2UU8 A;  1J58 A;  4Y1V A;  2XL9 A;  4Q4V 2;  5IYY A;  5J3U A;  5SV8 A;  4QX7 A;  1WCS A;  2FDI A;  1P8J A;  1UU6 A;  1MVE A;  3PUQ A;  2DCK A;  3KCX A;  1M4W A;  3O12 A;  3QH7 A;  2Z69 A;  3WG4 A;  5A3T A;  2ZML A;  2PFW A;  4UBH A;  2B42 B;  2OPK A;  1PK6 B;  3KM5 A;  4R4Z A;  3U14 A;  1IKQ A;  2RM2 1;  2ARC A;  3OPT A;  4IL7 A;  4MGI E;  1JZ7 A;  3M1H A;  3RI9 A;  4EQV A;  2DVD A;  1Y4W A;  3JXS A;  1MEC 1;  4HAN A;  3VBO B;  3VBF A;  1WA4 A;  1ZRC A;  5EHD A;  4FPL A;  3KS7 A;  2WS9 1;  2BFU S;  4ES8 A;  3I2J A;  3ZM8 A;  4J1X A;  1J84 A;  1UX7 A;  1V6N A;  4AK3 A;  2UYA A;  1QNY A;  2GU9 A;  1W6O B;  3JBG 3;  3OBT A;  4M3C A;  5BNQ A;  4YW3 A;  1IG0 A;  1GQP A;  1D2Q A;  1W2N A;  3AMQ A;  5FP4 A;  4E4H A;  1H2L A;  5FUP A;  3JCI A;  3VBS B;  4X8N A;  3ES4 A;  2ENR A;  2XBO 3;  3UES A;  3GCW A;  4LIV A;  3S57 A;  4LUL A;  2UWB A;  1W28 A;  2XQX A;  3BAL A;  4IQP A;  5EWS A;  4FFG A;  1UPS A;  2P17 A;  2WT1 A;  4X6R B;  1QU0 A;  4FPJ A;  5EYY A;  1IS5 A;  5K4L A;  1OOP C;  2JDZ A;  3QLQ A;  4XBN A;  1PMH X;  3U0Z A;  1VR3 A;  4XAA A;  3VZO A;  5GZF A;  3AP4 A;  1SZB A;  3ZYR A;  2VUA A;  1D4M 1;  1WW6 A;  2RS1 3;  1CX1 A;  1BVV A;  1AYM 1;  4QWN A;  5DG1 A;  4LNV A;  2ORX A;  2WFF 2;  4XDO A;  4K7J A;  5BYN A;  3FHA A;  1VBA 1;  4Q4Y 3;  4YYO A;  4LBO A;  3BIE A;  4Y1U A;  2JXA A;  4B7E A;  1PVC 1;  4QU1 A;  2OUH A;  3ZYF A;  3U78 A;  1PO1 1;  3ZIW A;  5AVP A;  3T2P A;  1DHK B;  3WR0 A;  4IEY A;  4TLG A;  5J7M A;  2VTF A;  4NOT A;  1LED A;  4OI1 A;  4Q29 A;  3VKF C;  5IFT A;  4MXV A;  1HRI 2;  2D6P A;  4U36 A;  5JI7 A;  1YJK A;  1CAW A;  4N7U A;  4XUQ A;  2NM1 A;  4Y33 A;  1O3T A;  5IAT A;  3O1V A;  1UYZ A;  2Y6G A;  1H8T A;  3RRD A;  3CO2 A;  3WDU A;  2EIG A;  4HLT A;  1ND2 A;  2XPJ A;  3HQX A;  1QNW A;  1U5Y A;  3A0K A;  4UFJ A;  5A6X A;  3HT2 A;  2ZGO A;  4BXS V;  5IT6 A;  5CFD A;  4IEV A;  5HXV A;  5IVV A;  3ABZ A;  4MG2 A;  4DXZ A;  2Y0O A;  5BNP A;  1JOD A;  4FVV A;  3ZXL A;  3S7I A;  5C7G A;  3OD0 A;  2ZAC A;  4CP9 B;  1DQ4 A;  4Q8K A;  3TYJ A;  1DCS A;  2GME A;  3LAG A;  5FPV A;  1TME 3;  2HWC 1;  2B9V A;  4BJ0 A;  3BCW A;  1N1V A;  4IDZ A;  1YLL A;  5FZB A;  4Q4X 2;  5FLI A;  1FXZ A;  3HPN A;  1GNH A;  2OYZ A;  2NYY A;  5EJ1 B;  1O59 A;  5IHR A;  2R0F A;  4CUC A;  4JC1 A;  5KR7 A;  1POV 1;  1I9R A;  2ZX3 A;  3T4H B;  4ET7 A;  2Y26 A;  3VD7 A;  4GIQ A;  5A33 B;  4XZP A;  4IV1 C;  2PLV 1;  4W8J A;  5FJK A;  3LIH A;  5F5Q A;  4E2G A;  1CWP A;  3WQB A;  4AVV A;  2W1W A;  4Y3O A;  1ULD A;  4P9I A;  4P9G A;  5FZD A;  1PZ9 A;  2VZR A;  3H50 A;  4Y5Z 0;  1KXG A;  2J7M A;  4HL0 A;  1DYO A;  2R0H A;  5JWP A;  2B4K A;  3BI3 A;  3S5A A;  1V6M A;  1HXS 2;  3ZFE A;  5A6Z A;  1XE0 A;  3BN6 A;  2WL1 A;  3LGR A;  4AGV A;  5JIU A;  1W0P A;  2WNV B;  1IKP A;  2MPF A;  2ZGQ A;  2ERF A;  1OUX A;  4I0W B;  3USU B;  4AEK A;  2C6S A;  4AI1 A;  4RYD A;  4RL7 A;  2V09 A;  4MXW A;  4Y26 A;  3WVJ A;  4LXL A;  1H1A A;  4AWD A;  4PF5 A;  4CDX C;  2K9Z A;  4ONU A;  3ZN6 A;  5A7N A;  4LBK A;  1UZ0 A;  1JW6 A;  4PDW B;  3INA A;  3VLB B;  1MEC 3;  4LEJ A;  1AL0 G;  3OY8 A;  5FJH A;  3ZO0 B;  4AI9 A;  1X7N A;  1YFU A;  2E63 A;  2IUW A;  2OVU A;  2P2K A;  3D6E A;  3QCW A;  4XAC A;  2HEY F;  4KWU A;  5FP8 A;  3WQ0 A;  4C91 A;  1JZ3 A;  2WLQ A;  3LOI A;  4AHY A;  4E4Z A;  2XON A;  3OUJ A;  3WW3 A;  2VR4 A;  4YPJ A;  3J8F 2;  1EY2 A;  2D40 A;  5FXW A;  2DU0 A;  2VZQ A;  2BER A;  5DUX A;  3APB A;  3WDV A;  5C4W B;  1PX4 A;  1VP6 A;  4AOC A;  4UI9 L;  5GZE A;  2TEP A;  2QNK A;  1VLN A;  2IXL A;  4I2O A;  3K77 A;  3U4X A;  1OLR A;  1QEX A;  4NPM A;  2QQP A;  1OQE A;  3WY6 A;  3ELN A;  3ZXF A;  4NPL A;  4XUO A;  2WQZ C;  2A3W A;  1SLA A;  4LO7 A;  5KXD A;  4ZU5 A;  1W8W A;  4GH4 C;  2SLI A;  4OZO A;  2G9Z A;  1DLC A;  1QJF A;  1AR6 2;  1RJ7 A;  1O6U A;  1VBC 3;  5H9Q A;  3CQO A;  1RUH 1;  4AI3 A;  4TYS A;  1SQ4 A;  1W9W A;  4H55 A;  4LO6 B;  5FMB A;  1AYM 3;  3ZXA C;  3GHN A;  1CGP A;  2ZX4 A;  2FZ2 A;  5FMO S;  4BH9 A;  4HK9 A;  1WW4 A;  3SNM A;  2VVD A;  4GA9 A;  3THC A;  4YM3 A;  1W90 A;  5F39 A;  4YFW A;  3EXU A;  5ACA 1;  5HV0 A;  2A6Z A;  3SEE A;  5BV6 A;  5I8T A;  4AZZ A;  1NCQ A;  3AFG A;  3WW1 A;  3KHB A;  1JYX A;  2HEV F;  3Q8F A;  3ZSJ A;  3IT8 A;  2R1D A;  4FOY A;  4KBB A;  5JXI A;  1H9P A;  1QJX 