2Y78A

Crystal structure of bpss1823, a mip-like chaperone from burkholderia pseudomallei
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
122
structure length
122
Chain Sequence
SGLVPRGSHMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
publication title The Structure of a Burkholderia Pseudomallei Immunophilin-Inhibitor Complex Reveals New Approaches to Antimicrobial Development
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 29
structure length 122
sequence length 122
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2y78A00
4ITZA 4JYSA 1PBKA 2DG3A 3NRKA 1YW5A 5I98A 3O5MA 1M5YA 4W9QA 2KE0A 2F2DA 2FAPA 3UI6A 4DIPA 4ODOA 5B8IC 3TC5A 4C02B 2KR7A 1F40A 3OOBA 2M08A 1QPFA 3O5JA 2RQSA 4DZ2A 4ODMA 1ROUA 3KCEA 1D7HA 1BKFA 1BL4A 4DRQA 1Y0OA 3JXVA 1JNTA 3CGMA 3O5GA 5HKGA 2LGOA 1W26A 2XP6A 2ZQUA 3NI6A 2ZR4A 4J4NA 3O5DA 1J4IA 1R9HA 1ROTA 2UZ5A 3MDYB 4ODQA 3TCZA 2XP9A 4LAYA 1FKSA 1TCOC 4GIVA 3UF8A 4ODLA 3O5IA 1N1AA 4U84A 4TW7A 4DROA 4DT4A 5DIVA 5BXJA 3PA7A 4R0XA 1U79A 4JFLA 2PV2A 2PV1A 3VAWA 1KT0A 2MLXA 5GPGA 3TDBA 4G2PA 4MSPA 5HWBA 2IF4A 5HUAA 5HTGA 5D75A 2DG9A 1FKHA 1NMWA 2KFWA 1KT1A 3KAIA 1HXVA 2PPNA 1FKKA 2L2SA 3UQBA 5HW6A 1J4HA 3KAHA 4FN2A 5J6EA 1EQ3A 3O5OA 3KAGA 2RUCA 3UI5A 3GPKA 1QZ2A 3O5PA 2OFNA 3CGNA 5HW8A 2ZR5A 1P5QA 2RUQA 1J6YA 3O5EA 3O5FA 4J4OA 3KADA 2M1IA 3RGCA 1PINA 3IHZA 4G50A 3JYMA 3NTPA 3KAFA 4ODNA 2F21A 4TW8A 1YATA 3IKGA 4W9PA 3WH0A 3ODKA 2XP7A 4IPXA 1C9HA 4JFJA 4DRIA 1FAPA 4O2TA 4LAXA 2RUDA 3LUOA 3PRBA 2VN1A 1NMVA 1Q1CA 4ODKA 4TX0A 4DRMA 1FKDA 3PRDA 4ODRA 1D7IA 3JYJA 4TW6A 2D9FA 1FKFA 2F4EA 2PPOA 1Q6HA 2MF9A 3UQIA 2PPPA 1FKJA 3EY6A 1NSGA 4DRKA 3FAPA 4QT2A 3UI4A 2MLYA 4JFKA 4JFIA 5HW7A 2RSEA 3I6CA 4TYOA 2XP4A 2Y78A 2KI3A 2MPHA 5DIUA 1T11A 2ZQTA 3B7XA 4NNRA 4FAPA 2VCDA 2LJ4A 2K8IA 2DG4A 2LKNA 2AWGA 1ZCNA 1EYMA 1ZK6A 2N87A 4TNSA 2PBCA 4DRHA 4U86A 1J4RA 4ODPA 4BF8A 2XP3A 4DRPA 4QT3A 3KABA 1FKIA 5HT1A 2ZQSA 1FJDA 1Q6UA 2LPVA 2KGJA 3H9RB 1FD9A 3IK8A 4IQ2A 1L1PA 2PV3A 1Q6IA 2MLZA 3O5LA 1D6OA 2XP5A 4JFMA 2KO7A 4DH0A 2ITKA 4DRJA 3O5KA 1F8AB 4LAWA 4QIBA 3KZ7A 5HWCA 4DZ3A 1FKTA 2M2AA 3IKDA 1JVWA 5DITA 1JNSA 3O5QA 1QPLA 2ZR6A 3UQAA 1FKGA 3RFWA 2Q5AA 3O5RA 4U85A 4W9OA 2ZQVA 4LAVA 1FKBA 4GGQA 2XPAA 4N19A 1FKRA 3KACA 1D7JA 2XPBA 2FKEA 1A7XA 2RURA 2XP8A 2MNTA 4IQCA 4MGVA 4DRNA 2JZVA 1B6CA 1FKLA
chains in the Genus database with same CATH superfamily
