2Y7IA

Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
228
structure length
228
Chain Sequence
ASVSARTLHFGTSATYAPYEFVDADNKIVGFDIDVANAVCKEMQAECSFTNQSFDSLIPSLRFKKFDAVIAGMDMTPKREQQVSFSQPYYEGLSAVVVTRKGAYHTFADLKGKKVGLENGTTHQRYLQDKQQAITPVAYDSYLNAFTDLKNNRLEGVFGDVAAIGKWLKNNPDYAIMDERASDPDYYGKGLGIAVRKDNDALLQEINAALDKVKASPEYAQMQEKWFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Microcalorimetric Analyses Reveal the Structural Basis for High Arginine Specificity in the Salmonella Enterica Serovar Typhimurium Periplasmic Binding Protein Stm4351.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica
molecule tags Arginine-binding protein
molecule keywords STM4351
total genus 83
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2y7iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2y7iA02
4PFYA 3T9XB 4NF5A 1QUJA 5A5XB 3HHGA 3Q29A 5HPQA 2QMWA 1QJMA 5JK4A 1MPCA 3K4UA 3D4CA 2I49A 1SDXA 5H8FB 4F1YA 4IO7A 1M5CA 4G77A 1UTBA 4F1VA 3OO9A 5TU0A 3SETA 3U72A 3VLVA 1QKAA 3IL1B 5ICTA 4KQPA 2DQVA 2F97A 2G93A 3OO6A 4JBZA 4U4XA 4YU0A 5AA4B 1URGA 1XS5A 3FD3A 3FIRA 2O51A 4O3CA 3KGCA 3MC2A 3THIA 4ELQA 4F29A 1O63A 4YAHX 1OMPA 2B65A 4E0WA 2O69A 3M3KA 3VXCA 4BDNA 3ECRA 1FQDA 1POY1 1RYXA 2D3IA 3LSFB 1Y4CA 4LQ2A 4OHNA 1MXYA 3V83A 4OEVA 3MWBA 2DXYA 1B51A 2HAUA 2DWIA 2A5TA 3IOWA 1ZJLA 4ISUA 3OEMA 3PMXA 4BDRA 3KN7A 3H3GA 4OFJA 3T93B 4RJZA 3TQLA 4RYAA 3N26A 4OQOA 1LAXA 5CRYA 5EYFA 3KOSA 3EHSA 1B40A 3MP8A 2DS9A 2I58A 1B3HA 3KEIA 4ESWA 2XHDA 1DTZA 5KZTA 1B52A 1LBBA 4MH5A 3ZS6A 3C34A 1MXXA 1YPNA 3KJTA 5I2KB 1N0TA 3DP4A 4RA1A 4ESXA 1NNPA 4PFUA 4QFLA 1QVSA 3CG1A 4GLIA 1Y20A 1A55A 2HEUA 4XKQA 2H99A 3LC8A 4H1XA 4JWYA 1P1OA 1I6AA 1N84A 3MAMA 1WDNA 2OK2A 1PBQA 2AL4A 3OENA 3C9HA 1Y1ZA 4FEDA 3MW0A 1BP5A 4NF8A 4PQJA 4XIGQ 4IO5A 1Y4TA 4X1BA 3B6QA 4F2OA 2Y7RA 2HZKA 3HCQA 3O6HA 3PV0E 3Q27A 4LZ8A 3IOTA 2R6GE 3UK4A 3FJ7A 3T9VA 4EQ9A 1B5IA 1SW4A 2BJJX 3UN6A 1FW0A 1MQGA 1SVXB 1ZMGA 4H5FA 1OQGA 5AE4A 1SW2A 1SW5A 3S9MC 4ZEDA 1Q35A 2V93A 4FAJA 4AB6A 2THIA 1MXVA 3S4UA 4EXLA 1RYOA 2V84A 2F5XA 1A54A 2Z8DA 3SERA 5FTHA 2UVGA 3TCFA 4DDDA 4EF2A 1B3GA 4QFOA 5DEXA 3FUZA 4X9TA 5ISUA 5H8HA 2UVHA 3HN0A 1N04A 3MVXA 2E1SA 4RPOA 3RTWB 1ZIUA 1I6BA 3VFJA 3MUQA 3H4ZA 1N76A 3TAJA 1Z7NE 1LSTA 2DOJA 4F3BA 1B6HA 1Y1MA 1MQIA 1MG1A 3KN8A 4ZEFA 4ONYA 1B4ZA 3SESA 1USYE 2UXAA 4RY1A 2AL5A 2H5YA 4YZZA 3CSGA 2XXPA 3TQWA 3FVGA 3BFTA 1MH3A 1NNFA 3K6XA 4YKPA 3Q26A 4OENA 5ITOA 4U2RA 2DVZA 3JV9A 3QXMA 1IXCA 1R6ZA 1RKMA 1SQYA 2IA4A 3C33A 4QRZA 4RK2A 5CMBA 3ZSFA 1AMFA 4LA9A 5HM4B 5CBSA 1GTKA 2ALUA 3EQ1A 3HPIA 1AOVA 3N6TA 2Y7KA 1PB7A 1I69A 1EU8A 1N3XA 1B3LA 5KCJB 5I58A 1B3EA 3G7WA 3H7MA 3OEKA 4TOZA 4NTLA 4GFRA 3E13X 2YLNA 4MFIA 5B7DA 3G3FA 1FTJA 4M1VA 5H8QB 3PD9A 4YB5A 1VSOA 3UGWA 2DWHA 4GIZA 5TPAB 4JB7A 1B0HA 3BFUA 3IR1A 1T0KA 1B1HA 5L9MA 3A3UA 2QS3A 2HXWA 2XXXA 4P0IA 3U92A 5ITPA 5M2VA 3W9WA 5I2NB 5TP9B 4KCCA 3B6WA 1NMUA 1ZLQA 3LSWA 2VP1A 3M3LA 4IGTA 1MDP1 3BBRA 3MPLA 5I84A 1MXWA 1LAFE 1MQHA 5ELVA 3CVGA 3B7DA 2B3FA 3MVYA 1FCKA 1QULA 3F11A 1XHYA 2O7IA 3K1PA 4Q5TA 1JW1A 3I3VA 3MP6A 1BLFA 1DPPA 1SBPA 1D3KA 2XD3A 1LLSA 4KCDA 4JSDA 4ZEIA 5EHMA 5L8DA 2H98A 4DIGA 5JEIA 3L6GA 4KHZE 3FATA 2XX8A 4Q30B 2Q89A 1A40A 3FV1A 1QUKA 3W9VA 1JEUA 2RC9A 1MPDA 1PB8A 1J1NA 4DZ1A 3GXAA 3I6VA 3ZKLA 5I56B 3PPQA 4FE8A 4WEDA 3TUSA 2PX1A 2RCBA 3TPAA 3IB2A 4F3PA 2ZXTA 4N07A 3TTNA 2WKYA 1DPEA 1QW0A 2P0SA 4GL0A 1B46A 1YTVA 3FXUA 4OETA 5EHSA 1ZKBA 5K2YA 3A3CA 2H4IA 3O2AA 1IXGA 3PUZE 3TTKA 2DWAA 2CZLA 4GXSB 2H9BA 4HCWA 4NE4A 3RNNA 5I59B 2VD3A 3RT8A 2DVCA 4OTEA 2PYYA 5JTYB 1SYIA 3R6UA 1HSJA 3EN3A 3KSXA 4IY6A 1MY3A 1YCJA 4MBPA 4OESA 3PUWE 5AA2B 1B58A 2X26A 4EUOA 1DOTA 4RXLA 4YKJA 1B1XA 3C36A 4POXA 2OJTA 2PVUA 4DXUA 4G8NA 4KYEA 3CFXA 4R6HA 1UTHB 3LBSA 2XXQA 4IO4A 1LGBC 4F3GA 1ZBMA 3MQ9A 4DXCA 1N3WA 1PDAA 3GZGA 3IJOB 4XKPA 2VGQA 3MVWA 3FASA 4JXIA 4M4GA 2UYFA 4RPNA 2RF1A 4YKKA 3QAXA 5IAIA 5I57B 4Q0CA 5A5XA 3B6TA 2RKMA 4OFLA 1TFAA 4NWCA 1OLCA 3R26A 1DMBA 3QUFA 4U1ZA 5H8FA 1P1NA 3IB1A 4IB2A 3MJNA 1UTBB 3P7IA 3JZJA 4U23A 1GV8A 4NMYA 1MQDA 2VD2A 2ZYKA 2XXUA 3O9PA 4ZS9A 1M5DA 3R7XA 3T96B 3KN3A 1KWHA 2Z22A 3TYHA 4HTGA 5AA2D 1MY1A 1ZTYA 3E9XA 4ZE8A 1JNFA 2O68A 3RLFE 1MPBA 1TWYA 4DE8A 2E0SA 4YMBA 3MP1A 4G68B 4L17A 3TCGA 3ONMA 1D9YA 2DYXA 2G29A 4U21A 4KPTA 4WXJA 3KSJA 2O6AA 3TFLA 5I56A 4H67A 4EF1A 1FTKA 2Y7WA 2DSFA 1QUIA 4F19A 3AXFA 5H8NB 2YPNA 1PEBA 1YAEA 3SKPA 2F7AA 2ZYNA 1USYH 1I6QA 2XXYA 3JYRA 1NH7A 4I62A 3FGSA 1B7ZA 4KYSA 2H25A 1LAGE 4GL8A 3K6VA 1BTJA 4C0RA 3K0VA 3RY3A 1M5FA 5DVFA 2V3QA 1BKAA 2F7CA 2Q9TA 1A8EA 4LVQA 2PT2A 2QSXA 3HV1A 2GH9A 3LUYA 3PUYE 4PFWA 3FXQA 1DTGA 2LAOA 3K2DA 1NL5A 3V8XB 3C31A 1FQFA 4ZE9A 3H06B 2I4CA 4NF8B 5B70A 1EZPA 3MBPA 4ND9A 4H8JA 4XKRA 4C1TA 4R2FA 1URDA 4F2QA 1FQAA 3CI8A 3DP8A 1SW1A 4NF4A 4MLVA 5CMMA 3Q25A 4ECFA 4OVJA 3QUJA 4K3FA 4R9GA 3CFLA 4O3BA 3PPPA 3VVDA 3CIJA 3H03A 1SD3A 3QIMA 4H0WA 1MDQA 1URSA 3LR1A 1Q1KA 4OEUA 4RNSA 2F35A 1H3DA 1S7YA 1P1WA 5BWJA 1IUDA 3PMVA 4X48A 4AQ4A 4MF3A 3PPNA 3DLNA 1VFDA 3OO8A 3TKDA 2VHAA 4F31B 3K01A 4G8MA 4R75A 3SDFA 5H8HB 4UA8A 1WODA 1JQFA 1R9LA 2ZNSA 1NFTA 2F36A 2GFEA 2REJA 2RINA 4PE5B 4OFOA 4THIA 3N5LA 3KBRA 2ESNA 5KDTA 4XTCQ 2QS4A 3CR9A 1Y3NA 4E0XA 1B2HA 1B7UA 2I0BA 3GLBA 3U94A 3G3GA 3H6VA 4I9DA 4G4PA 1H76A 2QJEA 1B4HA 2RCAA 4HW8A 3ILTB 1JW4A 2OCUA 3MPKA 3QYTA 3SEWA 3VE1B 1EZOA 1UIUA 5DVIA 4OYVA 1MXZA 2D21A 2V25A 4LZ5A 4Z7EA 4G68C 4GVOA 2P2AA 1CE2A 2ZYOA 4I8CA 1JVYA 1H43A 3MVZA 2XXTA 3OSRA 4GRKA 4JDFA 4R9FA 3UP9A 4BDOA 3IJXB 3K1NA 2NUVA 1LCFA 2XXVA 3VLWA 1MS7A 3OO7A 3O6IA 1PB9A 4Z0IA 2GRVA 5CC2A 2QPQA 3K02A 2NWJA 3HHFA 2D5WA 4ZECA 1II5A 4IY5A 3C32A 1LCTA 1MM7A 3ILUB 2F6GA 4JWXA 1OVTA 1R9QA 1S9TA 2NOOA 5H8QA 3OD7A 3SEUA 3TODA 3MZBA 4TLLB 4YMAA 3G3JA 5TPAA 4R73A 4OZ9A 3N6UA 3IO6A 1B32A 3K1MA 2YJPA 1N7XA 1JETA 2PMSA 4WEPA 1FQEA 2V3TA 4N13A 4NF6A 4QSEA 2QL3A 3FJMA 4TLMB 3KZGA 3DM0A 5I2NA 1DSNA 1QKBA 5L9OA 1ANFA 2F78A 5DT6A 3TCHA 4Q8RA 4NF5B 4FATA 1S50A 4FEBA 2XXIA 2VOZA 2ONKE 1NNKA 3N94A 1US4A 2AYSA 4OERA 3G3KA 2Q8JA 1CB6A 2XX9A 1UIVA 2I0CA 2Q88A 3PPRA 4JSOA 1FQCA 4F1UA 1B7HA 4G8HA 3C4MA 3UA8A 4U4SA 2HQ0A 3TTRA 4EQ7A 3I5OA 4LP2B 4LZ7A 4FIMA 2ANJA 2ZYMA 5CMKA 4BLAA 2PT1A 5AA4A 3UIFA 3OELA 3E4RA 5K2XA 3EPEA 3ZKKA 2I48A 2OWSA 4WKMA 4EXKA 1D4NA 1PC3A 5H8SA 2DP8A 3FVNA 4QFPA 2ONSA 4ZEBA 4ZEKA 1XVXA 2RC8A 1OIBA 4GWOA 1D9VA 2ZMBA 3VV5A 3FVKA 4G2ZA 3T9HB 1XVYA 1ELJA 2F8DA 2A5TB 3C35A 4NEDA 3GBAA 1MM6A 5CMCA 4U1OA 1NNTA 1O64A 2O84X 5AA1A 3OXNA 3RUMA 3HO7A 2UVIA 1POTA 1FTOA 2XXWA 4JWOA 4R72A 1NH8A 2R71A 3G3IA 3HSTA 3CRBA 2Q2AA 1ZU0A 2Y7IA 3IK6B 3MZ9A 3RGYA 3S9EA 3VVFA 2B3BA 3PD8A 1OLAA 5I2KA 2OZZA 3TZAA 1PBPA 2X7PA 4BDMA 1UQWA 1TFDA 5LOMA 5AA2A 2REGA 4X1DA 4PETA 1HSEA 4OWDA 2UVJA 2ZNUA 3KFMA 4FORA 4YB7A 1Y9UA 3G3HA 2O7UA 5DTBA 1WVJA 1TT1A 2DE2A 2Y84A 3D4GA 1UTHA 4LONB 4N6PA 3BKIB 1B0LA 2CMOA 3QK6A 4TQUQ 3DELB 1H45A 1US5A 2FA7A 2X7QA 4POWA 3T9UA 1XT8A 4QSCA 1LAHE 1B5JA 3TDJA 3IORA 4QHQA 3KG2A 4KI0E 5I57A 4DCXA 4F18A 1AH5A 1XOCA 2NVUB 5J1DA 4IGRA 3IB0A 2M8CA 2OBGA 2I6EA 4R6KA 3U93A 1A8FA 3PUVE 5DEXB 3O6GA 3WAFA 3SEVA 4R2BA 1A99A 1Z7ME 2XXHA 3KJ7A 4HCYA 4F3SA 1AL3A 4O3AA 2HZLA 4RK9A 4ELOA 2Z8FA 4ELPA 4GOTA 3IO4A 2P1SA 4QFKA 1MY4A 2AIXA 4DLDA 3O66A 2IEEA 3S9NC 4H8IA 3FZVA 1R1NA 1MH4A 1FTLA 4IO2A 3VLUA 3GBBA 2HAVA 3S2VA 1IXHA 1F9BA 4GQOA 4ELRA 3EF7A 4G68A 4KYDA 1N7WA 3O29A 4P0GA 2DWJA 1IEJA 3V89B 1B05A 3PPOA 3L6HA 3QSLA 2FYIA 1LBCA 4YICA 1OVBA 3FVOA 4H5GA 5H8NA 3TEPA 2OLBA 5CM6A 4ZDMA 3M8UA 1IZ1A 4GF8A 1M5EA 3FV2A 3CSBA 2QRYA 5CBRA 1H44A 1IQ7A 5AA3A 1EZ9A 1VFEA 3V5AA 4QF9A 1MXUA 1TXFA 4FECA 2PBWA 1VR5A 4KR5A 4R6YA 1XC1A 3U8QA 3ODBA 3PMWA 3TTLA 3TTMA 4AB5A 5I58B 5KCJA 1OQHA 1GR2A 1IXIA 1LFGA 1ATGA 2DE4A 1M5BA 2F7BA 2QS2A 3IOVA 4H6DA 4PFTA 2Z8EA 3MZ1A 3K6WA 3T66A 5ICQA 4I1DA 5FHNA 1LFHA 4LQ5A 3O28A 2GHBA 4IO6A 1EH3A 5F7VA 1L5TA 5L9SA 4NF4B 3LSLA 3H6UA 5TP9A 2A5SA 1P1QA 4QSDA 2I3VA 3TELA 1P1UA 3RT6B 4C1UA 2UYEA 5HBCA 1SYHA 3E3KA 1SI0A 2F34A 2W7YA 2FNCA 4OMBA 2HFBA 4BDLA 3PGFA 4HS7A 1MRPA 5DYHA 3RN8A 3EHUA 3WAEA 4KD5A 1B9JA 4R74A 4DXBA 2RC7A 1SI1A 1LFIA 5FTIA 3FJGA 3PUXE 1GVCA 2V3UA 3OSQA 3IOUA 1IITA 1Y3QA 2DXRA 3VDFA 4LATA 1GGGA 5KDTB 2QS1A 2XD2A 3K00A 4GXAA 2XXRA 4H65A 3U1OA 4BDQA 1FTMA 4XKNA 1AIVA 1IIWA 1LB8A 1HSLA 3EHTA 1LB9A 1JVXA 4LUBA 5F1QA 2GHAA 2QMXA 4ZZAA 3IAZA 3RPWA 3USDA 2OWTA 4EDPA 4EQBA 4GD5A 2Y7PA 1B3FA 3H6TA 2Q2CA 4U22A 3VXBA 3W15C 4XXUA 4MLQA 1NKXA 3CFZA 4UACA 2ZNTA 3A09A 3T22A 3UORA 2I3WA 1B5HA 2I4BA 1O7TA 1FQBA 2HCAA 1VE4A 4QFNA 5I59A 4DCYA 3CG3A 3K6UA 3RTFB 3IX1A 2F6PA 1BIYA 5JTYA 2O1MA 3M3FA 1MQJA 2R9JA 4FJPA 4NWDA 2KLFA 4IO3A 1MY2A 4KFQA 3PU5A 5CI5A 3S9LC 5FHMA 3VVEA 3H6WA 1P99A 3SEYA 3O97A 3OMBA 3FXRA 4YB6A 5DVJA 4ZZEA 3RQTA 4F39A 5BUUA 2XX7A 3DP6A 3OOAA 1JW5A 4PP0A 1Y3PA 2ONRA 3SEXA 1A7LA 4YKIA 4F22A 1JEVA 2Z23A 4NF6B 5FHOA 2DE3A 2ABHA 2O1LA 3TMGA 3KOTA 4P11A 4OXVA 1MY0A 2NXOA 3LSXA 5IKBA 3Q28A