1;  1DGL A;  2WII B;  4LBQ A;  1OOP A;  2QFE A;  3AFK A;  4QXK A;  1MZE A;  1Q8P A;  3J7M A;  3WUC A;  4G3Y C;  1HIX A;  1FPN 2;  5G04 L;  1OLM E;  4LKS A;  1N1Y A;  4KGG A;  4XHB A;  4A42 A;  1QXJ A;  3M2M A;  4ASM B;  1GNZ A;  2QVS B;  1VBB 3;  3HIF A;  5EXO A;  3RQ0 A;  3VHR A;  5FOJ B;  4CEY C;  4XEZ A;  1DGR A;  4E2Q A;  1HV0 A;  2DCY A;  5KWR A;  2D7F A;  1PGL 1;  5KXC A;  1WZX A;  1LB2 A;  3I2K A;  1YWK A;  5C8C B;  1FNY A;  3VZJ A;  1SLI A;  4UF0 A;  4I3P A;  4GWI A;  4N8M A;  1MQT C;  1F4H A;  2A3Y A;  3M3I A;  1RL3 A;  4QM9 A;  3GM8 A;  3KT1 A;  1MZF A;  3BB6 A;  3CJI A;  5A7S A;  3LOB A;  4LUM A;  2ZGS A;  4N53 B;  5T55 A;  1G8W A;  3M70 A;  2OUJ A;  2VOK A;  1BKZ A;  4K40 A;  5FK7 A;  5JXJ A;  4C8D A;  5L19 A;  3VBH B;  5FXZ A;  4D6R A;  1W8Z A;  2AEZ A;  1QGL A;  3RJ2 X;  1W6O A;  2I07 B;  1N1S A;  4LHK A;  5BNN B;  1HV1 A;  4R9C A;  3TOJ A;  1MS5 A;  4LIU A;  5CIS A;  1RXF A;  4IEQ A;  4PHZ A;  5FO7 B;  5F2W A;  4QPG B;  4SBV A;  3VHO A;  3VD5 A;  5LBB A;  2WZR 1;  5L73 A;  1LEC A;  3KCC A;  3NV3 A;  4CXY A;  5FP3 A;  3HD8 B;  1EP0 A;  4IE4 A;  1DGW A;  2FMY A;  1NXM A;  3NKG A;  4N9I A;  2ZHM A;  4XF1 A;  4YVW A;  5FYV A;  5IVY A;  5A7W A;  3TN9 2;  3ZPO A;  5AFB A;  1SEF A;  3CL1 A;  3PMS A;  2GC1 A;  4GD4 A;  3KGL A;  1BEV 1;  3WF0 A;  2FZ1 A;  4XFB A;  3NO8 A;  3RZM A;  5FYT A;  1GU3 A;  2JD9 A;  1R1A 2;  2VMH A;  5J09 A;  1WW7 A;  2QQM A;  1GV9 A;  4LOR A;  2VNG A;  2D3P A;  3O1M A;  2VQA A;  2ZOE B;  3HNM A;  4DPN A;  1L3J A;  4RGG A;  4AED B;  2YFU A;  2VAU A;  4XCA A;  2OQ7 A;  3AVR A;  4XUN A;  1Z78 A;  3AL5 A;  5FZ0 A;  3A4U A;  1O3R A;  2WSU A;  1RUI 1;  1GMM A;  3ALQ A;  2LRO A;  4OUL A;  5C71 A;  4Y4Y A;  3K75 B;  1UL9 A;  1DZR A;  4XXP A;  5ANN A;  2R6Q A;  3VBU B;  3AZW A;  4HMZ A;  2QQK A;  5DUW A;  3UV9 A;  3D5O A;  3W59 A;  2PQQ A;  1PNG A;  2BUK A;  1GZW B;  3IMN A;  3LCP A;  3MGU A;  3IKW A;  4ZU7 A;  1IGO A;  1W9Y A;  3HMY A;  1LU2 A;  1RTV A;  3T1L A;  5F37 A;  1JUH A;  3I3M A;  1UX6 A;  1V9U 1;  3H7J A;  1JHN A;  4Q0U A;  5A1L A;  4UYB A;  1WUV A;  2G9G A;  3AP7 A;  2EVX A;  5LCW L;  4BLI A;  3N9Q A;  3IMM A;  3ZN5 A;  1JHJ A;  4CU6 A;  5LRR A;  1QXP A;  1NZI A;  1W03 A;  2AC1 A;  4MGS A;  4WM7 C;  4P9J A;  4Q8L A;  3NAP A;  1F5F A;  1OXC A;  5C3P A;  1RUH 3;  1BBT 2;  2J1A A;  3K48 A;  4U2A A;  4COV A;  1RUD 2;  1UMZ A;  3I8T A;  2DCJ A;  1FMD 1;  4FPE A;  4OYU A;  5IWF A;  5L9B A;  5LRS A;  5CB7 A;  5LA9 A;  5LA1 A;  3T0D A;  4HZF A;  1JZ5 A;  2QBX A;  3R4D B;  2JDA A;  3DPR B;  4BHP A;  3T0B A;  4IEZ A;  3O14 A;  5JOY A;  1GZC A;  1Z7S 2;  1GR3 A;  1AJK A;  2PHR A;  1COV 1;  2WLP A;  2WN2 A;  3WP3 A;  3ZPY A;  2JDU A;  2R7E B;  3W20 A;  1FOD 1;  5FDB A;  3D0S A;  4XC9 A;  4HXC A;  4OI0 A;  4QHZ A;  1RUE 2;  4B7K A;  1B09 A;  2HBT A;  4K6B A;  2YPJ A;  3WF2 A;  2XUM A;  2KA3 A;  3MUZ 1;  1D0H A;  2QQO A;  2HYK A;  3VD4 A;  3ZFG B;  4B1L A;  4LK6 A;  2BVV A;  3N7L A;  4BPZ A;  1NYW A;  2VMD A;  1UQX A;  3K51 A;  5JSO A;  4PJY A;  3H1M A;  1RUF 2;  1F8V A;  2VZS A;  4CPB D;  3WG1 A;  1O8S A;  1LOG A;  2CWM A;  2HWD 1;  3ACH A;  1OFN A;  4LOS A;  2VJX A;  2X10 A;  1S0B A;  2WNE A;  3E5U A;  3M7A A;  2A73 B;  5DDJ 1;  3H1W A;  2GDF A;  2CDP A;  4P9W A;  4R9D A;  3V56 A;  4RS5 B;  1C4R A;  5HCF A;  1JUI A;  4OUM A;  3EMR A;  4M3C F;  4YZ2 A;  1XYN A;  2FDH A;  1RUC 2;  1ND3 B;  4DO0 A;  3BOW A;  4NHX A;  2ADE A;  1UOJ A;  4YM1 A;  4LT5 A;  2CWS A;  4V1P A;  1AYN 2;  4H7L A;  4DRR A;  3ETQ A;  3TAY A;  5F5A A;  3POB A;  2MNG A;  5AC9 3;  1IQD C;  1W99 A;  2X5I B;  4JZR A;  1ZZ7 A;  3VBR B;  4BLJ A;  1DQ5 A;  3FX3 A;  3WCR A;  5KHJ A;  1N47 A;  1OC1 A;  1OMI A;  3HEI A;  4B4R A;  2WNU C;  4N43 B;  2IXI A;  1J3P A;  2OII A;  1NY7 2;  3ZN4 A;  4QXH A;  4XJZ A;  3OPZ A;  4YGB A;  5IK8 A;  4QX8 A;  5KHK A;  4P14 A;  2WFP A;  2A6V A;  4XF4 A;  5F3G A;  2OT7 A;  4F8A A;  2ZGM A;  2RS3 3;  4JGY A;  5ACA 3;  3MV1 1;  2WIN B;  3FN9 A;  3IZO A;  2NP0 A;  3KF5 A;  1DIW A;  2YYO A;  3FFZ A;  5CKN A;  5KC5 A;  4MHR A;  2Q30 A;  1CES A;  1KQR A;  1BEV 3;  1PVX A;  2D6L X;  2F4L A;  2RDN A;  4NHK A;  4XQ4 A;  3RMY A;  2EIB A;  2L9L A;  4YGC A;  5A32 A;  2EXK A;  5D2A A;  1W3V A;  1Q8Q A;  2DTW A;  2E6V A;  1AR7 3;  3SH4 A;  3BVC A;  3TWI A;  5DZE A;  2YPD A;  