2Y7IA

Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
228
structure length
228
Chain Sequence
ASVSARTLHFGTSATYAPYEFVDADNKIVGFDIDVANAVCKEMQAECSFTNQSFDSLIPSLRFKKFDAVIAGMDMTPKREQQVSFSQPYYEGLSAVVVTRKGAYHTFADLKGKKVGLENGTTHQRYLQDKQQAITPVAYDSYLNAFTDLKNNRLEGVFGDVAAIGKWLKNNPDYAIMDERASDPDYYGKGLGIAVRKDNDALLQEINAALDKVKASPEYAQMQEKWFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STM4351
publication title Crystallographic and Microcalorimetric Analyses Reveal the Structural Basis for High Arginine Specificity in the Salmonella Enterica Serovar Typhimurium Periplasmic Binding Protein Stm4351.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica
molecule tags Arginine-binding protein
total genus 83
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2y7iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2y7iA02
3DELB 3K6UA 1CB6A 2BJJX 1UTHA 4F1VA 2DOJA 4YU0A 1B6HA 4U4XA 2DS9A 5K2YA 1PDAA 4NF8A 3TEPA 2F6GA 4QF9A 1NFTA 1QUJA 4KYDA 3G3JA 1KWHA 4QHQA 1OLCA 2O7IA 3IB0A 1A55A 1DPEA 1Y1ZA 1LGBC 2F5XA 1BIYA 1NNFA 2UVHA 4LVQA 2UYFA 3QXMA 1SW2A 4TOZA 4N6PA 1B7UA 3VVEA 2ZMBA 2H4IA 3VLVA 3KBRA 1DMBA 4U22A 3ZKKA 4GFRA 1LLSA 1PB8A 1EU8A 4PFYA 3DLNA 2ZXTA 4QFOA 3G3HA 4PP0A 5CMMA 1N76A 4GWOA 5CMCA 5EYFA 3C32A 3FASA 3S9EA 2GRVA 3PUVE 5I59A 3C36A 5EHMA 4H8JA 3PUYE 4PFTA 3TTRA 4K3FA 1FTJA 2WKYA 4YMBA 5ICTA 2Q89A 2NOOA 3MPKA 1ANFA 3OO6A 2GH9A 4U1OA 3KGCA 4F2QA 2I48A 4QFLA 1VSOA 3ZSFA 4EUOA 4Q30B 1FQCA 2I3VA 1GGGA 1EZOA 4BLAA 2G93A 5FHNA 5I84A 3KSJA 4IY6A 2F7AA 2D3IA 2VOZA 5H8HB 3SDFA 2ZNTA 2G29A 4H5FA 4BDRA 4ONYA 4F31B 1B3HA 1WVJA 1USYE 4I9DA 4X9TA 4YKKA 1B32A 3CIJA 2VD2A 2REGA 3N6UA 4ESXA 1RYXA 3ILTB 5CBSA 2Y7RA 1N7XA 5CI5A 2I49A 4DLDA 2P0SA 1FCKA 2F8DA 1NH7A 1BP5A 1MXZA 5BUUA 3EHSA 1GTKA 1N3XA 4NF5B 1P1NA 3CSGA 2OBGA 3FATA 3M8UA 1GR2A 4OFOA 2ZYNA 1SW5A 1PBQA 3IAZA 2RF1A 5J1DA 4GF8A 1ATGA 1M5CA 4X1DA 3THIA 3TTKA 4EDPA 2ZNSA 1NH8A 2PT1A 3MQ9A 4YB5A 3TDJA 4WEPA 4GXAA 4OETA 4I1DA 1PBPA 4R6YA 2HZKA 4ELRA 3C31A 1FTOA 2XD2A 2F97A 4ELPA 1OMPA 2THIA 2REJA 4OMBA 5JTYB 2V3TA 3KZGA 3Q26A 2QMXA 3P7IA 4HTGA 3K1PA 1DTZA 3QUFA 5JEIA 3CFZA 2RKMA 3N26A 3B7DA 2HAVA 1D4NA 2HFBA 3AXFA 3RY3A 5DEXB 5FHOA 1Y3QA 4EQ9A 3OO8A 4TLMB 4F18A 3MZ9A 2XXVA 4OESA 3DP4A 1POY1 1QVSA 3BKIB 3PV0E 5IKBA 2QPQA 4P0IA 2IEEA 1B40A 2XXWA 4E0XA 3E9XA 1B52A 4AB6A 4ZZAA 3MAMA 4XKPA 1QW0A 1SBPA 5AA2A 2PBWA 3IR1A 4MFIA 2V3QA 3U92A 3L6GA 2ZYKA 2NWJA 1MRPA 1N84A 1N7WA 1I69A 4RY1A 1P1OA 1IUDA 2DE4A 3F11A 3QUJA 3LSWA 4YKIA 3IK6B 2UVGA 5H8HA 3VVDA 1J1NA 3T9VA 3MVYA 3O6GA 4F19A 5K2XA 4LQ5A 3SERA 3OEMA 5I58B 1I6AA 1UIUA 1H3DA 4BDLA 3G3FA 4KI0E 4P0GA 1SDXA 3KSXA 2I4CA 4IGRA 1MQJA 3QK6A 4GIZA 1IXHA 1MXXA 3SEUA 4NF5A 4OEVA 1PC3A 1IEJA 2DXRA 1O7TA 1B3LA 5F1QA 1B3FA 4IGTA 3TTMA 2H98A 5JK4A 4IB2A 1IXIA 4GL8A 2GFEA 1OVTA 1O63A 3B6WA 2QRYA 4UACA 1HSLA 1MY3A 4KFQA 2UVJA 1LB8A 1UTHB 3MPLA 1ELJA 4ZEKA 4IO5A 1JNFA 1A8EA 1R6ZA 1XOCA 3JZJA 4DE8A 1LSTA 4ZECA 1TFDA 4O3CA 2VHAA 5HBCA 2O69A 1XVYA 2E1SA 1H44A 3KN3A 5A5XA 4GOTA 1JEUA 1B1XA 4PETA 2HQ0A 3H6TA 5EHSA 2XXHA 5H8NB 1DSNA 4JWXA 1Z7NE 5LOMA 3UK4A 1BTJA 2V93A 3HSTA 3KOTA 1MH4A 3VE1B 4AQ4A 2HXWA 1MXVA 3KEIA 1B3EA 3T9HB 1B4HA 2H9BA 4RPNA 1MQGA 3TPAA 1HSEA 2ZNUA 3H6UA 2I6EA 4EXKA 4YB6A 2FA7A 3FJGA 2ZYOA 4C1TA 3ODBA 4NEDA 3E3KA 4YKPA 1A40A 2QS2A 1B5IA 3Q27A 1YCJA 1WDNA 5CBRA 2M8CA 1MPCA 1PEBA 2Z8FA 4F3GA 2AL5A 4OVJA 3MWBA 1FTMA 1ZMGA 4DXBA 1MDP1 3H06B 3V83A 1FQDA 3MVXA 4ND9A 2YPNA 3LSLA 1MG1A 1PB9A 4DIGA 1JW1A 3OMBA 2RC9A 2HZLA 3O28A 1FQFA 2Z23A 4NF4A 2XX8A 1MY4A 1N0TA 2HAUA 3U8QA 2UVIA 2W7YA 3EHUA 1WODA 3S9MC 4OZ9A 4PFUA 1D9YA 1S7YA 1LBCA 1ZTYA 2V25A 4ZEIA 1II5A 3O29A 4R73A 2DQVA 1XHYA 2A5TA 2AYSA 4RA1A 1Y4CA 4GD5A 1SYIA 3DM0A 3FVNA 4IO4A 5CMBA 4HCYA 5AA4B 2Y7PA 4ELOA 5B7DA 3MP6A 1MH3A 3RNNA 2ONSA 1NNKA 2YJPA 5IAIA 3MVZA 2QL3A 4G2ZA 5DTBA 4ZDMA 3SKPA 3OELA 1N04A 2ANJA 3FXQA 1SYHA 1F9BA 3H6VA 5H8NA 5M2VA 4RK2A 4OHNA 2OWSA 4RNSA 3FZVA 3HV1A 4AB5A 3RQTA 3DP8A 1FQEA 3SEXA 3K02A 5AA3A 2F78A 1MY1A 1IXGA 3UP9A 4XIGQ 1SW4A 5AE4A 3ILUB 3BFTA 4QSCA 4POXA 1Y4TA 1A7LA 2D21A 5CM6A 1LB9A 4QFPA 2R9JA 1MXWA 4LONB 3CFXA 1R9QA 1M5FA 1NKXA 1IXCA 2XXTA 5I2KB 5FTIA 5AA2D 1B05A 2Q9TA 5AA2B 5H8QB 4H6DA 3CFLA 3RLFE 2DWIA 3KJTA 2IA4A 4QFKA 2VD3A 2O1MA 3TFLA 2I0CA 4JDFA 3IX1A 4OFJA 1BKAA 3TQLA 3V5AA 3LR1A 1NNTA 4EF2A 3HO7A 3PD8A 1MY0A 4FJPA 3TKDA 1UTBB 3FIRA 4LZ8A 4DCXA 1EH3A 3R26A 4DCYA 1URGA 3H6WA 3T9UA 4FAJA 3IL1B 4O3AA 1SQYA 2I0BA 1RYOA 3QAXA 5DT6A 4DDDA 2FYIA 4GXSB 3OO9A 3UORA 3VXBA 4Q8RA 1LFHA 4EXLA 1EZ9A 2QSXA 3O6HA 1MM6A 5AA4A 5B70A 3I5OA 4ESWA 1ZIUA 4GLIA 2YLNA 4LZ7A 3QSLA 1AL3A 2O68A 5A5XB 4NWDA 3RGYA 1SW1A 2PVUA 2XX7A 3PMVA 2RINA 1USYH 4YAHX 4H5GA 4F22A 2OCUA 4MH5A 3O97A 3BBRA 1PB7A 1LBBA 1P1QA 2DVCA 4I62A 4KHZE 3BFUA 3WAEA 4DZ1A 5I56B 4LQ2A 1IITA 3C9HA 1Q35A 4R6HA 2B3BA 1B9JA 2R71A 4POWA 1MPBA 4FEDA 3OSQA 1MQIA 5ISUA 4O3BA 1MM7A 2HEUA 3K00A 3KOSA 2Y7IA 3KJ7A 4OEUA 3U94A 1I6BA 3TELA 4M1VA 5DVIA 3K01A 1MQHA 4IY5A 1QULA 5L8DA 3FVGA 2RCAA 5I2KA 4N07A 4OYVA 3DP6A 1SVXB 4OWDA 3K6WA 3MW0A 5H8QA 2V84A 3HPIA 4JSOA 3EF7A 4XKQA 4XKNA 3W9WA 4KYSA 1S9TA 1B7HA 4ISUA 3WAFA 3O66A 2Q2CA 1YTVA 1B46A 3PD9A 1NNPA 4ELQA 5AA1A 3TCFA 2PMSA 3S4UA 4NF4B 3K0VA 2Z8EA 4F39A 4PE5B 5DYHA 3K1NA 1UTBA 3O2AA 3T22A 3JV9A 1FQBA 4XTCQ 1LCFA 2QJEA 1XT8A 4QRZA 3LSFB 4OENA 4UA8A 3OD7A 4OTEA 2A5TB 2O1LA 4DXCA 3TCGA 1R9LA 4EQ7A 2F6PA 2E0SA 3PPRA 2A5SA 4BDQA 4Q0CA 1QKBA 4LUBA 5TP9A 1XS5A 4NWCA 1B51A 1IZ1A 2DP8A 5ICQA 3KFMA 5FTHA 3FV1A 2FNCA 4MBPA 4RJZA 2F7BA 3MP8A 4F2OA 1LAGE 2Y7KA 2DSFA 1M5DA 3CRBA 1QKAA 3Q29A 3ECRA 2ZYMA 4R2BA 2D5WA 2H25A 4GQOA 1XVXA 2ABHA 4X1BA 3ZKLA 1ZBMA 3ONMA 1YAEA 3CG3A 1TT1A 1B5JA 5L9MA 5BWJA 5I56A 1S50A 3A3UA 3A3CA 4H67A 5ELVA 4BDNA 3QIMA 1DPPA 1H45A 4RPOA 3IB2A 1P1UA 3U72A 3JYRA 1NMUA 2I58A 3FJMA 1IQ7A 4F29A 2PT2A 2H99A 1JETA 1ZU0A 1T0KA 4F3PA 3O9PA 3HHFA 3IO4A 3MZBA 1ZJLA 5KZTA 4TQUQ 3ZS6A 2ONKE 2XXQA 3SESA 4HS7A 1URDA 4RXLA 3LC8A 1I6QA 5I2NB 4U23A 5ITOA 3PUWE 3R7XA 3TMGA 1A8FA 2RC7A 1D3KA 4G8HA 1QUIA 2NVUB 5CC2A 3I3VA 1R1NA 3TTLA 1QUKA 3M3FA 2I3WA 5KDTB 3E4RA 3VLWA 3T9XB 1B3GA 3IORA 4C0RA 3CI8A 3U1OA 4IO6A 5I57A 4NE4A 2Q88A 2OJTA 4NF6A 1B2HA 4F3BA 3LUYA 4G4PA 1LAXA 4HCWA 4M4GA 2VP1A 2XXPA 3H3GA 3RTWB 1OIBA 4XKRA 3VV5A 4PFWA 4C1UA 3PGFA 1YPNA 4G8MA 3KN7A 4RYAA 3PPQA 5HM4B 3EHTA 2GHAA 2LAOA 2UYEA 2F35A 2RC8A 3RN8A 3KN8A 3GBAA 4LA9A 4MF3A 1ZKBA 2AL4A 3Q25A 4JB7A 4F1UA 4H8IA 4BDMA 2O51A 4RK9A 2DWHA 2I4BA 4U4SA 4KQPA 1Q1KA 4MLQA 1B58A 2NUVA 1A54A 4G77A 3O6IA 4H1XA 1FQAA 4ZEBA 3FXRA 4EQBA 3T93B 3K4UA 2O7UA 3M3KA 3FV2A 1D9VA 3PPNA 4OFLA 5L9OA 4JXIA 3PUXE 1Y20A 1H43A 4G8NA 1AOVA 1TWYA 4WKMA 3H7MA 4BDOA 4FORA 3C4MA 2XHDA 3OO7A 1NL5A 3G3KA 3PPPA 3PU5A 3TCHA 1OQHA 4LP2B 1Y3PA 1XC1A 2XXIA 3LSXA 4QSEA 4YMAA 2XXYA 1AH5A 3K1MA 1M5EA 1OQGA 3S2VA 4ZEDA 1SI1A 3MUQA 4PQJA 4YB7A 2NXOA 2DVZA 3GZGA 4P11A 5I2NA 1B4ZA 2O84X 4YKJA 1A99A 4GVOA 3K2DA 1JVXA 1Y9UA 2DE3A 2PX1A 2ESNA 5H8SA 4LATA 1UIVA 5KDTA 3GLBA 3K6VA 4R74A 3D4GA 4IO7A 3FGSA 3RPWA 3K6XA 1B7ZA 1VFDA 3RT6B 1POTA 2ONRA 3M3LA 5TP9B 3G7WA 3PMWA 3CR9A 4JSDA 3IJXB 2ALUA 1LCTA 2XX9A 2DWJA 5ITPA 3I6VA 3S9NC 3QYTA 4ECFA 4U2RA 3FD3A 3N5LA 1B0LA 2QMWA 4U21A 4Z0IA 5TPAB 1LAHE 3TZAA 1EZPA 1ZLQA 3IO6A 2O6AA 3FJ7A 4DXUA 3FVKA 3OOAA 4R75A 4KCDA 1HSJA 3Q28A 5CRYA 3GBBA 4IO2A 4KR5A 3OENA 3T66A 2QS3A 5H8FB 1MS7A 1P99A 2Q8JA 4NTLA 4FATA 4U1ZA 1LFIA 3FVOA 3R6UA 2Z8DA 2Y84A 4JWYA 3MZ1A 2OZZA 3FUZA 3GXAA 1MY2A 3W9VA 3C34A 1IIWA 3OXNA 4YZZA 3A09A 1MQDA 2H5YA 3RUMA 4F1YA 5DVFA 4GL0A 3MP1A 4NMYA 3N6TA 3VLUA 3SEVA 4FE8A 3TTNA 1L5TA 1B5HA 4ZEFA 4N13A 2CMOA 4R2FA 1P1WA 1N3WA 4G68B 3MBPA 4H65A 4FEBA 1FTLA 4WEDA 4KD5A 3CVGA 1H76A 3EN3A 3CSBA 1M5BA 3KG2A 2QS1A 4R9GA 1JW4A 3TODA 3L6HA 1FW0A 1LFGA 2Y7WA 5FHMA 2OWTA 3LBSA 4F3SA 3PPOA 1CE2A 2F34A 1GV8A 4KYEA 3SEWA 2UXAA 3E13X 3IOVA 3TAJA 3H03A 3VVFA 4FIMA 4LZ5A 4ZE9A 3CG1A 2CZLA 1AIVA 3VFJA 3OEKA 3SETA 1VFEA 2AIXA 4OQOA 2XXUA 2GHBA 3EPEA 3SEYA 4HW8A 3N94A 3RTFB 5I57B 1SD3A 1B1HA 2R6GE 5KCJB 4NF6B 3UIFA 2F36A 5F7VA 3EQ1A 4R6KA 1VE4A 5TU0A 2QS4A 5TPAA 2B65A 1Z7ME 4QFNA 3V8XB 4H0WA 2X7PA 4FECA 3TUSA 1MXYA 3W15C 1Y1MA 1DOTA 4NF8B 1UQWA 3MVWA 3VDFA 2HCAA 4JWOA 1BLFA 2Q2AA 5H8FA 4Z7EA 3B6QA 5JTYA 4ZZEA 3FXUA 4Q5TA 1MDQA 4TLLB 3T96B 1US4A 1AMFA 3U93A 2KLFA 4JBZA 3V89B 3VXCA 1RKMA 3UGWA 3HCQA 5DEXA 4R9FA 2VGQA 1URSA 1B0HA 3PUZE 1GVCA 3MC2A 4EF1A 4I8CA 1O64A 4ZS9A 3G3IA 4G68A 3UA8A 3B6TA 5I59B 4OERA 3IOUA 1TFAA 5CMKA 2OK2A 4ZE8A 1Y3NA 3G3GA 1SI0A 2DWAA 4OXVA 1JQFA 5HPQA 3UN6A 5L9SA 4KPTA 2DYXA 3IJOB 4MLVA 1OVBA 3HN0A 4R72A 4YICA 1JEVA 3USDA 4G68C 4IO3A 2XD3A 3S9LC 2X7QA 1FTKA 1TXFA 3H4ZA 3HHGA 2XXXA 3TQWA 2P2AA 1JW5A 3IB1A 3TYHA 2F7CA 4XXUA 2P1SA 1MPDA 4L17A 4GRKA 4E0WA 2DXYA 4X48A 3PMXA 1DTGA 4KCCA 4QSDA 5I58A 1JVYA 2B3FA 2DE2A 3MJNA 2Z22A 5DVJA 2OLBA 3RT8A 2RCBA 1OLAA 5KCJA 2X26A 1LAFE 1MXUA 1VR5A 3D4CA 3IOWA 2PYYA 4WXJA 3C33A 1QJMA 3C35A 1US5A 4THIA 2V3UA 2XXRA 3IOTA 3OSRA