chains in the Genus database with same CATH superfamily
3T9XB 4NF5A 5HPQA 1MPCA 3K4UA 3D4CA 5H8FB 3IL1B 4KQPA 3OO6A 5AA4B 3CHGA 3FIRA 4MCOA 4PCDA 1NUZA 4E0WA 3S9LC 2D3IA 3LSFB 4OHNA 4OEVA 1FPJA 1B51A 2DWIA 4ISUA 3OEMA 3C34A 1N0TA 3DP4A 1NNPA 1A55A 3MAMA 1WDNA 1PBQA 3C9HA 1Y1ZA 4NF8A 4XIGQ 3LSXA 3ROJA 2Y7RA 3PV0E 3UK4A 4EQ9A 5IGAA 2R6GE 3FJ7A 1SW2A 3S9MC 1Q35A 1MXVA 3RPLA 3U65A 1G0HA 4I3YA 2F5XA 2UVGA 2ZZXA 4QFOA 4X9TA 2UVHA 3HN0A 1N04A 3MVXA 1ZIUA 3VFJA 3KC0A 1EYJA 3KN8A 4RY1A 4YZZA 4YKPA 4QRZA 1SQYA 4RK2A 4PF6A 1AMFA 2JJKA 5CBSA 1GTKA 1PB7A 1N3XA 5KCJB 1B3LA 4PFRA 3OEKA 2ZZWA 4NTLA 1LBYA 4GFRA 4N6KA 4JB7A 3A3UA 4P0IA 5I2NB 4P3LA 5I84A 1MDP1 1MXWA 3B7DA 3MVYA 1XHYA 3K1PA 5ET8A 1JW1A 3I3VA 3MP6A 1LLSA 4ZEIA 5EHMA 2FIEA 3L6GA 3FATA 5IZ3A 3W9VA 1J1NA 3PTYA 3I6VA 3PPQA 3TPAA 3IB2A 3TTNA 4QBAA 3O2AA 1IMEA 2DVCA 4OTEA 4IY6A 1MY3A 1YZ0A 1B1XA 4POXA 4PE3A 2OJTA 2PVUA 3LBSA 1N3WA 1PDAA 3IJOB 3D1RA 3FASA 4JXIA 4RPNA 5I57B 3B6TA 4NWCA 1OLCA 3R26A 1FPGA 1UTBB 1GV8A 3TYHA 3T96B 4ZS9A 3KN3A 4ZE8A 4PFIA 3TCGA 1K9YA 3TFLA 3AXFA 3SKPA 1PEBA 1YAEA 2F3DA 2F7AA 1USYH 4GL8A 1BTJA 3K0VA 4LVQA 3U8QA 2PT2A 2LAOA 1FQFA 1D9QA 4H8JA 4C1TA 4R2FA 4GWZA 1SW1A 5EQ8A 4NF4A 4ECFA 4O3BA 4RNSA 1SD3A 4OEUA 1MDQA 1IUDA 4AQ4A 3DLNA 1VFDA 4NN3A 3TKDA 3K01A 3SDFA 5H8HB 4UA8A 2ZNSA 2REJA 4NAPA 4E0XA 2I0BA 1JP4A 3H6VA 4I9DA 1H76A 2QJEA 1B4HA 2OCUA 1EZOA 4OYVA 2D21A 5ET5A 3OSRA 4JDFA 3UP9A 2NUVA 1LCFA 3OO7A 3K02A 2D5WA 1II5A 1MM7A 3ILUB 1S9TA 1R9QA 3LV0A 5H8QA 1LBZA 3G3JA 3N6UA 2YJPA 1N7XA 2QL3A 4TLMB 2PFYA 3KZGA 4P1LA 4NF5B 4FATA 1S50A 2ONKE 1KA1A 1CB6A 4JSOA 1FQCA 2OX3A 4F1UA 4U4SA 3TTRA 4LZ7A 2ZYMA 5CMKA 4BLAA 5AA4A 3UIFA 5K2XA 3EPEA 4N8YA 2DP8A 3FVNA 3FVKA 5IM2A 2F8DA 1FRPA 2A5TB 3GBAA 1O64A 2O84X 3BIGA 3OXNA 2UVIA 2XXWA 4JWOA 4R72A 3HSTA 4O94A 2Q2AA 3VVFA 2B3BA 3TZAA 1PBPA 4PETA 4P47A 1FBCA 2ZNUA 3KFMA 4YB7A 5DTBA 3G3HA 2Y84A 2DE2A 3D4GA 4PAIA 3QK6A 1US5A 2FA7A 2X7QA 3TDJA 2M8CA 3PUVE 4R2BA 1A99A 2XXHA 4F3SA 5T3JA 2HZLA 4RK9A 2HHMA 4ELOA 2Z8FA 2R8TA 2P1SA 3IO4A 4QFKA 3FZVA 2Y5KA 3VLUA 4IO2A 1IXHA 4GQOA 4G68A 3PPOA 1OVBA 5H8NA 3TEPA 1IQ7A 5AA3A 1EZ9A 1VR5A 4KR5A 5KCJA 3TTLA 5I58B 4O7MA 2DE4A 2FIXA 4H6DA 3QMFA 3T66A 2XA5A 4I1DA 4GWYA 3O28A 4IO6A 1L5TA 3LSLA 2I3VA 3RT6B 2UYEA 5HBCA 1SI0A 5LTCA 4HS7A 5DYHA 3EHUA 3WAEA 4AS5A 5F24A 1XI6A 5IZ3B 2ZZVA 3K00A 4PAFA 1LB8A 1LB9A 4LUBA 2GHAA 3RPWA 4EQBA 3VXBA 1NKXA 2ZNTA 2I3WA 2F3BA 1B5HA 1FQBA 2O1MA 3M3FA 1MQJA 4FJPA 4NWDA 2KLFA 4IO3A 5CI5A 3SEYA 1NUYA 4ZZEA 4F39A 5BUUA 2XX7A 1A7LA 4NF6B 2ABHA 4P11A 5IKBA 4N81A 4MF3A 4PFYA 1QUJA 3HHGA 2I49A 1SDXA 4F1YA 1M5CA 3U72A 3SETA 3VLVA 2F97A 4JBZA 1URGA 3KGCA 3THIA 1O63A 1OMPA 3VXCA 1RYXA 1Y4CA 3MWBA 1ZJLA 3PMXA 4OFJA 3H3GA 4RYAA 3N26A 5CRYA 5EYFA 3KOSA 3EHSA 3MP8A 4ESWA 1DTZA 4MH5A 2FBPA 1MXXA 1YPNA 3KJTA 5I2KB 4ESXA 4PFUA 4JVDA 3CG1A 1Y20A 3LC8A 1FPIA 1P1OA 2OK2A 2P3VA 4F2OA 4X1BA 3B6QA 4LZ8A 3Q27A 3T9VA 1SW4A 2BJJX 1MQGA 4H5FA 1OQGA 4PTKA 2WBBA 1A54A 3SERA 5DEXA 5ISUA 2QVVA 2E1SA 4KXPA 1I6BA 3MUQA 5J16A 1N76A 3TAJA 1Z7NE 4ZEFA 4GX6A 1LBXA 1B4ZA 1USYE 2AL5A 2H5YA 3CSGA 1MH3A 4OENA 4U2RA 3QXMA 1R6ZA 3C33A 5CMBA 1NI9A 5HM4B 3EQ1A 1AOVA 1I69A 1EU8A 4MFIA 5H8QB 2KR0A 4M1VA 3UGWA 3PD9A 1T0KA 5L9MA 2QS3A 5TP9B 1ZLQA 3MPLA 1LAFE 1MQHA 3F11A 1NV0A 2O7IA 4P8BA 4KCDA 1DPPA 5JEIA 1K9ZA 4JSDA 2H98A 4KHZE 1SPIA 2XX8A 4Q30B 2Q89A 5IZ1A 3FV1A 5I56B 4WEDA 2PX1A 4F3PA 2ZXTA 4N07A 1DPEA 1B46A 5EHSA 5K2YA 1IXGA 3TTKA 4HCWA 4NE4A 3RNNA 3RT8A 2PYYA 5JTYB 4MEVA 1HSJA 3EN3A 5AA2B 1B58A 1FTAA 2X26A 1DOTA 4YKJA 4DXUA 4G8NA 3CFXA 4MX6A 3GZGA 3MVWA 2CZHA 2RF1A 4YKKA 3QAXA 4OFLA 1DMBA 3QUFA 4JVIA 1P1NA 3IB1A 3MJNA 3P7IA 3JZJA 2XWIA 4NMYA 2VD2A 1KWHA 4HTGA 1MY1A 3E9XA 3RLFE 2L5VA 1TWYA 4DE8A 4YMBA 4G68B 2DYXA 2Y7WA 1QUIA 4F19A 4GWUA 3JYRA 3FGSA 4KYSA 2H25A 4PGPA 1LAGE 4C0RA 1M5FA 1EYIA 1A8EA 3LUYA 3K2DA 4GBWA 4ZE9A 3C31A 4MIJA 4NF8B 3MBPA 4F2QA 3CI8A 3DP8A 1KA0A 3QUJA 3CFLA 3A29A 4H0WA 1Q1KA 1NV7A 2F35A 1H3DA 1P1WA 4P9KA 3OO8A 2Q74A 4R75A 4AS4A 1R9LA 2GFEA 1B2HA 3GLBA 3G3GA 1FPFA 3VE1B 1BK4A 1UIUA 2WX9A 2V25A 4G68C 2P2AA 2CEYA 2XXTA 4R9FA 4BDOA 3K1NA 3VLWA 1MS7A 2GRVA 2NWJA 3HHFA 4JWXA 1LCTA 2F6GA 3TODA 4YMAA 1FBDA 4GX3A 4TLLB 4OZ9A 1B32A 2PMSA 4WEPA 1FQEA 2V3TA 4N13A 4NF6A 4QSEA 5L9OA 5DT6A 1NNKA 1US4A 2AYSA 3G3KA 2Q8JA 1UIVA 2Q88A 1FPEA 4G8HA 3UA8A 4EQ7A 4LP2B 2ANJA 1DCUA 2VPOA 2PT1A 3E4RA 2I48A 2OWSA 1PC3A 4QFPA 4ZEKA 1XVXA 1OIBA 2XWKA 3KC1A 3T9HB 1XVYA 4NEDA 5CMCA 1NH8A 4O8MA 3G3IA 3IK6B 3MZ9A 1ZU0A 3S9EA 5I2KA 5LOMA 4X1DA 2VPNA 5I5PA 1HSEA 4OWDA 4HE2A 4N6PA 4LONB 3E79A 1B0LA 1H45A 4POWA 1XT8A 4DCXA 4F18A 4IGRA 3U93A 1A8FA 1NV1A 1RDYA 5DEXB 3O6GA 3KJ7A 1AL3A 4O3AA 1MY4A 3S9NC 4OANA 5DW8A 1R1NA 1MH4A 1F9BA 4ELRA 3EF7A 4N4UA 3O29A 4P0GA 3L6HA 3FVOA 4H5GA 2OLBA 3FV2A 1H44A 2FHYA 4NG7A 1TXFA 3LUZA 4R6YA 3TTMA 1OQHA 1IXIA 3IOVA 4P1EA 2Z8EA 3HFUA 3MZ1A 3K6WA 3FBPA 5ICQA 1EYKA 5FHNA 4NF4B 3H6UA 3T1BA 1P1QA 1P1UA 1SYHA 2F34A 4OVQA 4OMBA 2HFBA 4DXBA 1B9JA 2RC7A 1IMAA 5FTIA 3IOUA 2DXRA 4GXAA 4H65A 1AIVA 2B4MA 3EHTA 1HSLA 1JVXA 5I56A 2QMXA 3IAZA 4U22A 3ISPA 3H6TA 4O7IA 4XXUA 4UACA 3A09A 3UORA 2I4BA 1O7TA 5A5LA 1FBEA 1VE4A 4QFNA 5I59A 3IX1A 5JTYA 2R9JA 3FXRA 3DP6A 3OOAA 4PP0A 2ONRA 3SEXA 4F22A 5FHOA 1MY0A 3U1OA 5A5XB 3Q29A 3FXBA 4G77A 3OO9A 5TU0A 5ESYA 1QKAA 5ICTA 2DQVA 2G93A 4U4XA 1AWBA 4OVRA 3FD3A 2Q8MA 3MC2A 5I3SA 4YAHX 2B65A 4BDNA 3M3KA 3ECRA 1POY1 4LQ2A 3V83A 1MXYA 2B4LA 2A5TA 4BDRA 4RJZA 3TQLA 1FPKA 1B3HA 3KEIA 2XHDA 5KZTA 3ZS6A 4NGUA 4GLIA 4XKQA 2HEUA 2H99A 1I6AA 1N84A 3OENA 2AL4A 3MW0A 2HZKA 3O6HA 3IOTA 1B5IA 3UN6A 1FW0A 5AE4A 1SW5A 4ZEDA 4FAJA 2V93A 2THIA 4DDDA 5FTHA 4EF2A 3FUZA 1FPLA 1QGXA 4RPOA 3RTWB 3EKIA 3H4ZA 4N17A 4F3BA 3SESA 1MG1A 4ONYA 2UXAA 3FVGA 1NNFA 3K6XA 5ITOA 4ELPA 1IXCA 2ALUA 1LFHA 5I58A 4TOZA 2YLNA 5B7DA 3G3FA 4YB5A 1VSOA 2DWHA 4GIZA 3BFUA 3IR1A 1FPDA 3U92A 5M2VA 2QFLA 4H46A 1NMUA 3LSWA 2VP1A 3M3LA 3BBRA 4I40A 5ELVA 3CVGA 2B3FA 1FCKA 4Q5TA 1SBPA 1D3KA 1A40A 2RC9A 1MPDA 3GXAA 3ZKLA 2RCBA 2WKYA 2P0SA 4OETA 3KBZA 3A3CA 2H4IA 2DWAA 2DDKA 1SYIA 3KSXA 4N8GA 2WYKA 4RXLA 4NHBA 1NV6A 4R6HA 4IO4A 1LGBC 1ZBMA 3MQ9A 4DXCA 4PDDA 2UYFA 5IAIA 4Q0CA 2BJIA 2RKMA 4MNPA 1TFAA 4U1ZA 4IB2A 1MQDA 2ZYKA 3O9PA 2XXUA 1M5DA 2Z22A 5AA2D 1ZTYA 2O68A 4MJOA 5ET7A 4NX1A 3MP1A 5IZZA 1D9YA 2G29A 4KPTA 4H67A 4PBHA 4EF1A 2DSFA 4GX4A 2ZYNA 3MSTA 2XXYA 4LN5A 4I62A 3K6VA 3RY3A 5DVFA 1BKAA 2Q9TA 2QSXA 3HV1A 2GH9A 3PUYE 1DTGA 3V8XB 1EZPA 2I4CA 5B70A 1DK4A 4MLVA 3Q25A 4OVJA 4K3FA 5EQAA 3RYDA 3VVDA 3CIJA 1NUXA 5EQ9A 1URSA 3LR1A 2FVZA 4X48A 3PPNA 2VHAA 4F31B 1WODA 1NFTA 2RINA 4THIA 3N5LA 5KDTA 1VDWA 4XTCQ 2QS4A 1Y3NA 1B7UA 4I3EA 2RCAA 4HW8A 3MPKA 4LZ5A 1DBZA 4Z7EA 4GVOA 2ZYOA 4I8CA 1H43A 3IJXB 2XXVA 4Z0IA 1PB9A 5CC2A 2QPQA 4ZECA 1OVTA 3OD7A 5TPAA 3IO6A 3K1MA 3DM0A 2PCRA 1DSNA 2F78A 3TCHA 4Q8RA 2XXIA 2VOZA 3GYYA 2I0CA 3PPRA 1B7HA 4PGNA 3I5OA 4EXKA 5H8SA 2ONSA 2RC8A 3VV5A 1D9VA 2ZMBA 4G2ZA 1ELJA 1NNTA 1FJ9A 3IFCA 5FBPA 1POTA 2R71A 2P3NA 2Y7IA 3RGYA 3PD8A 1OLAA 4XF5A 2OZZA 2X7PA 4BDMA 1UQWA 2HPGA 5AA2A 4FORA 1Y9UA 2O7UA 1UTHA 2CMOA 1LAHE 1B5JA 3IORA 4KI0E 3RPLB 1AH5A 1XOCA 3IB0A 2I6EA 2QVUA 4HCYA 4DLDA 3O66A 1NV5A 4H8IA 3GBBA 2HAVA 4GWXA 3S2VA 2PFZA 2MKZA 4KYDA 2DWJA 4XFEA 1B05A 3QSLA 2FYIA 4OA4A 1NUWA 4ZDMA 3M8UA 1IZ1A 2QRYA 5CBRA 1RDXA 1VFEA 4QF9A 1MXUA 2PBWA 1XC1A 3PMWA 4XEQA 1FBPA 1M5BA 2F7BA 4PFTA 1FBGA 5F7VA 4DI4B 2A5SA 4OVSA 3SZPA 2XWVA 4C1UA 2VT5A 2W7YA 2CEXA 2FNCA 4PFBA 1MRPA 3PUXE 1GVCA 3OSQA 3VDFA 1IITA 5EYGA 2XD2A 4BDQA 3T0JA 1IIWA 4ZZAA 3USDA 5F1QA 4EDPA 2OWTA 3B50A 4GD5A 2Y7PA 1B3FA 3W15C 1RDZA 4MLQA 3CFZA 3T22A 2V4CA 4DCYA 3K6UA 3RTFB 2QVRA 