3AP9 A;  2B46 X;  1BCX A;  3FHI B;  3POY A;  3E6D A;  4UBG A;  4UFL A;  4BM8 A;  4CEW C;  1QQP 1;  1SCS A;  2FCU A;  1RGS A;  1PX3 A;  2ZEX A;  4FO9 A;  3K3O A;  1YJL A;  2ZGT A;  3EBR A;  3ILF A;  2RDS A;  3NKT A;  1XC6 A;  4HKW A;  1BVP 1;  1JYN A;  3LA2 A;  2PMW B;  2QKD A;  4XCB A;  4HVQ A;  3IN9 A;  2WRA A;  3HOB A;  3LDK A;  4RR3 B;  1JTZ X;  1V9U 3;  1WLT A;  2BFU L;  2DVA A;  1RVF 2;  4Y22 B;  4OZX A;  4DFS A;  3ZYJ B;  1C8M 2;  4CDW C;  3MLL A;  1SDD B;  3FZ3 A;  3C7E A;  3N7M A;  2RDR A;  4QAW A;  4FXG B;  4MAD A;  5IVC A;  1PO2 1;  2ZGP A;  1WD3 A;  4M3C E;  4KQ7 A;  2PHF A;  5B4N A;  1US2 A;  4Q4W 1;  1MR5 A;  1SG3 A;  1F15 A;  4BA6 A;  4XTP A;  1MS4 A;  4XF0 A;  5IK7 A;  4MHU A;  2E51 A;  1ZBE 2;  2R06 1;  3TBD A;  4NN0 A;  3C2U A;  1EV1 3;  4Q0Q A;  5FZC A;  2YRO A;  2ZMN A;  4P08 A;  1GP4 A;  3VBH A;  3WOG A;  1BJQ A;  1CN1 A;  3D4K A;  4ATF A;  4EZ4 A;  2IFR A;  3HQU A;  4YVS B;  5FY8 A;  2A6Y A;  4ZY9 A;  2G4I A;  1LJ7 A;  4NWV A;  1RMU 2;  2G1M A;  1JI6 A;  2FCV A;  2Y33 A;  3DYM A;  5C3R A;  2C1F A;  3ITQ A;  1EAH 3;  5GZG A;  4M4P A;  5LY2 A;  5A6Y A;  1LGC A;  1KDK A;  5C9A B;  2MEV 2;  2W2I A;  4Q5O A;  3BTZ A;  1W8O A;  5C6C A;  1ZVF A;  3THD A;  1YYN A;  4OLL A;  3WNM A;  3VBF C;  5F1R A;  3B7M A;  1UOF A;  2XML A;  1VAL A;  1AR8 1;  1RC6 A;  4CDQ A;  4HOO A;  1BK0 A;  5CAD A;  4Z82 A;  3OYW A;  1H2M A;  3CNA A;  2RMU 1;  2YV8 A;  4IE7 A;  2VVF A;  3I59 A;  2W1S A;  1RUG 2;  4S2G A;  5IAV A;  2Q8D A;  4B3N A;  1NX9 A;  5FO9 B;  1SFP A;  2JWP A;  2XVL A;  2VO5 A;  4Q0V A;  4RA0 A;  5FKB A;  4XF9 A;  5A7P A;  2A5Z A;  2ZGU A;  3P3N A;  3R4S A;  3T09 A;  4IGQ A;  4L2N A;  3UK9 A;  3V65 A;  2YB7 A;  2WT0 A;  4OHX A;  4QPW A;  2YC0 A;  3AZY A;  1OUS A;  1POQ A;  1TME 2;  5BXX A;  3AL6 A;  4M0N A;  3AMP A;  2VZU A;  3GZA A;  2GMM A;  1W0O A;  5CAZ A;  5FLH A;  1CON A;  5FZ9 A;  2D6K A;  3K3N A;  2Y38 A;  4K21 A;  4K8R B;  4URT A;  2R07 2;  2LW8 A;  1F5J A;  3POW A;  1E5I A;  1GUI A;  4M00 A;  5A1A A;  3DN7 A;  1GQH A;  1XSQ A;  1UOG A;  1TMF 2;  2P4E A;  3S6P A;  2WAA A;  1DDL A;  3JBG 1;  4FOW A;  2RDQ A;  4LLO A;  3NJZ A;  2P3J A;  5LBF A;  1CAU A;  3EHK A;  1URX A;  4QB2 A;  4GB3 2;  5DN2 A;  1NOV A;  3WP5 A;  4H14 A;  1QIQ A;  3E6B A;  5J37 A;  1ZA7 A;  5A7O A;  1H6Y A;  4QGM A;  1UPI A;  5DAP A;  5BNO B;  2PAE A;  4Y20 B;  4A7Y A;  5D1I A;  4IER A;  3UYJ A;  5A3L A;  1TQ5 A;  3EQE A;  1REE A;  4NHL A;  4WVM A;  3DKQ A;  5DUV A;  3VZL A;  5JR7 B;  5A6Q A;  1ND2 C;  2VTX A;  2NMO A;  1XNK A;  2BEO A;  2HWE 3;  2B8M A;  2W92 A;  2RS1 1;  4RHV 1;  2VU9 A;  5LBC A;  2VUD A;  1JZ6 A;  4XZU G;  4MV2 A;  1LUL A;  4Q4Y 1;  2XJP A;  3OGS A;  4PLO A;  3MW2 A;  2XJS A;  3PME A;  4N90 A;  1UKG A;  4P5H A;  2ZGN A;  4G9S B;  5BNP C;  2WNU A;  2ETE A;  2RM2 2;  3C7G A;  4N9H A;  5L7O A;  2NQY A;  1HB4 A;  2R04 3;  3A22 A;  1HRV 3;  3WLU A;  1TNF A;  5CFC A;  2ZGL A;  1QQP 3;  2PHW A;  3HN1 A;  1MEC 2;  5LA0 A;  1W6Q B;  4FPG A;  3OF1 A;  2WT2 A;  4XFH A;  5IK4 A;  4GKX A;  2WS9 2;  4NHM A;  5K8S A;  1O5L A;  2YXS A;  1OF4 A;  2FDK A;  2JB8 A;  1UY1 A;  5FPL A;  2E31 A;  1W39 A;  4R9B A;  1OH3 A;  2DCT A;  2PN5 A;  5C3Q A;  5FQ0 B;  3UNP A;  1S0F A;  4FPK A;  2QQU A;  1SPP B;  2PXJ A;  1CAV A;  1GYK A;  1YEW A;  3GF6 A;  3UGH A;  2PHX A;  3JD7 3;  3KT7 A;  3B00 A;  4JDN A;  1CZS A;  1ST8 A;  1ZZ9 A;  2GH2 A;  2WA3 A;  3C7F A;  1PM7 A;  4CDU A;  1SAC A;  4CEW A;  2VUC A;  3SXW A;  1NG0 A;  1C5I A;  1D7P M;  1TG7 A;  2Y6H A;  3I2F A;  2ID4 A;  2JDM A;  2P3Y A;  3HNB M;  4AQ6 A;  5KC6 A;  2GSY A;  1D4M 2;  2XOM A;  3ZFE C;  2YGL A;  4FP2 A;  1AYM 2;  1OKO A;  4JCK A;  2DUO A;  4KNC A;  3SHR A;  2PHL A;  1VBA 2;  2LM3 A;  3KCY A;  2EAL A;  3QD6 A;  5FYC A;  3TEY A;  3PHM A;  4FOV A;  4K1Z A;  5E6H A;  5L9R A;  1PVC 2;  4OI4 A;  2XLF A;  1PO1 2;  1YUD A;  2VVE A;  3KF3 A;  3BUC A;  3LPF A;  5JOW A;  4NAM A;  4E2S A;  4JVA A;  1LU1 A;  3OUI A;  3KQ4 B;  4XBL A;  3ZXE A;  2D6M A;  1VBD 3;  1X33 A;  2C26 A;  4YW6 A;  5FMO L;  3ENR A;  5H9R A;  1UN1 A;  2ZAB A;  4WM8 A;  1LHW A;  1REF A;  4CCD A;  5FZK A;  1JXN A;  3I2G A;  3I2H A;  4LKD A;  2YBS A;  2VUL A;  2EXH A;  3SIS A;  2RMU 3;  3VDA A;  1CIY A;  2CY6 A;  3MIG A;  1JH5 A;  4XHX A;  3ZR6 A;  1JZ4 A;  4OUE A;  1R08 3;  1OA2 