1OWQA 2OLHA 4WK9A 3ARZA 3CH9A 5B8IC 3B8SA 1QPFA 4DZ2A 5JH8A 4NSBA 5DEZA 4WKHA 3PR9A 2ZR4A 1R9HA 4P8UA 2B31A 1W1VA 4LAYA 1FKSA 1TCOC 3WQVA 3RM9A 4TW7A 1LG1A 4R0XA 2A3BA 1U79A 2PV1A 3ARRA 3EIPA 3RM8A 2IF4A 5D75A 1FKHA 1KT1A 4UDMA 2PPNA 3ALFA 5HW6A 5GPRA 4FN2A 5J6EA 1E6PA 3O5OA 2DT2A 1VF8A 2ZR5A 2RUQA 3O5EA 2O92A 3WL1A 1O6IA 1IX5A 1PINA 4MNJA 3KAFA 4W9PA 3WH0A 1FFQA 4IPXA 1HKMA 3PRBA 1E9LA 2VN1A 1OGBA 3RM4A 1NWUA 1D7IA 3JYJA 2PPOA 2EULA 1Q6HA 1FKJA 1EHNA 1GUVA 2DT1A 1LG2A 4QT2A 4JFKA 3ALGA 2XP4A 2Y78A 2KI3A 4MAVA 3B7XA 2LJ4A 2DG4A 1ZBWA 2LKNA 4MTVA 4DRHA 4DWSC 4ODPA 4BF8A 4P8XA 1H0GA 3WL0A 1FFRA 1E6NA 3O5LA 1D6OA 2KO7A 1D2KA 4WJXA 1F8AB 1LQ0A 1FKTA 1GOIA 2A3CA 2WK2A 3ARTA 2Q5AA 3O5RA 4LAVA 3WD1A 4GGQA 2XPBA 1E6ZA 2XP8A 4MGVA 2MNTA 1W1PA 1WNOA 2YBUA 4ITZA 4JYSA 2DG3A 1YW5A 5DF0A 2KE0A 3QOKA 2B5UB 4ODOA 4C02B 3O5JA 3PRAA 4ODMA 4W5UA 4ZPTR 1BL4A 1Y0OA 3OA5A 2WM0A 3CGMA 2ZQUA 1W1TA 1GPFA 3MDYB 5GQBA 4ODQA 2F23A 3O5IA 3PA7A 4S3KA 1NWSA 1KT0A 1JNDA 5HWBA 5HUAA 1CTNA 3KAIA 1HJVA 1FKKA 3CHCA 1J4HA 3KAHA 4MNMA 3KAGA 3WD0A 1J6YA 4J4OA 4MPKA 3IHZA 1E44A 4G50A 3JYMA 1SYTA 1YATA 3IKGA 4TW8A 2XP7A 1C9HA 4JFJA 4LAXA 2RUDA 4TX0A 4P8WA 3B9EA 4TW6A 2D9FA 2MF9A 3UQIA 2PPPA 1NWRA 2ETNA 3ARSA 3ARWA 3WKZA 3AROA 4P8VA 3WD4A 2RSEA 3I6CA 4TYOA 2MPHA 5DIUA 1K9TA 1WB0A 4Z2GA 2YBTA 1UR8A 2QF8A 2DSWA 4QZVB 4HBEA 4Q22A 5HBFA 3ARPA 3AS1A 1J4RA 4Z2HA 1FKIA 2DT3A 2ZQSA 1Q6UA 3IK8A 4WKFA 2MLZA 4LGXA 4DH0A 3O5KA 4URIA 1H0IA 4Z2IA 1JVWA 2ZR6A 3UQAA 3CHFA 2AOSA 3RFWA 2XPAA 1W1YA 2DT0A 3B9AA 3CHEA 3NRKA 3O5MA 4DWSD 1M5YA 1ZB5A 2F2DA 4DIPA 2PI6A 3TC5A 2KR7A 3OOBA 3GU0A 1ROUA 3KCEA 1X6LA 4DRQA 3JXVA 1JNTA 2DSVA 3O5GA 2LGOA 2XP6A 4DWSA 3NI6A 4S3JA 3O5DA 1J4IA 1ROTA 2UZ5A 3TCZA 2XP9A 3WD3A 4ODLA 1N1AA 4DROA 5DIVA 5BXJA 4JFLA 2MLXA 5GPGA 1W9VA 4XAKA 4G2PA 1KFWA 4KQZA 2IUZA 1JNEA 3G6MA 3FXYA 1NMWA 1HXVA 1EQ3A 2ESCA 2RUCA 4Z2JA 3UI5A 3O5PA 3CGNA 5HW8A 1P5QA 3KADA 3RGCA 3NTPA 2F21A 3CHDA 3ODKA 4Q7NA 1JCHB 4O2TA 3LUOA 1W9UA 1NMVA 4ODKA 3ARVA 4DRMA 2A3EA 1FKDA 4Z2KA 4NZCA 2F4EA 2WLYA 1HJXA 3EY6A 4AY1A 4DRKA 3FAPA 4KR0B 1TFVA 1XRVA 2MLYA 3UI4A 4JFIA 4NNRA 3BXWA 1NWTA 2K8IA 4ZPWR 2O9OA 1ZBVA 2AWGA 1ZCNA 2N87A 4MNKA 3FY1A 4TNSA 4U86A 4DRPA 3KABA 1GRJA 1LL7A 2LPVA 4ML4A 4IQ2A 1L1PA 3G6LA 2XP5A 2ITKA 4DRJA 2A3AA 4QIBA 3KZ7A 5HWCA 3IKDA 1RD6A 5DITA 1ZL1A 3O5QA 1JNSA 1QPLA 2ZQVA 4MNLA 4N19A 3KACA 2RURA 4DRNA 3RMEA 2JZVA 1B6CA 1HKKA 3AQUA 4L3NA 1PBKA 5I98A 4W9QA 1ITXA 4Z2LA 2FAPA 3UI6A 4ZS6A 1F40A 4HBOA 3CZ8A 2M08A 2RQSA 1ZBKA 2DSZA 1D7HA 2FDMA 1BKFA 1NH6A 5DO2A 5HKGA 2PN0A 1W26A 1HJWA 4J4NA 2P4VA 3B9DA 4L72B 4GIVA 3UF8A 4U84A 4DT4A 3AS2A 3GTYX 2G41A 1W9PA 2PV2A 3VAWA 3TDBA 3ARXA 4MSPA 5HTGA 2DG9A 2KFWA 3AS3A 2L2SA 3UQBA 1HKJA 1ZU8A 3GPKA 1QZ2A 2OFNA 4PTMA 3O5FA 3W4RA 2M1IA 4DWSB 1EIBA 4ODNA 2DPEA 4IT6A 4WIWA 4DRIA 1FAPA 1WAWA 1LJYA 1Q1CA 3WD2A 4HARA 3PRDA 4ODRA 4IT4A 1FKFA 3ARYA 1UR9A 1NSGA 2DSUA 1ZBCA 4WKAA 1X6NA 4R5EA 3WQWA 5HW7A 1SR0A 3ARQA 3WIJA 1T11A 2ZQTA 4FAPA 1LL4A 2VCDA 2G8ZA 4ZPVR 1EYMA 1ZK6A 1EDQA 2PBCA 2WLZA 2XP3A 4QT3A 5HT1A 3BMBA 1HKIA 1FJDA 2KGJA 3H9RB 3AS0A 1FD9A 2PV3A 1Q6IA 4JFMA 1E6RA 4LAWA 1LL6A 4DZ3A 2M2AA 1E15A 1OGGA 1FKGA 4U85A 4W9OA 3ARUA 1FKBA 1XHGA 1FKRA 1D7JA 2FKEA 1A7XA 4IQCA 1FKLA