chains in the Genus database with same CATH superfamily
3DELB 4NQ8A 1FSAA 3K6UA 1CB6A 2BJJX 1UTHA 4F1VA 2DOJA 4YU0A 1B6HA 4U4XA 2DS9A 5K2YA 1PDAA 4NF8A 3TEPA 1FBPA 2F6GA 4QF9A 1NFTA 1QUJA 4KYDA 3G3JA 1KWHA 4QHQA 1OLCA 2O7IA 4HE0A 3IB0A 1A55A 1DPEA 1Y1ZA 1LGBC 2F5XA 1BIYA 1NNFA 2UVHA 4GWXA 4LVQA 2UYFA 3QXMA 1SW2A 4TOZA 4N6PA 1B7UA 3VVEA 2ZMBA 2H4IA 3VLVA 3KBRA 1DMBA 4U22A 3ZKKA 4GFRA 1LLSA 1PB8A 1EU8A 4PFYA 3DLNA 2ZXTA 4QFOA 3G3HA 4PP0A 5CMMA 1N76A 1FPDA 1LBXA 4GWOA 5CMCA 5EYFA 3C32A 3FASA 3S9EA 2GRVA 3PUVE 5I59A 3C36A 5EHMA 4H8JA 5FBPA 3PUYE 4PFTA 3TTRA 4K3FA 1FTJA 2WKYA 4YMBA 5ICTA 2Q89A 2NOOA 3MPKA 1ANFA 3OO6A 4MCOA 2GH9A 4U1OA 3KGCA 4F2QA 4P47A 2I48A 5IM2A 4QFLA 1VSOA 3ZSFA 1LBVA 4EUOA 4Q30B 1FQCA 1XI6A 2I3VA 1GGGA 3B50A 1EZOA 3HFUA 4BLAA 2G93A 5FHNA 5I84A 3KSJA 3A29A 4IY6A 2F7AA 2D3IA 2VOZA 1FBEA 5H8HB 3SDFA 2ZNTA 4PDHA 2G29A 4H5FA 4BDRA 4ONYA 4F31B 1B3HA 1WVJA 2L5VA 1USYE 4I9DA 4X9TA 4YKKA 1B32A 3CIJA 2VD2A 2REGA 4OANA 3N6UA 4ESXA 1RYXA 3ILTB 5CBSA 2Y7RA 1N7XA 5CI5A 2I49A 4DLDA 2P0SA 1FCKA 2F8DA 1NH7A 4PFRA 1BP5A 1MXZA 5BUUA 3EHSA 1GTKA 1N3XA 2OWZA 4NF5B 1P1NA 3CSGA 2OBGA 3FATA 3M8UA 1GR2A 4OFOA 2ZYNA 1SW5A 1PBQA 3IAZA 2RF1A 5J1DA 4GF8A 1ATGA 1M5CA 4X1DA 3THIA 1LBWA 3TTKA 4EDPA 2ZNSA 1NH8A 2PT1A 3MQ9A 4YB5A 2ZZWA 3TDJA 4WEPA 1NUZA 1NV1A 4GXAA 4OETA 4I1DA 1PBPA 4R6YA 2HZKA 4ELRA 3C31A 2Y5KA 1FTOA 2XD2A 2F97A 4ELPA 3D1RA 1OMPA 2VPNA 2THIA 2REJA 4OMBA 5JTYB 2V3TA 3KZGA 3Q26A 2QMXA 3P7IA 4HTGA 3K1PA 1DTZA 3QUFA 5JEIA 4NG7A 3CFZA 2RKMA 2ZZXA 3N26A 3B7DA 2HAVA 1D4NA 2HFBA 1NV0A 3AXFA 3RY3A 5DEXB 5FHOA 1Y3QA 4EQ9A 5T3JA 3OO8A 4TLMB 4F18A 3MZ9A 2F3BA 2XXVA 4JVDA 2CZHA 4OESA 3DP4A 1POY1 3ISPA 1QVSA 3BKIB 3IFCA 3PV0E 5IKBA 2QPQA 4P0IA 2IEEA 1B40A 2XXWA 4E0XA 3E9XA 1K9ZA 1B52A 4XF5A 4AB6A 4ZZAA 3MAMA 4PC9A 4XKPA 1QW0A 1SBPA 4QXDA 5AA2A 2PBWA 3IR1A 4MFIA 1FPLA 2V3QA 4NGUA 4UABA 3U92A 3L6GA 4MAGA 2ZYKA 2NWJA 1MRPA 2FBPA 1N84A 1N7WA 1I69A 4RY1A 1P1OA 1IUDA 2DE4A 1INPA 3PTYA 3F11A 3QUJA 3LSWA 4YKIA 3IK6B 2UVGA 5H8HA 3VVDA 1J1NA 3T9VA 1FPBA 1RDYA 3MVYA 4MMPA 2HXRA 3U65A 3O6GA 4F19A 5K2XA 4LQ5A 3SERA 3OEMA 5I58B 1I6AA 1UIUA 2WBDA 1H3DA 4BDLA 4DI4B 3G3FA 4KI0E 4P0GA 2MKZA 1SDXA 3KSXA 4O7MA 3NOHA 2I4CA 4IGRA 1MQJA 3QK6A 1IMCA 4GIZA 1IXHA 1MXXA 3SEUA 1RDZA 4NF5A 4OEVA 1PC3A 1IEJA 2DXRA 1O7TA 1B3LA 5F1QA 1B3FA 4IGTA 3TTMA 2H98A 5JK4A 4IB2A 1IXIA 4GL8A 2GFEA 1OVTA 1O63A 4LN5A 3B6WA 2BJIA 2QRYA 4UACA 1HSLA 4FBPA 1MY3A 4KFQA 2UVJA 1LB8A 1UTHB 3MPLA 1ELJA 4ZEKA 4IO5A 1JNFA 1A8EA 1R6ZA 1XOCA 3JZJA 4DE8A 1LSTA 4ZECA 1TFDA 4O3CA 2VHAA 5HBCA 2O69A 1XVYA 2E1SA 1H44A 3KN3A 1G0HA 4GOTA 5A5XA 4PAIA 2XA5A 1JEUA 1B1XA 4PETA 2HQ0A 3H6TA 5EHSA 2XXHA 5H8NB 1DSNA 4PAKA 4JWXA 4PF6A 1Z7NE 5LOMA 3UK4A 1BTJA 2V93A 3HSTA 3KOTA 1MH4A 3VE1B 4AQ4A 2HXWA 1MXVA 3KEIA 1B3EA 3T9HB 1B4HA 2H9BA 4RPNA 1MQGA 3TPAA 1HSEA 2ZNUA 5ET7A 1EYKA 3H6UA 2I6EA 5ET8A 4EXKA 4YB6A 2FA7A 3FJGA 2ZYOA 4C1TA 3ODBA 4NEDA 3E3KA 4YKPA 1A40A 2QS2A 1LEVA 1B5IA 3Q27A 1YCJA 4PGNA 1WDNA 5CBRA 2M8CA 1MPCA 1PEBA 2FHYA 4N17A 2Z8FA 4F3GA 4XFEA 2AL5A 4OVJA 3MWBA 1FTMA 1ZMGA 4DXBA 1MDP1 3H06B 3V83A 1FQDA 3MVXA 5LTCA 4ND9A 2YPNA 3LSLA 1MG1A 1PB9A 4DIGA 1JW1A 3OMBA 2RC9A 2HZLA 3O28A 1FQFA 2Z23A 4NF4A 4N4UA 4NAPA 2XX8A 1MY4A 1N0TA 3T0JA 2HAUA 2ZZVA 3U8QA 2UVIA 2W7YA 3EHUA 1WODA 3S9MC 4OZ9A 4PFUA 1D9YA 1S7YA 1LBCA 1Q9DA 4KXPA 1ZTYA 2V25A 4ZEIA 1II5A 3O29A 2QFLA 4R73A 2DQVA 1XHYA 2A5TA 2AYSA 4NN3A 4RA1A 1Y4CA 4GD5A 2QVUA 3EKIA 1SYIA 3DM0A 3FVNA 4IO4A 5CMBA 1FJ9A 4HCYA 5AA4B 2Y7PA 4ELOA 5B7DA 4GX3A 4MIJA 3MP6A 4P8BA 2DDKA 2QVVA 1MH3A 3RNNA 2ONSA 1NNKA 2YJPA 1DK4A 5IAIA 3MVZA 4O94A 2QL3A 4PTKA 4G2ZA 1FBDA 5DTBA 4ZDMA 3SKPA 3OELA 1N04A 2ANJA 3FXQA 1SYHA 1F9BA 2P3NA 3H6VA 5H8NA 4GBWA 5M2VA 4RK2A 4OHNA 1KZ8A 2OWSA 4RNSA 3FZVA 3HV1A 4AB5A 3RQTA 3DP8A 1FRPA 3BIGA 1FPFA 1FQEA 3SEXA 3K02A 5AA3A 3T1BA 2F78A 1MY1A 1IXGA 3UP9A 4XIGQ 1SW4A 5AE4A 3ILUB 3BFTA 4GWZA 4QSCA 4POXA 4P9KA 1Y4TA 1A7LA 2D21A 5CM6A 1LB9A 1NUWA 4QFPA 2R9JA 5LDZA 1MXWA 4LONB 1FBHA 3CFXA 3IFAA 1R9QA 1M5FA 1NKXA 1IXCA 2XXTA 5I2KB 5FTIA 5AA2D 1B05A 2Q9TA 5AA2B 1QGXA 5H8QB 4H6DA 3CFLA 3RLFE 2DWIA 3KJTA 2IA4A 2P3VA 4QFKA 2VD3A 2O1MA 3TFLA 2I0CA 4JDFA 3IX1A 4OFJA 1BKAA 3TQLA 3V5AA 1FBGA 3LR1A 4GWUA 1NNTA 4EF2A 3HO7A 3PD8A 2XWIA 1MY0A 5A5LA 4FJPA 3TKDA 1UTBB 3FIRA 4LZ8A 4DCXA 1EH3A 3R26A 4DCYA 1URGA 3H6WA 5ESYA 3T9UA 4FAJA 3IL1B 4DI3D 4O3AA 1SQYA 2I0BA 4MHFA 4QBAA 1RYOA 3QAXA 5DT6A 4DDDA 5J16A 2FYIA 4GXSB 3OO9A 3UORA 3VXBA 4Q8RA 5EQ7A 1LFHA 4PF8A 4EXLA 3KC1A 1EZ9A 2QSXA 3O6HA 1MM6A 5AA4A 5B70A 3QMFA 3I5OA 4ESWA 1ZIUA 4GLIA 2YLNA 2FVZA 4LZ7A 3QSLA 1AL3A 2O68A 2PFYA 5A5XB 4NWDA 5IZZA 3RGYA 1SW1A 2PVUA 2XX7A 3PMVA 2RINA 1USYH 4YAHX 4H5GA 2XXKA 4F22A 2CEYA 2OCUA 4MH5A 3O97A 3BBRA 1PB7A 1LBBA 1P1QA 2DVCA 4I62A 4KHZE 4MNCA 3BFUA 3WAEA 4DZ1A 5I56B 4LQ2A 1IITA 3C9HA 1Q35A 2JJKA 4R6HA 2B3BA 1B9JA 2R71A 4POWA 1MPBA 4FEDA 3OSQA 1MQIA 3LUZA 5ISUA 4O3BA 1MM7A 1FBCA 2HEUA 2CZKA 3K00A 3KOSA 2Y7IA 3KJ7A 4OEUA 3U94A 1I6BA 3TELA 4M1VA 5DVIA 3K01A 1MQHA 4IY5A 1QULA 2HPGA 4MNPA 5L8DA 3FVGA 2RCAA 5I2KA 4N07A 4OYVA 3DP6A 1SVXB 1DBZA 4OWDA 3K6WA 3MW0A 4PBHA 5H8QA 4N8GA 5F24A 1FJ6A 2V84A 4OVTA 3HPIA 4JSOA 3EF7A 4XKQA 2GQ1A 4XKNA 3W9WA 4KYSA 1S9TA 1B7HA 4ISUA 3WAFA 3O66A 2Q2CA 1YTVA 1B46A 3PD9A 1NNPA 4ELQA 5AA1A 3TCFA 2HHMA 2PMSA 3S4UA 1YZ0A 4NF4B 3K0VA 2Z8EA 4F39A 4PE5B 4O8MA 5DYHA 3K1NA 1UTBA 4JVIA 3O2AA 3T22A 3JV9A 1FQBA 4XTCQ 1LCFA 2QJEA 4PBQA 1XT8A 4PAFA 1FPGA 4QRZA 3LSFB 4OENA 4GBVA 4UA8A 4O7IA 3OD7A 4OTEA 2A5TB 2O1LA 4N8YA 4DXCA 3TCGA 1R9LA 4EQ7A 4GWWA 2F6PA 2E0SA 2Q8MA 3PPRA 2A5SA 4BDQA 4Q0CA 1QKBA 4LUBA 5TP9A 1XS5A 4NWCA 1B51A 1IZ1A 2DP8A 5ICQA 3KFMA 5FTHA 1IMBA 3FV1A 2FNCA 4P3LA 4MBPA 3E79A 4RJZA 2Y5LA 4HE1A 1FPKA 2F7BA 3MP8A 4NF0A 4F2OA 1LAGE 4I3EA 2CEXA 2Y7KA 2DSFA 1M5DA 3CRBA 1QKAA 3Q29A 3ECRA 4OVSA 2ZYMA 4R2BA 4GX6A 2D5WA 2H25A 1NUXA 5IZ1A 4GQOA 1XVXA 2ABHA 5IZ3B 4X1BA 3ZKLA 1ZBMA 3ONMA 1YAEA 3CG3A 1TT1A 1B5JA 5L9MA 5BWJA 5I56A 1S50A 3A3UA 3A3CA 4H67A 5ELVA 4BDNA 3QIMA 1DPPA 1H45A 4RPOA 4GWYA 3IB2A 1P1UA 4MX6A 3U72A 3JYRA 1NMUA 2I58A 1KA0A 2OX3A 3FJMA 1IQ7A 4F29A 5EQAA 3B8BA 2PT2A 1YXIA 2H99A 1JETA 1ZU0A 1T0KA 4F3PA 3O9PA 3HHFA 3IO4A 3MZBA 1ZJLA 5KZTA 4AS4A 4TQUQ 3ZS6A 4MEVA 2ONKE 1NV4A 3SZPA 2WYPA 2XXQA 4PFIA 3SESA 4HS7A 2VT5A 1URDA 4RXLA 4HE2A 2XWOA 3LC8A 1I6QA 5I2NB 4U23A 5ITOA 4JVCA 3PUWE 3R7XA 3TMGA 1A8FA 5IGAA 3KC0A 2RC7A 5EYGA 1D3KA 4G8HA 1QUIA 2NVUB 5CC2A 3I3VA 1R1NA 1NV3A 3TTLA 1QUKA 3RPLB 3M3FA 2I3WA 5KDTB 3E4RA 3VLWA 4N6DA 3T9XB 1B3GA 1NI9A 3IORA 4C0RA 3CI8A 3U1OA 4PCDA 1EYJA 4IO6A 5I57A 4NE4A 2Q88A 2OJTA 4NF6A 1B2HA 4F3BA 3LUYA 4G4PA 1LAXA 4HCWA 2QVRA 4M4GA 2VP1A 2XXPA 5I5PA 3H3GA 3RTWB 1OIBA 2PCRA 4XKRA 3VV5A 4PFWA 3RYDA 4C1UA 1FPEA 3PGFA 1YPNA 4G8MA 3KN7A 4X04A 4RYAA 3PPQA 5HM4B 3EHTA 2GHAA 2LAOA 2UYEA 2F35A 2RC8A 3RN8A 3KN8A 3GBAA 4LA9A 4MF3A 1ZKBA 2AL4A 3Q25A 4JB7A 4F1UA 4H8IA 4BDMA 2O51A 4RK9A 2DWHA 5IZ3A 3E78A 2I4BA 4U4SA 4KQPA 1Q1KA 4MLQA 1B58A 2NUVA 1A54A 3MYUA 3FXBA 4G77A 3O6IA 4H1XA 1FQAA 4ZEBA 3FXRA 4EQBA 3T93B 3K4UA 2O7UA 3M3KA 3FV2A 1D9VA 1KA1A 3PPNA 4OFLA 5L9OA 4JXIA 3PUXE 1Y20A 1IMDA 1H43A 1FBFA 4G8NA 1AOVA 1TWYA 4WKMA 3H7MA 4BDOA 4FORA 3C4MA 4MJOA 2XHDA 3OO7A 1NL5A 3G3KA 3PPPA 3PU5A 3TCHA 2R8TA 3ROJA 1OQHA 4LP2B 4N81A 1Y3PA 1XC1A 2XXIA 3LSXA 4PDDA 2V4CA 4QSEA 4YMAA 2XXYA 1AH5A 3K1MA 1FPIA 1M5EA 1OQGA 1D9QA 2F3DA 3S2VA 4ZEDA 4N6KA 1SI1A 3MUQA 4PQJA 1JP4A 4YB7A 2NXOA 2DVZA 3GZGA 4P11A 5I2NA 1B4ZA 2O84X 4IR8A 4YKJA 1A99A 3LV0A 4OA4A 4GVOA 3K2DA 1JVXA 3RPLA 1Y9UA 2DE3A 2PX1A 2ESNA 4LATA 1UIVA 5H8SA 5KDTA 3GLBA 3K6VA 4R74A 3D4GA 1NV7A 4IO7A 3FGSA 3RPWA 3K6XA 1B7ZA 1VFDA 3RT6B 1POTA 2WBBA 2ONRA 3M3LA 5TP9B 3G7WA 