A;  1G9A A;  1LAJ A;  3HT1 A;  4UW3 A;  5CG9 A;  1XOY A;  1Q8S A;  1BLZ A;  3RJR A;  1MS0 A;  3T0A A;  4Q1R A;  1VJ2 A;  4NIA A;  4LUK A;  3NQH A;  3ZKU A;  3N9P A;  2HWC 2;  3N3H A;  1HJG A;  4LBL A;  4Q26 A;  5FTT C;  2DUR A;  2DV9 A;  1NCR C;  5D8A B;  3O1T A;  1H4G A;  2XKP A;  4LBJ A;  4AVB A;  3ZOI A;  3KZ4 C;  1QJU 1;  3KLS A;  4KWL A;  5IUQ A;  2VMI A;  4BDV B;  4EV0 A;  2D97 A;  2RVA A;  1KGY A;  3M8L A;  3PU3 A;  5JAX A;  4MGZ E;  3RZZ A;  4D3W A;  1VRH 3;  2ZTN A;  3V0B A;  5DG2 A;  3FUQ A;  2PLV 2;  4V2V A;  4E9K A;  2H0V A;  1QOT A;  2YU1 A;  1R09 3;  4CTE A;  5EIY B;  3AM2 A;  1RHI 1;  2QJV A;  1AXK A;  1NCQ C;  1TE1 B;  5A70 A;  2ARB A;  2JKB A;  1FV3 A;  4RD7 A;  4FOQ A;  3AC0 A;  5FY1 A;  5FWJ A;  1HW5 A;  3B9I A;  2JE8 A;  2ARX A;  4ASK A;  3IDB B;  3FMG A;  3KVB A;  4A6S A;  4XFG A;  1QOO A;  1VBC 1;  1OI6 A;  4B8E A;  4XVH A;  3FJS A;  4ZS2 A;  3VUO A;  2WAO A;  2XDV A;  1YQ6 A;  3AKP A;  4JGZ B;  5FYZ A;  3FWE A;  3VL9 A;  4RHV 3;  4ZZ8 A;  3K2O A;  1HQW A;  1U5X A;  1YFW A;  2C0Z A;  2IVI B;  4EJR A;  1Q5O A;  3ORJ A;  3SH3 A;  1NA1 B;  1HQN A;  5JZG B;  2WBK A;  2ATF A;  2JG8 B;  1UYP A;  3FL7 A;  3LSD A;  4KBZ A;  5F9T A;  3BTY A;  1XU2 A;  4LHN A;  3NNL A;  3U10 A;  1S4C A;  2O8O A;  3O1U A;  3N9M A;  3WP4 A;  1AR9 1;  1KIT A;  4GAL A;  2WN3 A;  1JS9 A;  3I3E A;  3AYC A;  5FYM A;  4E8D A;  2GNM A;  3HR9 A;  5FUI A;  3CJI C;  4CCO A;  2BW8 A;  1QF3 A;  3I4I A;  1LOD A;  1YFX A;  4MLO A;  3E97 A;  3RG0 A;  2XHK A;  2V72 A;  5FKC A;  1RB8 G;  4IV1 B;  1VBB 1;  1UKR A;  2Y6L A;  3IM0 A;  3PUR A;  4AQT A;  3N4M A;  1AUY A;  1NKG A;  4AFA A;  2XWB B;  5JOZ A;  3N7K A;  4AR2 A;  3AB0 A;  1H6X A;  4Z8B A;  5CG8 A;  4JAA A;  4LHS A;  4BME A;  5GAL A;  4J25 A;  4BQ5 A;  3AK0 A;  1L7Q A;  1EYB A;  1GLH A;  3ATG A;  3KB5 A;  2KR2 A;  5JUV A;  4D6S A;  2ZEY A;  2ZJC A;  2WO7 A;  3I3B A;  1RUH 2;  4QX3 A;  1CAX A;  3I54 A;  4YVW C;  1VAM A;  3HN3 A;  1QJY 1;  3D0J A;  5LB6 A;  3IDE A;  3UJQ A;  4LKE A;  5FZI A;  1WW5 A;  3H8U A;  1CPN A;  4N7I A;  2VNO A;  1IPJ A;  4CDX B;  1DG6 A;  2RJL A;  3U75 A;  5FR3 A;  3NNM A;  4UW6 A;  2HWF 3;  1SFY A;  1YO8 A;  3ZSM A;  3OEA A;  3E6C C;  1AHS A;  3A0N A;  2VMC A;  1V6J A;  3K46 A;  4LTA A;  2OPW A;  4NVP A;  4WZC A;  4DZG A;  4AL9 A;  2VGD A;  1QJX 2;  3NNF A;  4DIN B;  4BZ4 A;  1E5S A;  1QH6 A;  4P9L A;  2VW2 A;  2ZAA A;  3IPV B;  4I0A A;  4QQP A;  1UZZ A;  2W39 A;  3CEW A;  2WZE A;  4YZ3 A;  2DDU A;  1CJP A;  1POV 0;  4Z07 A;  5I0S A;  2DVF A;  1WMD A;  4IV3 B;  3L2Y A;  3L2H A;  1J1T A;  1X36 A;  1UD1 A;  5FZO A;  2DUP A;  3NW4 A;  3IAP A;  2JX9 A;  1LEN A;  2VD7 A;  4WVW A;  3CMG A;  2W95 A;  4D8M A;  1PGL 2;  2QQV A;  2WA4 A;  2DUQ A;  4ARX A;  3DXU A;  1FNZ A;  4YGE A;  4GH4 B;  2A3X A;  1XRU A;  3LA7 A;  3MIB A;  4UXA A;  5K0U B;  2ZGR A;  2W9X A;  1ENQ A;  4D0Q A;  2JDN A;  1V00 A;  4NE9 A;  2P3I A;  3OTF A;  1O3Q A;  4QKD A;  3NAP C;  2JEC A;  1QJU 3;  2GMP A;  3KHC A;  3AYE A;  3AMH A;  1NLR A;  5HPO A;  2AH2 A;  2HBU A;  2XHN A;  2Z42 A;  4OMD A;  4X6Q B;  2J1T A;  1IS4 A;  4RSU A;  2GH8 A;  5SV5 A;  2WFF 1;  3SLI A;  3KQR A;  2AUY A;  1SPP A;  4KWK A;  5T54 A;  1LEM A;  2HLE A;  2ZX2 A;  4GXL A;  1RHI 3;  4XW3 A;  3SQO A;  3VZM A;  2WZR 2;  3HBZ A;  2Q1Z B;  1W6N A;  2OW4 A;  3ETP A;  3OEB A;  2DU1 A;  1NCR A;  3TB0 A;  3V0A B;  2GND A;  4JKK A;  1YQC A;  1ASJ 3;  1LNS A;  1XE7 A;  3VDD B;  3AJY A;  4L11 A;  2BZD A;  2CU5 A;  3GBF A;  4L0P A;  2RR1 3;  3SCF A;  1YIP A;  5AFE A;  4J6G A;  4NRM A;  1QKQ A;  1RIN A;  4CEY B;  1W8U A;  5FYI A;  5JPN B;  1UY2 A;  2RS5 3;  2WNV C;  3ZFF B;  3RWK X;  2K0G A;  3GBG A;  1Y7B A;  3N35 A;  3QBQ A;  4AHX A;  3IDA A;  4UFH A;  5FWE A;  2PEL A;  4EN8 B;  3ECQ A;  1H1I A;  1MQT B;  4BB3 A;  4P02 B;  1I1E A;  5F3C A;  3ZX7 A;  2O1Q A;  1I5P A;  3RZG A;  1AR9 3;  3WHU A;  1W6M A;  2OS2 A;  1GWL A;  2WWU A;  4CUG A;  3MV0 1;  1RUI 2;  2PAM A;  4I02 A;  3WDX A;  3OB8 A;  2BJS A;  2E9Q A;  5LEJ A;  1OA3 A;  2R49 A;  4QDS A;  5CZK A;  4DUX A;  1LOC A;  2GNB A;  2VH9 A;  3AX4 A;  3FUO A;  4HPK B;  5K7P A;  2VCA A;  2ARE A;  4PIX A;  4XUP A;  5I0R A;  1D0G A;  4XIL A;  4CZS A;  3PIJ A;  2CAV A;  4B4Q A;  4BOW A;  1SLT A;  5FYH A;  1V9U 2;  5GZC A;  5LK5 A;  5C4W C;  1AL2 3;  1KJL A;  4IET