chains in the Genus database with same CATH topology
1OWQA 2OLHA 4WK9A 3ARZA 3CH9A 5B8IC 3B8SA 1QPFA 4DZ2A 5JH8A 4NSBA 5DEZA 4WKHA 3PR9A 2ZR4A 1R9HA 4P8UA 2B31A 1W1VA 4LAYA 1FKSA 1TCOC 3WQVA 3RM9A 4TW7A 1LG1A 4R0XA 2A3BA 1U79A 2PV1A 3ARRA 3RM8A 2IF4A 5D75A 1FKHA 1KT1A 2PPNA 3ALFA 5HW6A 5GPRA 4FN2A 5J6EA 1E6PA 3O5OA 2DT2A 1VF8A 2ZR5A 2RUQA 3O5EA 2O92A 3WL1A 1O6IA 1IX5A 1PINA 4MNJA 3KAFA 4W9PA 3WH0A 1FFQA 4IPXA 1HKMA 3PRBA 1E9LA 2VN1A 1OGBA 3RM4A 1NWUA 1D7IA 3JYJA 2PPOA 1Q6HA 1FKJA 1EHNA 1GUVA 2DT1A 1LG2A 4QT2A 4JFKA 3ALGA 2XP4A 2Y78A 2KI3A 4MAVA 3B7XA 2LJ4A 2DG4A 1ZBWA 2LKNA 4MTVA 4DRHA 4DWSC 4ODPA 4BF8A 4P8XA 1H0GA 3WL0A 1FFRA 1E6NA 3O5LA 1D6OA 2KO7A 1D2KA 4WJXA 1F8AB 1LQ0A 1FKTA 1GOIA 2A3CA 2WK2A 3ARTA 2Q5AA 3O5RA 4LAVA 3WD1A 4GGQA 2XPBA 1E6ZA 2XP8A 4MGVA 2MNTA 1W1PA 1WNOA 2YBUA 4ITZA 4JYSA 2DG3A 1YW5A 5DF0A 2KE0A 3QOKA 4ODOA 4C02B 3O5JA 3PRAA 4ODMA 4W5UA 4ZPTR 1BL4A 1Y0OA 3OA5A 2WM0A 3CGMA 2ZQUA 1W1TA 1GPFA 3MDYB 5GQBA 4ODQA 3O5IA 3PA7A 4S3KA 1NWSA 1KT0A 1JNDA 5HWBA 5HUAA 1CTNA 3KAIA 1HJVA 1FKKA 3CHCA 1J4HA 3KAHA 4MNMA 3KAGA 3WD0A 1J6YA 4J4OA 4MPKA 3IHZA 4G50A 3JYMA 1SYTA 1YATA 3IKGA 4TW8A 2XP7A 1C9HA 4JFJA 4LAXA 2RUDA 4TX0A 4P8WA 3B9EA 4TW6A 2D9FA 2MF9A 3UQIA 2PPPA 1NWRA 3ARSA 3ARWA 3WKZA 3AROA 4P8VA 3WD4A 2RSEA 3I6CA 4TYOA 2MPHA 5DIUA 1K9TA 1WB0A 4Z2GA 2YBTA 1UR8A 2QF8A 2DSWA 4QZVB 4HBEA 4Q22A 5HBFA 3ARPA 3AS1A 1J4RA 4Z2HA 1FKIA 2DT3A 2ZQSA 1Q6UA 3IK8A 4WKFA 2MLZA 4LGXA 4DH0A 3O5KA 4URIA 1H0IA 4Z2IA 1JVWA 2ZR6A 3UQAA 3CHFA 2AOSA 3RFWA 2XPAA 1W1YA 2DT0A 3B9AA 3CHEA 3NRKA 3O5MA 4DWSD 1M5YA 1ZB5A 2F2DA 4DIPA 2PI6A 3TC5A 2KR7A 3OOBA 1ROUA 3KCEA 1X6LA 4DRQA 3JXVA 1JNTA 2DSVA 3O5GA 2LGOA 2XP6A 4DWSA 3NI6A 4S3JA 3O5DA 1J4IA 1ROTA 2UZ5A 3TCZA 2XP9A 3WD3A 4ODLA 1N1AA 4DROA 5DIVA 5BXJA 4JFLA 2MLXA 5GPGA 1W9VA 4XAKA 4G2PA 1KFWA 4KQZA 2IUZA 1JNEA 3G6MA 3FXYA 1NMWA 1HXVA 1EQ3A 2ESCA 2RUCA 4Z2JA 3UI5A 3O5PA 3CGNA 5HW8A 1P5QA 3KADA 3RGCA 3NTPA 2F21A 3CHDA 3ODKA 4Q7NA 4O2TA 3LUOA 1W9UA 1NMVA 4ODKA 3ARVA 4DRMA 2A3EA 1FKDA 4Z2KA 4NZCA 2F4EA 2WLYA 1HJXA 3EY6A 4AY1A 4DRKA 3FAPA 4KR0B 1TFVA 1XRVA 2MLYA 3UI4A 4JFIA 4NNRA 3BXWA 1NWTA 2K8IA 4ZPWR 2O9OA 1ZBVA 2AWGA 1ZCNA 2N87A 4MNKA 3FY1A 4TNSA 4U86A 4DRPA 3KABA 1LL7A 2LPVA 4ML4A 4IQ2A 1L1PA 3G6LA 2XP5A 2ITKA 4DRJA 2A3AA 4QIBA 3KZ7A 5HWCA 3IKDA 1RD6A 5DITA 1ZL1A 3O5QA 1JNSA 1QPLA 