1BIYA 3B8BA 4KFQA 3VVEA 3MYUA 5DVJA 3RQTA 2KQZA 1FBFA 1Y3PA 4YKIA 1JEVA 3TMGA 4OXVA 3Q28A 2QMWA 1QJMA 5JK4A 2Y5LA 4IO7A 1UTBA 1NV2A 1IMCA 4YU0A 4MAGA 1XS5A 2O51A 4H45A 4O3CA 4ELQA 4F29A 2O69A 1FQDA 2DXYA 2HAUA 3IOWA 3KN7A 3T93B 4OQOA 1LAXA 1B40A 2DS9A 2I58A 2OWZA 1B52A 1LBBA 4RA1A 4QFLA 1QVSA 4H1XA 4JWYA 4FEDA 1BP5A 4PQJA 4HE0A 4IO5A 1Y4TA 3HCQA 4F1VA 1SVXB 1FJ6A 1ZMGA 4AB6A 3S4UA 4EXLA 1RYOA 2V84A 3TCFA 2Z8DA 1B3GA 5H8HA 1LSTA 2DOJA 1B6HA 1Y1MA 1MQIA 3TQWA 2XXPA 3BFTA 3Q26A 4G61A 2DVZA 3JV9A 1RKMA 2IA4A 3ZSFA 4LA9A 3HPIA 3N6TA 2Y7KA 4NQ8A 1B3EA 3G7WA 3H7MA 1FBHA 3E13X 4JVCA 1FTJA 5TPAB 1B0HA 1B1HA 2XXXA 2HXWA 5ITPA 3W9WA 4KCCA 3B6WA 1IMBA 4GBVA 4IGTA 4HE1A 1QULA 1BLFA 2XD3A 5L8DA 4DIGA 5ET6A 1NV4A 4PBQA 1QUKA 1JEUA 1CNQA 1PB8A 4DZ1A 3TUSA 4FE8A 1QW0A 4GL0A 3FXUA 1YTVA 1ZKBA 1IMFA 3PUZE 2CZLA 4GXSB 2H9BA 5I59B 2VD3A 1YYZA 3R6UA 1YCJA 4MBPA 4OESA 3PUWE 4EUOA 3C36A 5LDZA 4KYEA 1UTHB 2XXQA 4F3GA 4XKPA 2VGQA 4M4GA 4X8RA 5A5XA 4DI3D 1LBVA 5H8FA 4UABA 4U23A 4MMPA 3R7XA 2WEFA 1JNFA 1MPBA 4OVPA 1KZ8A 2E0SA 4L17A 3ONMA 4WXJA 4U21A 3KSJA 2O6AA 1FTKA 5H8NB 2YPNA 1I6QA 4OVTA 1NH7A 1B7ZA 2V3QA 2F7CA 4PFWA 3FXQA 1NL5A 1FSAA 3H06B 1Q9DA 4XKRA 1URDA 1FQAA 5EYHA 5CMMA 4R9GA 3PPPA 3H03A 3QIMA 5BWJA 1S7YA 3PMVA 1IMDA 4G8MA 1JQFA 2F36A 4PE5B 4OFOA 3KBRA 2ESNA 3CR9A 3IFAA 4PDHA 3U94A 4G4PA 2XXKA 4X04A 3ILTB 1JW4A 3QYTA 3SEWA 4MHFA 5DVIA 2XWOA 1MXZA 1CE2A 1JVYA 3MVZA 4GRKA 2GQ1A 3O6IA 4IY5A 3C32A 2NOOA 3SEUA 1INPA 3MZBA 4R73A 1JETA 4MNCA 1G0IA 3FJMA 5I2NA 1QKBA 1ANFA 4FEBA 3N94A 4OERA 4QXDA 2XX9A 3C4MA 2HQ0A 4FIMA 3ZKKA 3OELA 4WKMA 1D4NA 4ZEBA 4GWOA 3C35A 1MM6A 4U1OA 3E78A 5AA1A 3RUMA 3HO7A 1FTOA 2HXRA 3CRBA 2WBDA 1TFDA 2REGA 4GWWA 2UVJA 1WVJA 1TT1A 3BIHA 3BKIB 4TQUQ 3DELB 3T9UA 2CZKA 4QSCA 4QHQA 3KG2A 5I57A 2NVUB 5J1DA 4R6KA 2OBGA 3NOHA 3WAFA 3SEVA 1Z7ME 4GOTA 2AIXA 2IEEA 1FTLA 1N7WA 1IEJA 3V89B 1LBCA 4YICA 1LBWA 4N6DA 5CM6A 4GF8A 1M5EA 3CSBA 4PAKA 3V5AA 4FECA 3ODBA 4AB5A 1GR2A 1LFGA 1ATGA 1FPBA 2QS2A 4PF8A 4MNIA 4N15A 1LEVA 4LQ5A 2GHBA 1EH3A 4P56A 5TP9A 2CZIA 4QSDA 3TELA 3E3KA 4HXVA 4BDLA 3PGFA 3RN8A 2WYPA 4KD5A 4R74A 1SI1A 1LFIA 3FJGA 2V3UA 5KDTB 1Y3QA 4LATA 1GGGA 2QS1A 2XXRA 1FTMA 4XKNA 4GWSA 5I7IA 5L9SA 4N91A 4FBPA 1YXIA 2Q2CA 4NF0A 2HCAA 3CG3A 2F6PA 4IR8A 1MY2A 5EQ7A 3PU5A 5FHMA 3H6WA 1P99A 3O97A 3OMBA 4YB6A 1JW5A 1NV3A 2Z23A 2DE3A 2O1LA 3KOTA 2NXOA 4ND9A 4PC9A
chains in the Genus database with same CATH topology
4PFYA 3T9XB 4NF5A 1QUJA 5A5XB 3HHGA 3Q29A 5HPQA 2QMWA 1QJMA 5JK4A 1MPCA 3K4UA 3D4CA 2I49A 1SDXA 5H8FB 4F1YA 4IO7A 1M5CA 4G77A 1UTBA 4F1VA 3OO9A 5TU0A 3SETA 3U72A 3VLVA 1QKAA 3IL1B 5ICTA 4KQPA 2DQVA 2F97A 2G93A 3OO6A 4JBZA 4U4XA 4YU0A 5AA4B 1URGA 1XS5A 3FD3A 3FIRA 2O51A 4O3CA 3KGCA 3MC2A 3THIA 4ELQA 4F29A 1O63A 4YAHX 1OMPA 2B65A 4E0WA 2O69A 3M3KA 3VXCA 4BDNA 3ECRA 1FQDA 1POY1 1RYXA 2D3IA 3LSFB 1Y4CA 4LQ2A 4OHNA 1MXYA 3V83A 4OEVA 3MWBA 2DXYA 1B51A 2HAUA 2DWIA 2A5TA 3IOWA 1ZJLA 4ISUA 3OEMA 3PMXA 4BDRA 3KN7A 3H3GA 4OFJA 3T93B 4RJZA 3TQLA 4RYAA 3N26A 4OQOA 1LAXA 5CRYA 5EYFA 3KOSA 3EHSA 1B40A 3MP8A 2DS9A 2I58A 1B3HA 3KEIA 4ESWA 2XHDA 1DTZA 5KZTA 1B52A 1LBBA 4MH5A 3ZS6A 3C34A 1MXXA 1YPNA 3KJTA 5I2KB 1N0TA 3DP4A 4RA1A 4ESXA 1NNPA 4PFUA 4QFLA 1QVSA 3CG1A 4GLIA 1Y20A 1A55A 2HEUA 4XKQA 2H99A 3LC8A 4H1XA 4JWYA 1P1OA 1I6AA 1N84A 3MAMA 1WDNA 2OK2A 1PBQA 2AL4A 3OENA 3C9HA 1Y1ZA 4FEDA 3MW0A 1BP5A 4NF8A 4PQJA 4XIGQ 4IO5A 1Y4TA 4X1BA 3B6QA 4F2OA 2Y7RA 2HZKA 3HCQA 3O6HA 3PV0E 3Q27A 4LZ8A 3IOTA 2R6GE 3UK4A 3FJ7A 3T9VA 4EQ9A 1B5IA 1SW4A 2BJJX 3UN6A 1FW0A 1MQGA 1SVXB 1ZMGA 4H5FA 1OQGA 5AE4A 1SW2A 1SW5A 3S9MC 4ZEDA 1Q35A 2V93A 4FAJA 4AB6A 2THIA 1MXVA 3S4UA 4EXLA 1RYOA 2V84A 2F5XA 1A54A 2Z8DA 3SERA 5FTHA 2UVGA 3TCFA 4DDDA 4EF2A 1B3GA 4QFOA 5DEXA 3FUZA 4X9TA 5ISUA 5H8HA 2UVHA 3HN0A 1N04A 3MVXA 2E1SA 4RPOA 3RTWB 1ZIUA 1I6BA 3VFJA 3MUQA 3H4ZA 1N76A 3TAJA 1Z7NE 1LSTA 2DOJA 4F3BA 1B6HA 1Y1MA 1MQIA 1MG1A 3KN8A 4ZEFA 4ONYA 1B4ZA 3SESA 1USYE 2UXAA 4RY1A 2AL5A 2H5YA 4YZZA 3CSGA 2XXPA 3TQWA 3FVGA 3BFTA 1MH3A 1NNFA 3K6XA 4YKPA 3Q26A 4OENA 5ITOA 4U2RA 2DVZA 3JV9A 3QXMA 1IXCA 1R6ZA 1RKMA 1SQYA 2IA4A 3C33A 4QRZA 4RK2A 5CMBA 3ZSFA 1AMFA 4LA9A 5HM4B 5CBSA 1GTKA 2ALUA 3EQ1A 3HPIA 1AOVA 3N6TA 2Y7KA 1PB7A 1I69A 1EU8A 1N3XA 1B3LA 5KCJB 5I58A 1B3EA 3G7WA 3H7MA 3OEKA 4TOZA 4NTLA 4GFRA 3E13X 2YLNA 4MFIA 5B7DA 3G3FA 1FTJA 4M1VA 5H8QB 3PD9A 4YB5A 1VSOA 3UGWA 2DWHA 4GIZA 5TPAB 4JB7A 1B0HA 3BFUA 3IR1A 1T0KA 1B1HA 5L9MA 3A3UA 2QS3A 2HXWA 2XXXA 4P0IA 3U92A 5ITPA 5M2VA 3W9WA 5I2NB 5TP9B 4KCCA 3B6WA 1NMUA 1ZLQA 3LSWA 2VP1A 3M3LA 4IGTA 1MDP1 3BBRA 3MPLA 5I84A 1MXWA 1LAFE 1MQHA 5ELVA 3CVGA 3B7DA 2B3FA 3MVYA 1FCKA 1QULA 3F11A 1XHYA 2O7IA 3K1PA 4Q5TA 1JW1A 3I3VA 3MP6A 1BLFA 1DPPA 1SBPA 1D3KA 2XD3A 1LLSA 4KCDA 4JSDA 4ZEIA 5EHMA 5L8DA 2H98A 4DIGA 5JEIA 3L6GA 4KHZE 3FATA 2XX8A 4Q30B 2Q89A 1A40A 3FV1A 1QUKA 3W9VA 1JEUA 2RC9A 1MPDA 1PB8A 1J1NA 4DZ1A 3GXAA 3I6VA 3ZKLA 5I56B 3PPQA 4FE8A 4WEDA 3TUSA 2PX1A 2RCBA 3TPAA 3IB2A 4F3PA 2ZXTA 4N07A 3TTNA 2WKYA 1DPEA 1QW0A 2P0SA 4GL0A 1B46A 1YTVA 3FXUA 4OETA 5EHSA 1ZKBA 5K2YA 3A3CA 2H4IA 3O2AA 1IXGA 3PUZE 3TTKA 2DWAA 2CZLA 4GXSB 2H9BA 4HCWA 4NE4A 3RNNA 5I59B 2VD3A 3RT8A 2DVCA 4OTEA 2PYYA 5JTYB 1SYIA 3R6UA 1HSJA 3EN3A 3KSXA 4IY6A 1MY3A 1YCJA 4MBPA 4OESA 3PUWE 5AA2B 1B58A 2X26A 4EUOA 1DOTA 4RXLA 4YKJA 1B1XA 3C36A 4POXA 2OJTA 2PVUA 4DXUA 4G8NA 4KYEA 3CFXA 4R6HA 1UTHB 3LBSA 2XXQA 4IO4A 1LGBC 4F3GA 1ZBMA 3MQ9A 4DXCA 1N3WA 1PDAA 3GZGA 3IJOB 4XKPA 2VGQA 3MVWA 3FASA 4JXIA 4M4GA 2UYFA 4RPNA 2RF1A 4YKKA 3QAXA 5IAIA 5I57B 4Q0CA 5A5XA 3B6TA 2RKMA 4OFLA 1TFAA 4NWCA 1OLCA 3R26A 1DMBA 3QUFA 4U1ZA 5H8FA 1P1NA 3IB1A 4IB2A 3MJNA 1UTBB 3P7IA 3JZJA 4U23A 1GV8A 4NMYA 1MQDA 2VD2A 2ZYKA 2XXUA 3O9PA 4ZS9A 1M5DA 3R7XA 3T96B 3KN3A 1KWHA 2Z22A 3TYHA 4HTGA 5AA2D 1MY1A 1ZTYA 3E9XA 4ZE8A 1JNFA 2O68A 3RLFE 1MPBA 1TWYA 4DE8A 2E0SA 4YMBA 3MP1A 4G68B 4L17A 3TCGA 3ONMA 1D9YA 2DYXA 2G29A 4U21A 4KPTA 4WXJA 3KSJA 2O6AA 3TFLA 5I56A 4H67A 4EF1A 1FTKA 2Y7WA 2DSFA 1QUIA 4F19A 3AXFA 5H8NB 2YPNA 1PEBA 1YAEA 3SKPA 2F7AA 2ZYNA 1USYH 1I6QA 2XXYA 3JYRA 1NH7A 4I62A 3FGSA 1B7ZA 4KYSA 2H25A 1LAGE 4GL8A 3K6VA 1BTJA 4C0RA 3K0VA 3RY3A 1M5FA 5DVFA 2V3QA 1BKAA 2F7CA 2Q9TA 1A8EA 4LVQA 2PT2A 2QSXA 3HV1A 2GH9A 3LUYA 3PUYE 4PFWA 3FXQA 1DTGA 2LAOA 3K2DA 1NL5A 3V8XB 3C31A 1FQFA 4ZE9A 3H06B 2I4CA 4NF8B 5B70A 1EZPA 3MBPA 4ND9A 4H8JA 4XKRA 4C1TA 4R2FA 1URDA 4F2QA 1FQAA 3CI8A 3DP8A 1SW1A 4NF4A 4MLVA 5CMMA 3Q25A 4ECFA 4OVJA 3QUJA 4K3FA 4R9GA 3CFLA 4O3BA 3PPPA 3VVDA 3CIJA 3H03A 1SD3A 3QIMA 4H0WA 1MDQA 1URSA 3LR1A 1Q1KA 4OEUA 4RNSA 2F35A 1H3DA 1S7YA 1P1WA 5BWJA 1IUDA 3PMVA 4X48A 4AQ4A 4MF3A 3PPNA 3DLNA 1VFDA 3OO8A 3TKDA 2VHAA 4F31B 3K01A 4G8MA 4R75A 3SDFA 5H8HB 4UA8A 1WODA 1JQFA 1R9LA 2ZNSA 1NFTA 2F36A 2GFEA 2REJA 2RINA 4PE5B 4OFOA 4THIA 3N5LA 3KBRA 2ESNA 5KDTA 4XTCQ 2QS4A 3CR9A 1Y3NA 4E0XA 1B2HA 1B7UA 2I0BA 3GLBA 3U94A 3G3GA 3H6VA 4I9DA 4G4PA 1H76A 2QJEA 1B4HA 2RCAA 4HW8A 3ILTB 1JW4A 2OCUA 3MPKA 3QYTA 3SEWA 3VE1B 1EZOA 1UIUA 5DVIA 4OYVA 1MXZA 2D21A 2V25A 4LZ5A 4Z7EA 4G68C 4GVOA 2P2AA 1CE2A 2ZYOA 4I8CA 1JVYA 1H43A 3MVZA 2XXTA 3OSRA 4GRKA 4JDFA 4R9FA 3UP9A 4BDOA 3IJXB 3K1NA 2NUVA 1LCFA 2XXVA 3VLWA 1MS7A 3OO7A 3O6IA 1PB9A 4Z0IA 2GRVA 5CC2A 2QPQA 3K02A 2NWJA 3HHFA 2D5WA 4ZECA 1II5A 4IY5A 3C32A 1LCTA 1MM7A 3ILUB 2F6GA 4JWXA 1OVTA 1R9QA 1S9TA 2NOOA 5H8QA 3OD7A 3SEUA 3TODA 3MZBA 4TLLB 4YMAA 3G3JA 5TPAA 4R73A 4OZ9A 3N6UA 3IO6A 1B32A 3K1MA 2YJPA 1N7XA 1JETA 2PMSA 4WEPA 1FQEA 2V3TA 4N13A 4NF6A 4QSEA 2QL3A 3FJMA 4TLMB 3KZGA 3DM0A 5I2NA 1DSNA 1QKBA 5L9OA 1ANFA 2F78A 5DT6A 3TCHA 4Q8RA 4NF5B 4FATA 1S50A 4FEBA 2XXIA 2VOZA 2ONKE 1NNKA 3N94A 1US4A 2AYSA 4OERA 3G3KA 2Q8JA 1CB6A 2XX9A 1UIVA 2I0CA 2Q88A 3PPRA 4JSOA 1FQCA 4F1UA 1B7HA 4G8HA 3C4MA 3UA8A 4U4SA 2HQ0A 3TTRA 4EQ7A 3I5OA 4LP2B 4LZ7A 4FIMA 2ANJA 2ZYMA 5CMKA 4BLAA 2PT1A 5AA4A 3UIFA 3OELA 3E4RA 5K2XA 3EPEA 3ZKKA 2I48A 2OWSA 4WKMA 4EXKA 1D4NA 1PC3A 5H8SA 2DP8A 3FVNA 4QFPA 2ONSA 4ZEBA 4ZEKA 1XVXA 2RC8A 1OIBA 4GWOA 1D9VA 2ZMBA 3VV5A 3FVKA 4G2ZA 3T9HB 1XVYA 1ELJA 2F8DA 2A5TB 3C35A 4NEDA 3GBAA 1MM6A 5CMCA 4U1OA 1NNTA 1O64A 2O84X 5AA1A 3OXNA 3RUMA 3HO7A 2UVIA 1POTA 1FTOA 2XXWA 4JWOA 4R72A 1NH8A 2R71A 3G3IA 3HSTA 3CRBA 2Q2AA 1ZU0A 2Y7IA 3IK6B 3MZ9A 3RGYA 3S9EA 3VVFA 2B3BA 3PD8A 1OLAA 5I2KA 2OZZA 3TZAA 