A;  3B01 A;  4K9S A;  1RXG A;  1PK6 A;  5GLU A;  2YZ4 A;  4E4D X;  2P5B A;  1SCR A;  1W2T A;  3WQ1 A;  2BWA A;  1VBE 1;  3JU9 A;  2A70 A;  4FP3 A;  2CAU A;  3RFR A;  3VDB A;  3CKH A;  2WC2 A;  5F3I A;  4F7Z A;  3AZX A;  4CP0 A;  4H3W A;  5A3U A;  2PQS A;  1N3O A;  4PBP A;  3VBO A;  2VBP A;  4AVA A;  4IW3 A;  2FHR A;  1BMV 2;  3MLK A;  1XB9 A;  2CL2 A;  1FMD 2;  1QJY 3;  1Y9M A;  1HXS 1;  2BTV C;  3B02 A;  2BVB A;  3C3V A;  4JGY C;  4QPI B;  4Y1Y A;  3ILR A;  3BPS A;  4Q4V 3;  4AFD A;  2IXH A;  3THP A;  3WW4 A;  4OI2 A;  3AMN A;  1HQL A;  3Q8E A;  2DTY A;  4RGK A;  2X29 A;  4XJ8 A;  2XG3 A;  4J1W A;  1COV 2;  2GAU A;  2Y8K A;  3WDT A;  4AFB A;  3VBS A;  5FAX A;  4FTE A;  5AC9 1;  1UMH A;  1FOD 2;  3RNS A;  3I49 A;  2WO3 A;  5GLW A;  3MFC A;  4BYY A;  2WWJ A;  5A7Q A;  3RZL A;  3QOP A;  2Y34 A;  1G9D A;  5FRA A;  2Z5W A;  3P6B A;  2D44 A;  3WNP A;  4GQ7 A;  4CCN A;  1HN0 A;  3ZKY A;  2JKX A;  2IWG B;  3MIE A;  2RS3 1;  1SFN A;  5H9P A;  3GNE A;  4D69 A;  4ZKT B;  3LB9 A;  1W0N A;  3MLJ A;  5IAX A;  4JGZ A;  4CPB A;  1UZY A;  3C8X A;  3V64 A;  1UZV A;  4KU7 A;  4MGQ A;  3VN4 A;  5FCC A;  2JDP A;  2HWD 2;  3NV1 A;  1GKB A;  1AR7 1;  2JG8 A;  2JG9 B;  2OA2 A;  2YC4 A;  3P5B A;  1JMU B;  4XMI A;  4COU A;  5FLJ A;  1HB2 A;  2B45 X;  1NQJ A;  5I91 A;  5DDJ 2;  2CGO A;  3MDP A;  3MPB A;  4JTO A;  1ZX5 A;  2NMN A;  3GBW A;  1S0I A;  1XPW A;  2QQI A;  1OT5 A;  3LDB A;  2J42 A;  2DWR A;  4HFS A;  1ZBA 2;  4XJA A;  1YQ5 A;  1B35 B;  3D82 A;  4XDQ A;  1JYW A;  3SCG A;  3EYP A;  5FY5 A;  4DXT A;  5A3M A;  4QKB A;  4LLF A;  4B4P A;  1R64 A;  5FZ6 A;  3DYP A;  5JIA A;  1PGW 2;  2C24 A;  2WFF 3;  3POJ A;  3VBH C;  4HET A;  1AX2 A;  1JOP A;  1MZ6 A;  4SLI A;  1W3X A;  4YW1 A;  3G7D A;  1QMJ A;  4FT8 A;  4FPH A;  4DOU A;  3UL2 A;  1OF3 A;  5T5O A;  1LOE A;  5HI0 A;  2D3R A;  1OQ1 A;  1CX4 A;  4QPG C;  1LKN A;  5FZG A;  4CP9 A;  2CNA A;  5FOB B;  4GMP 1;  1ONA A;  4XUT A;  3LKJ A;  2A7A A;  2CDO A;  1HRI 3;  3NNG A;  5C5U A;  3DL3 A;  4I0B A;  3LA3 A;  2YDE A;  2WKK A;  1FV2 A;  4ASL A;  1WBF A;  5KXE A;  4FTB A;  3DYO A;  1HB3 A;  2ET1 A;  1I5Z A;  4RQP B;  2AGS A;  1N3Q A;  4NWW A;  1KFX L;  3ZMN A;  4CDQ C;  3NST A;  1W6P B;  1EV1 1;  3MPP G;  2JE7 A;  1K3I A;  1W8T A;  1KD7 A;  3HAG A;  4Q0P A;  1QDC A;  4QT6 A;  1DQ0 A;  2P37 A;  2WQ8 A;  2W3J A;  4NMI A;  5A33 A;  4YAR A;  2B5H A;  1MZ5 A;  3MFA A;  3W21 A;  1ALY A;  2C9K A;  3W5M A;  1EAH 1;  5FPB A;  4UW4 A;  3VD9 A;  1QQP 2;  3OD4 A;  1LHN A;  1FAT A;  1XNA A;  3H8R A;  3J7H A;  4MGY E;  3X29 B;  3ACF A;  3VKN A;  4CRQ A;  1ENS A;  3IPV A;  2JE9 A;  4CU8 A;  4DNY A;  4Y4R A;  2C9A A;  5ABJ B;  3T30 A;  3A23 A;  2BGP A;  3I7D A;  4GZ9 A;  3DCQ A;  4XTM A;  5FIX A;  2FDG A;  3VBU C;  4AG4 A;  2WNV A;  4QD2 A;  1GZ9 A;  1G9C A;  2PHT A;  1WD4 A;  2VPV A;  2WSV A;  2CGN A;  3USU A;  4NRO A;  4ERO A;  5LW9 A;  4JX0 A;  5E88 A;  4AFM A;  5CEH A;  1H0B A;  4IGP A;  4QMA A;  3VZK A;  1PO2 2;  1YIF A;  1VBE 3;  1D4V B;  3A21 A;  3S0M A;  4Q4W 2;  5DQ0 A;  2PAK A;  3UKT A;  3ZDV A;  4PDW A;  2TNF A;  1IQA A;  2VZ1 A;  2XJV A;  4AEM A;  1S1A A;  4B1M A;  2R30 A;  1U12 A;  3AZZ A;  2FDJ A;  2QTW B;  2R06 2;  4QXC A;  1HXS 3;  1DQ1 A;  4YZ4 A;  4WBB A;  4GWJ A;  3IAQ A;  1UU4 A;  1K5M B;  3BOP A;  2GP3 A;  2LTN A;  3GJA A;  5JSP A;  4K8F A;  2RHP A;  3DUI A;  5C3S A;  1QWR A;  3ZR5 A;  4C0H A;  1JYT A;  4ZU4 A;  5I0D A;  5C4W A;  1ULC A;  4CXX A;  2V5D A;  4L99 A;  3DPR C;  1AJO A;  3BYW A;  3PVO A;  2CHH A;  3AZV A;  1V6L A;  2JEN A;  3PTR B;  2P1B A;  3QAC A;  5LA2 A;  1MS9 A;  2YBP A;  2QZ3 A;  3TNQ A;  5L7O C;  2W94 A;  2VC9 A;  4FQZ A;  5CFC C;  3D3A A;  3WEZ A;  4DS0 A;  4QU2 A;  1WCD J;  4XAE A;  3T3Y A;  2XLG A;  1C3H A;  1AR8 2;  1U0A A;  5A3P A;  2F6B A;  3IB3 A;  3NL1 A;  1RUJ 1;  4XUR A;  2VBD A;  3QH6 A;  5FYS A;  5TSW A;  3J8F 3;  1ZA4 A;  2RMU 2;  4NR1 A;  4WV8 A;  2OXB A;  2XJQ A;  4QX0 A;  1UO9 A;  3M3E A;  3ZFG C;  1G9F A;  2HWE 1;  1LR5 A;  2PHD A;  2XKO A;  1LTE A;  2VEC A;  4CDW B;  1UWW A;  3SIT A;  2W52 A;  3RGB A;  4BQ2 A;  1TZO A;  2G19 A;  1Y43 B;  2AR6 A;  3E5Q A;  1IS6 A;  4I3G A;  2R04 1;  4CDU C;  3AXE A;  1FX5 A;  1HRV 1;  5LZ6 A;  3UT0 A;  5IFP A;  1C28 A;  4WVZ A;  4YW7 A;  3PJY A;  3S7E A;  1XJA A;  5LWB A;  1AR6 3;  