2ZQVA 4MNLA 4N19A 3KACA 2RURA 4DRNA 3RMEA 2JZVA 1B6CA 1HKKA 3AQUA 4L3NA 1PBKA 5I98A 4W9QA 1ITXA 4Z2LA 2FAPA 3UI6A 4ZS6A 1F40A 4HBOA 3CZ8A 2M08A 2RQSA 1ZBKA 2DSZA 1D7HA 2FDMA 1BKFA 1NH6A 5DO2A 5HKGA 1W26A 1HJWA 4J4NA 3B9DA 4L72B 4GIVA 3UF8A 4U84A 4DT4A 3AS2A 2G41A 1W9PA 2PV2A 3VAWA 3TDBA 3ARXA 4MSPA 5HTGA 2DG9A 2KFWA 3AS3A 2L2SA 3UQBA 1HKJA 1ZU8A 3GPKA 1QZ2A 2OFNA 4PTMA 3O5FA 3W4RA 2M1IA 4DWSB 1EIBA 4ODNA 2DPEA 4IT6A 4WIWA 4DRIA 1FAPA 1WAWA 1LJYA 1Q1CA 3WD2A 4HARA 3PRDA 4ODRA 4IT4A 1FKFA 3ARYA 1UR9A 1NSGA 2DSUA 1ZBCA 4WKAA 1X6NA 4R5EA 3WQWA 5HW7A 1SR0A 3ARQA 3WIJA 1T11A 2ZQTA 4FAPA 1LL4A 2VCDA 2G8ZA 4ZPVR 1EYMA 1ZK6A 1EDQA 2PBCA 2WLZA 2XP3A 4QT3A 5HT1A 1HKIA 1FJDA 2KGJA 3H9RB 3AS0A 1FD9A 2PV3A 1Q6IA 4JFMA 1E6RA 4LAWA 1LL6A 4DZ3A 2M2AA 1E15A 1OGGA 1FKGA 4U85A 4W9OA 3ARUA 1FKBA 1XHGA 1FKRA 1D7JA 2FKEA 1A7XA 4IQCA 1FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITZ A;  4JYS A;  1PBK A;  2DG3 A;  3NRK A;  1YW5 A;  5I98 A;  3O5M A;  1M5Y A;  4W9Q A;  2KE0 A;  2F2D A;  2FAP A;  3UI6 A;  4DIP A;  4ODO A;  5B8I C;  3TC5 A;  4C02 B;  2KR7 A;  1F40 A;  3OOB A;  2M08 A;  1QPF A;  3O5J A;  2RQS A;  4DZ2 A;  4ODM A;  1ROU A;  3KCE A;  1D7H A;  1BKF A;  1BL4 A;  4DRQ A;  1Y0O A;  3JXV A;  1JNT A;  3CGM A;  3O5G A;  5HKG A;  2LGO A;  1W26 A;  2XP6 A;  2ZQU A;  3NI6 A;  2ZR4 A;  4J4N A;  3O5D A;  1J4I A;  1R9H A;  1ROT A;  2UZ5 A;  3MDY B;  4ODQ A;  3TCZ A;  2XP9 A;  4LAY A;  1FKS A;  1TCO C;  4GIV A;  3UF8 A;  4ODL A;  3O5I A;  1N1A A;  4U84 A;  4TW7 A;  4DRO A;  4DT4 A;  5DIV A;  5BXJ A;  3PA7 A;  4R0X A;  1U79 A;  4JFL A;  2PV2 A;  2PV1 A;  3VAW A;  1KT0 A;  2MLX A;  5GPG A;  3TDB A;  4G2P A;  4MSP A;  5HWB A;  2IF4 A;  5HUA A;  5HTG A;  5D75 A;  2DG9 A;  1FKH A;  1NMW A;  2KFW A;  1KT1 A;  3KAI A;  1HXV A;  2PPN A;  1FKK A;  2L2S A;  3UQB A;  5HW6 A;  1J4H A;  3KAH A;  4FN2 A;  5J6E A;  1EQ3 A;  3O5O A;  3KAG A;  2RUC A;  3UI5 A;  3GPK A;  1QZ2 A;  3O5P A;  2OFN A;  3CGN A;  5HW8 A;  2ZR5 A;  1P5Q A;  2RUQ A;  1J6Y A;  3O5E A;  3O5F A;  4J4O A;  3KAD A;  2M1I A;  3RGC A;  1PIN A;  3IHZ A;  4G50 A;  3JYM A;  3NTP A;  3KAF A;  4ODN A;  2F21 A;  4TW8 A;  1YAT A;  3IKG A;  4W9P A;  3WH0 A;  3ODK A;  2XP7 A;  4IPX A;  1C9H A;  4JFJ A;  4DRI A;  1FAP A;  4O2T A;  4LAX A;  2RUD A;  3LUO A;  3PRB A;  2VN1 A;  1NMV A;  1Q1C A;  4ODK A;  4TX0 A;  4DRM A;  1FKD A;  3PRD A;  4ODR A;  1D7I A;  3JYJ A;  4TW6 A;  2D9F A;  1FKF A;  2F4E A;  2PPO A;  1Q6H A;  2MF9 A;  3UQI A;  2PPP A;  1FKJ A;  3EY6 A;  1NSG A;  4DRK A;  3FAP A;  4QT2 A;  3UI4 A;  2MLY A;  4JFK A;  4JFI A;  5HW7 A;  2RSE A;  3I6C A;  4TYO A;  2XP4 A;  2Y78 A;  2KI3 