1PBPA 2X7PA 4BDMA 1UQWA 1TFDA 5LOMA 5AA2A 2REGA 4X1DA 4PETA 1HSEA 4OWDA 2UVJA 2ZNUA 3KFMA 4FORA 4YB7A 1Y9UA 3G3HA 2O7UA 5DTBA 1WVJA 1TT1A 2DE2A 2Y84A 3D4GA 1UTHA 4LONB 4N6PA 3BKIB 1B0LA 2CMOA 3QK6A 4TQUQ 3DELB 1H45A 1US5A 2FA7A 2X7QA 4POWA 3T9UA 1XT8A 4QSCA 1LAHE 1B5JA 3TDJA 3IORA 4QHQA 3KG2A 4KI0E 5I57A 4DCXA 4F18A 1AH5A 1XOCA 2NVUB 5J1DA 4IGRA 3IB0A 2M8CA 2OBGA 2I6EA 4R6KA 3U93A 1A8FA 3PUVE 5DEXB 3O6GA 3WAFA 3SEVA 4R2BA 1A99A 1Z7ME 2XXHA 3KJ7A 4HCYA 4F3SA 1AL3A 4O3AA 2HZLA 4RK9A 4ELOA 2Z8FA 4ELPA 4GOTA 3IO4A 2P1SA 4QFKA 1MY4A 2AIXA 4DLDA 3O66A 2IEEA 3S9NC 4H8IA 3FZVA 1R1NA 1MH4A 1FTLA 4IO2A 3VLUA 3GBBA 2HAVA 3S2VA 1IXHA 1F9BA 4GQOA 4ELRA 3EF7A 4G68A 4KYDA 1N7WA 3O29A 4P0GA 2DWJA 1IEJA 3V89B 1B05A 3PPOA 3L6HA 3QSLA 2FYIA 1LBCA 4YICA 1OVBA 3FVOA 4H5GA 5H8NA 3TEPA 2OLBA 5CM6A 4ZDMA 3M8UA 1IZ1A 4GF8A 1M5EA 3FV2A 3CSBA 2QRYA 5CBRA 1H44A 1IQ7A 5AA3A 1EZ9A 1VFEA 3V5AA 4QF9A 1MXUA 1TXFA 4FECA 2PBWA 1VR5A 4KR5A 4R6YA 1XC1A 3U8QA 3ODBA 3PMWA 3TTLA 3TTMA 4AB5A 5I58B 5KCJA 1OQHA 1GR2A 1IXIA 1LFGA 1ATGA 2DE4A 1M5BA 2F7BA 2QS2A 3IOVA 4H6DA 4PFTA 2Z8EA 3MZ1A 3K6WA 3T66A 5ICQA 4I1DA 5FHNA 1LFHA 4LQ5A 3O28A 2GHBA 4IO6A 1EH3A 5F7VA 1L5TA 5L9SA 4NF4B 3LSLA 3H6UA 5TP9A 2A5SA 1P1QA 4QSDA 2I3VA 3TELA 1P1UA 3RT6B 4C1UA 2UYEA 5HBCA 1SYHA 3E3KA 1SI0A 2F34A 2W7YA 2FNCA 4OMBA 2HFBA 4BDLA 3PGFA 4HS7A 1MRPA 5DYHA 3RN8A 3EHUA 3WAEA 4KD5A 1B9JA 4R74A 4DXBA 2RC7A 1SI1A 1LFIA 5FTIA 3FJGA 3PUXE 1GVCA 2V3UA 3OSQA 3IOUA 1IITA 1Y3QA 2DXRA 3VDFA 4LATA 1GGGA 5KDTB 2QS1A 2XD2A 3K00A 4GXAA 2XXRA 4H65A 3U1OA 4BDQA 1FTMA 4XKNA 1AIVA 1IIWA 1LB8A 1HSLA 3EHTA 1LB9A 1JVXA 4LUBA 5F1QA 2GHAA 2QMXA 4ZZAA 3IAZA 3RPWA 3USDA 2OWTA 4EDPA 4EQBA 4GD5A 2Y7PA 1B3FA 3H6TA 2Q2CA 4U22A 3VXBA 3W15C 4XXUA 4MLQA 1NKXA 3CFZA 4UACA 2ZNTA 3A09A 3T22A 3UORA 2I3WA 1B5HA 2I4BA 1O7TA 1FQBA 2HCAA 1VE4A 4QFNA 5I59A 4DCYA 3CG3A 3K6UA 3RTFB 3IX1A 2F6PA 1BIYA 5JTYA 2O1MA 3M3FA 1MQJA 2R9JA 4FJPA 4NWDA 2KLFA 4IO3A 1MY2A 4KFQA 3PU5A 5CI5A 3S9LC 5FHMA 3VVEA 3H6WA 1P99A 3SEYA 3O97A 3OMBA 3FXRA 4YB6A 5DVJA 4ZZEA 3RQTA 4F39A 5BUUA 2XX7A 3DP6A 3OOAA 1JW5A 4PP0A 1Y3PA 2ONRA 3SEXA 1A7LA 4YKIA 4F22A 1JEVA 2Z23A 4NF6B 5FHOA 2DE3A 2ABHA 2O1LA 3TMGA 3KOTA 4P11A 4OXVA 1MY0A 2NXOA 3LSXA 5IKBA 3Q28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PFY A;  3T9X B;  4NF5 A;  1QUJ A;  5A5X B;  3HHG A;  3Q29 A;  5HPQ A;  2QMW A;  1QJM A;  5JK4 A;  1MPC A;  3K4U A;  3D4C A;  2I49 A;  1SDX A;  5H8F B;  4F1Y A;  4IO7 A;  1M5C A;  4G77 A;  1UTB A;  4F1V A;  3OO9 A;  5TU0 A;  3SET A;  3U72 A;  3VLV A;  1QKA A;  3IL1 B;  5ICT A;  4KQP A;  2DQV A;  2F97 A;  2G93 A;  3OO6 A;  4JBZ A;  4U4X A;  4YU0 A;  5AA4 B;  1URG A;  1XS5 A;  3FD3 A;  3FIR A;  2O51 A;  4O3C A;  3KGC A;  3MC2 A;  3THI A;  4ELQ A;  4F29 A;  1O63 A;  4YAH X;  1OMP A;  2B65 A;  4E0W A;  2O69 A;  3M3K A;  3VXC A;  4BDN A;  3ECR A;  1FQD A;  1POY 1;  1RYX A;  2D3I A;  3LSF B;  1Y4C A;  4LQ2 A;  4OHN A;  1MXY A;  3V83 A;  4OEV A;  3MWB A;  2DXY A;  1B51 A;  2HAU A;  2DWI A;  2A5T A;  3IOW A;  1ZJL A;  4ISU A;  3OEM A;  3PMX A;  4BDR A;  3KN7 A;  3H3G A;  4OFJ A;  3T93 B;  4RJZ A;  3TQL A;  4RYA A;  3N26 A;  4OQO A;  1LAX A;  5CRY A;  5EYF A;  3KOS A;  3EHS A;  1B40 A;  3MP8 A;  2DS9 A;  2I58 A;  1B3H A;  3KEI A;  4ESW A;  2XHD A;  1DTZ A;  5KZT A;  1B52 A;  1LBB A;  4MH5 A;  3ZS6 A;  3C34 A;  1MXX A;  1YPN A;  3KJT A;  5I2K B;  1N0T A;  3DP4 A;  4RA1 A;  4ESX A;  1NNP A;  4PFU A;  4QFL A;  1QVS A;  3CG1 A;  4GLI A;  1Y20 A;  1A55 A;  2HEU A;  4XKQ A;  2H99 A;  3LC8 A;  4H1X A;  4JWY A;  1P1O A;  1I6A A;  1N84 A;  3MAM A;  1WDN A;  2OK2 A;  1PBQ A;  2AL4 A;  3OEN A;  3C9H A;  1Y1Z A;  4FED A;  3MW0 A;  1BP5 A;  4NF8 A;  4PQJ A;  4XIG Q;  4IO5 A;  1Y4T A;  4X1B A;  3B6Q A;  4F2O A;  2Y7R A;  2HZK A;  3HCQ A;  3O6H A;  3PV0 E;  3Q27 A;  4LZ8 A;  3IOT A;  2R6G E;  3UK4 A;  3FJ7 A;  3T9V A;  4EQ9 A;  1B5I A;  1SW4 A;  2BJJ X;  3UN6 A;  1FW0 A;  1MQG A;  1SVX B;  1ZMG A;  4H5F A;  1OQG A;  5AE4 A;  1SW2 A;  1SW5 A;  3S9M C;  4ZED A;  1Q35 A;  2V93 A;  4FAJ A;  4AB6 A;  2THI A;  1MXV A;  3S4U A;  4EXL A;  1RYO A;  2V84 A;  2F5X A;  1A54 A;  2Z8D A;  3SER A;  5FTH A;  2UVG A;  3TCF A;  4DDD A;  4EF2 A;  1B3G A;  4QFO A;  5DEX A;  3FUZ A;  4X9T A;  5ISU A;  5H8H A;  2UVH A;  3HN0 A;  1N04 A;  3MVX A;  2E1S A;  4RPO A;  3RTW B;  1ZIU A;  1I6B A;  3VFJ A;  3MUQ A;  3H4Z A;  1N76 A;  3TAJ A;  1Z7N E;  1LST A;  2DOJ A;  4F3B A;  1B6H A;  1Y1M A;  1MQI A;  1MG1 A;  3KN8 A;  4ZEF A;  4ONY A;  1B4Z A;  3SES A;  1USY E;  2UXA A;  4RY1 A;  2AL5 A;  2H5Y A;  4YZZ A;  3CSG A;  2XXP A;  3TQW A;  3FVG A;  3BFT A;  1MH3 A;  1NNF A;  3K6X A;  4YKP A;  3Q26 A;  4OEN A;  5ITO A;  4U2R A;  2DVZ A;  3JV9 A;  3QXM A;  1IXC A;  1R6Z A;  1RKM A;  1SQY A;  2IA4 A;  3C33 A;  4QRZ A;  4RK2 A;  5CMB A;  3ZSF A;  1AMF A;  4LA9 A;  5HM4 B;  5CBS A;  1GTK A;  2ALU A;  3EQ1 A;  3HPI A;  1AOV A;  3N6T A;  2Y7K A;  1PB7 A;  1I69 A;  1EU8 A;  1N3X A;  1B3L A;  5KCJ B;  5I58 A;  1B3E A;  3G7W A;  3H7M A;  3OEK A;  4TOZ A;  4NTL A;  4GFR A;  3E13 X;  2YLN A;  4MFI A;  5B7D A;  3G3F A;  1FTJ A;  4M1V A;  5H8Q B;  3PD9 A;  4YB5 A;  1VSO A;  3UGW A;  2DWH A;  4GIZ A;  5TPA B;  4JB7 A;  1B0H A;  3BFU A;  3IR1 A;  1T0K A;  1B1H A;  5L9M A;  3A3U A;  2QS3 A;  2HXW A;  2XXX A;  4P0I A;  3U92 A;  5ITP A;  5M2V A;  3W9W A;  5I2N B;  5TP9 B;  4KCC A;  3B6W A;  1NMU A;  1ZLQ A;  3LSW A;  2VP1 A;  3M3L A;  4IGT A;  1MDP 1;  3BBR A;  3MPL A;  5I84 A;  1MXW A;  1LAF E;  1MQH A;  5ELV A;  3CVG A;  3B7D A;  2B3F A;  3MVY A;  1FCK A;  1QUL A;  3F11 A;  1XHY A;  2O7I A;  3K1P A;  4Q5T A;  1JW1 A;  3I3V A;  3MP6 A;  1BLF A;  1DPP A;  1SBP A;  1D3K A;  2XD3 A;  1LLS A;  4KCD A;  4JSD A;  4ZEI A;  5EHM A;  5L8D A;  2H98 A;  4DIG A;  5JEI A;  3L6G A;  4KHZ E;  3FAT A;  2XX8 A;  4Q30 B;  2Q89 A;  1A40 A;  3FV1 A;  1QUK A;  3W9V A;  1JEU A;  2RC9 A;  1MPD A;  1PB8 A;  1J1N A;  4DZ1 A;  3GXA A;  3I6V A;  3ZKL A;  5I56 B;  3PPQ A;  4FE8 A;  4WED A;  3TUS A;  2PX1 A;  2RCB A;  3TPA A;  3IB2 A;  4F3P A;  2ZXT A;  4N07 A;  3TTN A;  2WKY A;  1DPE A;  1QW0 A;  2P0S A;  4GL0 A;  1B46 A;  1YTV A;  3FXU A;  4OET A;  5EHS A;  1ZKB A;  5K2Y A;  3A3C A;  2H4I A;  3O2A A;  1IXG A;  3PUZ E;  3TTK A;  2DWA A;  2CZL A;  4GXS B;  2H9B A;  4HCW A;  4NE4 A;  3RNN A;  5I59 B;  2VD3 A;  3RT8 A;  2DVC A;  4OTE A;  2PYY A;  5JTY B;  1SYI A;  3R6U A;  1HSJ A;  3EN3 A;  3KSX A;  4IY6 A;  1MY3 A;  1YCJ A;  4MBP A;  4OES A;  3PUW E;  5AA2 B;  1B58 A;  2X26 A;  4EUO A;  1DOT A;  4RXL A;  4YKJ A;  1B1X A;  3C36 A;  4POX A;  2OJT A;  2PVU A;  4DXU A;  4G8N A;  4KYE A;  3CFX A;  4R6H A;  1UTH B;  3LBS A;  2XXQ A;  4IO4 A;  1LGB C;  4F3G A;  1ZBM A;  3MQ9 A;  4DXC A;  1N3W A;  1PDA A;  3GZG A;  3IJO B;  4XKP A;  2VGQ A;  3MVW A;  3FAS A;  4JXI A;  4M4G A;  2UYF A;  4RPN A;  2RF1 A;  4YKK A;  3QAX A;  5IAI A;  5I57 B;  4Q0C A;  5A5X A;  3B6T A;  2RKM A;  4OFL A;  1TFA A;  4NWC A;  1OLC A;  3R26 A;  1DMB A;  3QUF A;  4U1Z A;  5H8F A;  1P1N A;  3IB1 A;  4IB2 A;  3MJN A;  1UTB B;  3P7I A;  3JZJ A;  4U23 A;  1GV8 A;  4NMY A;  1MQD A;  2VD2 A;  2ZYK A;  2XXU A;  3O9P A;  4ZS9 A;  1M5D A;  3R7X A;  3T96 B;  3KN3 A;  1KWH A;  2Z22 A;  3TYH A;  4HTG A;  5AA2 D;  1MY1 A;  1ZTY A;  3E9X A;  4ZE8 A;  1JNF A;  2O68 A;  3RLF E;  1MPB A;  1TWY A;  4DE8 A;  2E0S A;  4YMB A;  3MP1 A;  4G68 B;  4L17 A;  3TCG A;  3ONM A;  1D9Y A;  2DYX A;  2G29 A;  4U21 A;  4KPT A;  4WXJ A;  3KSJ A;  2O6A A;  3TFL A;  5I56 A;  4H67 A;  4EF1 A;  1FTK A;  2Y7W A;  2DSF A;  1QUI A;  4F19 A;  3AXF A;  5H8N B;  2YPN A;  1PEB A;  1YAE A;  3SKP A;  2F7A A;  2ZYN A;  1USY H;  1I6Q A;  2XXY A;  3JYR A;  1NH7 A;  4I62 A;  3FGS A;  1B7Z A;  4KYS A;  2H25 A;  1LAG E;  4GL8 A;  3K6V A;  1BTJ A;  4C0R A;  3K0V A;  3RY3 A;  1M5F A;  5DVF A;  2V3Q A;  1BKA A;  2F7C A;  2Q9T A;  1A8E A;  4LVQ A;  2PT2 A;  2QSX A;  3HV1 A;  2GH9 A;  3LUY A;  3PUY E;  4PFW A;  3FXQ A;  1DTG A;  2LAO A;  3K2D A;  1NL5 A;  3V8X B;  3C31 A;  1FQF A;  4ZE9 A;  3H06 B;  2I4C A;  4NF8 B;  5B70 A;  1EZP A;  3MBP A;  4ND9 A;  4H8J A;  4XKR A;  4C1T A;  4R2F A;  1URD A;  4F2Q A;  1FQA A;  3CI8 A;  3DP8 A;  1SW1 A;  4NF4 A;  4MLV A;  5CMM A;  3Q25 A;  4ECF