4RS5 C;  4DB5 A;  1OBN A;  1EPZ A;  5HCA A;  2BNM A;  3JQW A;  1XNC A;  4CUA A;  3UKV A;  2OX0 A;  4XBQ A;  5EJ3 A;  2R1B A;  4E27 A;  1DQ6 A;  1LES A;  3JBG 2;  1ND3 C;  2D3S A;  2GP5 A;  2DBI A;  3TEW A;  4JTN A;  3Q9O A;  4QQO A;  3WNL A;  2Q8O A;  1ZNP A;  3WIN E;  3ON7 A;  4YM2 A;  4XDP A;  2GC3 A;  1G86 A;  2XBO 2;  3JD7 1;  3SMH A;  2X5I C;  5C8C A;  4QX2 A;  5CIR A;  3FC0 A;  4GMP 3;  5FMD A;  1GOF A;  4WVV A;  4K20 A;  3VBF B;  2ZGK A;  1CIW A;  2XVG A;  3CIH A;  4DRV A;  3GJB A;  3WD5 A;  2VG9 A;  4OHW A;  4A6O A;  4RN5 A;  2UYB A;  2OZ6 A;  4WM8 C;  5JDB A;  2BOI A;  1KJR A;  4N53 A;  3H8O A;  1FPN 3;  3N7J A;  2WDB A;  4M3C B;  4RHV 2;  2RS1 2;  1GZT A;  1VMJ A;  3LE0 A;  1LGN A;  3OUH A;  5B4X A;  2ZPX A;  5K9Y A;  2E53 A;  4Q4Y 2;  4D94 A;  2QQW A;  2W08 A;  3R05 A;  5H9S A;  4D7S A;  4GJY A;  5BNN A;  2I45 A;  3HJR A;  2IXJ A;  1E5R A;  1KS4 A;  1RIT A;  3FBM A;  1MS1 A;  1U5Z A;  4QPG A;  5BUV A;  2H6C A;  2K46 A;  4AXO A;  4LE4 A;  2Y64 A;  1VBD 1;  2Q8C A;  4OUS A;  5JCT A;  1BZW A;  1GQG A;  3VKL A;  3GZE A;  1LOF A;  2EA7 A;  4FFH A;  4L9B A;  1GWM A;  5CU1 A;  4AE2 A;  5APA A;  5F5C A;  2IXK A;  2AYH A;  4MO3 M;  2DFB A;  1VRB A;  3ZXD A;  1OH4 A;  1OLQ A;  3PVB B;  3AKS A;  3ZYH A;  5GJ6 A;  2ZHK A;  3OCP A;  4Y5S A;  4LBN A;  3WX5 A;  1LRH A;  4OHV A;  1R08 1;  5F3E A;  4QB6 A;  2XQR A;  2P6H A;  3WNO A;  1S2B A;  2QQL A;  2ET7 A;  2WNO A;  4EYU A;  4JRA A;  2QZ2 A;  5T52 A;  2P3K A;  3VD3 A;  1OKQ A;  1XQN A;  4ZS3 A;  4JQR A;  3WNK A;  4AED A;  4LO4 B;  4D7Y A;  4MSV A;  4BU2 A;  1WCK A;  4QPY A;  1CAW B;  1S0J A;  1ZRE A;  1W2U A;  2D5F A;  5FZA A;  1A8M A;  5DPN A;  1ENR A;  1H8T B;  1QJZ A;  4XFA A;  3SKV A;  1A6C A;  2ZX1 A;  1ND2 B;  1ZM1 A;  3OBZ A;  4K3U A;  3TN9 3;  4CYD A;  3DEM A;  3NMB A;  4C0B A;  5FV3 A;  2W46 A;  2D6N A;  4RFR B;  3VBU A;  2XL7 A;  1YI9 A;  2HWB 1;  1WMF A;  2BNN A;  3H8X A;  1NUK A;  2VM9 A;  5CFD B;  4HVR A;  1VRH 1;  2ZEW A;  1GZW A;  1R1A 3;  3OGV A;  5BNP B;  2GZW A;  4MGT A;  5KHG A;  4HVO A;  4W6Y A;  4JQT A;  4YVS C;  4LA3 A;  1R09 1;  3PNA A;  5D21 A;  2R16 A;  4KU8 A;  5F2S A;  3WF3 A;  3AKT A;  4QX1 A;  3CDZ B;  1PIV 1;  3PUA A;  1MS3 A;  4YG0 A;  3AYA A;  3WV6 A;  1DGR N;  4QQL A;  3S30 A;  1RUJ 3;  2AEN A;  4C1W A;  4BXF A;  1IPS A;  2VOX A;  2Y6K A;  1U5I A;  3WQ7 A;  2IFW A;  3MIH A;  3A7Q A;  1NXD 1;  4XMA A;  3R6S A;  3CLP A;  4JRL A;  2EXJ A;  4H2A A;  4F83 A;  5DZF A;  5BY5 A;  4BIO A;  4R52 A;  5F32 A;  4LJH A;  2ZZQ A;  3DPR A;  2WZP P;  1F35 A;  1W9T A;  3ZIX A;  2E7Q A;  2VQT A;  5GM0 A;  2QDR A;  2J22 A;  2QCS B;  3JZV A;  3P1I A;  4Q2F A;  3VKM A;  2W1U A;  2JJ6 A;  4MX3 A;  1J1L A;  2ZKL A;  5F6L B;  2EF6 A;  1JZ8 A;  2J1R A;  1J83 A;  3LF7 A;  1QJU 2;  2PYT A;  1BBT 3;  1W04 A;  2CYF A;  1RUD 3;  2VNR A;  2ORZ A;  4XE9 A;  3POS A;  4O7X A;  1WME A;  5FZ3 A;  5IW0 A;  3RPQ A;  3ZFG A;  1DQ2 A;  4O9E A;  5GLV A;  4KWJ A;  3N9L A;  1O8P A;  1F9K A;  1W8H A;  4MXW B;  4BMB A;  3B93 A;  4LA2 A;  1Z7S 3;  1XBF A;  4HKO A;  2ZEZ A;  1RHI 2;  3ZN6 B;  2Z79 A;  1XYP A;  3PLQ A;  5DAB A;  4TLF A;  3LEI A;  2DCZ A;  1JOB A;  3OGG A;  4DUW A;  1WGP A;  2ZHN A;  1RUE 3;  3OY8 B;  4EN0 A;  2VOW A;  4DIQ A;  2X05 A;  2WO2 A;  3HWJ A;  4OCT A;  4RS5 A;  3U11 A;  3AP6 A;  3T2Q A;  4FBF A;  1VBC 2;  1J3R A;  3W58 A;  5FXX A;  1S0E A;  2BOJ A;  2DVB A;  3OG2 A;  4E8C A;  4HSJ A;  4HSL A;  3FBY A;  2VCM A;  3MF6 A;  1ND3 A;  3M4F A;  2Q1F A;  5JSR A;  1A34 A;  4YGD A;  1X82 A;  1YHF A;  5JXG A;  2CTV A;  2P34 A;  1H9W A;  2XWJ B;  3FLT A;  4GAZ A;  3ZYB A;  2BYV E;  4A44 A;  4B29 A;  1O4Z A;  5M0T A;  2HWF 1;  2X5I A;  3VBR A;  5DAV A;  1UYX A;  1M06 G;  1XXN A;  1H2N A;  1VMH A;  4N43 A;  2XXZ A;  3KV9 A;  1APN A;  4LOT A;  1CR7 A;  2XVK A;  3O0X A;  3CBN A;  3R4U A;  5KXB A;  2O14 A;  3O0V A;  4UFK A;  3B94 A;  3FE5 A;  1GOG A;  3F95 A;  1RUC 3;  4AQS A;  4S2H A;  1YQ2 A;  1VBB 2;  4W6W A;  2BQP A;  2RE9 A;  4XOG A;  3WP6 A;  1AYN 3;  5LEK A;  5FFO C;  5J96 B;  4I30 A;  1OD5 A;  4HT1 T;  1HN1 A;  2VZP A;  1DF0 A;  1AVB A;  3PTY A;  3THT A;  4YZ5 A;  3ZYI B;  1RIR A;  5FK8 A;  4LR4 A;  2BPA 2;  4NIG A;  3L9J T;  3T4V A;  1PM4 A;  5G05 L;  3ILN A;  3SKJ E;  4QX5 A;  3J26 N;  1OOP B;  4JDM A;  4LBQ B;  4BQ3 A;  1JU4 