A;  2MPH A;  5DIU A;  1T11 A;  2ZQT A;  3B7X A;  4NNR A;  4FAP A;  2VCD A;  2LJ4 A;  2K8I A;  2DG4 A;  2LKN A;  2AWG A;  1ZCN A;  1EYM A;  1ZK6 A;  2N87 A;  4TNS A;  2PBC A;  4DRH A;  4U86 A;  1J4R A;  4ODP A;  4BF8 A;  2XP3 A;  4DRP A;  4QT3 A;  3KAB A;  1FKI A;  5HT1 A;  2ZQS A;  1FJD A;  1Q6U A;  2LPV A;  2KGJ A;  3H9R B;  1FD9 A;  3IK8 A;  4IQ2 A;  1L1P A;  2PV3 A;  1Q6I A;  2MLZ A;  3O5L A;  1D6O A;  2XP5 A;  4JFM A;  2KO7 A;  4DH0 A;  2ITK A;  4DRJ A;  3O5K A;  1F8A B;  4LAW A;  4QIB A;  3KZ7 A;  5HWC A;  4DZ3 A;  1FKT A;  2M2A A;  3IKD A;  1JVW A;  5DIT A;  1JNS A;  3O5Q A;  1QPL A;  2ZR6 A;  3UQA A;  1FKG A;  3RFW A;  2Q5A A;  3O5R A;  4U85 A;  4W9O A;  2ZQV A;  4LAV A;  1FKB A;  4GGQ A;  2XPA A;  4N19 A;  1FKR A;  3KAC A;  1D7J A;  2XPB A;  2FKE A;  1A7X A;  2RUR A;  2XP8 A;  2MNT A;  4IQC A;  4MGV A;  4DRN A;  2JZV A;  1B6C A;  1FKL A; 
#chains in the Genus database with same CATH topology
 1OWQ A;  2OLH A;  4WK9 A;  3ARZ A;  3CH9 A;  5B8I C;  3B8S A;  1QPF A;  4DZ2 A;  5JH8 A;  4NSB A;  5DEZ A;  4WKH A;  3PR9 A;  2ZR4 A;  1R9H A;  4P8U A;  2B31 A;  1W1V A;  4LAY A;  1FKS A;  1TCO C;  3WQV A;  3RM9 A;  4TW7 A;  1LG1 A;  4R0X A;  2A3B A;  1U79 A;  2PV1 A;  3ARR A;  3EIP A;  3RM8 A;  2IF4 A;  5D75 A;  1FKH A;  1KT1 A;  4UDM A;  2PPN A;  3ALF A;  5HW6 A;  5GPR A;  4FN2 A;  5J6E A;  1E6P A;  3O5O A;  2DT2 A;  1VF8 A;  2ZR5 A;  2RUQ A;  3O5E A;  2O92 A;  3WL1 A;  1O6I A;  1IX5 A;  1PIN A;  4MNJ A;  3KAF A;  4W9P A;  3WH0 A;  1FFQ A;  4IPX A;  1HKM A;  3PRB A;  1E9L A;  2VN1 A;  1OGB A;  3RM4 A;  1NWU A;  1D7I A;  3JYJ A;  2PPO A;  2EUL A;  1Q6H A;  1FKJ A;  1EHN A;  1GUV A;  2DT1 A;  1LG2 A;  4QT2 A;  4JFK A;  3ALG A;  2XP4 A;  2Y78 A;  2KI3 A;  4MAV A;  3B7X A;  2LJ4 A;  2DG4 A;  1ZBW A;  2LKN A;  4MTV A;  4DRH A;  4DWS C;  4ODP A;  4BF8 A;  4P8X A;  1H0G A;  3WL0 A;  1FFR A;  1E6N A;  3O5L A;  1D6O A;  2KO7 A;  1D2K A;  4WJX A;  1F8A B;  1LQ0 A;  1FKT A;  1GOI A;  2A3C A;  2WK2 A;  3ART A;  2Q5A A;  3O5R A;  4LAV A;  3WD1 A;  4GGQ A;  2XPB A;  1E6Z A;  2XP8 A;  4MGV A;  2MNT A;  1W1P A;  1WNO A;  2YBU A;  4ITZ A;  4JYS A;  2DG3 A;  1YW5 A;  5DF0 A;  2KE0 A;  3QOK A;  2B5U B;  4ODO A;  4C02 B;  3O5J A;  3PRA A;  4ODM A;  4W5U A;  4ZPT R;  1BL4 A;  1Y0O A;  3OA5 A;  2WM0 A;  3CGM A;  2ZQU A;  1W1T A;  1GPF A;  3MDY B;  5GQB A;  4ODQ A;  2F23 A;  3O5I A;  3PA7 A;  4S3K A;  1NWS A;  1KT0 A;  1JND A;  5HWB A;  5HUA A;  1CTN A;  3KAI A;  1HJV A;  1FKK A;  3CHC A;  1J4H A;  3KAH A;  4MNM A;  3KAG A;  3WD0 A;  1J6Y A;  4J4O A;  4MPK A;  3IHZ A;  1E44 A;  4G50 A;  3JYM A;  1SYT A;  1YAT A;  3IKG A;  4TW8 A;  2XP7 