3PMWA 3CR9A 4JSDA 3IJXB 2ALUA 1LCTA 2XX9A 2DWJA 5ITPA 3I6VA 3S9NC 3QYTA 4ECFA 4U2RA 3FD3A 3N5LA 1B0LA 2QMWA 4U21A 4Z0IA 2VPOA 5TPAB 1LAHE 4OVRA 4MNIA 5I3SA 5ET6A 3TZAA 1EZPA 1ZLQA 3IO6A 2O6AA 3FJ7A 4GX4A 2WX9A 1VDWA 4DXUA 4OVPA 3FVKA 3OOAA 4R75A 4KCDA 1HSJA 3Q28A 5CRYA 3GBBA 4IO2A 4KR5A 3OENA 4P56A 1K9YA 4N91A 3T66A 2QS3A 5H8FB 1MS7A 1P99A 2Q8JA 3MSTA 4NTLA 4FATA 4U1ZA 1LFIA 3FVOA 3R6UA 2Z8DA 2Y84A 4JWYA 3MZ1A 2OZZA 3FUZA 3GXAA 1MY2A 3W9VA 2FIXA 3C34A 1IIWA 3OXNA 4YZZA 3A09A 1MQDA 2H5YA 3RUMA 4F1YA 5DVFA 4GL0A 3MP1A 4NMYA 3N6TA 3VLUA 3SEVA 4FE8A 3TTNA 1L5TA 1B5HA 4ZEFA 4N13A 2CMOA 4I3YA 4R2FA 1P1WA 1N3WA 4G68B 3MBPA 3FBPA 2WEFA 4H65A 4FEBA 1FTLA 4WEDA 4KD5A 3CVGA 1H76A 3EN3A 1NV6A 3CSBA 1M5BA 3KG2A 2QS1A 4R9GA 1LBYA 1JW4A 3TODA 4PE3A 1DCUA 4X8RA 3L6HA 1FW0A 3CHGA 2B4LA 1LFGA 2Y7WA 4H45A 4G61A 5FHMA 2OWTA 3LBSA 4F3SA 3PPOA 2B4MA 1IMAA 1CE2A 2F34A 1NV2A 5EQ8A 1GV8A 4KYEA 3SEWA 2UXAA 3E13X 3IOVA 3TAJA 3H03A 2XWVA 3VVFA 4FIMA 4LZ5A 4ZE9A 3CG1A 2CZLA 1AIVA 1G0IA 3VFJA 2FIEA 1IMEA 3OEKA 5DW8A 3SETA 1VFEA 4N15A 2AIXA 4OQOA 5ET5A 2XXUA 2GHBA 3EPEA 1EYIA 4GWSA 3SEYA 4HW8A 3N94A 3RTFB 2XWKA 5I57B 1SD3A 1B1HA 1BK4A 2R6GE 5KCJB 4NF6B 3UIFA 2F36A 5F7VA 3EQ1A 4R6KA 1VE4A 5TU0A 2QS4A 5EYHA 5TPAA 2B65A 2KQZA 1Z7ME 4QFNA 1IMFA 4H46A 3V8XB 4H0WA 2X7PA 4FECA 3TUSA 1MXYA 3W15C 3KBZA 1Y1MA 1DOTA 1FPJA 4NF8B 1UQWA 4HXVA 3MVWA 3VDFA 2HCAA 2CZIA 4JWOA 1BLFA 2Q2AA 5H8FA 4I40A 4Z7EA 3B6QA 5JTYA 4ZZEA 3FXUA 4Q5TA 1MDQA 4TLLB 3T96B 1US4A 1AMFA 3U93A 2KLFA 4JBZA 3V89B 4OVQA 4P1LA 3VXCA 1RKMA 4NX1A 3UGWA 3HCQA 5DEXA 4R9FA 2VGQA 1URSA 1B0HA 3PUZE 1GVCA 1CNQA 3MC2A 1SPIA 4EF1A 4I8CA 1FTAA 1O64A 4ZS9A 3G3IA 4G68A 3UA8A 3B6TA 5I59B 4OERA 3IOUA 1TFAA 5CMKA 1RDXA 2OK2A 5EQ9A 4ZE8A 1Y3NA 5I7IA 2Q74A 3G3GA 1SI0A 2DWAA 4OXVA 1AWBA 1NV5A 1JQFA 5HPQA 1YYZA 3UN6A 5L9SA 4KPTA 2DYXA 3IJOB 4MLVA 1OVBA 4PGPA 3HN0A 4R72A 4YICA 1JEVA 3USDA 4G68C 4IO3A 3BIHA 2XD3A 3S9LC 2X7QA 1FTKA 1TXFA 3H4ZA 3HHGA 4NHBA 1LBZA 4PFBA 2PFZA 2XXXA 3TQWA 2P2AA 1JW5A 3IB1A 3TYHA 2F7CA 4XXUA 2P1SA 1MPDA 4L17A 4GRKA 4E0WA 2WYKA 2DXYA 4P1EA 4X48A 3PMXA 1DTGA 4AS5A 4KCCA 4QSDA 5I58A 1JVYA 2B3FA 2DE2A 3GYYA 3MJNA 2Z22A 5DVJA 1NUYA 2OLBA 3RT8A 2RCBA 1OLAA 5KCJA 2X26A 1LAFE 1MXUA 1VR5A 3D4CA 3IOWA 2PYYA 2KR0A 4WXJA 3C33A 1QJMA 3C35A 1US5A 4THIA 2V3UA 2XXRA 3IOTA 3OSRA 4XEQA
chains in the Genus database with same CATH topology
3DELB 3K6UA 1CB6A 2BJJX 1UTHA 4F1VA 2DOJA 4YU0A 1B6HA 4U4XA 2DS9A 5K2YA 1PDAA 4NF8A 3TEPA 2F6GA 4QF9A 1NFTA 1QUJA 4KYDA 3G3JA 1KWHA 4QHQA 1OLCA 2O7IA 3IB0A 1A55A 1DPEA 1Y1ZA 1LGBC 2F5XA 1BIYA 1NNFA 2UVHA 4LVQA 2UYFA 3QXMA 1SW2A 4TOZA 4N6PA 1B7UA 3VVEA 2ZMBA 2H4IA 3VLVA 3KBRA 1DMBA 4U22A 3ZKKA 4GFRA 1LLSA 1PB8A 1EU8A 4PFYA 3DLNA 2ZXTA 4QFOA 3G3HA 4PP0A 5CMMA 1N76A 4GWOA 5CMCA 5EYFA 3C32A 3FASA 3S9EA 2GRVA 3PUVE 5I59A 3C36A 5EHMA 4H8JA 3PUYE 4PFTA 3TTRA 4K3FA 1FTJA 2WKYA 4YMBA 5ICTA 2Q89A 2NOOA 3MPKA 1ANFA 3OO6A 2GH9A 4U1OA 3KGCA 4F2QA 2I48A 4QFLA 1VSOA 3ZSFA 4EUOA 4Q30B 1FQCA 2I3VA 1GGGA 1EZOA 4BLAA 2G93A 5FHNA 5I84A 3KSJA 4IY6A 2F7AA 2D3IA 2VOZA 5H8HB 3SDFA 2ZNTA 2G29A 4H5FA 4BDRA 4ONYA 4F31B 1B3HA 1WVJA 1USYE 4I9DA 4X9TA 4YKKA 1B32A 3CIJA 2VD2A 2REGA 3N6UA 4ESXA 1RYXA 3ILTB 5CBSA 2Y7RA 1N7XA 5CI5A 2I49A 4DLDA 2P0SA 1FCKA 2F8DA 1NH7A 1BP5A 1MXZA 5BUUA 3EHSA 1GTKA 1N3XA 4NF5B 1P1NA 3CSGA 2OBGA 3FATA 3M8UA 1GR2A 4OFOA 2ZYNA 1SW5A 1PBQA 3IAZA 2RF1A 5J1DA 4GF8A 1ATGA 1M5CA 4X1DA 3THIA 3TTKA 4EDPA 2ZNSA 1NH8A 2PT1A 3MQ9A 4YB5A 3TDJA 4WEPA 4GXAA 4OETA 4I1DA 1PBPA 4R6YA 2HZKA 4ELRA 3C31A 1FTOA 2XD2A 2F97A 4ELPA 1OMPA 2THIA 2REJA 4OMBA 5JTYB 2V3TA 3KZGA 3Q26A 2QMXA 3P7IA 4HTGA 3K1PA 1DTZA 3QUFA 5JEIA 3CFZA 2RKMA 3N26A 3B7DA 2HAVA 1D4NA 2HFBA 3AXFA 3RY3A 5DEXB 5FHOA 1Y3QA 4EQ9A 3OO8A 4TLMB 4F18A 3MZ9A 2XXVA 4OESA 3DP4A 1POY1 1QVSA 3BKIB 3PV0E 5IKBA 2QPQA 4P0IA 2IEEA 1B40A 2XXWA 4E0XA 3E9XA 1B52A 4AB6A 4ZZAA 3MAMA 4XKPA 1QW0A 1SBPA 5AA2A 2PBWA 3IR1A 4MFIA 2V3QA 3U92A 3L6GA 2ZYKA 2NWJA 1MRPA 1N84A 1N7WA 1I69A 4RY1A 1P1OA 1IUDA 2DE4A 3F11A 3QUJA 3LSWA 4YKIA 3IK6B 2UVGA 5H8HA 3VVDA 1J1NA 3T9VA 3MVYA 3O6GA 4F19A 5K2XA 4LQ5A 3SERA 3OEMA 5I58B 1I6AA 1UIUA 1H3DA 4BDLA 3G3FA 4KI0E 4P0GA 1SDXA 3KSXA 2I4CA 4IGRA 1MQJA 3QK6A 4GIZA 1IXHA 1MXXA 3SEUA 4NF5A 4OEVA 1PC3A 1IEJA 2DXRA 1O7TA 1B3LA 5F1QA 1B3FA 4IGTA 3TTMA 2H98A 5JK4A 4IB2A 1IXIA 4GL8A 2GFEA 1OVTA 1O63A 3B6WA 2QRYA 4UACA 1HSLA 1MY3A 4KFQA 2UVJA 1LB8A 1UTHB 3MPLA 1ELJA 4ZEKA 4IO5A 1JNFA 1A8EA 1R6ZA 1XOCA 3JZJA 4DE8A 1LSTA 4ZECA 1TFDA 4O3CA 2VHAA 5HBCA 2O69A 1XVYA 2E1SA 1H44A 3KN3A 5A5XA 4GOTA 1JEUA 1B1XA 4PETA 2HQ0A 3H6TA 5EHSA 2XXHA 5H8NB 1DSNA 4JWXA 1Z7NE 5LOMA 3UK4A 1BTJA 2V93A 3HSTA 3KOTA 1MH4A 3VE1B 4AQ4A 2HXWA 1MXVA 3KEIA 1B3EA 3T9HB 1B4HA 2H9BA 4RPNA 1MQGA 3TPAA 1HSEA 2ZNUA 3H6UA 2I6EA 4EXKA 4YB6A 2FA7A 3FJGA 2ZYOA 4C1TA 3ODBA 4NEDA 3E3KA 4YKPA 1A40A 2QS2A 1B5IA 3Q27A 1YCJA 1WDNA 5CBRA 2M8CA 1MPCA 1PEBA 2Z8FA 4F3GA 2AL5A 4OVJA 3MWBA 1FTMA 1ZMGA 4DXBA 1MDP1 3H06B 3V83A 1FQDA 3MVXA 4ND9A 2YPNA 3LSLA 1MG1A 1PB9A 4DIGA 1JW1A 3OMBA 2RC9A 2HZLA 3O28A 1FQFA 2Z23A 4NF4A 2XX8A 1MY4A 1N0TA 2HAUA 3U8QA 2UVIA 2W7YA 3EHUA 1WODA 3S9MC 4OZ9A 4PFUA 1D9YA 1S7YA 1LBCA 1ZTYA 2V25A 4ZEIA 1II5A 3O29A 4R73A 2DQVA 1XHYA 2A5TA 2AYSA 4RA1A 1Y4CA 4GD5A 1SYIA 3DM0A 3FVNA 4IO4A 5CMBA 4HCYA 5AA4B 2Y7PA 4ELOA 5B7DA 3MP6A 1MH3A 3RNNA 2ONSA 1NNKA 2YJPA 5IAIA 3MVZA 2QL3A 4G2ZA 5DTBA 4ZDMA 3SKPA 3OELA 1N04A 2ANJA 3FXQA 1SYHA 1F9BA 3H6VA 5H8NA 5M2VA 4RK2A 4OHNA 2OWSA 4RNSA 3FZVA 3HV1A 4AB5A 3RQTA 3DP8A 1FQEA 3SEXA 3K02A 5AA3A 2F78A 1MY1A 1IXGA 3UP9A 4XIGQ 1SW4A 5AE4A 3ILUB 3BFTA 4QSCA 4POXA 1Y4TA 1A7LA 2D21A 5CM6A 1LB9A 4QFPA 2R9JA 1MXWA 4LONB 3CFXA 1R9QA 1M5FA 1NKXA 1IXCA 2XXTA 5I2KB 5FTIA 5AA2D 1B05A 2Q9TA 5AA2B 5H8QB 4H6DA 3CFLA 3RLFE 2DWIA 3KJTA 2IA4A 4QFKA 2VD3A 2O1MA 3TFLA 2I0CA 4JDFA 3IX1A 4OFJA 1BKAA 3TQLA 3V5AA 3LR1A 1NNTA 4EF2A 3HO7A 3PD8A 1MY0A 4FJPA 3TKDA 1UTBB 3FIRA 4LZ8A 4DCXA 1EH3A 3R26A 4DCYA 1URGA 3H6WA 3T9UA 4FAJA 3IL1B 4O3AA 1SQYA 2I0BA 1RYOA 3QAXA 5DT6A 4DDDA 2FYIA 4GXSB 3OO9A 3UORA 3VXBA 4Q8RA 1LFHA 4EXLA 1EZ9A 2QSXA 3O6HA 1MM6A 5AA4A 5B70A 3I5OA 4ESWA 1ZIUA 4GLIA 2YLNA 4LZ7A 3QSLA 1AL3A 2O68A 5A5XB 4NWDA 3RGYA 1SW1A 2PVUA 2XX7A 3PMVA 2RINA 1USYH 4YAHX 4H5GA 4F22A 2OCUA 4MH5A 3O97A 3BBRA 1PB7A 1LBBA 1P1QA 2DVCA 4I62A 4KHZE 3BFUA 3WAEA 4DZ1A 5I56B 4LQ2A 1IITA 3C9HA 1Q35A 4R6HA 2B3BA 1B9JA 2R71A 4POWA 1MPBA 4FEDA 3OSQA 1MQIA 5ISUA 4O3BA 1MM7A 2HEUA 3K00A 3KOSA 2Y7IA 3KJ7A 4OEUA 3U94A 1I6BA 3TELA 4M1VA 5DVIA 3K01A 1MQHA 4IY5A 1QULA 5L8DA 3FVGA 2RCAA 5I2KA 4N07A 4OYVA 3DP6A 1SVXB 4OWDA 3K6WA 3MW0A 5H8QA 2V84A 3HPIA 4JSOA 3EF7A 4XKQA 4XKNA 3W9WA 4KYSA 1S9TA 1B7HA 4ISUA 3WAFA 3O66A 2Q2CA 1YTVA 1B46A 3PD9A 1NNPA 4ELQA 5AA1A 3TCFA 2PMSA 3S4UA 4NF4B 3K0VA 2Z8EA 4F39A 4PE5B 5DYHA 3K1NA 1UTBA 3O2AA 3T22A 3JV9A 1FQBA 4XTCQ 1LCFA 2QJEA 1XT8A 4QRZA 3LSFB 4OENA 4UA8A 3OD7A 4OTEA 2A5TB 2O1LA 4DXCA 3TCGA 1R9LA 4EQ7A 2F6PA 2E0SA 3PPRA 2A5SA 4BDQA 4Q0CA 1QKBA 4LUBA 5TP9A 1XS5A 4NWCA 1B51A 1IZ1A 2DP8A 5ICQA 3KFMA 5FTHA 3FV1A 2FNCA 4MBPA 4RJZA 2F7BA 3MP8A 4F2OA 1LAGE 2Y7KA 2DSFA 1M5DA 3CRBA 1QKAA 3Q29A 3ECRA 2ZYMA 4R2BA 2D5WA 2H25A 4GQOA 1XVXA 2ABHA 4X1BA 3ZKLA 1ZBMA 3ONMA 1YAEA 3CG3A 1TT1A 1B5JA 5L9MA 5BWJA 5I56A 1S50A 3A3UA 3A3CA 4H67A 5ELVA 4BDNA 3QIMA 1DPPA 1H45A 4RPOA 3IB2A 1P1UA 3U72A 3JYRA 1NMUA 2I58A 3FJMA 1IQ7A 4F29A 2PT2A 2H99A 1JETA 1ZU0A 1T0KA 4F3PA 3O9PA 3HHFA 3IO4A 3MZBA 1ZJLA 5KZTA 4TQUQ 3ZS6A 2ONKE 2XXQA 3SESA 4HS7A 1URDA 4RXLA 3LC8A 1I6QA 5I2NB 4U23A 5ITOA 3PUWE 3R7XA 3TMGA 1A8FA 2RC7A 1D3KA 4G8HA 1QUIA 2NVUB 5CC2A 3I3VA 1R1NA 3TTLA 1QUKA 3M3FA 2I3WA 5KDTB 3E4RA 3VLWA 3T9XB 1B3GA 3IORA 4C0RA 3CI8A 3U1OA 4IO6A 5I57A 4NE4A 2Q88A 2OJTA 4NF6A 1B2HA 4F3BA 3LUYA 4G4PA 1LAXA 4HCWA 4M4GA 2VP1A 2XXPA 3H3GA 3RTWB 1OIBA 4XKRA 3VV5A 4PFWA 4C1UA 3PGFA 1YPNA 4G8MA 3KN7A 4RYAA 3PPQA 5HM4B 3EHTA 2GHAA 2LAOA 2UYEA 2F35A 2RC8A 3RN8A 3KN8A 3GBAA 4LA9A 4MF3A 1ZKBA 2AL4A 3Q25A 4JB7A 4F1UA 4H8IA 4BDMA 2O51A 4RK9A 2DWHA 2I4BA 4U4SA 4KQPA 1Q1KA 4MLQA 1B58A 2NUVA 1A54A 4G77A 3O6IA 4H1XA 1FQAA 4ZEBA 3FXRA 4EQBA 3T93B 3K4UA 2O7UA 3M3KA 3FV2A 1D9VA 3PPNA 4OFLA 5L9OA 4JXIA 3PUXE 1Y20A 1H43A 4G8NA 1AOVA 1TWYA 4WKMA 3H7MA 4BDOA 4FORA 3C4MA 2XHDA 3OO7A 1NL5A 3G3KA 3PPPA 3PU5A 3TCHA 1OQHA 4LP2B 1Y3PA 1XC1A 2XXIA 3LSXA 4QSEA 4YMAA 