A;  4OVJ A;  3QUJ A;  4K3F A;  4R9G A;  3CFL A;  4O3B A;  3PPP A;  3VVD A;  3CIJ A;  3H03 A;  1SD3 A;  3QIM A;  4H0W A;  1MDQ A;  1URS A;  3LR1 A;  1Q1K A;  4OEU A;  4RNS A;  2F35 A;  1H3D A;  1S7Y A;  1P1W A;  5BWJ A;  1IUD A;  3PMV A;  4X48 A;  4AQ4 A;  4MF3 A;  3PPN A;  3DLN A;  1VFD A;  3OO8 A;  3TKD A;  2VHA A;  4F31 B;  3K01 A;  4G8M A;  4R75 A;  3SDF A;  5H8H B;  4UA8 A;  1WOD A;  1JQF A;  1R9L A;  2ZNS A;  1NFT A;  2F36 A;  2GFE A;  2REJ A;  2RIN A;  4PE5 B;  4OFO A;  4THI A;  3N5L A;  3KBR A;  2ESN A;  5KDT A;  4XTC Q;  2QS4 A;  3CR9 A;  1Y3N A;  4E0X A;  1B2H A;  1B7U A;  2I0B A;  3GLB A;  3U94 A;  3G3G A;  3H6V A;  4I9D A;  4G4P A;  1H76 A;  2QJE A;  1B4H A;  2RCA A;  4HW8 A;  3ILT B;  1JW4 A;  2OCU A;  3MPK A;  3QYT A;  3SEW A;  3VE1 B;  1EZO A;  1UIU A;  5DVI A;  4OYV A;  1MXZ A;  2D21 A;  2V25 A;  4LZ5 A;  4Z7E A;  4G68 C;  4GVO A;  2P2A A;  1CE2 A;  2ZYO A;  4I8C A;  1JVY A;  1H43 A;  3MVZ A;  2XXT A;  3OSR A;  4GRK A;  4JDF A;  4R9F A;  3UP9 A;  4BDO A;  3IJX B;  3K1N A;  2NUV A;  1LCF A;  2XXV A;  3VLW A;  1MS7 A;  3OO7 A;  3O6I A;  1PB9 A;  4Z0I A;  2GRV A;  5CC2 A;  2QPQ A;  3K02 A;  2NWJ A;  3HHF A;  2D5W A;  4ZEC A;  1II5 A;  4IY5 A;  3C32 A;  1LCT A;  1MM7 A;  3ILU B;  2F6G A;  4JWX A;  1OVT A;  1R9Q A;  1S9T A;  2NOO A;  5H8Q A;  3OD7 A;  3SEU A;  3TOD A;  3MZB A;  4TLL B;  4YMA A;  3G3J A;  5TPA A;  4R73 A;  4OZ9 A;  3N6U A;  3IO6 A;  1B32 A;  3K1M A;  2YJP A;  1N7X A;  1JET A;  2PMS A;  4WEP A;  1FQE A;  2V3T A;  4N13 A;  4NF6 A;  4QSE A;  2QL3 A;  3FJM A;  4TLM B;  3KZG A;  3DM0 A;  5I2N A;  1DSN A;  1QKB A;  5L9O A;  1ANF A;  2F78 A;  5DT6 A;  3TCH A;  4Q8R A;  4NF5 B;  4FAT A;  1S50 A;  4FEB A;  2XXI A;  2VOZ A;  2ONK E;  1NNK A;  3N94 A;  1US4 A;  2AYS A;  4OER A;  3G3K A;  2Q8J A;  1CB6 A;  2XX9 A;  1UIV A;  2I0C A;  2Q88 A;  3PPR A;  4JSO A;  1FQC A;  4F1U A;  1B7H A;  4G8H A;  3C4M A;  3UA8 A;  4U4S A;  2HQ0 A;  3TTR A;  4EQ7 A;  3I5O A;  4LP2 B;  4LZ7 A;  4FIM A;  2ANJ A;  2ZYM A;  5CMK A;  4BLA A;  2PT1 A;  5AA4 A;  3UIF A;  3OEL A;  3E4R A;  5K2X A;  3EPE A;  3ZKK A;  2I48 A;  2OWS A;  4WKM A;  4EXK A;  1D4N A;  1PC3 A;  5H8S A;  2DP8 A;  3FVN A;  4QFP A;  2ONS A;  4ZEB A;  4ZEK A;  1XVX A;  2RC8 A;  1OIB A;  4GWO A;  1D9V A;  2ZMB A;  3VV5 A;  3FVK A;  4G2Z A;  3T9H B;  1XVY A;  1ELJ A;  2F8D A;  2A5T B;  3C35 A;  4NED A;  3GBA A;  1MM6 A;  5CMC A;  4U1O A;  1NNT A;  1O64 A;  2O84 X;  5AA1 A;  3OXN A;  3RUM A;  3HO7 A;  2UVI A;  1POT A;  1FTO A;  2XXW A;  4JWO A;  4R72 A;  1NH8 A;  2R71 A;  3G3I A;  3HST A;  3CRB A;  2Q2A A;  1ZU0 A;  2Y7I A;  3IK6 B;  3MZ9 A;  3RGY A;  3S9E A;  3VVF A;  2B3B A;  3PD8 A;  1OLA A;  5I2K A;  2OZZ A;  3TZA A;  1PBP A;  2X7P A;  4BDM A;  1UQW A;  1TFD A;  5LOM A;  5AA2 A;  2REG A;  4X1D A;  4PET A;  1HSE A;  4OWD A;  2UVJ A;  2ZNU A;  3KFM A;  4FOR A;  4YB7 A;  1Y9U A;  3G3H A;  2O7U A;  5DTB A;  1WVJ A;  1TT1 A;  2DE2 A;  2Y84 A;  3D4G A;  1UTH A;  4LON B;  4N6P A;  3BKI B;  1B0L A;  2CMO A;  3QK6 A;  4TQU Q;  3DEL B;  1H45 A;  1US5 A;  2FA7 A;  2X7Q A;  4POW A;  3T9U A;  1XT8 A;  4QSC A;  1LAH E;  1B5J A;  3TDJ A;  3IOR A;  4QHQ A;  3KG2 A;  4KI0 E;  5I57 A;  4DCX A;  4F18 A;  1AH5 A;  1XOC A;  2NVU B;  5J1D A;  4IGR A;  3IB0 A;  2M8C A;  2OBG A;  2I6E A;  4R6K A;  3U93 A;  1A8F A;  3PUV E;  5DEX B;  3O6G A;  3WAF A;  3SEV A;  4R2B A;  1A99 A;  1Z7M E;  2XXH A;  3KJ7 A;  4HCY A;  4F3S A;  1AL3 A;  4O3A A;  2HZL A;  4RK9 A;  4ELO A;  2Z8F A;  4ELP A;  4GOT A;  3IO4 A;  2P1S A;  4QFK A;  1MY4 A;  2AIX A;  4DLD A;  3O66 A;  2IEE A;  3S9N C;  4H8I A;  3FZV A;  1R1N A;  1MH4 A;  1FTL A;  4IO2 A;  3VLU A;  3GBB A;  2HAV A;  3S2V A;  1IXH A;  1F9B A;  4GQO A;  4ELR A;  3EF7 A;  4G68 A;  4KYD A;  1N7W A;  3O29 A;  4P0G A;  2DWJ A;  1IEJ A;  3V89 B;  1B05 A;  3PPO A;  3L6H A;  3QSL A;  2FYI A;  1LBC A;  4YIC A;  1OVB A;  3FVO A;  4H5G A;  5H8N A;  3TEP A;  2OLB A;  5CM6 A;  4ZDM A;  3M8U A;  1IZ1 A;  4GF8 A;  1M5E A;  3FV2 A;  3CSB A;  2QRY A;  5CBR A;  1H44 A;  1IQ7 A;  5AA3 A;  1EZ9 A;  1VFE A;  3V5A A;  4QF9 A;  1MXU A;  1TXF A;  4FEC A;  2PBW A;  1VR5 A;  4KR5 A;  4R6Y A;  1XC1 A;  3U8Q A;  3ODB A;  3PMW A;  3TTL A;  3TTM A;  4AB5 A;  5I58 B;  5KCJ A;  1OQH A;  1GR2 A;  1IXI A;  1LFG A;  1ATG A;  2DE4 A;  1M5B A;  2F7B A;  2QS2 A;  3IOV A;  4H6D A;  4PFT A;  2Z8E A;  3MZ1 A;  3K6W A;  3T66 A;  5ICQ A;  4I1D A;  5FHN A;  1LFH A;  4LQ5 A;  3O28 A;  2GHB A;  4IO6 A;  1EH3 A;  5F7V A;  1L5T A;  5L9S A;  4NF4 B;  3LSL A;  3H6U A;  5TP9 A;  2A5S A;  1P1Q A;  4QSD A;  2I3V A;  3TEL A;  1P1U A;  3RT6 B;  4C1U A;  2UYE A;  5HBC A;  1SYH A;  3E3K A;  1SI0 A;  2F34 A;  2W7Y A;  2FNC A;  4OMB A;  2HFB A;  4BDL A;  3PGF A;  4HS7 A;  1MRP A;  5DYH A;  3RN8 A;  3EHU A;  3WAE A;  4KD5 A;  1B9J A;  4R74 A;  4DXB A;  2RC7 A;  1SI1 A;  1LFI A;  5FTI A;  3FJG A;  3PUX E;  1GVC A;  2V3U A;  3OSQ A;  3IOU A;  1IIT A;  1Y3Q A;  2DXR A;  3VDF A;  4LAT A;  1GGG A;  5KDT B;  2QS1 A;  2XD2 A;  3K00 A;  4GXA A;  2XXR A;  4H65 A;  3U1O A;  4BDQ A;  1FTM A;  4XKN A;  1AIV A;  1IIW A;  1LB8 A;  1HSL A;  3EHT A;  1LB9 A;  1JVX A;  4LUB A;  5F1Q A;  2GHA A;  2QMX A;  4ZZA A;  3IAZ A;  3RPW A;  3USD A;  2OWT A;  4EDP A;  4EQB A;  4GD5 A;  2Y7P A;  1B3F A;  3H6T A;  2Q2C A;  4U22 A;  3VXB A;  3W15 C;  4XXU A;  4MLQ A;  1NKX A;  3CFZ A;  4UAC A;  2ZNT A;  3A09 A;  3T22 A;  3UOR A;  2I3W A;  1B5H A;  2I4B A;  1O7T A;  1FQB A;  2HCA A;  1VE4 A;  4QFN A;  5I59 A;  4DCY A;  3CG3 A;  3K6U A;  3RTF B;  3IX1 A;  2F6P A;  1BIY A;  5JTY A;  2O1M A;  3M3F A;  1MQJ A;  2R9J A;  4FJP A;  4NWD A;  2KLF A;  4IO3 A;  1MY2 A;  4KFQ A;  3PU5 A;  5CI5 A;  3S9L C;  5FHM A;  3VVE A;  3H6W A;  1P99 A;  3SEY A;  3O97 A;  3OMB A;  3FXR A;  4YB6 A;  5DVJ A;  4ZZE A;  3RQT A;  4F39 A;  5BUU A;  2XX7 A;  3DP6 A;  3OOA A;  1JW5 A;  4PP0 A;  1Y3P A;  2ONR A;  3SEX A;  1A7L A;  4YKI A;  4F22 A;  1JEV A;  2Z23 A;  4NF6 B;  5FHO A;  2DE3 A;  2ABH A;  2O1L A;  3TMG A;  3KOT A;  4P11 A;  4OXV A;  1MY0 A;  2NXO A;  3LSX A;  5IKB A;  3Q28 A; 
#chains in the Genus database with same CATH topology
 3T9X B;  4NF5 A;  5HPQ A;  1MPC A;  3K4U A;  3D4C A;  5H8F B;  3IL1 B;  4KQP A;  3OO6 A;  5AA4 B;  3CHG A;  3FIR A;  4MCO A;  4PCD A;  1NUZ A;  4E0W A;  3S9L C;  2D3I A;  3LSF B;  4OHN A;  4OEV A;  1FPJ A;  1B51 A;  2DWI A;  4ISU A;  3OEM A;  3C34 A;  1N0T A;  3DP4 A;  1NNP A;  1A55 A;  3MAM A;  1WDN A;  1PBQ A;  3C9H A;  1Y1Z A;  4NF8 A;  4XIG Q;  3LSX A;  3ROJ A;  2Y7R A;  3PV0 E;  3UK4 A;  4EQ9 A;  5IGA A;  2R6G E;  3FJ7 A;  1SW2 A;  3S9M C;  1Q35 A;  1MXV A;  3RPL A;  3U65 A;  1G0H A;  4I3Y A;  2F5X A;  2UVG A;  2ZZX A;  4QFO A;  4X9T A;  2UVH A;  3HN0 A;  1N04 A;  3MVX A;  1ZIU A;  3VFJ A;  3KC0 A;  1EYJ A;  3KN8 A;  4RY1 A;  4YZZ A;  4YKP A;  4QRZ A;  1SQY A;  4RK2 A;  4PF6 A;  1AMF A;  2JJK A;  5CBS A;  1GTK A;  1PB7 A;  1N3X A;  5KCJ B;  1B3L A;  4PFR A;  3OEK A;  2ZZW A;  4NTL A;  1LBY A;  4GFR A;  4N6K A;  4JB7 A;  3A3U A;  4P0I A;  5I2N B;  4P3L A;  5I84 A;  1MDP 1;  1MXW A;  3B7D A;  3MVY A;  1XHY A;  3K1P A;  5ET8 A;  1JW1 A;  3I3V A;  3MP6 A;  1LLS A;  4ZEI A;  5EHM A;  2FIE A;  3L6G A;  3FAT A;  5IZ3 A;  3W9V A;  1J1N A;  3PTY A;  3I6V A;  3PPQ A;  3TPA A;  3IB2 A;  3TTN A;  4QBA A;  3O2A A;  1IME A;  2DVC A;  4OTE A;  4IY6 A;  1MY3 A;  1YZ0 A;  1B1X A;  4POX A;  4PE3 A;  2OJT A;  2PVU A;  3LBS A;  1N3W A;  1PDA A;  3IJO B;  3D1R A;  3FAS A;  4JXI A;  4RPN A;  5I57 B;  3B6T A;  4NWC A;  1OLC A;  3R26 A;  1FPG A;  1UTB B;  1GV8 A;  3TYH A;  3T96 B;  4ZS9 A;  3KN3 A;  4ZE8 A;  4PFI A;  3TCG A;  1K9Y A;  3TFL A;  3AXF A;  3SKP A;  1PEB A;  1YAE A;  2F3D A;  2F7A A;  1USY H;  4GL8 A;  1BTJ A;  3K0V A;  4LVQ A;  3U8Q A;  2PT2 A;  2LAO A;  1FQF A;  1D9Q A;  4H8J A;  4C1T A;  4R2F A;  4GWZ A;  1SW1 A;  5EQ8 A;  4NF4 A;  4ECF A;  4O3B A;  4RNS A;  1SD3 A;  4OEU A;  1MDQ A;  1IUD A;  4AQ4 A;  3DLN A;  1VFD A;  4NN3 A;  3TKD A;  3K01 A;  3SDF A;  5H8H B;  4UA8 A;  2ZNS A;  2REJ A;  4NAP A;  4E0X A;  2I0B A;  1JP4 A;  3H6V A;  4I9D A;  1H76 A;  2QJE A;  1B4H A;  2OCU A;  1EZO A;  4OYV A;  2D21 A;  5ET5 A;  3OSR A;  4JDF A;  3UP9 A;  2NUV A;  1LCF