A;  1C9H A;  4JFJ A;  4LAX A;  2RUD A;  4TX0 A;  4P8W A;  3B9E A;  4TW6 A;  2D9F A;  2MF9 A;  3UQI A;  2PPP A;  1NWR A;  2ETN A;  3ARS A;  3ARW A;  3WKZ A;  3ARO A;  4P8V A;  3WD4 A;  2RSE A;  3I6C A;  4TYO A;  2MPH A;  5DIU A;  1K9T A;  1WB0 A;  4Z2G A;  2YBT A;  1UR8 A;  2QF8 A;  2DSW A;  4QZV B;  4HBE A;  4Q22 A;  5HBF A;  3ARP A;  3AS1 A;  1J4R A;  4Z2H A;  1FKI A;  2DT3 A;  2ZQS A;  1Q6U A;  3IK8 A;  4WKF A;  2MLZ A;  4LGX A;  4DH0 A;  3O5K A;  4URI A;  1H0I A;  4Z2I A;  1JVW A;  2ZR6 A;  3UQA A;  3CHF A;  2AOS A;  3RFW A;  2XPA A;  1W1Y A;  2DT0 A;  3B9A A;  3CHE A;  3NRK A;  3O5M A;  4DWS D;  1M5Y A;  1ZB5 A;  2F2D A;  4DIP A;  2PI6 A;  3TC5 A;  2KR7 A;  3OOB A;  3GU0 A;  1ROU A;  3KCE A;  1X6L A;  4DRQ A;  3JXV A;  1JNT A;  2DSV A;  3O5G A;  2LGO A;  2XP6 A;  4DWS A;  3NI6 A;  4S3J A;  3O5D A;  1J4I A;  1ROT A;  2UZ5 A;  3TCZ A;  2XP9 A;  3WD3 A;  4ODL A;  1N1A A;  4DRO A;  5DIV A;  5BXJ A;  4JFL A;  2MLX A;  5GPG A;  1W9V A;  4XAK A;  4G2P A;  1KFW A;  4KQZ A;  2IUZ A;  1JNE A;  3G6M A;  3FXY A;  1NMW A;  1HXV A;  1EQ3 A;  2ESC A;  2RUC A;  4Z2J A;  3UI5 A;  3O5P A;  3CGN A;  5HW8 A;  1P5Q A;  3KAD A;  3RGC A;  3NTP A;  2F21 A;  3CHD A;  3ODK A;  4Q7N A;  1JCH B;  4O2T A;  3LUO A;  1W9U A;  1NMV A;  4ODK A;  3ARV A;  4DRM A;  2A3E A;  1FKD A;  4Z2K A;  4NZC A;  2F4E A;  2WLY A;  1HJX A;  3EY6 A;  4AY1 A;  4DRK A;  3FAP A;  4KR0 B;  1TFV A;  1XRV A;  2MLY A;  3UI4 A;  4JFI A;  4NNR A;  3BXW A;  1NWT A;  2K8I A;  4ZPW R;  2O9O A;  1ZBV A;  2AWG A;  1ZCN A;  2N87 A;  4MNK A;  3FY1 A;  4TNS A;  4U86 A;  4DRP A;  3KAB A;  1GRJ A;  1LL7 A;  2LPV A;  4ML4 A;  4IQ2 A;  1L1P A;  3G6L A;  2XP5 A;  2ITK A;  4DRJ A;  2A3A A;  4QIB A;  3KZ7 A;  5HWC A;  3IKD A;  1RD6 A;  5DIT A;  1ZL1 A;  3O5Q A;  1JNS A;  1QPL A;  2ZQV A;  4MNL A;  4N19 A;  3KAC A;  2RUR A;  4DRN A;  3RME A;  2JZV A;  1B6C A;  1HKK A;  3AQU A;  4L3N A;  1PBK A;  5I98 A;  4W9Q A;  1ITX A;  4Z2L A;  2FAP A;  3UI6 A;  4ZS6 A;  1F40 A;  4HBO A;  3CZ8 A;  2M08 A;  2RQS A;  1ZBK A;  2DSZ A;  1D7H A;  2FDM A;  1BKF A;  1NH6 A;  5DO2 A;  5HKG A;  2PN0 A;  1W26 A;  1HJW A;  4J4N A;  2P4V A;  3B9D A;  4L72 B;  4GIV A;  3UF8 A;  4U84 A;  4DT4 A;  3AS2 A;  3GTY X;  2G41 A;  1W9P A;  2PV2 A;  3VAW A;  3TDB A;  3ARX A;  4MSP A;  5HTG A;  2DG9 A;  2KFW A;  3AS3 A;  2L2S A;  3UQB A;  1HKJ A;  1ZU8 A;  3GPK A;  1QZ2 A;  2OFN A;  4PTM A;  3O5F A;  3W4R A;  2M1I A;  4DWS B;  1EIB A;  4ODN A;  2DPE A;  4IT6 A;  4WIW A;  4DRI A;  1FAP A;  1WAW A;  1LJY A;  1Q1C A;  3WD2 A;  4HAR A;  3PRD A;  4ODR A;  4IT4 A;  1FKF A;  3ARY A;  1UR9 A;  1NSG A;  2DSU A;  1ZBC A;  