2XXYA 1AH5A 3K1MA 1M5EA 1OQGA 3S2VA 4ZEDA 1SI1A 3MUQA 4PQJA 4YB7A 2NXOA 2DVZA 3GZGA 4P11A 5I2NA 1B4ZA 2O84X 4YKJA 1A99A 4GVOA 3K2DA 1JVXA 1Y9UA 2DE3A 2PX1A 2ESNA 5H8SA 4LATA 1UIVA 5KDTA 3GLBA 3K6VA 4R74A 3D4GA 4IO7A 3FGSA 3RPWA 3K6XA 1B7ZA 1VFDA 3RT6B 1POTA 2ONRA 3M3LA 5TP9B 3G7WA 3PMWA 3CR9A 4JSDA 3IJXB 2ALUA 1LCTA 2XX9A 2DWJA 5ITPA 3I6VA 3S9NC 3QYTA 4ECFA 4U2RA 3FD3A 3N5LA 1B0LA 2QMWA 4U21A 4Z0IA 5TPAB 1LAHE 3TZAA 1EZPA 1ZLQA 3IO6A 2O6AA 3FJ7A 4DXUA 3FVKA 3OOAA 4R75A 4KCDA 1HSJA 3Q28A 5CRYA 3GBBA 4IO2A 4KR5A 3OENA 3T66A 2QS3A 5H8FB 1MS7A 1P99A 2Q8JA 4NTLA 4FATA 4U1ZA 1LFIA 3FVOA 3R6UA 2Z8DA 2Y84A 4JWYA 3MZ1A 2OZZA 3FUZA 3GXAA 1MY2A 3W9VA 3C34A 1IIWA 3OXNA 4YZZA 3A09A 1MQDA 2H5YA 3RUMA 4F1YA 5DVFA 4GL0A 3MP1A 4NMYA 3N6TA 3VLUA 3SEVA 4FE8A 3TTNA 1L5TA 1B5HA 4ZEFA 4N13A 2CMOA 4R2FA 1P1WA 1N3WA 4G68B 3MBPA 4H65A 4FEBA 1FTLA 4WEDA 4KD5A 3CVGA 1H76A 3EN3A 3CSBA 1M5BA 3KG2A 2QS1A 4R9GA 1JW4A 3TODA 3L6HA 1FW0A 1LFGA 2Y7WA 5FHMA 2OWTA 3LBSA 4F3SA 3PPOA 1CE2A 2F34A 1GV8A 4KYEA 3SEWA 2UXAA 3E13X 3IOVA 3TAJA 3H03A 3VVFA 4FIMA 4LZ5A 4ZE9A 3CG1A 2CZLA 1AIVA 3VFJA 3OEKA 3SETA 1VFEA 2AIXA 4OQOA 2XXUA 2GHBA 3EPEA 3SEYA 4HW8A 3N94A 3RTFB 5I57B 1SD3A 1B1HA 2R6GE 5KCJB 4NF6B 3UIFA 2F36A 5F7VA 3EQ1A 4R6KA 1VE4A 5TU0A 2QS4A 5TPAA 2B65A 1Z7ME 4QFNA 3V8XB 4H0WA 2X7PA 4FECA 3TUSA 1MXYA 3W15C 1Y1MA 1DOTA 4NF8B 1UQWA 3MVWA 3VDFA 2HCAA 4JWOA 1BLFA 2Q2AA 5H8FA 4Z7EA 3B6QA 5JTYA 4ZZEA 3FXUA 4Q5TA 1MDQA 4TLLB 3T96B 1US4A 1AMFA 3U93A 2KLFA 4JBZA 3V89B 3VXCA 1RKMA 3UGWA 3HCQA 5DEXA 4R9FA 2VGQA 1URSA 1B0HA 3PUZE 1GVCA 3MC2A 4EF1A 4I8CA 1O64A 4ZS9A 3G3IA 4G68A 3UA8A 3B6TA 5I59B 4OERA 3IOUA 1TFAA 5CMKA 2OK2A 4ZE8A 1Y3NA 3G3GA 1SI0A 2DWAA 4OXVA 1JQFA 5HPQA 3UN6A 5L9SA 4KPTA 2DYXA 3IJOB 4MLVA 1OVBA 3HN0A 4R72A 4YICA 1JEVA 3USDA 4G68C 4IO3A 2XD3A 3S9LC 2X7QA 1FTKA 1TXFA 3H4ZA 3HHGA 2XXXA 3TQWA 2P2AA 1JW5A 3IB1A 3TYHA 2F7CA 4XXUA 2P1SA 1MPDA 4L17A 4GRKA 4E0WA 2DXYA 4X48A 3PMXA 1DTGA 4KCCA 4QSDA 5I58A 1JVYA 2B3FA 2DE2A 3MJNA 2Z22A 5DVJA 2OLBA 3RT8A 2RCBA 1OLAA 5KCJA 2X26A 1LAFE 1MXUA 1VR5A 3D4CA 3IOWA 2PYYA 4WXJA 3C33A 1QJMA 3C35A 1US5A 4THIA 2V3UA 2XXRA 3IOTA 3OSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEL B;  3K6U A;  1CB6 A;  2BJJ X;  1UTH A;  4F1V A;  2DOJ A;  4YU0 A;  1B6H A;  4U4X A;  2DS9 A;  5K2Y A;  1PDA A;  4NF8 A;  3TEP A;  2F6G A;  4QF9 A;  1NFT A;  1QUJ A;  4KYD A;  3G3J A;  1KWH A;  4QHQ A;  1OLC A;  2O7I A;  3IB0 A;  1A55 A;  1DPE A;  1Y1Z A;  1LGB C;  2F5X A;  1BIY A;  1NNF A;  2UVH A;  4LVQ A;  2UYF A;  3QXM A;  1SW2 A;  4TOZ A;  4N6P A;  1B7U A;  3VVE A;  2ZMB A;  2H4I A;  3VLV A;  3KBR A;  1DMB A;  4U22 A;  3ZKK A;  4GFR A;  1LLS A;  1PB8 A;  1EU8 A;  4PFY A;  3DLN A;  2ZXT A;  4QFO A;  3G3H A;  4PP0 A;  5CMM A;  1N76 A;  4GWO A;  5CMC A;  5EYF A;  3C32 A;  3FAS A;  3S9E A;  2GRV A;  3PUV E;  5I59 A;  3C36 A;  5EHM A;  4H8J A;  3PUY E;  4PFT A;  3TTR A;  4K3F A;  1FTJ A;  2WKY A;  4YMB A;  5ICT A;  2Q89 A;  2NOO A;  3MPK A;  1ANF A;  3OO6 A;  2GH9 A;  4U1O A;  3KGC A;  4F2Q A;  2I48 A;  4QFL A;  1VSO A;  3ZSF A;  4EUO A;  4Q30 B;  1FQC A;  2I3V A;  1GGG A;  1EZO A;  4BLA A;  2G93 A;  5FHN A;  5I84 A;  3KSJ A;  4IY6 A;  2F7A A;  2D3I A;  2VOZ A;  5H8H B;  3SDF A;  2ZNT A;  2G29 A;  4H5F A;  4BDR A;  4ONY A;  4F31 B;  1B3H A;  1WVJ A;  1USY E;  4I9D A;  4X9T A;  4YKK A;  1B32 A;  3CIJ A;  2VD2 A;  2REG A;  3N6U A;  4ESX A;  1RYX A;  3ILT B;  5CBS A;  2Y7R A;  1N7X A;  5CI5 A;  2I49 A;  4DLD A;  2P0S A;  1FCK A;  2F8D A;  1NH7 A;  1BP5 A;  1MXZ A;  5BUU A;  3EHS A;  1GTK A;  1N3X A;  4NF5 B;  1P1N A;  3CSG A;  2OBG A;  3FAT A;  3M8U A;  1GR2 A;  4OFO A;  2ZYN A;  1SW5 A;  1PBQ A;  3IAZ A;  2RF1 A;  5J1D A;  4GF8 A;  1ATG A;  1M5C A;  4X1D A;  3THI A;  3TTK A;  4EDP A;  2ZNS A;  1NH8 A;  2PT1 A;  3MQ9 A;  4YB5 A;  3TDJ A;  4WEP A;  4GXA A;  4OET A;  4I1D A;  1PBP A;  4R6Y A;  2HZK A;  4ELR A;  3C31 A;  1FTO A;  2XD2 A;  2F97 A;  4ELP A;  1OMP A;  2THI A;  2REJ A;  4OMB A;  5JTY B;  2V3T A;  3KZG A;  3Q26 A;  2QMX A;  3P7I A;  4HTG A;  3K1P A;  1DTZ A;  3QUF A;  5JEI A;  3CFZ A;  2RKM A;  3N26 A;  3B7D A;  2HAV A;  1D4N A;  2HFB A;  3AXF A;  3RY3 A;  5DEX B;  5FHO A;  1Y3Q A;  4EQ9 A;  3OO8 A;  4TLM B;  4F18 A;  3MZ9 A;  2XXV A;  4OES A;  3DP4 A;  1POY 1;  1QVS A;  3BKI B;  3PV0 E;  5IKB A;  2QPQ A;  4P0I A;  2IEE A;  1B40 A;  2XXW A;  4E0X A;  3E9X A;  1B52 A;  4AB6 A;  4ZZA A;  3MAM A;  4XKP A;  1QW0 A;  1SBP A;  5AA2 A;  2PBW A;  3IR1 A;  4MFI A;  2V3Q A;  3U92 A;  3L6G A;  2ZYK A;  2NWJ A;  1MRP A;  1N84 A;  1N7W A;  1I69 A;  4RY1 A;  1P1O A;  1IUD A;  2DE4 A;  3F11 A;  3QUJ A;  3LSW A;  4YKI A;  3IK6 B;  2UVG A;  5H8H A;  3VVD A;  1J1N A;  3T9V A;  3MVY A;  3O6G A;  4F19 A;  5K2X A;  4LQ5 A;  3SER A;  3OEM A;  5I58 B;  1I6A A;  1UIU A;  1H3D A;  4BDL A;  3G3F A;  4KI0 E;  4P0G A;  1SDX A;  3KSX A;  2I4C A;  4IGR A;  1MQJ A;  3QK6 A;  4GIZ A;  1IXH A;  1MXX A;  3SEU A;  4NF5 A;  4OEV A;  1PC3 A;  1IEJ A;  2DXR A;  1O7T A;  1B3L A;  5F1Q A;  1B3F A;  4IGT A;  3TTM A;  2H98 A;  5JK4 A;  4IB2 A;  1IXI A;  4GL8 A;  2GFE A;  1OVT A;  1O63 A;  3B6W A;  2QRY A;  4UAC A;  1HSL A;  1MY3 A;  4KFQ A;  2UVJ A;  1LB8 A;  1UTH B;  3MPL A;  1ELJ A;  4ZEK A;  4IO5 A;  1JNF A;  1A8E A;  1R6Z A;  1XOC A;  3JZJ A;  4DE8 A;  1LST A;  4ZEC A;  1TFD A;  4O3C A;  2VHA A;  5HBC A;  2O69 A;  1XVY A;  2E1S A;  1H44 A;  3KN3 A;  5A5X A;  4GOT A;  1JEU A;  1B1X A;  4PET A;  2HQ0 A;  3H6T A;  5EHS A;  2XXH A;  5H8N B;  1DSN A;  4JWX A;  1Z7N E;  5LOM A;  3UK4 A;  1BTJ A;  2V93 A;  3HST A;  3KOT A;  1MH4 A;  3VE1 B;  4AQ4 A;  2HXW A;  1MXV A;  3KEI A;  1B3E A;  3T9H B;  1B4H A;  2H9B A;  4RPN A;  1MQG A;  3TPA A;  1HSE A;  2ZNU A;  3H6U A;  2I6E A;  4EXK A;  4YB6 A;  2FA7 A;  3FJG A;  2ZYO A;  4C1T A;  3ODB A;  4NED A;  3E3K A;  4YKP A;  1A40 A;  2QS2 A;  1B5I A;  3Q27 A;  1YCJ A;  1WDN A;  5CBR A;  2M8C A;  1MPC A;  1PEB A;  2Z8F A;  4F3G A;  2AL5 A;  4OVJ A;  3MWB A;  1FTM A;  1ZMG A;  4DXB A;  1MDP 1;  3H06 B;  3V83 A;  1FQD A;  3MVX A;  4ND9 A;  2YPN A;  3LSL A;  1MG1 A;  1PB9 A;  4DIG A;  1JW1 A;  3OMB A;  2RC9 A;  2HZL A;  3O28 A;  1FQF A;  2Z23 A;  4NF4 A;  2XX8 A;  1MY4 A;  1N0T A;  2HAU A;  3U8Q A;  2UVI A;  2W7Y A;  3EHU A;  1WOD A;  3S9M C;  4OZ9 A;  4PFU A;  1D9Y A;  1S7Y A;  1LBC A;  1ZTY A;  2V25 A;  4ZEI A;  1II5 A;  3O29 A;  4R73 A;  2DQV A;  1XHY A;  2A5T A;  2AYS A;  4RA1 A;  1Y4C A;  4GD5 A;  1SYI A;  3DM0 A;  3FVN A;  4IO4 A;  5CMB A;  4HCY A;  5AA4 B;  2Y7P A;  4ELO A;  5B7D A;  3MP6 A;  1MH3 A;  3RNN A;  2ONS A;  1NNK A;  2YJP A;  5IAI A;  3MVZ A;  2QL3 A;  4G2Z A;  5DTB A;  4ZDM A;  3SKP A;  3OEL A;  1N04 A;  2ANJ A;  3FXQ A;  1SYH A;  1F9B A;  3H6V A;  5H8N A;  5M2V A;  4RK2 A;  4OHN A;  2OWS A;  4RNS A;  3FZV A;  3HV1 A;  4AB5 A;  3RQT A;  3DP8 A;  1FQE A;  3SEX A;  3K02 A;  5AA3 A;  2F78 A;  1MY1 A;  1IXG A;  3UP9 A;  4XIG Q;  1SW4 A;  5AE4 A;  3ILU B;  3BFT A;  4QSC A;  4POX A;  1Y4T A;  1A7L A;  2D21 A;  5CM6 A;  1LB9 A;  4QFP A;  2R9J A;  1MXW A;  4LON B;  3CFX A;  1R9Q A;  1M5F A;  1NKX A;  1IXC A;  2XXT A;  5I2K B;  5FTI A;  5AA2 D;  1B05 A;  2Q9T A;  5AA2 B;  5H8Q B;  4H6D A;  3CFL A;  3RLF E;  2DWI A;  3KJT A;  2IA4 A;  4QFK A;  2VD3 A;  2O1M A;  3TFL A;  2I0C A;  4JDF A;  3IX1 A;  4OFJ A;  1BKA A;  3TQL A;  3V5A A;  3LR1 A;  1NNT A;  4EF2 A;  3HO7 A;  3PD8 A;  1MY0 A;  4FJP A;  3TKD A;  1UTB B;  3FIR A;  4LZ8 A;  4DCX A;  1EH3 A;  3R26 A;  4DCY A;  1URG A;  3H6W A;  3T9U A;  4FAJ A;  3IL1 B;  4O3A A;  1SQY A;  2I0B A;  1RYO A;  3QAX A;  5DT6 A;  4DDD A;  2FYI A;  4GXS B;  3OO9 A;  3UOR A;  3VXB A;  4Q8R A;  1LFH A;  4EXL A;  1EZ9 A;  2QSX A;  3O6H A;  1MM6 A;  5AA4 A;  5B70 A;  3I5O A;  4ESW A;  1ZIU A;  4GLI A;  2YLN A;  4LZ7 A;  3QSL A;  1AL3 A;  2O68 A;  5A5X B;  4NWD A;  3RGY A;  1SW1 A;  2PVU A;  2XX7 A;  3PMV A;  2RIN A;  1USY H;  4YAH X;  4H5G A;  4F22 A;  2OCU A;  4MH5 A;  3O97 A;  3BBR A;  1PB7 A;  1LBB A;  1P1Q A;  2DVC A;  4I62 A;  4KHZ E;  3BFU A;  3WAE A;  4DZ1 A;  5I56 B;  4LQ2 A;  1IIT A;  3C9H A;  1Q35 A;  4R6H A;  2B3B A;  1B9J A;  2R71 A;  4POW A;  1MPB A;  4FED A;  3OSQ A;  1MQI A;  5ISU A;  4O3B A;  1MM7 A;  2HEU A;  3K00 A;  3KOS A;  2Y7I A;  3KJ7 A;  4OEU A;  