A;  3OO7 A;  3K02 A;  2D5W A;  1II5 A;  1MM7 A;  3ILU B;  1S9T A;  1R9Q A;  3LV0 A;  5H8Q A;  1LBZ A;  3G3J A;  3N6U A;  2YJP A;  1N7X A;  2QL3 A;  4TLM B;  2PFY A;  3KZG A;  4P1L A;  4NF5 B;  4FAT A;  1S50 A;  2ONK E;  1KA1 A;  1CB6 A;  4JSO A;  1FQC A;  2OX3 A;  4F1U A;  4U4S A;  3TTR A;  4LZ7 A;  2ZYM A;  5CMK A;  4BLA A;  5AA4 A;  3UIF A;  5K2X A;  3EPE A;  4N8Y A;  2DP8 A;  3FVN A;  3FVK A;  5IM2 A;  2F8D A;  1FRP A;  2A5T B;  3GBA A;  1O64 A;  2O84 X;  3BIG A;  3OXN A;  2UVI A;  2XXW A;  4JWO A;  4R72 A;  3HST A;  4O94 A;  2Q2A A;  3VVF A;  2B3B A;  3TZA A;  1PBP A;  4PET A;  4P47 A;  1FBC A;  2ZNU A;  3KFM A;  4YB7 A;  5DTB A;  3G3H A;  2Y84 A;  2DE2 A;  3D4G A;  4PAI A;  3QK6 A;  1US5 A;  2FA7 A;  2X7Q A;  3TDJ A;  2M8C A;  3PUV E;  4R2B A;  1A99 A;  2XXH A;  4F3S A;  5T3J A;  2HZL A;  4RK9 A;  2HHM A;  4ELO A;  2Z8F A;  2R8T A;  2P1S A;  3IO4 A;  4QFK A;  3FZV A;  2Y5K A;  3VLU A;  4IO2 A;  1IXH A;  4GQO A;  4G68 A;  3PPO A;  1OVB A;  5H8N A;  3TEP A;  1IQ7 A;  5AA3 A;  1EZ9 A;  1VR5 A;  4KR5 A;  5KCJ A;  3TTL A;  5I58 B;  4O7M A;  2DE4 A;  2FIX A;  4H6D A;  3QMF A;  3T66 A;  2XA5 A;  4I1D A;  4GWY A;  3O28 A;  4IO6 A;  1L5T A;  3LSL A;  2I3V A;  3RT6 B;  2UYE A;  5HBC A;  1SI0 A;  5LTC A;  4HS7 A;  5DYH A;  3EHU A;  3WAE A;  4AS5 A;  5F24 A;  1XI6 A;  5IZ3 B;  2ZZV A;  3K00 A;  4PAF A;  1LB8 A;  1LB9 A;  4LUB A;  2GHA A;  3RPW A;  4EQB A;  3VXB A;  1NKX A;  2ZNT A;  2I3W A;  2F3B A;  1B5H A;  1FQB A;  2O1M A;  3M3F A;  1MQJ A;  4FJP A;  4NWD A;  2KLF A;  4IO3 A;  5CI5 A;  3SEY A;  1NUY A;  4ZZE A;  4F39 A;  5BUU A;  2XX7 A;  1A7L A;  4NF6 B;  2ABH A;  4P11 A;  5IKB A;  4N81 A;  4MF3 A;  4PFY A;  1QUJ A;  3HHG A;  2I49 A;  1SDX A;  4F1Y A;  1M5C A;  3U72 A;  3SET A;  3VLV A;  2F97 A;  4JBZ A;  1URG A;  3KGC A;  3THI A;  1O63 A;  1OMP A;  3VXC A;  1RYX A;  1Y4C A;  3MWB A;  1ZJL A;  3PMX A;  4OFJ A;  3H3G A;  4RYA A;  3N26 A;  5CRY A;  5EYF A;  3KOS A;  3EHS A;  3MP8 A;  4ESW A;  1DTZ A;  4MH5 A;  2FBP A;  1MXX A;  1YPN A;  3KJT A;  5I2K B;  4ESX A;  4PFU A;  4JVD A;  3CG1 A;  1Y20 A;  3LC8 A;  1FPI A;  1P1O A;  2OK2 A;  2P3V A;  4F2O A;  4X1B A;  3B6Q A;  4LZ8 A;  3Q27 A;  3T9V A;  1SW4 A;  2BJJ X;  1MQG A;  4H5F A;  1OQG A;  4PTK A;  2WBB A;  1A54 A;  3SER A;  5DEX A;  5ISU A;  2QVV A;  2E1S A;  4KXP A;  1I6B A;  3MUQ A;  5J16 A;  1N76 A;  3TAJ A;  1Z7N E;  4ZEF A;  4GX6 A;  1LBX A;  1B4Z A;  1USY E;  2AL5 A;  2H5Y A;  3CSG A;  1MH3 A;  4OEN A;  4U2R A;  3QXM A;  1R6Z A;  3C33 A;  5CMB A;  1NI9 A;  5HM4 B;  3EQ1 A;  1AOV A;  1I69 A;  1EU8 A;  4MFI A;  5H8Q B;  2KR0 A;  4M1V A;  3UGW A;  3PD9 A;  1T0K A;  5L9M A;  2QS3 A;  5TP9 B;  1ZLQ A;  3MPL A;  1LAF E;  1MQH A;  3F11 A;  1NV0 A;  2O7I A;  4P8B A;  4KCD A;  1DPP A;  5JEI A;  1K9Z A;  4JSD A;  2H98 A;  4KHZ E;  1SPI A;  2XX8 A;  4Q30 B;  2Q89 A;  5IZ1 A;  3FV1 A;  5I56 B;  4WED A;  2PX1 A;  4F3P A;  2ZXT A;  4N07 A;  1DPE A;  1B46 A;  5EHS A;  5K2Y A;  1IXG A;  3TTK A;  4HCW A;  4NE4 A;  3RNN A;  3RT8 A;  2PYY A;  5JTY B;  4MEV A;  1HSJ A;  3EN3 A;  5AA2 B;  1B58 A;  1FTA A;  2X26 A;  1DOT A;  4YKJ A;  4DXU A;  4G8N A;  3CFX A;  4MX6 A;  3GZG A;  3MVW A;  2CZH A;  2RF1 A;  4YKK A;  3QAX A;  4OFL A;  1DMB A;  3QUF A;  4JVI A;  1P1N A;  3IB1 A;  3MJN A;  3P7I A;  3JZJ A;  2XWI A;  4NMY A;  2VD2 A;  1KWH A;  4HTG A;  1MY1 A;  3E9X A;  3RLF E;  2L5V A;  1TWY A;  4DE8 A;  4YMB A;  4G68 B;  2DYX A;  2Y7W A;  1QUI A;  4F19 A;  4GWU A;  3JYR A;  3FGS A;  4KYS A;  2H25 A;  4PGP A;  1LAG E;  4C0R A;  1M5F A;  1EYI A;  1A8E A;  3LUY A;  3K2D A;  4GBW A;  4ZE9 A;  3C31 A;  4MIJ A;  4NF8 B;  3MBP A;  4F2Q A;  3CI8 A;  3DP8 A;  1KA0 A;  3QUJ A;  3CFL A;  3A29 A;  4H0W A;  1Q1K A;  1NV7 A;  2F35 A;  1H3D A;  1P1W A;  4P9K A;  3OO8 A;  2Q74 A;  4R75 A;  4AS4 A;  1R9L A;  2GFE A;  1B2H A;  3GLB A;  3G3G A;  1FPF A;  3VE1 B;  1BK4 A;  1UIU A;  2WX9 A;  2V25 A;  4G68 C;  2P2A A;  2CEY A;  2XXT A;  4R9F A;  4BDO A;  3K1N A;  3VLW A;  1MS7 A;  2GRV A;  2NWJ A;  3HHF A;  4JWX A;  1LCT A;  2F6G A;  3TOD A;  4YMA A;  1FBD A;  4GX3 A;  4TLL B;  4OZ9 A;  1B32 A;  2PMS A;  4WEP A;  1FQE A;  2V3T A;  4N13 A;  4NF6 A;  4QSE A;  5L9O A;  5DT6 A;  1NNK A;  1US4 A;  2AYS A;  3G3K A;  2Q8J A;  1UIV A;  2Q88 A;  1FPE A;  4G8H A;  3UA8 A;  4EQ7 A;  4LP2 B;  2ANJ A;  1DCU A;  2VPO A;  2PT1 A;  3E4R A;  2I48 A;  2OWS A;  1PC3 A;  4QFP A;  4ZEK A;  1XVX A;  1OIB A;  2XWK A;  3KC1 A;  3T9H B;  1XVY A;  4NED A;  5CMC A;  1NH8 A;  4O8M A;  3G3I A;  3IK6 B;  3MZ9 A;  1ZU0 A;  3S9E A;  5I2K A;  5LOM A;  4X1D A;  2VPN A;  5I5P A;  1HSE A;  4OWD A;  4HE2 A;  4N6P A;  4LON B;  3E79 A;  1B0L A;  1H45 A;  4POW A;  1XT8 A;  4DCX A;  4F18 A;  4IGR A;  3U93 A;  1A8F A;  1NV1 A;  1RDY A;  5DEX B;  3O6G A;  3KJ7 A;  1AL3 A;  4O3A A;  1MY4 A;  3S9N C;  4OAN A;  5DW8 A;  1R1N A;  1MH4 A;  1F9B A;  4ELR A;  3EF7 A;  4N4U A;  3O29 A;  4P0G A;  3L6H A;  3FVO A;  4H5G A;  2OLB A;  3FV2 A;  1H44 A;  2FHY A;  4NG7 A;  1TXF A;  3LUZ A;  4R6Y A;  3TTM A;  1OQH A;  1IXI A;  3IOV A;  4P1E A;  2Z8E A;  3HFU A;  3MZ1 A;  3K6W A;  3FBP A;  5ICQ A;  1EYK A;  5FHN A;  4NF4 B;  3H6U A;  3T1B A;  1P1Q A;  1P1U A;  1SYH A;  2F34 A;  4OVQ A;  4OMB A;  2HFB A;  4DXB A;  1B9J A;  2RC7 A;  1IMA A;  5FTI A;  3IOU A;  2DXR A;  4GXA A;  4H65 A;  1AIV A;  2B4M A;  3EHT A;  1HSL A;  1JVX A;  5I56 A;  2QMX A;  3IAZ A;  4U22 A;  3ISP A;  3H6T A;  4O7I A;  4XXU A;  4UAC A;  3A09 A;  3UOR A;  2I4B A;  1O7T A;  5A5L A;  1FBE A;  1VE4 A;  4QFN A;  5I59 A;  3IX1 A;  5JTY A;  2R9J A;  3FXR A;  3DP6 A;  3OOA A;  4PP0 A;  2ONR A;  3SEX A;  4F22 A;  5FHO A;  1MY0 A;  3U1O A;  5A5X B;  3Q29 A;  3FXB A;  4G77 A;  3OO9 A;  5TU0 A;  5ESY A;  1QKA A;  5ICT A;  2DQV A;  2G93 A;  4U4X A;  1AWB A;  4OVR A;  3FD3 A;  2Q8M A;  3MC2 A;  5I3S A;  4YAH X;  2B65 A;  4BDN A;  3M3K A;  3ECR A;  1POY 1;  4LQ2 A;  3V83 A;  1MXY A;  2B4L A;  2A5T A;  4BDR A;  4RJZ A;  3TQL A;  1FPK A;  1B3H A;  3KEI A;  2XHD A;  5KZT A;  3ZS6 A;  4NGU A;  4GLI A;  4XKQ A;  2HEU A;  2H99 A;  1I6A A;  1N84 A;  3OEN A;  2AL4 A;  3MW0 A;  2HZK A;  3O6H A;  3IOT A;  1B5I A;  3UN6 A;  1FW0 A;  5AE4 A;  1SW5 A;  4ZED A;  4FAJ A;  2V93 A;  2THI A;  4DDD A;  5FTH A;  4EF2 A;  3FUZ A;  1FPL A;  1QGX A;  4RPO A;  3RTW B;  3EKI A;  3H4Z A;  4N17 A;  4F3B A;  3SES A;  1MG1 A;  4ONY A;  2UXA A;  3FVG A;  1NNF A;  3K6X A;  5ITO A;  4ELP A;  1IXC A;  2ALU A;  1LFH A;  5I58 A;  4TOZ A;  2YLN A;  5B7D A;  3G3F A;  4YB5 A;  1VSO A;  2DWH A;  4GIZ A;  3BFU A;  3IR1 A;  1FPD A;  3U92 A;  5M2V A;  2QFL A;  4H46 A;  1NMU A;  3LSW A;  2VP1 A;  3M3L A;  3BBR A;  4I40 A;  5ELV A;  3CVG A;  2B3F A;  1FCK A;  4Q5T A;  1SBP A;  1D3K A;  1A40 A;  2RC9 A;  1MPD A;  3GXA A;  3ZKL A;  2RCB A;  2WKY A;  2P0S A;  4OET A;  3KBZ A;  3A3C A;  2H4I A;  2DWA A;  2DDK A;  1SYI A;  3KSX A;  4N8G A;  2WYK A;  4RXL A;  4NHB A;  1NV6 A;  4R6H A;  4IO4 A;  1LGB C;  1ZBM A;  3MQ9 A;  4DXC A;  4PDD A;  2UYF A;  5IAI A;  4Q0C A;  2BJI A;  2RKM A;  4MNP A;  1TFA A;  4U1Z A;  4IB2 A;  1MQD A;  2ZYK A;  3O9P A;  2XXU A;  1M5D A;  2Z22 A;  5AA2 D;  1ZTY A;  2O68 A;  4MJO A;  5ET7 A;  4NX1 A;  3MP1 A;  5IZZ A;  1D9Y A;  2G29 A;  4KPT A;  4H67 A;  4PBH A;  4EF1 A;  2DSF A;  4GX4 A;  2ZYN A;  3MST A;  2XXY A;  4LN5 A;  4I62 A;  3K6V A;  3RY3 A;  5DVF A;  1BKA A;  2Q9T A;  2QSX A;  3HV1 A;  2GH9 A;  3PUY E;  1DTG A;  3V8X B;  1EZP A;  2I4C A;  5B70 A;  1DK4 A;  4MLV A;  3Q25 A;  4OVJ A;  4K3F A;  5EQA A;  3RYD A;  3VVD A;  3CIJ A;  1NUX A;  5EQ9 A;  1URS A;  3LR1 A;  2FVZ A;  4X48 A;  3PPN A;  2VHA A;  4F31 B;  1WOD A;  1NFT A;  2RIN A;  4THI A;  3N5L A;  5KDT A;  1VDW A;  4XTC Q;  2QS4 A;  1Y3N A;  1B7U A;  4I3E A;  2RCA A;  4HW8 A;  3MPK A;  4LZ5 A;  1DBZ A;  4Z7E A;  4GVO A;  2ZYO A;  4I8C A;  1H43 A;  3IJX B;  2XXV A;  4Z0I A;  1PB9 A;  5CC2 A;  2QPQ A;  4ZEC A;  1OVT A;  3OD7 A;  5TPA A;  3IO6 A;  3K1M A;  3DM0 A;  2PCR A;  1DSN A;  2F78 A;  3TCH A;  4Q8R A;  2XXI A;  2VOZ A;  3GYY A;  2I0C A;  3PPR A;  1B7H A;  4PGN A;  3I5O A;  4EXK A;  5H8S A;  2ONS A;  2RC8 A;  3VV5 A;  1D9V A;  2ZMB A;  4G2Z A;  1ELJ A;  1NNT A;  1FJ9 A;  3IFC A;  5FBP A;  1POT A;  