4WKA A;  1X6N A;  4R5E A;  3WQW A;  5HW7 A;  1SR0 A;  3ARQ A;  3WIJ A;  1T11 A;  2ZQT A;  4FAP A;  1LL4 A;  2VCD A;  2G8Z A;  4ZPV R;  1EYM A;  1ZK6 A;  1EDQ A;  2PBC A;  2WLZ A;  2XP3 A;  4QT3 A;  5HT1 A;  3BMB A;  1HKI A;  1FJD A;  2KGJ A;  3H9R B;  3AS0 A;  1FD9 A;  2PV3 A;  1Q6I A;  4JFM A;  1E6R A;  4LAW A;  1LL6 A;  4DZ3 A;  2M2A A;  1E15 A;  1OGG A;  1FKG A;  4U85 A;  4W9O A;  3ARU A;  1FKB A;  1XHG A;  1FKR A;  1D7J A;  2FKE A;  1A7X A;  4IQC A;  1FKL A; 
#chains in the Genus database with same CATH homology
 1OWQ A;  2OLH A;  4WK9 A;  3ARZ A;  3CH9 A;  5B8I C;  3B8S A;  1QPF A;  4DZ2 A;  5JH8 A;  4NSB A;  5DEZ A;  4WKH A;  3PR9 A;  2ZR4 A;  1R9H A;  4P8U A;  2B31 A;  1W1V A;  4LAY A;  1FKS A;  1TCO C;  3WQV A;  3RM9 A;  4TW7 A;  1LG1 A;  4R0X A;  2A3B A;  1U79 A;  2PV1 A;  3ARR A;  3RM8 A;  2IF4 A;  5D75 A;  1FKH A;  1KT1 A;  2PPN A;  3ALF A;  5HW6 A;  5GPR A;  4FN2 A;  5J6E A;  1E6P A;  3O5O A;  2DT2 A;  1VF8 A;  2ZR5 A;  2RUQ A;  3O5E A;  2O92 A;  3WL1 A;  1O6I A;  1IX5 A;  1PIN A;  4MNJ A;  3KAF A;  4W9P A;  3WH0 A;  1FFQ A;  4IPX A;  1HKM A;  3PRB A;  1E9L A;  2VN1 A;  1OGB A;  3RM4 A;  1NWU A;  1D7I A;  3JYJ A;  2PPO A;  1Q6H A;  1FKJ A;  1EHN A;  1GUV A;  2DT1 A;  1LG2 A;  4QT2 A;  4JFK A;  3ALG A;  2XP4 A;  2Y78 A;  2KI3 A;  4MAV A;  3B7X A;  2LJ4 A;  2DG4 A;  1ZBW A;  2LKN A;  4MTV A;  4DRH A;  4DWS C;  4ODP A;  4BF8 A;  4P8X A;  1H0G A;  3WL0 A;  1FFR A;  1E6N A;  3O5L A;  1D6O A;  2KO7 A;  1D2K A;  4WJX A;  1F8A B;  1LQ0 A;  1FKT A;  1GOI A;  2A3C A;  2WK2 A;  3ART A;  2Q5A A;  3O5R A;  4LAV A;  3WD1 A;  4GGQ A;  2XPB A;  1E6Z A;  2XP8 A;  4MGV A;  2MNT A;  1W1P A;  1WNO A;  2YBU A;  4ITZ A;  4JYS A;  2DG3 A;  1YW5 A;  5DF0 A;  2KE0 A;  3QOK A;  4ODO A;  4C02 B;  3O5J A;  3PRA A;  4ODM A;  4W5U A;  4ZPT R;  1BL4 A;  1Y0O A;  3OA5 A;  2WM0 A;  3CGM A;  2ZQU A;  1W1T A;  1GPF A;  3MDY B;  5GQB A;  4ODQ A;  3O5I A;  3PA7 A;  4S3K A;  1NWS A;  1KT0 A;  1JND A;  5HWB A;  5HUA A;  1CTN A;  3KAI A;  1HJV A;  1FKK A;  3CHC A;  1J4H A;  3KAH A;  4MNM A;  3KAG A;  3WD0 A;  1J6Y A;  4J4O A;  4MPK A;  3IHZ A;  4G50 A;  3JYM A;  1SYT A;  1YAT A;  3IKG A;  4TW8 A;  2XP7 A;  1C9H A;  4JFJ A;  4LAX A;  2RUD A;  4TX0 A;  4P8W A;  3B9E A;  4TW6 A;  2D9F A;  2MF9 A;  3UQI A;  2PPP A;  1NWR A;  3ARS A;  3ARW A;  3WKZ A;  3ARO A;  4P8V A;  3WD4 A;  2RSE A;  3I6C A;  4TYO A;  2MPH A;  5DIU A;  1K9T A;  1WB0 A;  4Z2G A;  2YBT A;  1UR8 A;  2QF8 A;  2DSW A;  4QZV B;  4HBE A;  4Q22 A;  5HBF A;  3ARP A;  3AS1 A;  1J4R A;  4Z2H A;  1FKI A;  2DT3 A;  2ZQS A;  1Q6U A;  3IK8 A;  4WKF A;  2MLZ A;  4LGX A;  4DH0 A;  3O5K