3U94 A;  1I6B A;  3TEL A;  4M1V A;  5DVI A;  3K01 A;  1MQH A;  4IY5 A;  1QUL A;  5L8D A;  3FVG A;  2RCA A;  5I2K A;  4N07 A;  4OYV A;  3DP6 A;  1SVX B;  4OWD A;  3K6W A;  3MW0 A;  5H8Q A;  2V84 A;  3HPI A;  4JSO A;  3EF7 A;  4XKQ A;  4XKN A;  3W9W A;  4KYS A;  1S9T A;  1B7H A;  4ISU A;  3WAF A;  3O66 A;  2Q2C A;  1YTV A;  1B46 A;  3PD9 A;  1NNP A;  4ELQ A;  5AA1 A;  3TCF A;  2PMS A;  3S4U A;  4NF4 B;  3K0V A;  2Z8E A;  4F39 A;  4PE5 B;  5DYH A;  3K1N A;  1UTB A;  3O2A A;  3T22 A;  3JV9 A;  1FQB A;  4XTC Q;  1LCF A;  2QJE A;  1XT8 A;  4QRZ A;  3LSF B;  4OEN A;  4UA8 A;  3OD7 A;  4OTE A;  2A5T B;  2O1L A;  4DXC A;  3TCG A;  1R9L A;  4EQ7 A;  2F6P A;  2E0S A;  3PPR A;  2A5S A;  4BDQ A;  4Q0C A;  1QKB A;  4LUB A;  5TP9 A;  1XS5 A;  4NWC A;  1B51 A;  1IZ1 A;  2DP8 A;  5ICQ A;  3KFM A;  5FTH A;  3FV1 A;  2FNC A;  4MBP A;  4RJZ A;  2F7B A;  3MP8 A;  4F2O A;  1LAG E;  2Y7K A;  2DSF A;  1M5D A;  3CRB A;  1QKA A;  3Q29 A;  3ECR A;  2ZYM A;  4R2B A;  2D5W A;  2H25 A;  4GQO A;  1XVX A;  2ABH A;  4X1B A;  3ZKL A;  1ZBM A;  3ONM A;  1YAE A;  3CG3 A;  1TT1 A;  1B5J A;  5L9M A;  5BWJ A;  5I56 A;  1S50 A;  3A3U A;  3A3C A;  4H67 A;  5ELV A;  4BDN A;  3QIM A;  1DPP A;  1H45 A;  4RPO A;  3IB2 A;  1P1U A;  3U72 A;  3JYR A;  1NMU A;  2I58 A;  3FJM A;  1IQ7 A;  4F29 A;  2PT2 A;  2H99 A;  1JET A;  1ZU0 A;  1T0K A;  4F3P A;  3O9P A;  3HHF A;  3IO4 A;  3MZB A;  1ZJL A;  5KZT A;  4TQU Q;  3ZS6 A;  2ONK E;  2XXQ A;  3SES A;  4HS7 A;  1URD A;  4RXL A;  3LC8 A;  1I6Q A;  5I2N B;  4U23 A;  5ITO A;  3PUW E;  3R7X A;  3TMG A;  1A8F A;  2RC7 A;  1D3K A;  4G8H A;  1QUI A;  2NVU B;  5CC2 A;  3I3V A;  1R1N A;  3TTL A;  1QUK A;  3M3F A;  2I3W A;  5KDT B;  3E4R A;  3VLW A;  3T9X B;  1B3G A;  3IOR A;  4C0R A;  3CI8 A;  3U1O A;  4IO6 A;  5I57 A;  4NE4 A;  2Q88 A;  2OJT A;  4NF6 A;  1B2H A;  4F3B A;  3LUY A;  4G4P A;  1LAX A;  4HCW A;  4M4G A;  2VP1 A;  2XXP A;  3H3G A;  3RTW B;  1OIB A;  4XKR A;  3VV5 A;  4PFW A;  4C1U A;  3PGF A;  1YPN A;  4G8M A;  3KN7 A;  4RYA A;  3PPQ A;  5HM4 B;  3EHT A;  2GHA A;  2LAO A;  2UYE A;  2F35 A;  2RC8 A;  3RN8 A;  3KN8 A;  3GBA A;  4LA9 A;  4MF3 A;  1ZKB A;  2AL4 A;  3Q25 A;  4JB7 A;  4F1U A;  4H8I A;  4BDM A;  2O51 A;  4RK9 A;  2DWH A;  2I4B A;  4U4S A;  4KQP A;  1Q1K A;  4MLQ A;  1B58 A;  2NUV A;  1A54 A;  4G77 A;  3O6I A;  4H1X A;  1FQA A;  4ZEB A;  3FXR A;  4EQB A;  3T93 B;  3K4U A;  2O7U A;  3M3K A;  3FV2 A;  1D9V A;  3PPN A;  4OFL A;  5L9O A;  4JXI A;  3PUX E;  1Y20 A;  1H43 A;  4G8N A;  1AOV A;  1TWY A;  4WKM A;  3H7M A;  4BDO A;  4FOR A;  3C4M A;  2XHD A;  3OO7 A;  1NL5 A;  3G3K A;  3PPP A;  3PU5 A;  3TCH A;  1OQH A;  4LP2 B;  1Y3P A;  1XC1 A;  2XXI A;  3LSX A;  4QSE A;  4YMA A;  2XXY A;  1AH5 A;  3K1M A;  1M5E A;  1OQG A;  3S2V A;  4ZED A;  1SI1 A;  3MUQ A;  4PQJ A;  4YB7 A;  2NXO A;  2DVZ A;  3GZG A;  4P11 A;  5I2N A;  1B4Z A;  2O84 X;  4YKJ A;  1A99 A;  4GVO A;  3K2D A;  1JVX A;  1Y9U A;  2DE3 A;  2PX1 A;  2ESN A;  5H8S A;  4LAT A;  1UIV A;  5KDT A;  3GLB A;  3K6V A;  4R74 A;  3D4G A;  4IO7 A;  3FGS A;  3RPW A;  3K6X A;  1B7Z A;  1VFD A;  3RT6 B;  1POT A;  2ONR A;  3M3L A;  5TP9 B;  3G7W A;  3PMW A;  3CR9 A;  4JSD A;  3IJX B;  2ALU A;  1LCT A;  2XX9 A;  2DWJ A;  5ITP A;  3I6V A;  3S9N C;  3QYT A;  4ECF A;  4U2R A;  3FD3 A;  3N5L A;  1B0L A;  2QMW A;  4U21 A;  4Z0I A;  5TPA B;  1LAH E;  3TZA A;  1EZP A;  1ZLQ A;  3IO6 A;  2O6A A;  3FJ7 A;  4DXU A;  3FVK A;  3OOA A;  4R75 A;  4KCD A;  1HSJ A;  3Q28 A;  5CRY A;  3GBB A;  4IO2 A;  4KR5 A;  3OEN A;  3T66 A;  2QS3 A;  5H8F B;  1MS7 A;  1P99 A;  2Q8J A;  4NTL A;  4FAT A;  4U1Z A;  1LFI A;  3FVO A;  3R6U A;  2Z8D A;  2Y84 A;  4JWY A;  3MZ1 A;  2OZZ A;  3FUZ A;  3GXA A;  1MY2 A;  3W9V A;  3C34 A;  1IIW A;  3OXN A;  4YZZ A;  3A09 A;  1MQD A;  2H5Y A;  3RUM A;  4F1Y A;  5DVF A;  4GL0 A;  3MP1 A;  4NMY A;  3N6T A;  3VLU A;  3SEV A;  4FE8 A;  3TTN A;  1L5T A;  1B5H A;  4ZEF A;  4N13 A;  2CMO A;  4R2F A;  1P1W A;  1N3W A;  4G68 B;  3MBP A;  4H65 A;  4FEB A;  1FTL A;  4WED A;  4KD5 A;  3CVG A;  1H76 A;  3EN3 A;  3CSB A;  1M5B A;  3KG2 A;  2QS1 A;  4R9G A;  1JW4 A;  3TOD A;  3L6H A;  1FW0 A;  1LFG A;  2Y7W A;  5FHM A;  2OWT A;  3LBS A;  4F3S A;  3PPO A;  1CE2 A;  2F34 A;  1GV8 A;  4KYE A;  3SEW A;  2UXA A;  3E13 X;  3IOV A;  3TAJ A;  3H03 A;  3VVF A;  4FIM A;  4LZ5 A;  4ZE9 A;  3CG1 A;  2CZL A;  1AIV A;  3VFJ A;  3OEK A;  3SET A;  1VFE A;  2AIX A;  4OQO A;  2XXU A;  2GHB A;  3EPE A;  3SEY A;  4HW8 A;  3N94 A;  3RTF B;  5I57 B;  1SD3 A;  1B1H A;  2R6G E;  5KCJ B;  4NF6 B;  3UIF A;  2F36 A;  5F7V A;  3EQ1 A;  4R6K A;  1VE4 A;  5TU0 A;  2QS4 A;  5TPA A;  2B65 A;  1Z7M E;  4QFN A;  3V8X B;  4H0W A;  2X7P A;  4FEC A;  3TUS A;  1MXY A;  3W15 C;  1Y1M A;  1DOT A;  4NF8 B;  1UQW A;  3MVW A;  3VDF A;  2HCA A;  4JWO A;  1BLF A;  2Q2A A;  5H8F A;  4Z7E A;  3B6Q A;  5JTY A;  4ZZE A;  3FXU A;  4Q5T A;  1MDQ A;  4TLL B;  3T96 B;  1US4 A;  1AMF A;  3U93 A;  2KLF A;  4JBZ A;  3V89 B;  3VXC A;  1RKM A;  3UGW A;  3HCQ A;  5DEX A;  4R9F A;  2VGQ A;  1URS A;  1B0H A;  3PUZ E;  1GVC A;  3MC2 A;  4EF1 A;  4I8C A;  1O64 A;  4ZS9 A;  3G3I A;  4G68 A;  3UA8 A;  3B6T A;  5I59 B;  4OER A;  3IOU A;  1TFA A;  5CMK A;  2OK2 A;  4ZE8 A;  1Y3N A;  3G3G A;  1SI0 A;  2DWA A;  4OXV A;  1JQF A;  5HPQ A;  3UN6 A;  5L9S A;  4KPT A;  2DYX A;  3IJO B;  4MLV A;  1OVB A;  3HN0 A;  4R72 A;  4YIC A;  1JEV A;  3USD A;  4G68 C;  4IO3 A;  2XD3 A;  3S9L C;  2X7Q A;  1FTK A;  1TXF A;  3H4Z A;  3HHG A;  2XXX A;  3TQW A;  2P2A A;  1JW5 A;  3IB1 A;  3TYH A;  2F7C A;  4XXU A;  2P1S A;  1MPD A;  4L17 A;  4GRK A;  4E0W A;  2DXY A;  4X48 A;  3PMX A;  1DTG A;  4KCC A;  4QSD A;  5I58 A;  1JVY A;  2B3F A;  2DE2 A;  3MJN A;  2Z22 A;  5DVJ A;  2OLB A;  3RT8 A;  2RCB A;  1OLA A;  5KCJ A;  2X26 A;  1LAF E;  1MXU A;  1VR5 A;  3D4C A;  3IOW A;  2PYY A;  4WXJ A;  3C33 A;  1QJM A;  3C35 A;  1US5 A;  4THI A;  2V3U A;  2XXR A;  3IOT A;  3OSR A; 
#chains in the Genus database with same CATH topology
 3DEL B;  4NQ8 A;  1FSA A;  3K6U A;  1CB6 A;  2BJJ X;  1UTH A;  4F1V A;  2DOJ A;  4YU0 A;  1B6H A;  4U4X A;  2DS9 A;  5K2Y A;  1PDA A;  4NF8 A;  3TEP A;  1FBP A;  2F6G A;  4QF9 A;  1NFT A;  1QUJ A;  4KYD A;  3G3J A;  1KWH A;  4QHQ A;  1OLC A;  2O7I A;  4HE0 A;  3IB0 A;  1A55 A;  1DPE A;  1Y1Z A;  1LGB C;  2F5X A;  1BIY A;  1NNF A;  2UVH A;  4GWX A;  4LVQ A;  2UYF A;  3QXM A;  1SW2 A;  4TOZ A;  4N6P A;  1B7U A;  3VVE A;  2ZMB A;  2H4I A;  3VLV A;  3KBR A;  1DMB A;  4U22 A;  3ZKK A;  4GFR A;  1LLS A;  1PB8 A;  1EU8 A;  4PFY A;  3DLN A;  2ZXT A;  4QFO A;  3G3H A;  4PP0 A;  5CMM A;  1N76 A;  1FPD A;  1LBX A;  4GWO A;  5CMC A;  5EYF A;  3C32 A;  3FAS A;  3S9E A;  2GRV A;  3PUV E;  5I59 A;  3C36 A;  5EHM A;  4H8J A;  5FBP A;  3PUY E;  4PFT A;  3TTR A;  4K3F A;  1FTJ A;  2WKY A;  4YMB A;  5ICT A;  2Q89 A;  2NOO A;  3MPK A;  1ANF A;  3OO6 A;  4MCO A;  2GH9 A;  4U1O A;  3KGC A;  4F2Q A;  4P47 A;  2I48 A;  5IM2 A;  4QFL A;  1VSO A;  3ZSF A;  1LBV A;  4EUO A;  4Q30 B;  1FQC A;  1XI6 A;  2I3V A;  1GGG A;  3B50 A;  1EZO A;  3HFU A;  4BLA A;  2G93 A;  5FHN A;  5I84 A;  3KSJ A;  3A29 A;  4IY6 A;  2F7A A;  2D3I A;  2VOZ A;  1FBE A;  5H8H B;  3SDF A;  2ZNT A;  4PDH A;  2G29 A;  4H5F A;  4BDR A;  4ONY A;  4F31 B;  1B3H A;  1WVJ A;  2L5V A;  1USY E;  4I9D A;  4X9T A;  4YKK A;  1B32 A;  3CIJ A;  2VD2 A;  2REG A;  4OAN A;  3N6U A;  4ESX A;  1RYX A;  3ILT B;  5CBS A;  2Y7R A;  1N7X A;  5CI5 A;  2I49 A;  4DLD A;  2P0S A;  1FCK A;  2F8D A;  1NH7 A;  4PFR A;  1BP5 A;  1MXZ A;  5BUU A;  3EHS A;  1GTK A;  1N3X A;  2OWZ A;  4NF5 B;  1P1N A;  3CSG A;  2OBG A;  3FAT A;  3M8U A;  1GR2 A;  4OFO A;  2ZYN A;  1SW5 A;  1PBQ A;  3IAZ A;  2RF1 A;  5J1D A;  4GF8 A;  1ATG A;  1M5C A;  4X1D A;  3THI A;  1LBW A;  3TTK A;  4EDP A;  2ZNS A;  1NH8 A;  2PT1 A;  3MQ9 A;  4YB5 A;  2ZZW A;  3TDJ A;  4WEP A;  1NUZ A;  1NV1 A;  4GXA A;  4OET A;  4I1D A;  1PBP A;  4R6Y A;  2HZK A;  4ELR A;  3C31 A;  2Y5K A;  1FTO A;  2XD2 A;  2F97 A;  4ELP A;  3D1R A;  1OMP A;  2VPN A;  2THI A;  2REJ A;  4OMB A;  5JTY B;  2V3T A;  3KZG A;  3Q26 A;  2QMX A;  3P7I A;  4HTG A;  3K1P A;  1DTZ A;  3QUF A;  5JEI A;  4NG7 A;  3CFZ A;  2RKM A;  2ZZX A;  3N26 A;  3B7D A;  2HAV A;  