2R71 A;  2P3N A;  2Y7I A;  3RGY A;  3PD8 A;  1OLA A;  4XF5 A;  2OZZ A;  2X7P A;  4BDM A;  1UQW A;  2HPG A;  5AA2 A;  4FOR A;  1Y9U A;  2O7U A;  1UTH A;  2CMO A;  1LAH E;  1B5J A;  3IOR A;  4KI0 E;  3RPL B;  1AH5 A;  1XOC A;  3IB0 A;  2I6E A;  2QVU A;  4HCY A;  4DLD A;  3O66 A;  1NV5 A;  4H8I A;  3GBB A;  2HAV A;  4GWX A;  3S2V A;  2PFZ A;  2MKZ A;  4KYD A;  2DWJ A;  4XFE A;  1B05 A;  3QSL A;  2FYI A;  4OA4 A;  1NUW A;  4ZDM A;  3M8U A;  1IZ1 A;  2QRY A;  5CBR A;  1RDX A;  1VFE A;  4QF9 A;  1MXU A;  2PBW A;  1XC1 A;  3PMW A;  4XEQ A;  1FBP A;  1M5B A;  2F7B A;  4PFT A;  1FBG A;  5F7V A;  4DI4 B;  2A5S A;  4OVS A;  3SZP A;  2XWV A;  4C1U A;  2VT5 A;  2W7Y A;  2CEX A;  2FNC A;  4PFB A;  1MRP A;  3PUX E;  1GVC A;  3OSQ A;  3VDF A;  1IIT A;  5EYG A;  2XD2 A;  4BDQ A;  3T0J A;  1IIW A;  4ZZA A;  3USD A;  5F1Q A;  4EDP A;  2OWT A;  3B50 A;  4GD5 A;  2Y7P A;  1B3F A;  3W15 C;  1RDZ A;  4MLQ A;  3CFZ A;  3T22 A;  2V4C A;  4DCY A;  3K6U A;  3RTF B;  2QVR A;  1BIY A;  3B8B A;  4KFQ A;  3VVE A;  3MYU A;  5DVJ A;  3RQT A;  2KQZ A;  1FBF A;  1Y3P A;  4YKI A;  1JEV A;  3TMG A;  4OXV A;  3Q28 A;  2QMW A;  1QJM A;  5JK4 A;  2Y5L A;  4IO7 A;  1UTB A;  1NV2 A;  1IMC A;  4YU0 A;  4MAG A;  1XS5 A;  2O51 A;  4H45 A;  4O3C A;  4ELQ A;  4F29 A;  2O69 A;  1FQD A;  2DXY A;  2HAU A;  3IOW A;  3KN7 A;  3T93 B;  4OQO A;  1LAX A;  1B40 A;  2DS9 A;  2I58 A;  2OWZ A;  1B52 A;  1LBB A;  4RA1 A;  4QFL A;  1QVS A;  4H1X A;  4JWY A;  4FED A;  1BP5 A;  4PQJ A;  4HE0 A;  4IO5 A;  1Y4T A;  3HCQ A;  4F1V A;  1SVX B;  1FJ6 A;  1ZMG A;  4AB6 A;  3S4U A;  4EXL A;  1RYO A;  2V84 A;  3TCF A;  2Z8D A;  1B3G A;  5H8H A;  1LST A;  2DOJ A;  1B6H A;  1Y1M A;  1MQI A;  3TQW A;  2XXP A;  3BFT A;  3Q26 A;  4G61 A;  2DVZ A;  3JV9 A;  1RKM A;  2IA4 A;  3ZSF A;  4LA9 A;  3HPI A;  3N6T A;  2Y7K A;  4NQ8 A;  1B3E A;  3G7W A;  3H7M A;  1FBH A;  3E13 X;  4JVC A;  1FTJ A;  5TPA B;  1B0H A;  1B1H A;  2XXX A;  2HXW A;  5ITP A;  3W9W A;  4KCC A;  3B6W A;  1IMB A;  4GBV A;  4IGT A;  4HE1 A;  1QUL A;  1BLF A;  2XD3 A;  5L8D A;  4DIG A;  5ET6 A;  1NV4 A;  4PBQ A;  1QUK A;  1JEU A;  1CNQ A;  1PB8 A;  4DZ1 A;  3TUS A;  4FE8 A;  1QW0 A;  4GL0 A;  3FXU A;  1YTV A;  1ZKB A;  1IMF A;  3PUZ E;  2CZL A;  4GXS B;  2H9B A;  5I59 B;  2VD3 A;  1YYZ A;  3R6U A;  1YCJ A;  4MBP A;  4OES A;  3PUW E;  4EUO A;  3C36 A;  5LDZ A;  4KYE A;  1UTH B;  2XXQ A;  4F3G A;  4XKP A;  2VGQ A;  4M4G A;  4X8R A;  5A5X A;  4DI3 D;  1LBV A;  5H8F A;  4UAB A;  4U23 A;  4MMP A;  3R7X A;  2WEF A;  1JNF A;  1MPB A;  4OVP A;  1KZ8 A;  2E0S A;  4L17 A;  3ONM A;  4WXJ A;  4U21 A;  3KSJ A;  2O6A A;  1FTK A;  5H8N B;  2YPN A;  1I6Q A;  4OVT A;  1NH7 A;  1B7Z A;  2V3Q A;  2F7C A;  4PFW A;  3FXQ A;  1NL5 A;  1FSA A;  3H06 B;  1Q9D A;  4XKR A;  1URD A;  1FQA A;  5EYH A;  5CMM A;  4R9G A;  3PPP A;  3H03 A;  3QIM A;  5BWJ A;  1S7Y A;  3PMV A;  1IMD A;  4G8M A;  1JQF A;  2F36 A;  4PE5 B;  4OFO A;  3KBR A;  2ESN A;  3CR9 A;  3IFA A;  4PDH A;  3U94 A;  4G4P A;  2XXK A;  4X04 A;  3ILT B;  1JW4 A;  3QYT A;  3SEW A;  4MHF A;  5DVI A;  2XWO A;  1MXZ A;  1CE2 A;  1JVY A;  3MVZ A;  4GRK A;  2GQ1 A;  3O6I A;  4IY5 A;  3C32 A;  2NOO A;  3SEU A;  1INP A;  3MZB A;  4R73 A;  1JET A;  4MNC A;  1G0I A;  3FJM A;  5I2N A;  1QKB A;  1ANF A;  4FEB A;  3N94 A;  4OER A;  4QXD A;  2XX9 A;  3C4M A;  2HQ0 A;  4FIM A;  3ZKK A;  3OEL A;  4WKM A;  1D4N A;  4ZEB A;  4GWO A;  3C35 A;  1MM6 A;  4U1O A;  3E78 A;  5AA1 A;  3RUM A;  3HO7 A;  1FTO A;  2HXR A;  3CRB A;  2WBD A;  1TFD A;  2REG A;  4GWW A;  2UVJ A;  1WVJ A;  1TT1 A;  3BIH A;  3BKI B;  4TQU Q;  3DEL B;  3T9U A;  2CZK A;  4QSC A;  4QHQ A;  3KG2 A;  5I57 A;  2NVU B;  5J1D A;  4R6K A;  2OBG A;  3NOH A;  3WAF A;  3SEV A;  1Z7M E;  4GOT A;  2AIX A;  2IEE A;  1FTL A;  1N7W A;  1IEJ A;  3V89 B;  1LBC A;  4YIC A;  1LBW A;  4N6D A;  5CM6 A;  4GF8 A;  1M5E A;  3CSB A;  4PAK A;  3V5A A;  4FEC A;  3ODB A;  4AB5 A;  1GR2 A;  1LFG A;  1ATG A;  1FPB A;  2QS2 A;  4PF8 A;  4MNI A;  4N15 A;  1LEV A;  4LQ5 A;  2GHB A;  1EH3 A;  4P56 A;  5TP9 A;  2CZI A;  4QSD A;  3TEL A;  3E3K A;  4HXV A;  4BDL A;  3PGF A;  3RN8 A;  2WYP A;  4KD5 A;  4R74 A;  1SI1 A;  1LFI A;  3FJG A;  2V3U A;  5KDT B;  1Y3Q A;  4LAT A;  1GGG A;  2QS1 A;  2XXR A;  1FTM A;  4XKN A;  4GWS A;  5I7I A;  5L9S A;  4N91 A;  4FBP A;  1YXI A;  2Q2C A;  4NF0 A;  2HCA A;  3CG3 A;  2F6P A;  4IR8 A;  1MY2 A;  5EQ7 A;  3PU5 A;  5FHM A;  3H6W A;  1P99 A;  3O97 A;  3OMB A;  4YB6 A;  1JW5 A;  1NV3 A;  2Z23 A;  2DE3 A;  2O1L A;  3KOT A;  2NXO A;  4ND9 A;  4PC9 A; 
#chains in the Genus database with same CATH homology
 4PFY A;  3T9X B;  4NF5 A;  1QUJ A;  5A5X B;  3HHG A;  3Q29 A;  5HPQ A;  2QMW A;  1QJM A;  5JK4 A;  1MPC A;  3K4U A;  3D4C A;  2I49 A;  1SDX A;  5H8F B;  4F1Y A;  4IO7 A;  1M5C A;  4G77 A;  1UTB A;  4F1V A;  3OO9 A;  5TU0 A;  3SET A;  3U72 A;  3VLV A;  1QKA A;  3IL1 B;  5ICT A;  4KQP A;  2DQV A;  2F97 A;  2G93 A;  3OO6 A;  4JBZ A;  4U4X A;  4YU0 A;  5AA4 B;  1URG A;  1XS5 A;  3FD3 A;  3FIR A;  2O51 A;  4O3C A;  3KGC A;  3MC2 A;  3THI A;  4ELQ A;  4F29 A;  1O63 A;  4YAH X;  1OMP A;  2B65 A;  4E0W A;  2O69 A;  3M3K A;  3VXC A;  4BDN A;  3ECR A;  1FQD A;  1POY 1;  1RYX A;  2D3I A;  3LSF B;  1Y4C A;  4LQ2 A;  4OHN A;  1MXY A;  3V83 A;  4OEV A;  3MWB A;  2DXY A;  1B51 A;  2HAU A;  2DWI A;  2A5T A;  3IOW A;  1ZJL A;  4ISU A;  3OEM A;  3PMX A;  4BDR A;  3KN7 A;  3H3G A;  4OFJ A;  3T93 B;  4RJZ A;  3TQL A;  4RYA A;  3N26 A;  4OQO A;  1LAX A;  5CRY A;  5EYF A;  3KOS A;  3EHS A;  1B40 A;  3MP8 A;  2DS9 A;  2I58 A;  1B3H A;  3KEI A;  4ESW A;  2XHD A;  1DTZ A;  5KZT A;  1B52 A;  1LBB A;  4MH5 A;  3ZS6 A;  3C34 A;  1MXX A;  1YPN A;  3KJT A;  5I2K B;  1N0T A;  3DP4 A;  4RA1 A;  4ESX A;  1NNP A;  4PFU A;  4QFL A;  1QVS A;  3CG1 A;  4GLI A;  1Y20 A;  1A55 A;  2HEU A;  4XKQ A;  2H99 A;  3LC8 A;  4H1X A;  4JWY A;  1P1O A;  1I6A A;  1N84 A;  3MAM A;  1WDN A;  2OK2 A;  1PBQ A;  2AL4 A;  3OEN A;  3C9H A;  1Y1Z A;  4FED A;  3MW0 A;  1BP5 A;  4NF8 A;  4PQJ A;  4XIG Q;  4IO5 A;  1Y4T A;  4X1B A;  3B6Q A;  4F2O A;  2Y7R A;  2HZK A;  3HCQ A;  3O6H A;  3PV0 E;  3Q27 A;  4LZ8 A;  3IOT A;  2R6G E;  3UK4 A;  3FJ7 A;  3T9V A;  4EQ9 A;  1B5I A;  1SW4 A;  2BJJ X;  3UN6 A;  1FW0 A;  1MQG A;  1SVX B;  1ZMG A;  4H5F A;  1OQG A;  5AE4 A;  1SW2 A;  1SW5 A;  3S9M C;  4ZED A;  1Q35 A;  2V93 A;  4FAJ A;  4AB6 A;  2THI A;  1MXV A;  3S4U A;  4EXL A;  1RYO A;  2V84 A;  2F5X A;  1A54 A;  2Z8D A;  3SER A;  5FTH A;  2UVG A;  3TCF A;  4DDD A;  4EF2 A;  1B3G A;  4QFO A;  5DEX A;  3FUZ A;  4X9T A;  5ISU A;  5H8H A;  2UVH A;  3HN0 A;  1N04 A;  3MVX A;  2E1S A;  4RPO A;  3RTW B;  1ZIU A;  1I6B A;  3VFJ A;  3MUQ A;  3H4Z A;  1N76 A;  3TAJ A;  1Z7N E;  1LST A;  2DOJ A;  4F3B A;  1B6H A;  1Y1M A;  1MQI A;  1MG1 A;  3KN8 A;  4ZEF A;  4ONY A;  1B4Z A;  3SES A;  1USY E;  2UXA A;  4RY1 A;  2AL5 A;  2H5Y A;  4YZZ A;  3CSG A;  2XXP A;  3TQW A;  3FVG A;  3BFT A;  1MH3 A;  1NNF A;  3K6X A;  4YKP A;  3Q26 A;  4OEN A;  5ITO A;  4U2R A;  2DVZ A;  3JV9 A;  3QXM A;  1IXC A;  1R6Z A;  1RKM A;  1SQY A;  2IA4 A;  3C33 A;  4QRZ A;  4RK2 A;  5CMB A;  3ZSF A;  1AMF A;  4LA9 A;  5HM4 B;  5CBS A;  1GTK A;  2ALU A;  3EQ1 A;  3HPI A;  1AOV A;  3N6T A;  2Y7K A;  1PB7 A;  1I69 A;  1EU8 A;  1N3X A;  1B3L A;  5KCJ B;  5I58 A;  1B3E A;  3G7W A;  3H7M A;  3OEK A;  4TOZ A;  4NTL A;  4GFR A;  3E13 X;  2YLN A;  4MFI A;  5B7D A;  3G3F A;  1FTJ A;  4M1V A;  5H8Q B;  3PD9 A;  4YB5 A;  1VSO A;  3UGW A;  2DWH A;  4GIZ A;  5TPA B;  4JB7 A;  1B0H A;  3BFU A;  3IR1 A;  1T0K A;  1B1H A;  5L9M A;  3A3U A;  2QS3 A;  2HXW A;  2XXX A;  4P0I A;  3U92 A;  5ITP A;  5M2V A;  3W9W A;  5I2N B;  5TP9 B;  4KCC A;  3B6W A;  1NMU A;  1ZLQ A;  3LSW A;  2VP1 A;  3M3L A;  4IGT A;  1MDP 1;  3BBR A;  3MPL A;  5I84 A;  1MXW A;  1LAF E;  1MQH A;  5ELV A;  3CVG A;  3B7D A;  2B3F A;  3MVY A;  1FCK A;  1QUL A;  3F11 A;  1XHY A;  2O7I A;  3K1P A;  4Q5T A;  1JW1 A;  3I3V A;  3MP6 A;  1BLF A;  1DPP A;  1SBP A;  1D3K A;  2XD3 A;  1LLS A;  4KCD A;  4JSD A;  4ZEI A;  5EHM A;  5L8D A;  2H98 A;  4DIG A;  5JEI A;  3L6G A;  4KHZ E;  3FAT A;  2XX8 A;  4Q30 B;  2Q89 A;  1A40 A;  3FV1 A;  1QUK A;  3W9V A;  1JEU