A;  4URI A;  1H0I A;  4Z2I A;  1JVW A;  2ZR6 A;  3UQA A;  3CHF A;  2AOS A;  3RFW A;  2XPA A;  1W1Y A;  2DT0 A;  3B9A A;  3CHE A;  3NRK A;  3O5M A;  4DWS D;  1M5Y A;  1ZB5 A;  2F2D A;  4DIP A;  2PI6 A;  3TC5 A;  2KR7 A;  3OOB A;  1ROU A;  3KCE A;  1X6L A;  4DRQ A;  3JXV A;  1JNT A;  2DSV A;  3O5G A;  2LGO A;  2XP6 A;  4DWS A;  3NI6 A;  4S3J A;  3O5D A;  1J4I A;  1ROT A;  2UZ5 A;  3TCZ A;  2XP9 A;  3WD3 A;  4ODL A;  1N1A A;  4DRO A;  5DIV A;  5BXJ A;  4JFL A;  2MLX A;  5GPG A;  1W9V A;  4XAK A;  4G2P A;  1KFW A;  4KQZ A;  2IUZ A;  1JNE A;  3G6M A;  3FXY A;  1NMW A;  1HXV A;  1EQ3 A;  2ESC A;  2RUC A;  4Z2J A;  3UI5 A;  3O5P A;  3CGN A;  5HW8 A;  1P5Q A;  3KAD A;  3RGC A;  3NTP A;  2F21 A;  3CHD A;  3ODK A;  4Q7N A;  4O2T A;  3LUO A;  1W9U A;  1NMV A;  4ODK A;  3ARV A;  4DRM A;  2A3E A;  1FKD A;  4Z2K A;  4NZC A;  2F4E A;  2WLY A;  1HJX A;  3EY6 A;  4AY1 A;  4DRK A;  3FAP A;  4KR0 B;  1TFV A;  1XRV A;  2MLY A;  3UI4 A;  4JFI A;  4NNR A;  3BXW A;  1NWT A;  2K8I A;  4ZPW R;  2O9O A;  1ZBV A;  2AWG A;  1ZCN A;  2N87 A;  4MNK A;  3FY1 A;  4TNS A;  4U86 A;  4DRP A;  3KAB A;  1LL7 A;  2LPV A;  4ML4 A;  4IQ2 A;  1L1P A;  3G6L A;  2XP5 A;  2ITK A;  4DRJ A;  2A3A A;  4QIB A;  3KZ7 A;  5HWC A;  3IKD A;  1RD6 A;  5DIT A;  1ZL1 A;  3O5Q A;  1JNS A;  1QPL A;  2ZQV A;  4MNL A;  4N19 A;  3KAC A;  2RUR A;  4DRN A;  3RME A;  2JZV A;  1B6C A;  1HKK A;  3AQU A;  4L3N A;  1PBK A;  5I98 A;  4W9Q A;  1ITX A;  4Z2L A;  2FAP A;  3UI6 A;  4ZS6 A;  1F40 A;  4HBO A;  3CZ8 A;  2M08 A;  2RQS A;  1ZBK A;  2DSZ A;  1D7H A;  2FDM A;  1BKF A;  1NH6 A;  5DO2 A;  5HKG A;  1W26 A;  1HJW A;  4J4N A;  3B9D A;  4L72 B;  4GIV A;  3UF8 A;  4U84 A;  4DT4 A;  3AS2 A;  2G41 A;  1W9P A;  2PV2 A;  3VAW A;  3TDB A;  3ARX A;  4MSP A;  5HTG A;  2DG9 A;  2KFW A;  3AS3 A;  2L2S A;  3UQB A;  1HKJ A;  1ZU8 A;  3GPK A;  1QZ2 A;  2OFN A;  4PTM A;  3O5F A;  3W4R A;  2M1I A;  4DWS B;  1EIB A;  4ODN A;  2DPE A;  4IT6 A;  4WIW A;  4DRI A;  1FAP A;  1WAW A;  1LJY A;  1Q1C A;  3WD2 A;  4HAR A;  3PRD A;  4ODR A;  4IT4 A;  1FKF A;  3ARY A;  1UR9 A;  1NSG A;  2DSU A;  1ZBC A;  4WKA A;  1X6N A;  4R5E A;  3WQW A;  5HW7 A;  1SR0 A;  3ARQ A;  3WIJ A;  1T11 A;  2ZQT A;  4FAP A;  1LL4 A;  2VCD A;  2G8Z A;  4ZPV R;  1EYM A;  1ZK6 A;  1EDQ A;  2PBC A;  2WLZ A;  2XP3 A;  4QT3 A;  5HT1 A;  1HKI A;  1FJD A;  2KGJ A;  3H9R B;  3AS0 A;  1FD9 A;  2PV3 A;  1Q6I A;  4JFM A;  1E6R A;  4LAW A;  1LL6 A;  4DZ3 A;  2M2A A;  1E15 A;  1OGG A;  1FKG A;  4U85 A;  4W9O A;  3ARU A;  1FKB A;  1XHG A;  1FKR A;  1D7J A;  2FKE A;  1A7X A;  4IQC A;  1FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...