1D4N A;  2HFB A;  1NV0 A;  3AXF A;  3RY3 A;  5DEX B;  5FHO A;  1Y3Q A;  4EQ9 A;  5T3J A;  3OO8 A;  4TLM B;  4F18 A;  3MZ9 A;  2F3B A;  2XXV A;  4JVD A;  2CZH A;  4OES A;  3DP4 A;  1POY 1;  3ISP A;  1QVS A;  3BKI B;  3IFC A;  3PV0 E;  5IKB A;  2QPQ A;  4P0I A;  2IEE A;  1B40 A;  2XXW A;  4E0X A;  3E9X A;  1K9Z A;  1B52 A;  4XF5 A;  4AB6 A;  4ZZA A;  3MAM A;  4PC9 A;  4XKP A;  1QW0 A;  1SBP A;  4QXD A;  5AA2 A;  2PBW A;  3IR1 A;  4MFI A;  1FPL A;  2V3Q A;  4NGU A;  4UAB A;  3U92 A;  3L6G A;  4MAG A;  2ZYK A;  2NWJ A;  1MRP A;  2FBP A;  1N84 A;  1N7W A;  1I69 A;  4RY1 A;  1P1O A;  1IUD A;  2DE4 A;  1INP A;  3PTY A;  3F11 A;  3QUJ A;  3LSW A;  4YKI A;  3IK6 B;  2UVG A;  5H8H A;  3VVD A;  1J1N A;  3T9V A;  1FPB A;  1RDY A;  3MVY A;  4MMP A;  2HXR A;  3U65 A;  3O6G A;  4F19 A;  5K2X A;  4LQ5 A;  3SER A;  3OEM A;  5I58 B;  1I6A A;  1UIU A;  2WBD A;  1H3D A;  4BDL A;  4DI4 B;  3G3F A;  4KI0 E;  4P0G A;  2MKZ A;  1SDX A;  3KSX A;  4O7M A;  3NOH A;  2I4C A;  4IGR A;  1MQJ A;  3QK6 A;  1IMC A;  4GIZ A;  1IXH A;  1MXX A;  3SEU A;  1RDZ A;  4NF5 A;  4OEV A;  1PC3 A;  1IEJ A;  2DXR A;  1O7T A;  1B3L A;  5F1Q A;  1B3F A;  4IGT A;  3TTM A;  2H98 A;  5JK4 A;  4IB2 A;  1IXI A;  4GL8 A;  2GFE A;  1OVT A;  1O63 A;  4LN5 A;  3B6W A;  2BJI A;  2QRY A;  4UAC A;  1HSL A;  4FBP A;  1MY3 A;  4KFQ A;  2UVJ A;  1LB8 A;  1UTH B;  3MPL A;  1ELJ A;  4ZEK A;  4IO5 A;  1JNF A;  1A8E A;  1R6Z A;  1XOC A;  3JZJ A;  4DE8 A;  1LST A;  4ZEC A;  1TFD A;  4O3C A;  2VHA A;  5HBC A;  2O69 A;  1XVY A;  2E1S A;  1H44 A;  3KN3 A;  1G0H A;  4GOT A;  5A5X A;  4PAI A;  2XA5 A;  1JEU A;  1B1X A;  4PET A;  2HQ0 A;  3H6T A;  5EHS A;  2XXH A;  5H8N B;  1DSN A;  4PAK A;  4JWX A;  4PF6 A;  1Z7N E;  5LOM A;  3UK4 A;  1BTJ A;  2V93 A;  3HST A;  3KOT A;  1MH4 A;  3VE1 B;  4AQ4 A;  2HXW A;  1MXV A;  3KEI A;  1B3E A;  3T9H B;  1B4H A;  2H9B A;  4RPN A;  1MQG A;  3TPA A;  1HSE A;  2ZNU A;  5ET7 A;  1EYK A;  3H6U A;  2I6E A;  5ET8 A;  4EXK A;  4YB6 A;  2FA7 A;  3FJG A;  2ZYO A;  4C1T A;  3ODB A;  4NED A;  3E3K A;  4YKP A;  1A40 A;  2QS2 A;  1LEV A;  1B5I A;  3Q27 A;  1YCJ A;  4PGN A;  1WDN A;  5CBR A;  2M8C A;  1MPC A;  1PEB A;  2FHY A;  4N17 A;  2Z8F A;  4F3G A;  4XFE A;  2AL5 A;  4OVJ A;  3MWB A;  1FTM A;  1ZMG A;  4DXB A;  1MDP 1;  3H06 B;  3V83 A;  1FQD A;  3MVX A;  5LTC A;  4ND9 A;  2YPN A;  3LSL A;  1MG1 A;  1PB9 A;  4DIG A;  1JW1 A;  3OMB A;  2RC9 A;  2HZL A;  3O28 A;  1FQF A;  2Z23 A;  4NF4 A;  4N4U A;  4NAP A;  2XX8 A;  1MY4 A;  1N0T A;  3T0J A;  2HAU A;  2ZZV A;  3U8Q A;  2UVI A;  2W7Y A;  3EHU A;  1WOD A;  3S9M C;  4OZ9 A;  4PFU A;  1D9Y A;  1S7Y A;  1LBC A;  1Q9D A;  4KXP A;  1ZTY A;  2V25 A;  4ZEI A;  1II5 A;  3O29 A;  2QFL A;  4R73 A;  2DQV A;  1XHY A;  2A5T A;  2AYS A;  4NN3 A;  4RA1 A;  1Y4C A;  4GD5 A;  2QVU A;  3EKI A;  1SYI A;  3DM0 A;  3FVN A;  4IO4 A;  5CMB A;  1FJ9 A;  4HCY A;  5AA4 B;  2Y7P A;  4ELO A;  5B7D A;  4GX3 A;  4MIJ A;  3MP6 A;  4P8B A;  2DDK A;  2QVV A;  1MH3 A;  3RNN A;  2ONS A;  1NNK A;  2YJP A;  1DK4 A;  5IAI A;  3MVZ A;  4O94 A;  2QL3 A;  4PTK A;  4G2Z A;  1FBD A;  5DTB A;  4ZDM A;  3SKP A;  3OEL A;  1N04 A;  2ANJ A;  3FXQ A;  1SYH A;  1F9B A;  2P3N A;  3H6V A;  5H8N A;  4GBW A;  5M2V A;  4RK2 A;  4OHN A;  1KZ8 A;  2OWS A;  4RNS A;  3FZV A;  3HV1 A;  4AB5 A;  3RQT A;  3DP8 A;  1FRP A;  3BIG A;  1FPF A;  1FQE A;  3SEX A;  3K02 A;  5AA3 A;  3T1B A;  2F78 A;  1MY1 A;  1IXG A;  3UP9 A;  4XIG Q;  1SW4 A;  5AE4 A;  3ILU B;  3BFT A;  4GWZ A;  4QSC A;  4POX A;  4P9K A;  1Y4T A;  1A7L A;  2D21 A;  5CM6 A;  1LB9 A;  1NUW A;  4QFP A;  2R9J A;  5LDZ A;  1MXW A;  4LON B;  1FBH A;  3CFX A;  3IFA A;  1R9Q A;  1M5F A;  1NKX A;  1IXC A;  2XXT A;  5I2K B;  5FTI A;  5AA2 D;  1B05 A;  2Q9T A;  5AA2 B;  1QGX A;  5H8Q B;  4H6D A;  3CFL A;  3RLF E;  2DWI A;  3KJT A;  2IA4 A;  2P3V A;  4QFK A;  2VD3 A;  2O1M A;  3TFL A;  2I0C A;  4JDF A;  3IX1 A;  4OFJ A;  1BKA A;  3TQL A;  3V5A A;  1FBG A;  3LR1 A;  4GWU A;  1NNT A;  4EF2 A;  3HO7 A;  3PD8 A;  2XWI A;  1MY0 A;  5A5L A;  4FJP A;  3TKD A;  1UTB B;  3FIR A;  4LZ8 A;  4DCX A;  1EH3 A;  3R26 A;  4DCY A;  1URG A;  3H6W A;  5ESY A;  3T9U A;  4FAJ A;  3IL1 B;  4DI3 D;  4O3A A;  1SQY A;  2I0B A;  4MHF A;  4QBA A;  1RYO A;  3QAX A;  5DT6 A;  4DDD A;  5J16 A;  2FYI A;  4GXS B;  3OO9 A;  3UOR A;  3VXB A;  4Q8R A;  5EQ7 A;  1LFH A;  4PF8 A;  4EXL A;  3KC1 A;  1EZ9 A;  2QSX A;  3O6H A;  1MM6 A;  5AA4 A;  5B70 A;  3QMF A;  3I5O A;  4ESW A;  1ZIU A;  4GLI A;  2YLN A;  2FVZ A;  4LZ7 A;  3QSL A;  1AL3 A;  2O68 A;  2PFY A;  5A5X B;  4NWD A;  5IZZ A;  3RGY A;  1SW1 A;  2PVU A;  2XX7 A;  3PMV A;  2RIN A;  1USY H;  4YAH X;  4H5G A;  2XXK A;  4F22 A;  2CEY A;  2OCU A;  4MH5 A;  3O97 A;  3BBR A;  1PB7 A;  1LBB A;  1P1Q A;  2DVC A;  4I62 A;  4KHZ E;  4MNC A;  3BFU A;  3WAE A;  4DZ1 A;  5I56 B;  4LQ2 A;  1IIT A;  3C9H A;  1Q35 A;  2JJK A;  4R6H A;  2B3B A;  1B9J A;  2R71 A;  4POW A;  1MPB A;  4FED A;  3OSQ A;  1MQI A;  3LUZ A;  5ISU A;  4O3B A;  1MM7 A;  1FBC A;  2HEU A;  2CZK A;  3K00 A;  3KOS A;  2Y7I A;  3KJ7 A;  4OEU A;  3U94 A;  1I6B A;  3TEL A;  4M1V A;  5DVI A;  3K01 A;  1MQH A;  4IY5 A;  1QUL A;  2HPG A;  4MNP A;  5L8D A;  3FVG A;  2RCA A;  5I2K A;  4N07 A;  4OYV A;  3DP6 A;  1SVX B;  1DBZ A;  4OWD A;  3K6W A;  3MW0 A;  4PBH A;  5H8Q A;  4N8G A;  5F24 A;  1FJ6 A;  2V84 A;  4OVT A;  3HPI A;  4JSO A;  3EF7 A;  4XKQ A;  2GQ1 A;  4XKN A;  3W9W A;  4KYS A;  1S9T A;  1B7H A;  4ISU A;  3WAF A;  3O66 A;  2Q2C A;  1YTV A;  1B46 A;  3PD9 A;  1NNP A;  4ELQ A;  5AA1 A;  3TCF A;  2HHM A;  2PMS A;  3S4U A;  1YZ0 A;  4NF4 B;  3K0V A;  2Z8E A;  4F39 A;  4PE5 B;  4O8M A;  5DYH A;  3K1N A;  1UTB A;  4JVI A;  3O2A A;  3T22 A;  3JV9 A;  1FQB A;  4XTC Q;  1LCF A;  2QJE A;  4PBQ A;  1XT8 A;  4PAF A;  1FPG A;  4QRZ A;  3LSF B;  4OEN A;  4GBV A;  4UA8 A;  4O7I A;  3OD7 A;  4OTE A;  2A5T B;  2O1L A;  4N8Y A;  4DXC A;  3TCG A;  1R9L A;  4EQ7 A;  4GWW A;  2F6P A;  2E0S A;  2Q8M A;  3PPR A;  2A5S A;  4BDQ A;  4Q0C A;  1QKB A;  4LUB A;  5TP9 A;  1XS5 A;  4NWC A;  1B51 A;  1IZ1 A;  2DP8 A;  5ICQ A;  3KFM A;  5FTH A;  1IMB A;  3FV1 A;  2FNC A;  4P3L A;  4MBP A;  3E79 A;  4RJZ A;  2Y5L A;  4HE1 A;  1FPK A;  2F7B A;  3MP8 A;  4NF0 A;  4F2O A;  1LAG E;  4I3E A;  2CEX A;  2Y7K A;  2DSF A;  1M5D A;  3CRB A;  1QKA A;  3Q29 A;  3ECR A;  4OVS A;  2ZYM A;  4R2B A;  4GX6 A;  2D5W A;  2H25 A;  1NUX A;  5IZ1 A;  4GQO A;  1XVX A;  2ABH A;  5IZ3 B;  4X1B A;  3ZKL A;  1ZBM A;  3ONM A;  1YAE A;  3CG3 A;  1TT1 A;  1B5J A;  5L9M A;  5BWJ A;  5I56 A;  1S50 A;  3A3U A;  3A3C A;  4H67 A;  5ELV A;  4BDN A;  3QIM A;  1DPP A;  1H45 A;  4RPO A;  4GWY A;  3IB2 A;  1P1U A;  4MX6 A;  3U72 A;  3JYR A;  1NMU A;  2I58 A;  1KA0 A;  2OX3 A;  3FJM A;  1IQ7 A;  4F29 A;  5EQA A;  3B8B A;  2PT2 A;  1YXI A;  2H99 A;  1JET A;  1ZU0 A;  1T0K A;  4F3P A;  3O9P A;  3HHF A;  3IO4 A;  3MZB A;  1ZJL A;  5KZT A;  4AS4 A;  4TQU Q;  3ZS6 A;  4MEV A;  2ONK E;  1NV4 A;  3SZP A;  2WYP A;  2XXQ A;  4PFI A;  3SES A;  4HS7 A;  2VT5 A;  1URD A;  4RXL A;  4HE2 A;  2XWO A;  3LC8 A;  1I6Q A;  5I2N B;  4U23 A;  5ITO A;  4JVC A;  3PUW E;  3R7X A;  3TMG A;  1A8F A;  5IGA A;  3KC0 A;  2RC7 A;  5EYG A;  1D3K A;  4G8H A;  1QUI A;  2NVU B;  5CC2 A;  3I3V A;  1R1N A;  1NV3 A;  3TTL A;  1QUK A;  3RPL B;  3M3F A;  2I3W A;  5KDT B;  3E4R A;  3VLW A;  4N6D A;  3T9X B;  1B3G A;  1NI9 A;  3IOR A;  4C0R A;  3CI8 A;  3U1O A;  4PCD A;  1EYJ A;  4IO6 A;  5I57 A;  4NE4 A;  2Q88 A;  2OJT A;  4NF6 A;  1B2H A;  4F3B A;  3LUY A;  4G4P A;  1LAX A;  4HCW A;  2QVR A;  4M4G A;  2VP1 A;  2XXP A;  5I5P A;  3H3G A;  3RTW B;  1OIB A;  2PCR A;  4XKR A;  3VV5 A;  4PFW A;  3RYD A;  4C1U A;  1FPE A;  3PGF A;  1YPN A;  4G8M A;  3KN7 A;  4X04 A;  4RYA A;  3PPQ A;  5HM4 B;  3EHT A;  2GHA A;  2LAO A;  2UYE A;  2F35 A;  2RC8 A;  3RN8 A;  3KN8 A;  3GBA A;  4LA9 A;  4MF3 A;  1ZKB A;  2AL4 A;  3Q25 A;  4JB7 A;  4F1U A;  4H8I A;  4BDM A;  2O51 A;  4RK9 A;  2DWH A;  5IZ3 A;  3E78 A;  2I4B A;  4U4S A;  4KQP A;  1Q1K A;  4MLQ A;  1B58 A;  2NUV A;  1A54 A;  3MYU A;  3FXB A;  4G77 A;  3O6I A;  4H1X A;  1FQA A;  4ZEB A;  3FXR A;  4EQB A;  3T93 B;  3K4U A;  2O7U A;  3M3K A;  3FV2 A;  1D9V A;  1KA1 A;  3PPN A;  4OFL A;  