A;  5IVE A;  2W0X A;  2ZMK A;  1QJY 2;  3RDI A;  3KGZ A;  4MUV A;  2IC1 A;  2ZCW A;  2HKX A;  1S0G A;  2HWB 3;  1S2E A;  2Q0A A;  2NZ9 A;  3RZJ A;  4UAP A;  1N3P A;  3PUS A;  4NRQ A;  2JIC A;  3WZ1 A;  5FYB A;  1VIW B;  4RR3 A;  4NID A;  1DYK A;  1HB1 A;  4UF0 B;  4Y22 A;  5DUU A;  1XNB A;  5EYX A;  4P5Y A;  5FPZ A;  4KMQ A;  5FYU A;  1NLS A;  5EP9 A;  2R32 A;  1EUU A;  5F6K A;  1ZRI A;  3B9C A;  1E57 A;  1PIV 3;  2OQ6 A;  2JB4 A;  3CJI B;  2W47 A;  5FZL A;  5J36 A;  4AVC A;  1H30 A;  4CU9 A;  3C7H A;  1K45 A;  4Q0S A;  1ASJ 1;  4PIY A;  1FYU A;  1UIK A;  3NRU A;  5J48 A;  2VUJ A;  1V6O A;  2RR1 1;  3ZSE A;  3HNY M;  2C4X A;  1SLB A;  2IZW A;  4HON A;  2RS5 1;  3WF1 A;  4AI8 A;  4CCJ A;  2HH9 A;  3EB7 A;  1ZZC A;  3ES1 A;  1ZRD A;  1RVF 3;  4YVS A;  1DZT A;  1C8M 3;  4W4Z A;  1PK6 C;  2VQU A;  3F2Z A;  3S5Q A;  1SLL A;  2J1V A;  3B5L B;  2A1X A;  1IG3 A;  1WLD A;  5C9A A;  4YVW B;  5A7W B;  3NVC A;  3RZK A;  2TUN A;  5JVV A;  4YLZ A;  5D8A C;  4A3X A;  5CA6 A;  4IE6 A;  3VBO C;  5F8P A;  3LEK A;  5HBA A;  1ZBE 3;  4JV4 A;  1NZC A;  3POE A;  2AEY A;  1JYC A;  2Q1M A;  1O4T A;  3LSE A;  3ZYP A;  4A45 A;  5JPM B;  3RYK A;  5FP9 A;  3BU7 A;  2J1E A;  3WG3 A;  5CKQ A;  5GLZ A;  3IWZ A;  5IJR A;  2DFC A;  4BQY A;  3WUD A;  2VMG A;  2W68 A;  4XJ9 A;  4TZD A;  2RG4 A;  1A78 A;  1AL2 1;  1RMU 3;  4E4S A;  4NHY A;  1Q3E A;  3VBS C;  3TEZ A;  5CYY A;  1DFQ A;  3T2T A;  1UZW A;  3WDY A;  3CZU A;  4ZHN A;  3M3C A;  4IEP A;  1NE4 A;  2MEV 3;  4NJ4 A;  3Q8B A;  3OBA A;  1ENX A;  3KV4 A;  5IVB A;  1SBE A;  2BP6 A;  3ACI A;  3MF9 A;  4KG8 A;  5A3W A;  3AKR A;  3DV8 A;  4QDR A;  5CVR A;  1V6K A;  1IOA A;  1NQD A;  3B69 A;  1JBC A;  3ZXJ A;  3CZJ A;  1AX0 A;  4Q4V 1;  2O0O A;  3BOD A;  4JGZ C;  1IZ3 A;  1RUG 3;  4LE3 A;  3KV6 A;  5EQU A;  3RWN A;  3HVD A;  5JXH A;  4AAX A;  2PTM A;  1NA1 C;  4QB1 A;  2X53 S;  5JZG C;  2JG8 C;  1ODM A;  3J7L A;  3MID A;  1UAI A;  1UNB A;  1KS5 A;  2E32 A;  5IVJ A;  3NAP B;  4QXB A;  2IVJ A;  2WJS A;  3RSJ A;  1JN2 P;  4BQX A;  3H3L A;  5BNO A;  1W2A X;  2QE3 A;  4Y20 A;  1YXW A;  4NIH A;  2R07 3;  3ROU A;  1F4A A;  2RV9 A;  3K4D A;  1S0D A;  1TMF 3;  4RFT 0;  2Y6J A;  4ORF A;  1YCI A;  1GP6 A;  1X8M A;  3WW2 A;  2LRP A;  1O7F A;  5JR2 A;  3JUU A;  3VB9 A;  4PLN A;  1UF2 C;  5I8Y A;  5ISL A;  1WCQ A;  2BBA A;  2LS6 A;  1GP5 A;  4HKL A;  3T2O A;  4GB3 3;  1XU1 A;  1Y9Q A;  2QQJ A;  3G6J B;  2OZJ A;  1VBE 2;  3KD4 A;  2FMD A;  4IES A;  4L8Q A;  4MVT A;  5KHI A;  5CNA A;  5E89 A;  3AJZ A;  5BPX A;  4DEQ A;  3CF6 E;  4XJW A;  3O1R A;  3EO6 A;  3ST7 A;  1W6Q A;  2C5D A;  5ACA 2;  1RJ8 A;  5FZH A;  5LAT A;  4EN6 B;  1ZYB A;  1OPO A;  2K2S A;  1DU3 D;  2JIG A;  2I2S A;  4Z92 B;  2YFZ A;  3LEG A;  3WHT A;  1A3K A;  4LKF A;  4MOA A;  3KT4 A;  3PU8 A;  2B9U A;  2V5Y A;  4Y24 A;  5FQ0 A;  4OMC A;  3GHM A;  1CD3 G;  2CV6 A;  5AC9 2;  1N1T A;  1IPK A;  1W06 A;  2RM2 3;  2VW1 A;  4LQR A;  3H3Z A;  1Q8O A;  5KHH A;  4NUB A;  5T3N A;  1QDO A;  2JD4 A;  4MGK E;  3PIG A;  4AEJ A;  1HRI 1;  1WCU A;  3HBK A;  2JDH A;  4NRP A;  3GZU C;  2WS9 3;  4AHW A;  5C3O A;  1WWY A;  1J3Q A;  2RS3 2;  4QHB A;  4QQ2 A;  2AAC A;  4R4X A;  3U4S A;  2WWS A;  3NJX A;  4CSW A;  1UY4 A;  2ZKN A;  1BEV 2;  2D6O X;  2GC2 A;  2XJR A;  4IV3 C;  3ASI A;  1C5H A;  5J98 B;  2D93 A;  3RZH A; 
#chains in the Genus database with same CATH homology
 3JXS A;  1XNA A;  1NX9 A;  3J7H A;  2VO5 A;  3ACF A;  4Z2A A;  3BGA A;  4CU8 A;  3I2J A;  2W91 A;  3T09 A;  3ZM8 A;  4DXR A;  1J84 A;  1UX7 A;  2YB7 A;  3A23 A;  2BGP A;  4QPW A;  4GZ9 A;  4JHZ A;  2WAB A;  2VZU A;  1GQP A;  1UYY A;  4ARY A;  2QQN A;  3K4A A;  4JX0 A;  3UET A;  2LW8 A;  3UES A;  1GUI A;  5A1A A;  5J1X A;  2XQX A;  3U37 A;  3A21 A;  2WAA A;  5DQ0 A;  2VZ1 A;  1PMH X;  4CUA A;  4QB2 A;  4GWJ A;  3IAQ A;  5DN2 A;  1CX1 A;  1H6Y A;  2ORX A;  3FHA A;  4W50 A;  5I0D A;  4KI5 M;  3LPG A;  2V5D A;  3T2P A;  3NJV A;  2VTF A;  5LA2 A;  2KD7 A;  4CUB A;  5IFT A;  2W92 A;  2W94 A;  2VC9 A;  1JZ6 A;  4XZU G;  3D3A A;  3WEZ A;  3OGS A;  4XUQ A;  1UYZ A;  2Y6G A;  3IB3 A;  4XUR A;  3C7G A;  2E26 A;  4LPL A;  4AG4 A;  3A22 A;  4QX0 A;  5LA0 A;  1US3 A;  2RJ2 A;  4BXS V;  1ULO A;  1UWW A;  3ABZ A;  1OF4 A;  2VZT A;  1UY1 A;  1CZT A;  2E31 A;  5C7G A;  1XNT A;  2WO1 A;  