5L9O A;  4JXI A;  3PUX E;  1Y20 A;  1IMD A;  1H43 A;  1FBF A;  4G8N A;  1AOV A;  1TWY A;  4WKM A;  3H7M A;  4BDO A;  4FOR A;  3C4M A;  4MJO A;  2XHD A;  3OO7 A;  1NL5 A;  3G3K A;  3PPP A;  3PU5 A;  3TCH A;  2R8T A;  3ROJ A;  1OQH A;  4LP2 B;  4N81 A;  1Y3P A;  1XC1 A;  2XXI A;  3LSX A;  4PDD A;  2V4C A;  4QSE A;  4YMA A;  2XXY A;  1AH5 A;  3K1M A;  1FPI A;  1M5E A;  1OQG A;  1D9Q A;  2F3D A;  3S2V A;  4ZED A;  4N6K A;  1SI1 A;  3MUQ A;  4PQJ A;  1JP4 A;  4YB7 A;  2NXO A;  2DVZ A;  3GZG A;  4P11 A;  5I2N A;  1B4Z A;  2O84 X;  4IR8 A;  4YKJ A;  1A99 A;  3LV0 A;  4OA4 A;  4GVO A;  3K2D A;  1JVX A;  3RPL A;  1Y9U A;  2DE3 A;  2PX1 A;  2ESN A;  4LAT A;  1UIV A;  5H8S A;  5KDT A;  3GLB A;  3K6V A;  4R74 A;  3D4G A;  1NV7 A;  4IO7 A;  3FGS A;  3RPW A;  3K6X A;  1B7Z A;  1VFD A;  3RT6 B;  1POT A;  2WBB A;  2ONR A;  3M3L A;  5TP9 B;  3G7W A;  3PMW A;  3CR9 A;  4JSD A;  3IJX B;  2ALU A;  1LCT A;  2XX9 A;  2DWJ A;  5ITP A;  3I6V A;  3S9N C;  3QYT A;  4ECF A;  4U2R A;  3FD3 A;  3N5L A;  1B0L A;  2QMW A;  4U21 A;  4Z0I A;  2VPO A;  5TPA B;  1LAH E;  4OVR A;  4MNI A;  5I3S A;  5ET6 A;  3TZA A;  1EZP A;  1ZLQ A;  3IO6 A;  2O6A A;  3FJ7 A;  4GX4 A;  2WX9 A;  1VDW A;  4DXU A;  4OVP A;  3FVK A;  3OOA A;  4R75 A;  4KCD A;  1HSJ A;  3Q28 A;  5CRY A;  3GBB A;  4IO2 A;  4KR5 A;  3OEN A;  4P56 A;  1K9Y A;  4N91 A;  3T66 A;  2QS3 A;  5H8F B;  1MS7 A;  1P99 A;  2Q8J A;  3MST A;  4NTL A;  4FAT A;  4U1Z A;  1LFI A;  3FVO A;  3R6U A;  2Z8D A;  2Y84 A;  4JWY A;  3MZ1 A;  2OZZ A;  3FUZ A;  3GXA A;  1MY2 A;  3W9V A;  2FIX A;  3C34 A;  1IIW A;  3OXN A;  4YZZ A;  3A09 A;  1MQD A;  2H5Y A;  3RUM A;  4F1Y A;  5DVF A;  4GL0 A;  3MP1 A;  4NMY A;  3N6T A;  3VLU A;  3SEV A;  4FE8 A;  3TTN A;  1L5T A;  1B5H A;  4ZEF A;  4N13 A;  2CMO A;  4I3Y A;  4R2F A;  1P1W A;  1N3W A;  4G68 B;  3MBP A;  3FBP A;  2WEF A;  4H65 A;  4FEB A;  1FTL A;  4WED A;  4KD5 A;  3CVG A;  1H76 A;  3EN3 A;  1NV6 A;  3CSB A;  1M5B A;  3KG2 A;  2QS1 A;  4R9G A;  1LBY A;  1JW4 A;  3TOD A;  4PE3 A;  1DCU A;  4X8R A;  3L6H A;  1FW0 A;  3CHG A;  2B4L A;  1LFG A;  2Y7W A;  4H45 A;  4G61 A;  5FHM A;  2OWT A;  3LBS A;  4F3S A;  3PPO A;  2B4M A;  1IMA A;  1CE2 A;  2F34 A;  1NV2 A;  5EQ8 A;  1GV8 A;  4KYE A;  3SEW A;  2UXA A;  3E13 X;  3IOV A;  3TAJ A;  3H03 A;  2XWV A;  3VVF A;  4FIM A;  4LZ5 A;  4ZE9 A;  3CG1 A;  2CZL A;  1AIV A;  1G0I A;  3VFJ A;  2FIE A;  1IME A;  3OEK A;  5DW8 A;  3SET A;  1VFE A;  4N15 A;  2AIX A;  4OQO A;  5ET5 A;  2XXU A;  2GHB A;  3EPE A;  1EYI A;  4GWS A;  3SEY A;  4HW8 A;  3N94 A;  3RTF B;  2XWK A;  5I57 B;  1SD3 A;  1B1H A;  1BK4 A;  2R6G E;  5KCJ B;  4NF6 B;  3UIF A;  2F36 A;  5F7V A;  3EQ1 A;  4R6K A;  1VE4 A;  5TU0 A;  2QS4 A;  5EYH A;  5TPA A;  2B65 A;  2KQZ A;  1Z7M E;  4QFN A;  1IMF A;  4H46 A;  3V8X B;  4H0W A;  2X7P A;  4FEC A;  3TUS A;  1MXY A;  3W15 C;  3KBZ A;  1Y1M A;  1DOT A;  1FPJ A;  4NF8 B;  1UQW A;  4HXV A;  3MVW A;  3VDF A;  2HCA A;  2CZI A;  4JWO A;  1BLF A;  2Q2A A;  5H8F A;  4I40 A;  4Z7E A;  3B6Q A;  5JTY A;  4ZZE A;  3FXU A;  4Q5T A;  1MDQ A;  4TLL B;  3T96 B;  1US4 A;  1AMF A;  3U93 A;  2KLF A;  4JBZ A;  3V89 B;  4OVQ A;  4P1L A;  3VXC A;  1RKM A;  4NX1 A;  3UGW A;  3HCQ A;  5DEX A;  4R9F A;  2VGQ A;  1URS A;  1B0H A;  3PUZ E;  1GVC A;  1CNQ A;  3MC2 A;  1SPI A;  4EF1 A;  4I8C A;  1FTA A;  1O64 A;  4ZS9 A;  3G3I A;  4G68 A;  3UA8 A;  3B6T A;  5I59 B;  4OER A;  3IOU A;  1TFA A;  5CMK A;  1RDX A;  2OK2 A;  5EQ9 A;  4ZE8 A;  1Y3N A;  5I7I A;  2Q74 A;  3G3G A;  1SI0 A;  2DWA A;  4OXV A;  1AWB A;  1NV5 A;  1JQF A;  5HPQ A;  1YYZ A;  3UN6 A;  5L9S A;  4KPT A;  2DYX A;  3IJO B;  4MLV A;  1OVB A;  4PGP A;  3HN0 A;  4R72 A;  4YIC A;  1JEV A;  3USD A;  4G68 C;  4IO3 A;  3BIH A;  2XD3 A;  3S9L C;  2X7Q A;  1FTK A;  1TXF A;  3H4Z A;  3HHG A;  4NHB A;  1LBZ A;  4PFB A;  2PFZ A;  2XXX A;  3TQW A;  2P2A A;  1JW5 A;  3IB1 A;  3TYH A;  2F7C A;  4XXU A;  2P1S A;  1MPD A;  4L17 A;  4GRK A;  4E0W A;  2WYK A;  2DXY A;  4P1E A;  4X48 A;  3PMX A;  1DTG A;  4AS5 A;  4KCC A;  4QSD A;  5I58 A;  1JVY A;  2B3F A;  2DE2 A;  3GYY A;  3MJN A;  2Z22 A;  5DVJ A;  1NUY A;  2OLB A;  3RT8 A;  2RCB A;  1OLA A;  5KCJ A;  2X26 A;  1LAF E;  1MXU A;  1VR5 A;  3D4C A;  3IOW A;  2PYY A;  2KR0 A;  4WXJ A;  3C33 A;  1QJM A;  3C35 A;  1US5 A;  4THI A;  2V3U A;  2XXR A;  3IOT A;  3OSR A;  4XEQ A; 
#chains in the Genus database with same CATH homology
 3DEL B;  3K6U A;  1CB6 A;  2BJJ X;  1UTH A;  4F1V A;  2DOJ A;  4YU0 A;  1B6H A;  4U4X A;  2DS9 A;  5K2Y A;  1PDA A;  4NF8 A;  3TEP A;  2F6G A;  4QF9 A;  1NFT A;  1QUJ A;  4KYD A;  3G3J A;  1KWH A;  4QHQ A;  1OLC A;  2O7I A;  3IB0 A;  1A55 A;  1DPE A;  1Y1Z A;  1LGB C;  2F5X A;  1BIY A;  1NNF A;  2UVH A;  4LVQ A;  2UYF A;  3QXM A;  1SW2 A;  4TOZ A;  4N6P A;  1B7U A;  3VVE A;  2ZMB A;  2H4I A;  3VLV A;  3KBR A;  1DMB A;  4U22 A;  3ZKK A;  4GFR A;  1LLS A;  1PB8 A;  1EU8 A;  4PFY A;  3DLN A;  2ZXT A;  4QFO A;  3G3H A;  4PP0 A;  5CMM A;  1N76 A;  4GWO A;  5CMC A;  5EYF A;  3C32 A;  3FAS A;  3S9E A;  2GRV A;  3PUV E;  5I59 A;  3C36 A;  5EHM A;  4H8J A;  3PUY E;  4PFT A;  3TTR A;  4K3F A;  1FTJ A;  2WKY A;  4YMB A;  5ICT A;  2Q89 A;  2NOO A;  3MPK A;  1ANF A;  3OO6 A;  2GH9 A;  4U1O A;  3KGC A;  4F2Q A;  2I48 A;  4QFL A;  1VSO A;  3ZSF A;  4EUO A;  4Q30 B;  1FQC A;  2I3V A;  1GGG A;  1EZO A;  4BLA A;  2G93 A;  5FHN A;  5I84 A;  3KSJ A;  4IY6 A;  2F7A A;  2D3I A;  2VOZ A;  5H8H B;  3SDF A;  2ZNT A;  2G29 A;  4H5F A;  4BDR A;  4ONY A;  4F31 B;  1B3H A;  1WVJ A;  1USY E;  4I9D A;  4X9T A;  4YKK A;  1B32 A;  3CIJ A;  2VD2 A;  2REG A;  3N6U A;  4ESX A;  1RYX A;  3ILT B;  5CBS A;  2Y7R A;  1N7X A;  5CI5 A;  2I49 A;  4DLD A;  2P0S A;  1FCK A;  2F8D A;  1NH7 A;  1BP5 A;  1MXZ A;  5BUU A;  3EHS A;  1GTK A;  1N3X A;  4NF5 B;  1P1N A;  3CSG A;  2OBG A;  3FAT A;  3M8U A;  1GR2 A;  4OFO A;  2ZYN A;  1SW5 A;  1PBQ A;  3IAZ A;  2RF1 A;  5J1D A;  4GF8 A;  1ATG A;  1M5C A;  4X1D A;  3THI A;  3TTK A;  4EDP A;  2ZNS A;  1NH8 A;  2PT1 A;  3MQ9 A;  4YB5 A;  3TDJ A;  4WEP A;  4GXA A;  4OET A;  4I1D A;  1PBP A;  4R6Y A;  2HZK A;  4ELR A;  3C31 A;  1FTO A;  2XD2 A;  2F97 A;  4ELP A;  1OMP A;  2THI A;  2REJ A;  4OMB A;  5JTY B;  2V3T A;  3KZG A;  3Q26 A;  2QMX A;  3P7I A;  4HTG A;  3K1P A;  1DTZ A;  3QUF A;  5JEI A;  3CFZ A;  2RKM A;  3N26 A;  3B7D A;  2HAV A;  1D4N A;  2HFB A;  3AXF A;  3RY3 A;  5DEX B;  5FHO A;  1Y3Q A;  4EQ9 A;  3OO8 A;  4TLM B;  4F18 A;  3MZ9 A;  2XXV A;  4OES A;  3DP4 A;  1POY 1;  1QVS A;  3BKI B;  3PV0 E;  5IKB A;  2QPQ A;  4P0I A;  2IEE A;  1B40 A;  2XXW A;  4E0X A;  3E9X A;  1B52 A;  4AB6 A;  4ZZA A;  3MAM A;  4XKP A;  1QW0 A;  1SBP A;  5AA2 A;  2PBW A;  3IR1 A;  4MFI A;  2V3Q A;  3U92 A;  3L6G A;  2ZYK A;  2NWJ A;  1MRP A;  1N84 A;  1N7W A;  1I69 A;  4RY1 A;  1P1O A;  1IUD A;  2DE4 A;  3F11 A;  3QUJ A;  3LSW A;  4YKI A;  3IK6 B;  2UVG A;  5H8H A;  3VVD A;  1J1N A;  3T9V A;  3MVY A;  3O6G A;  4F19 A;  5K2X A;  4LQ5 A;  3SER A;  3OEM A;  5I58 B;  1I6A A;  1UIU A;  1H3D A;  4BDL A;  3G3F A;  4KI0 E;  4P0G A;  1SDX A;  3KSX A;  2I4C A;  4IGR A;  1MQJ A;  3QK6 A;  4GIZ A;  1IXH A;  1MXX A;  3SEU A;  4NF5 A;  4OEV A;  1PC3 A;  1IEJ A;  2DXR A;  1O7T A;  1B3L A;  5F1Q A;  1B3F A;  4IGT A;  3TTM A;  2H98 A;  5JK4 A;  4IB2 A;  1IXI A;  4GL8 A;  2GFE A;  1OVT A;  1O63 A;  3B6W A;  2QRY A;  4UAC A;  1HSL A;  1MY3 A;  4KFQ A;  2UVJ A;  1LB8 A;  1UTH B;  3MPL A;  1ELJ A;  4ZEK A;  4IO5 A;  1JNF A;  1A8E A;  1R6Z A;  1XOC A;  3JZJ A;  4DE8 A;  1LST A;  4ZEC A;  1TFD A;  4O3C A;  2VHA A;  5HBC A;  2O69 A;  1XVY A;  2E1S A;  1H44 A;  3KN3 A;  5A5X A;  4GOT A;  1JEU A;  1B1X A;  4PET A;  2HQ0 A;  3H6T A;  5EHS A;  2XXH A;  5H8N B;  1DSN A;  4JWX A;  1Z7N E;  5LOM A;  3UK4 A;  1BTJ A;  2V93 A;  3HST A;  3KOT A;  1MH4 A;  3VE1 B;  4AQ4 A;  2HXW A;  1MXV A;  3KEI A;  1B3E A;  3T9H B;  1B4H A;  2H9B A;  4RPN A;  1MQG A;  3TPA A;  1HSE A;  2ZNU A;  3H6U A;  2I6E A;  4EXK A;  4YB6 A;  2FA7 A;  3FJG A;  2ZYO A;  4C1T A;  3ODB A;  4NED A;  3E3K A;  4YKP A;  1A40 A;  2QS2 A;  1B5I A;  3Q27 A;  1YCJ A;  1WDN A;  5CBR A;  2M8C A;  1MPC A;  1PEB A;  2Z8F A;  4F3G A;  2AL5 A;  4OVJ A;  3MWB A;  1FTM A;  1ZMG A;  4DXB A;  1MDP 1;  3H06 B;  3V83 A;  1FQD A;  3MVX A;  4ND9 A;  2YPN A;  3LSL A;  1MG1 A;  1PB9 A;  4DIG A;  1JW1 A;  3OMB A;  2RC9 A;  2HZL A;  3O28 A;  1FQF A;  2Z23 A;  4NF4 A;  2XX8 A;  1MY4 A;  1N0T A;  2HAU A;  3U8Q A;  2UVI A;  2W7Y A;  3EHU A;  1WOD A;  3S9M C;  4OZ9 A;  4PFU A;  1D9Y A;  1S7Y A;  1LBC A;  1ZTY A;  2V25 A;  4ZEI A;  1II5 A;  3O29 A;  4R73 A;  2DQV A;  1XHY A;  2A5T A;  2AYS A;  4RA1 A;  1Y4C A;  4GD5 A;  1SYI A;  3DM0 A;  3FVN A;  4IO4 A;  5CMB A;  4HCY A;  5AA4 B;  2Y7P A;  4ELO A;  5B7D A;  3MP6 A;  1MH3 A;  3RNN A;  2ONS A;  1NNK A;  2YJP A;  5IAI A;  3MVZ A;  2QL3 A;  4G2Z A;  5DTB A;  4ZDM A;  3SKP A;  3OEL A;  1N04 A;  2ANJ A;  3FXQ A;  1SYH A;  1F9B A;  3H6V A;  5H8N A;  5M2V A;  4RK2 A;  4OHN A;  2OWS A;  4RNS A;  3FZV A;  3HV1 A;  4AB5 A;  3RQT A;  3DP8 A;  1FQE A;  3SEX A;  3K02 A;  5AA3 A;  2F78 A;  1MY1 A;  1IXG A;  3UP9 A;  4XIG Q;  1SW4 A;  5AE4 A;  3ILU B;  3BFT A;  4QSC A;  4POX A;  1Y4T A;  1A7L A;  2D21 A;  5CM6 A;  1LB9 A;  4QFP A;  2R9J A;  1MXW A;  4LON B;  3CFX A;  1R9Q A;  1M5F A;  1NKX A;  1IXC A;  2XXT A;  5I2K B;  5FTI A;  5AA2 D;  1B05 A;  2Q9T A;  5AA2 B;  5H8Q B;  4H6D A;  3CFL A;  3RLF E;  2DWI A;  3KJT A;  2IA4 A;  4QFK A;  2VD3 A;  2O1M A;  3TFL A;  2I0C A;  4JDF A;  3IX1 A;  4OFJ A;  1BKA A;  3TQL A;  3V5A A;  3LR1 A;  1NNT A;  4EF2 A;  3HO7 A;  3PD8 A;  1MY0 A;  4FJP A;  3TKD A;  1UTB B;  3FIR A;  4LZ8 A;  4DCX A;  1EH3 A;  3R26 A;  4DCY A;  1URG A;  3H6W A;  3T9U A;  4FAJ A;  3IL1 B;  4O3A A;  1SQY A;  2I0B A;  1RYO A;  3QAX A;  5DT6 A;  4DDD A;  2FYI A;  4GXS B;  3OO9 A;  3UOR A;  3VXB A;  4Q8R A;  1LFH A;  4EXL A;  1EZ9 A;  2QSX A;  3O6H A;  1MM6 A;  5AA4 A;  5B70 A;  3I5O A;  4ESW A;  1ZIU A;  4GLI A;  2YLN A;  4LZ7 A;  3QSL A;  1AL3 A;  2O68 A;  5A5X B;  4NWD A;  3RGY A;  1SW1 A;  2PVU A;  2XX7 A;  3PMV A;  2RIN A;  1USY H;  4YAH X;  4H5G A;  4F22 A;  2OCU A;  4MH5 A;  3O97 A;  3BBR A;  1PB7 A;  1LBB A;  1P1Q A;  2DVC A;  4I62 A;  4KHZ E;  3BFU A;  3WAE A;  4DZ1 A;  5I56 B;  4LQ2 A;  1IIT A;  3C9H A;  1Q35 A;  4R6H A;  2B3B A;  1B9J A;  2R71 A;  4POW A;  1MPB A;  4FED A;  3OSQ A;  1MQI A;  5ISU A;  4O3B A;  1MM7 A;  2HEU A;  3K00 A;  3KOS A;  2Y7I A;  3KJ7 A;  4OEU A;  3U94 A;  1I6B A;  3TEL A;  4M1V A;  5DVI A;  3K01 A;  1MQH A;  4IY5 A;  1QUL A;  5L8D A;  3FVG A;  2RCA A;  5I2K A;  4N07 A;  4OYV A;  3DP6 A;  1SVX B;  4OWD A;  3K6W A;  3MW0 A;  5H8Q A;  2V84 A;  3HPI A;  4JSO A;  3EF7 A;  4XKQ A;  4XKN A;  3W9W A;  4KYS A;  1S9T A;  1B7H A;  4ISU A;  3WAF A;  3O66 A;  2Q2C A;  1YTV A;  1B46 A;  3PD9 A;  1NNP A;  4ELQ A;  5AA1 A;  3TCF A;  2PMS A;  3S4U A;  4NF4 B;  3K0V A;  2Z8E A;  4F39 A;  4PE5 B;  5DYH A;  3K1N A;  1UTB A;  3O2A A;  3T22 A;  3JV9 A;  1FQB A;  4XTC Q;  1LCF A;  2QJE A;  1XT8 A;  4QRZ A;  3LSF B;  4OEN A;  4UA8 A;  3OD7 A;  4OTE A;  2A5T B;  2O1L A;  4DXC A;  3TCG A;  1R9L A;  4EQ7 A;  2F6P A;  2E0S A;  3PPR A;  2A5S A;  4BDQ A;  4Q0C A;  1QKB A;  4LUB A;  5TP9 A;  1XS5 A;  4NWC A;  1B51 A;  1IZ1 A;  2DP8 A;  5ICQ A;  3KFM A;  5FTH A;  3FV1 A;  2FNC A;  4MBP A;  4RJZ A;  2F7B A;  3MP8 A;  4F2O A;  1LAG E;  2Y7K A;  2DSF A;  1M5D A;  3CRB A;  1QKA A;  3Q29 A;  3ECR A;  2ZYM A;  4R2B A;  2D5W A;  2H25 A;  4GQO A;  1XVX A;  2ABH A;  4X1B A;  3ZKL A;  1ZBM A;  3ONM A;  1YAE A;  3CG3 A;  1TT1 A;  1B5J A;  5L9M A;  5BWJ A;  5I56 A;  1S50 A;  3A3U A;  3A3C A;  4H67 A;  5ELV A;  4BDN A;  3QIM A;  1DPP A;  1H45 A;  4RPO A;  3IB2 A;  1P1U A;  3U72 A;  3JYR A;  1NMU A;  2I58 A;  3FJM A;  1IQ7 A;  4F29 A;  2PT2 A;  2H99 A;  1JET A;  1ZU0 A;  1T0K A;  4F3P A;  3O9P A;  3HHF A;  3IO4 A;  3MZB A;  1ZJL A;  5KZT A;  4TQU Q;  3ZS6 A;  2ONK E;  2XXQ A;  3SES A;  4HS7 A;  1URD A;  4RXL A;  3LC8 A;  1I6Q A;  5I2N B;  4U23 A;  5ITO A;  3PUW E;  3R7X A;  3TMG A;  1A8F A;  2RC7 A;  1D3K A;  4G8H A;  1QUI A;  2NVU B;  5CC2 A;  3I3V A;  1R1N A;  3TTL A;  1QUK A;  3M3F A;  2I3W A;  5KDT B;  3E4R A;  3VLW A;  3T9X B;  1B3G A;  3IOR A;  4C0R A;  3CI8 A;  3U1O A;  4IO6 A;  5I57 A;  4NE4 A;  2Q88 A;  2OJT A;  4NF6 A;  1B2H A;  4F3B A;  3LUY A;  4G4P A;  1LAX A;  4HCW A;  4M4G A;  2VP1 A;  2XXP A;  3H3G A;  3RTW B;  1OIB A;  4XKR A;  3VV5 A;  4PFW A;  4C1U A;  3PGF A;  1YPN A;  4G8M A;  3KN7 A;  4RYA A;  3PPQ A;  5HM4 B;  3EHT A;  2GHA A;  2LAO A;  2UYE A;  2F35 A;  2RC8 A;  3RN8 A;  3KN8 A;  3GBA A;  4LA9 A;  4MF3 A;  1ZKB A;  2AL4 A;  3Q25 A;  4JB7 A;  4F1U A;  4H8I A;  4BDM A;  2O51 A;  4RK9 A;  2DWH A;  2I4B A;  4U4S A;  4KQP A;  1Q1K A;  4MLQ A;  1B58 A;  2NUV A;  1A54 A;  4G77 A;  3O6I A;  4H1X A;  1FQA A;  4ZEB A;  3FXR A;  4EQB A;  3T93 B;  3K4U A;  2O7U A;  3M3K A;  3FV2 A;  1D9V A;  3PPN A;  4OFL A;  5L9O A;  4JXI A;  3PUX E;  1Y20 A;  1H43 A;  4G8N A;  1AOV A;  1TWY A;  4WKM A;  3H7M A;  4BDO A;  4FOR A;  3C4M A;  2XHD A;  3OO7 A;  1NL5 A;  3G3K A;  3PPP A;  3PU5 A;  3TCH A;  1OQH A;  4LP2 B;  1Y3P A;  1XC1 A;  2XXI A;  3LSX A;  4QSE A;  4YMA A;  2XXY A;  1AH5 A;  3K1M A;  1M5E A;  1OQG A;  3S2V A;  4ZED A;  1SI1 A;  3MUQ A;  4PQJ A;  4YB7 A;  2NXO A;  2DVZ A;  3GZG A;  4P11 A;  5I2N A;  1B4Z A;  2O84 X;  4YKJ A;  1A99 A;  4GVO A;  3K2D A;  1JVX A;  1Y9U A;  2DE3 A;  2PX1 A;  2ESN A;  5H8S A;  4LAT A;  1UIV A;  5KDT A;  3GLB A;  3K6V A;  4R74 A;  3D4G A;  4IO7 A;  3FGS A;  3RPW A;  3K6X A;  1B7Z A;  1VFD A;  3RT6 B;  1POT A;  2ONR A;  3M3L A;  5TP9 B;  3G7W A;  3PMW A;  3CR9 A;  4JSD A;  3IJX B;  2ALU A;  1LCT A;  2XX9 A;  2DWJ A;  5ITP A;  3I6V A;  3S9N C;  3QYT A;  4ECF A;  4U2R A;  3FD3 A;  3N5L A;  1B0L A;  2QMW A;  4U21 A;  4Z0I A;  5TPA B;  1LAH E;  3TZA A;  1EZP A;  1ZLQ A;  3IO6 A;  2O6A A;  3FJ7 A;  4DXU A;  3FVK A;  3OOA A;  4R75 A;  4KCD A;  1HSJ A;  3Q28 A;  5CRY A;  3GBB A;  4IO2 A;  4KR5 A;  3OEN A;  3T66 A;  2QS3 A;  5H8F B;  1MS7 A;  1P99 A;  2Q8J A;  4NTL A;  4FAT A;  4U1Z A;  1LFI A;  3FVO A;  3R6U A;  2Z8D A;  2Y84 A;  4JWY A;  3MZ1 A;  2OZZ A;  3FUZ A;  3GXA A;  1MY2 A;  3W9V A;  3C34 A;  1IIW A;  3OXN A;  4YZZ A;  3A09 A;  1MQD A;  2H5Y A;  3RUM A;  4F1Y A;  5DVF A;  4GL0 A;  3MP1 A;  4NMY A;  3N6T A;  3VLU A;  3SEV A;  4FE8 A;  3TTN A;  1L5T A;  1B5H A;  4ZEF A;  4N13 A;  2CMO A;  4R2F A;  1P1W A;  1N3W A;  4G68 B;  3MBP A;  4H65 A;  4FEB A;  1FTL A;  4WED A;  4KD5 A;  3CVG A;  1H76 A;  3EN3 A;  3CSB A;  1M5B A;  3KG2 A;  2QS1 A;  4R9G A;  1JW4 A;  3TOD A;  3L6H A;  1FW0 A;  1LFG A;  2Y7W A;  5FHM A;  2OWT A;  3LBS A;  4F3S A;  3PPO A;  1CE2 A;  2F34 A;  1GV8 A;  4KYE A;  3SEW A;  2UXA A;  3E13 X;  3IOV A;  3TAJ A;  3H03 A;  3VVF A;  4FIM A;  4LZ5 A;  4ZE9 A;  3CG1 A;  2CZL A;  1AIV A;  3VFJ A;  3OEK A;  3SET A;  1VFE A;  2AIX A;  4OQO A;  2XXU A;  2GHB A;  3EPE A;  3SEY A;  4HW8 A;  3N94 A;  3RTF B;  5I57 B;  1SD3 A;  1B1H A;  2R6G E;  5KCJ B;  4NF6 B;  3UIF A;  2F36 A;  5F7V A;  3EQ1 A;  4R6K A;  1VE4 A;  5TU0 A;  2QS4 A;  5TPA A;  2B65 A;  1Z7M E;  4QFN A;  3V8X B;  4H0W A;  2X7P A;  4FEC A;  3TUS A;  1MXY A;  3W15 C;  1Y1M A;  1DOT A;  4NF8 B;  1UQW A;  3MVW A;  3VDF A;  2HCA A;  4JWO A;  1BLF A;  2Q2A A;  5H8F A;  4Z7E A;  3B6Q A;  5JTY A;  4ZZE A;  3FXU A;  4Q5T A;  1MDQ A;  4TLL B;  3T96 B;  1US4 A;  1AMF A;  3U93 A;  2KLF A;  4JBZ A;  3V89 B;  3VXC A;  1RKM A;  3UGW A;  3HCQ A;  5DEX A;  4R9F A;  2VGQ A;  1URS A;  1B0H A;  3PUZ E;  1GVC A;  3MC2 A;  4EF1 A;  4I8C A;  1O64 A;  4ZS9 A;  3G3I A;  4G68 A;  3UA8 A;  3B6T A;  5I59 B;  4OER A;  3IOU A;  1TFA A;  5CMK A;  2OK2 A;  4ZE8 A;  1Y3N A;  3G3G A;  1SI0 A;  2DWA A;  4OXV A;  1JQF A;  5HPQ A;  3UN6 A;  5L9S A;  4KPT A;  2DYX A;  3IJO B;  4MLV A;  1OVB A;  3HN0 A;  4R72 A;  4YIC A;  1JEV A;  3USD A;  4G68 C;  4IO3 A;  2XD3 A;  3S9L C;  2X7Q A;  1FTK A;  1TXF A;  3H4Z A;  3HHG A;  2XXX A;  3TQW A;  2P2A A;  1JW5 A;  3IB1 A;  3TYH A;  2F7C A;  4XXU A;  2P1S A;  1MPD A;  4L17 A;  4GRK A;  4E0W A;  2DXY A;  4X48 A;  3PMX A;  1DTG A;  4KCC A;  4QSD A;  5I58 A;  1JVY A;  2B3F A;  2DE2 A;  3MJN A;  2Z22 A;  5DVJ A;  2OLB A;  3RT8 A;  2RCB A;  1OLA A;  5KCJ A;  2X26 A;  1LAF E;  1MXU A;  1VR5 A;  3D4C A;  3IOW A;  2PYY A;  4WXJ A;  3C33 A;  1QJM A;  3C35 A;  1US5 A;  4THI A;  2V3U A;  2XXR A;  3IOT A;  3OSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...