2B9V A;  4BJ0 A;  3UNP A;  4JKM A;  5IFP A;  3I97 A;  3I2I A;  3HPN A;  1UXX X;  5EJ1 B;  1O59 A;  5IHR A;  1CZS A;  2VOT A;  3C7F A;  4CUC A;  4BK5 A;  5C70 A;  4ET7 A;  3VD7 A;  3WNL A;  1D7P M;  3III A;  1TG7 A;  2Y6H A;  3I2F A;  4W8J A;  2ID4 A;  3HNB M;  3WQB A;  2W1W A;  2XOM A;  4A41 A;  4QX2 A;  2VZR A;  1GOF A;  2J7M A;  3CIH A;  1DYO A;  2B4K A;  1MPX A;  4UOJ A;  4RN5 A;  4A6O A;  3LPF A;  2J1S A;  4CVU A;  3BN6 A;  2WDB A;  2C26 A;  3MO4 A;  1UMI A;  3LE0 A;  5B4X A;  2W5F A;  4RYD A;  3HJR A;  3I2G A;  3I2H A;  1L7R A;  2Y64 A;  3VDA A;  1UZ0 A;  1CIY A;  2X09 A;  4OUE A;  3LQC A;  1JZ3 A;  4KWU A;  4MO3 M;  3T0A A;  2XON A;  2VR4 A;  3NQH A;  4YPJ A;  1OH4 A;  2VZQ A;  2BER A;  2EIE A;  1DP0 A;  1PX4 A;  4UI9 L;  4QDQ A;  2VMF A;  3K77 A;  4QB6 A;  3WF4 A;  3WNO A;  2QQL A;  4P00 B;  4XUO A;  4BDV B;  2RVA A;  1KGY A;  3VD3 A;  3W5N A;  4OZO A;  1K12 A;  2VZV A;  3WNK A;  2W1Q A;  1ULP A;  1DLC A;  3MUY 1;  5DPN A;  3SKV A;  3CQO A;  2VCB A;  5EIY B;  1JU3 A;  1W9W A;  2W46 A;  1NUK A;  2VM9 A;  3AC0 A;  3THC A;  2ZEW A;  3OGV A;  2JE8 A;  1UY0 A;  3PUI A;  4PQQ A;  3SEE A;  4XVH A;  2WAO A;  4ZZ8 A;  3WF3 A;  4QX1 A;  1JYX A;  3CDZ B;  5JXI A;  3T08 A;  2WBK A;  3FL7 A;  2VCC A;  4A4A A;  3DEC A;  3VDC A;  2Y6K A;  5G04 L;  1JYV A;  4LKS A;  4A42 A;  3C7O A;  2W87 A;  3A7Q A;  1BHG A;  2WN3 A;  3I3E A;  3GXU A;  4E8D A;  5FUI A;  1W9T A;  3I2K A;  2VQT A;  2J22 A;  3P1I A;  4GWI A;  2W1U A;  1F4H A;  2V72 A;  2VZO A;  2Y6L A;  3GM8 A;  1WKY A;  1NKG A;  1JZ8 A;  2J1R A;  1J83 A;  1H6X A;  2ORZ A;  3OGR A;  4LHS A;  5JXJ A;  1GOH A;  4CU7 A;  1L7Q A;  2VZ3 A;  4DUV A;  5JUV A;  1O8P A;  2ZEY A;  2VME A;  3I3B A;  2ZEZ A;  4QX3 A;  3HN3 A;  1OD3 A;  3LEI A;  3VD5 A;  1UXZ A;  4DUW A;  2X05 A;  2WO2 A;  1EUT A;  3T2Q A;  3OEA A;  3OG2 A;  4E8C A;  2VMC A;  3K46 A;  3SEP A;  3WF0 A;  2EID A;  5JXG A;  1GU3 A;  2JD9 A;  2OKX A;  4A44 A;  2QQM A;  2WZE A;  2DDU A;  4TTG A;  3HNM A;  1UYX A;  4M4R A;  2YFU A;  3IAP A;  4JKL A;  4XUN A;  3CMG A;  2W95 A;  4D8M A;  1T2X A;  1GMM A;  2WUH A;  4ARX A;  5C71 A;  3K75 B;  1GOG A;  2QQK A;  1YQ2 A;  2W9X A;  4D0Q A;  4PF1 A;  1HN1 A;  2VZP A;  4DXS A;  1W9S A;  5HPO A;  2XHN A;  5LCW L;  4TXW A;  1JHJ A;  4CU6 A;  4OMD A;  1PMJ X;  2J1T A;  5G05 L;  3SKJ E;  4MGS A;  2V4V A;  4PT6 A;  1JU4 A;  2J1A A;  2HLE A;  1RYY A;  4OYU A;  2DCJ A;  2YG0 A;  3ETP A;  1SHW B;  3OEB A;  5LA1 A;  3T0D A;  4UAP A;  3K4Z A;  2VL4 A;  1JZ5 A;  2QBX A;  2JDA A;  4JKK A;  3T0B A;  1LNS A;  2WN2 A;  2BZD A;  4L0P A;  2BGO A;  2R7E B;  4P5Y A;  4KMQ A;  1UY3 A;  1CZV A;  5DMY A;  1EUU A;  1UY2 A;  2W47 A;  3WF2 A;  3ACG A;  2WYS A;  4CU9 A;  3C7H A;  3IDA A;  1GNY A;  1K45 A;  1JZ2 A;  3MUZ 1;  2E33 A;  2QQO A;  3NRU A;  4A3Z A;  3ECQ A;  4P02 B;  3VD4 A;  3HNY M;  1I5P A;  2C4X A;  2VMD A;  3MV0 1;  2WZ8 A;  2VZS A;  3WF1 A;  1O8S A;  3OB8 A;  3EB7 A;  3ACH A;  4FI9 A;  4QDS A;  4DUX A;  2VJX A;  2X10 A;  4W4Z A;  5CZK A;  3F2Z A;  2VQU A;  2VCA A;  3GGL A;  4XUP A;  4BK4 A;  2J1V A;  5EJZ B;  2CDP A;  5F7U A;  3PUH A;  5JMO A;  3LEK A;  4A45 A;  3VDB A;  5HXM A;  3CKH A;  2J1E A;  5IJR A;  2ZXQ A;  2PQS A;  1IQD C;  1W99 A;  3WSO A;  3I3D A;  2Z4F A;  4ZXE A;  3HEI A;  5CYY A;  2EIC A;  3CZU A;  3OBA A;  2Y8K A;  3ACI A;  3MV1 1;  3FN9 A;  1UMH A;  4QDR A;  4DEV A;  1KEX A;  2WO3 A;  3WNN A;  3CZJ A;  1K42 A;  2EIB A;  2L9L A;  3FHQ A;  3P6B A;  3WNP A;  5JXH A;  4AAX A;  5B4N A;  2JKX A;  4QB1 A;  1W0N A;  2E32 A;  4HG6 B;  3C8X A;  4MGQ A;  1PX3 A;  2ZEX A;  4ZZ5 A;  2YC4 A;  1F4A A;  1XC6 A;  2RV9 A;  3K4D A;  1JYN A;  2Y6J A;  1TVG A;  1NAE A;  3HOB A;  1XPW A;  2QQI A;  1OT5 A;  5JR2 A;  2YC2 A;  1WCQ A;  2BBA A;  2LS6 A;  1SDD B;  3T2O A;  1JYW A;  3C7E A;  2QQJ A;  4QAW A;  3EYP A;  3E1F 1;  4DXT A;  4MAD A;  1R64 A;  3DYP A;  4DEQ A;  2HYX A;  1US2 A;  1SG3 A;  3MBW A;  1JZ4 A;  1W8N A;  1OF3 A;  2J1U A;  2YFZ A;  3LEG A;  4XUT A;  4P08 A;  2CDO A;  4MOA A;  3NNG A;  4OMC A;  4ZY9 A;  4IUG A;  3DYO A;  1JI6 A;  3GDB A;  3DYM A;  4LQR A;  5IYY A;  4M4P A;  1P8J A;  2DCK A;  1K3I A;  1W8O A;  3THD A;  3WNM A;  2WQ8 A;  2W3J A;  3NJX A;  1UY4 A;  2C9K A;  3W5M A;  3VD9 A;  1JZ7 A;  2W1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...