A;  2RC9 A;  1MPD A;  1PB8 A;  1J1N A;  4DZ1 A;  3GXA A;  3I6V A;  3ZKL A;  5I56 B;  3PPQ A;  4FE8 A;  4WED A;  3TUS A;  2PX1 A;  2RCB A;  3TPA A;  3IB2 A;  4F3P A;  2ZXT A;  4N07 A;  3TTN A;  2WKY A;  1DPE A;  1QW0 A;  2P0S A;  4GL0 A;  1B46 A;  1YTV A;  3FXU A;  4OET A;  5EHS A;  1ZKB A;  5K2Y A;  3A3C A;  2H4I A;  3O2A A;  1IXG A;  3PUZ E;  3TTK A;  2DWA A;  2CZL A;  4GXS B;  2H9B A;  4HCW A;  4NE4 A;  3RNN A;  5I59 B;  2VD3 A;  3RT8 A;  2DVC A;  4OTE A;  2PYY A;  5JTY B;  1SYI A;  3R6U A;  1HSJ A;  3EN3 A;  3KSX A;  4IY6 A;  1MY3 A;  1YCJ A;  4MBP A;  4OES A;  3PUW E;  5AA2 B;  1B58 A;  2X26 A;  4EUO A;  1DOT A;  4RXL A;  4YKJ A;  1B1X A;  3C36 A;  4POX A;  2OJT A;  2PVU A;  4DXU A;  4G8N A;  4KYE A;  3CFX A;  4R6H A;  1UTH B;  3LBS A;  2XXQ A;  4IO4 A;  1LGB C;  4F3G A;  1ZBM A;  3MQ9 A;  4DXC A;  1N3W A;  1PDA A;  3GZG A;  3IJO B;  4XKP A;  2VGQ A;  3MVW A;  3FAS A;  4JXI A;  4M4G A;  2UYF A;  4RPN A;  2RF1 A;  4YKK A;  3QAX A;  5IAI A;  5I57 B;  4Q0C A;  5A5X A;  3B6T A;  2RKM A;  4OFL A;  1TFA A;  4NWC A;  1OLC A;  3R26 A;  1DMB A;  3QUF A;  4U1Z A;  5H8F A;  1P1N A;  3IB1 A;  4IB2 A;  3MJN A;  1UTB B;  3P7I A;  3JZJ A;  4U23 A;  1GV8 A;  4NMY A;  1MQD A;  2VD2 A;  2ZYK A;  2XXU A;  3O9P A;  4ZS9 A;  1M5D A;  3R7X A;  3T96 B;  3KN3 A;  1KWH A;  2Z22 A;  3TYH A;  4HTG A;  5AA2 D;  1MY1 A;  1ZTY A;  3E9X A;  4ZE8 A;  1JNF A;  2O68 A;  3RLF E;  1MPB A;  1TWY A;  4DE8 A;  2E0S A;  4YMB A;  3MP1 A;  4G68 B;  4L17 A;  3TCG A;  3ONM A;  1D9Y A;  2DYX A;  2G29 A;  4U21 A;  4KPT A;  4WXJ A;  3KSJ A;  2O6A A;  3TFL A;  5I56 A;  4H67 A;  4EF1 A;  1FTK A;  2Y7W A;  2DSF A;  1QUI A;  4F19 A;  3AXF A;  5H8N B;  2YPN A;  1PEB A;  1YAE A;  3SKP A;  2F7A A;  2ZYN A;  1USY H;  1I6Q A;  2XXY A;  3JYR A;  1NH7 A;  4I62 A;  3FGS A;  1B7Z A;  4KYS A;  2H25 A;  1LAG E;  4GL8 A;  3K6V A;  1BTJ A;  4C0R A;  3K0V A;  3RY3 A;  1M5F A;  5DVF A;  2V3Q A;  1BKA A;  2F7C A;  2Q9T A;  1A8E A;  4LVQ A;  2PT2 A;  2QSX A;  3HV1 A;  2GH9 A;  3LUY A;  3PUY E;  4PFW A;  3FXQ A;  1DTG A;  2LAO A;  3K2D A;  1NL5 A;  3V8X B;  3C31 A;  1FQF A;  4ZE9 A;  3H06 B;  2I4C A;  4NF8 B;  5B70 A;  1EZP A;  3MBP A;  4ND9 A;  4H8J A;  4XKR A;  4C1T A;  4R2F A;  1URD A;  4F2Q A;  1FQA A;  3CI8 A;  3DP8 A;  1SW1 A;  4NF4 A;  4MLV A;  5CMM A;  3Q25 A;  4ECF A;  4OVJ A;  3QUJ A;  4K3F A;  4R9G A;  3CFL A;  4O3B A;  3PPP A;  3VVD A;  3CIJ A;  3H03 A;  1SD3 A;  3QIM A;  4H0W A;  1MDQ A;  1URS A;  3LR1 A;  1Q1K A;  4OEU A;  4RNS A;  2F35 A;  1H3D A;  1S7Y A;  1P1W A;  5BWJ A;  1IUD A;  3PMV A;  4X48 A;  4AQ4 A;  4MF3 A;  3PPN A;  3DLN A;  1VFD A;  3OO8 A;  3TKD A;  2VHA A;  4F31 B;  3K01 A;  4G8M A;  4R75 A;  3SDF A;  5H8H B;  4UA8 A;  1WOD A;  1JQF A;  1R9L A;  2ZNS A;  1NFT A;  2F36 A;  2GFE A;  2REJ A;  2RIN A;  4PE5 B;  4OFO A;  4THI A;  3N5L A;  3KBR A;  2ESN A;  5KDT A;  4XTC Q;  2QS4 A;  3CR9 A;  1Y3N A;  4E0X A;  1B2H A;  1B7U A;  2I0B A;  3GLB A;  3U94 A;  3G3G A;  3H6V A;  4I9D A;  4G4P A;  1H76 A;  2QJE A;  1B4H A;  2RCA A;  4HW8 A;  3ILT B;  1JW4 A;  2OCU A;  3MPK A;  3QYT A;  3SEW A;  3VE1 B;  1EZO A;  1UIU A;  5DVI A;  4OYV A;  1MXZ A;  2D21 A;  2V25 A;  4LZ5 A;  4Z7E A;  4G68 C;  4GVO A;  2P2A A;  1CE2 A;  2ZYO A;  4I8C A;  1JVY A;  1H43 A;  3MVZ A;  2XXT A;  3OSR A;  4GRK A;  4JDF A;  4R9F A;  3UP9 A;  4BDO A;  3IJX B;  3K1N A;  2NUV A;  1LCF A;  2XXV A;  3VLW A;  1MS7 A;  3OO7 A;  3O6I A;  1PB9 A;  4Z0I A;  2GRV A;  5CC2 A;  2QPQ A;  3K02 A;  2NWJ A;  3HHF A;  2D5W A;  4ZEC A;  1II5 A;  4IY5 A;  3C32 A;  1LCT A;  1MM7 A;  3ILU B;  2F6G A;  4JWX A;  1OVT A;  1R9Q A;  1S9T A;  2NOO A;  5H8Q A;  3OD7 A;  3SEU A;  3TOD A;  3MZB A;  4TLL B;  4YMA A;  3G3J A;  5TPA A;  4R73 A;  4OZ9 A;  3N6U A;  3IO6 A;  1B32 A;  3K1M A;  2YJP A;  1N7X A;  1JET A;  2PMS A;  4WEP A;  1FQE A;  2V3T A;  4N13 A;  4NF6 A;  4QSE A;  2QL3 A;  3FJM A;  4TLM B;  3KZG A;  3DM0 A;  5I2N A;  1DSN A;  1QKB A;  5L9O A;  1ANF A;  2F78 A;  5DT6 A;  3TCH A;  4Q8R A;  4NF5 B;  4FAT A;  1S50 A;  4FEB A;  2XXI A;  2VOZ A;  2ONK E;  1NNK A;  3N94 A;  1US4 A;  2AYS A;  4OER A;  3G3K A;  2Q8J A;  1CB6 A;  2XX9 A;  1UIV A;  2I0C A;  2Q88 A;  3PPR A;  4JSO A;  1FQC A;  4F1U A;  1B7H A;  4G8H A;  3C4M A;  3UA8 A;  4U4S A;  2HQ0 A;  3TTR A;  4EQ7 A;  3I5O A;  4LP2 B;  4LZ7 A;  4FIM A;  2ANJ A;  2ZYM A;  5CMK A;  4BLA A;  2PT1 A;  5AA4 A;  3UIF A;  3OEL A;  3E4R A;  5K2X A;  3EPE A;  3ZKK A;  2I48 A;  2OWS A;  4WKM A;  4EXK A;  1D4N A;  1PC3 A;  5H8S A;  2DP8 A;  3FVN A;  4QFP A;  2ONS A;  4ZEB A;  4ZEK A;  1XVX A;  2RC8 A;  1OIB A;  4GWO A;  1D9V A;  2ZMB A;  3VV5 A;  3FVK A;  4G2Z A;  3T9H B;  1XVY A;  1ELJ A;  2F8D A;  2A5T B;  3C35 A;  4NED A;  3GBA A;  1MM6 A;  5CMC A;  4U1O A;  1NNT A;  1O64 A;  2O84 X;  5AA1 A;  3OXN A;  3RUM A;  3HO7 A;  2UVI A;  1POT A;  1FTO A;  2XXW A;  4JWO A;  4R72 A;  1NH8 A;  2R71 A;  3G3I A;  3HST A;  3CRB A;  2Q2A A;  1ZU0 A;  2Y7I A;  3IK6 B;  3MZ9 A;  3RGY A;  3S9E A;  3VVF A;  2B3B A;  3PD8 A;  1OLA A;  5I2K A;  2OZZ A;  3TZA A;  1PBP A;  2X7P A;  4BDM A;  1UQW A;  1TFD A;  5LOM A;  5AA2 A;  2REG A;  4X1D A;  4PET A;  1HSE A;  4OWD A;  2UVJ A;  2ZNU A;  3KFM A;  4FOR A;  4YB7 A;  1Y9U A;  3G3H A;  2O7U A;  5DTB A;  1WVJ A;  1TT1 A;  2DE2 A;  2Y84 A;  3D4G A;  1UTH A;  4LON B;  4N6P A;  3BKI B;  1B0L A;  2CMO A;  3QK6 A;  4TQU Q;  3DEL B;  1H45 A;  1US5 A;  2FA7 A;  2X7Q A;  4POW A;  3T9U A;  1XT8 A;  4QSC A;  1LAH E;  1B5J A;  3TDJ A;  3IOR A;  4QHQ A;  3KG2 A;  4KI0 E;  5I57 A;  4DCX A;  4F18 A;  1AH5 A;  1XOC A;  2NVU B;  5J1D A;  4IGR A;  3IB0 A;  2M8C A;  2OBG A;  2I6E A;  4R6K A;  3U93 A;  1A8F A;  3PUV E;  5DEX B;  3O6G A;  3WAF A;  3SEV A;  4R2B A;  1A99 A;  1Z7M E;  2XXH A;  3KJ7 A;  4HCY A;  4F3S A;  1AL3 A;  4O3A A;  2HZL A;  4RK9 A;  4ELO A;  2Z8F A;  4ELP A;  4GOT A;  3IO4 A;  2P1S A;  4QFK A;  1MY4 A;  2AIX A;  4DLD A;  3O66 A;  2IEE A;  3S9N C;  4H8I A;  3FZV A;  1R1N A;  1MH4 A;  1FTL A;  4IO2 A;  3VLU A;  3GBB A;  2HAV A;  3S2V A;  1IXH A;  1F9B A;  4GQO A;  4ELR A;  3EF7 A;  4G68 A;  4KYD A;  1N7W A;  3O29 A;  4P0G A;  2DWJ A;  1IEJ A;  3V89 B;  1B05 A;  3PPO A;  3L6H A;  3QSL A;  2FYI A;  1LBC A;  4YIC A;  1OVB A;  3FVO A;  4H5G A;  5H8N A;  3TEP A;  2OLB A;  5CM6 A;  4ZDM A;  3M8U A;  1IZ1 A;  4GF8 A;  1M5E A;  3FV2 A;  3CSB A;  2QRY A;  5CBR A;  1H44 A;  1IQ7 A;  5AA3 A;  1EZ9 A;  1VFE A;  3V5A A;  4QF9 A;  1MXU A;  1TXF A;  4FEC A;  2PBW A;  1VR5 A;  4KR5 A;  4R6Y A;  1XC1 A;  3U8Q A;  3ODB A;  3PMW A;  3TTL A;  3TTM A;  4AB5 A;  5I58 B;  5KCJ A;  1OQH A;  1GR2 A;  1IXI A;  1LFG A;  1ATG A;  2DE4 A;  1M5B A;  2F7B A;  2QS2 A;  3IOV A;  4H6D A;  4PFT A;  2Z8E A;  3MZ1 A;  3K6W A;  3T66 A;  5ICQ A;  4I1D A;  5FHN A;  1LFH A;  4LQ5 A;  3O28 A;  2GHB A;  4IO6 A;  1EH3 A;  5F7V A;  1L5T A;  5L9S A;  4NF4 B;  3LSL A;  3H6U A;  5TP9 A;  2A5S A;  1P1Q A;  4QSD A;  2I3V A;  3TEL A;  1P1U A;  3RT6 B;  4C1U A;  2UYE A;  5HBC A;  1SYH A;  3E3K A;  1SI0 A;  2F34 A;  2W7Y A;  2FNC A;  4OMB A;  2HFB A;  4BDL A;  3PGF A;  4HS7 A;  1MRP A;  5DYH A;  3RN8 A;  3EHU A;  3WAE A;  4KD5 A;  1B9J A;  4R74 A;  4DXB A;  2RC7 A;  1SI1 A;  1LFI A;  5FTI A;  3FJG A;  3PUX E;  1GVC A;  2V3U A;  3OSQ A;  3IOU A;  1IIT A;  1Y3Q A;  2DXR A;  3VDF A;  4LAT A;  1GGG A;  5KDT B;  2QS1 A;  2XD2 A;  3K00 A;  4GXA A;  2XXR A;  4H65 A;  3U1O A;  4BDQ A;  1FTM A;  4XKN A;  1AIV A;  1IIW A;  1LB8 A;  1HSL A;  3EHT A;  1LB9 A;  1JVX A;  4LUB A;  5F1Q A;  2GHA A;  2QMX A;  4ZZA A;  3IAZ A;  3RPW A;  3USD A;  2OWT A;  4EDP A;  4EQB A;  4GD5 A;  2Y7P A;  1B3F A;  3H6T A;  2Q2C A;  4U22 A;  3VXB A;  3W15 C;  4XXU A;  4MLQ A;  1NKX A;  3CFZ A;  4UAC A;  2ZNT A;  3A09 A;  3T22 A;  3UOR A;  2I3W A;  1B5H A;  2I4B A;  1O7T A;  1FQB A;  2HCA A;  1VE4 A;  4QFN A;  5I59 A;  4DCY A;  3CG3 A;  3K6U A;  3RTF B;  3IX1 A;  2F6P A;  1BIY A;  5JTY A;  2O1M A;  3M3F A;  1MQJ A;  2R9J A;  4FJP A;  4NWD A;  2KLF A;  4IO3 A;  1MY2 A;  4KFQ A;  3PU5 A;  5CI5 A;  3S9L C;  5FHM A;  3VVE A;  3H6W A;  1P99 A;  3SEY A;  3O97 A;  3OMB A;  3FXR A;  4YB6 A;  5DVJ A;  4ZZE A;  3RQT A;  4F39 A;  5BUU A;  2XX7 A;  3DP6 A;  3OOA A;  1JW5 A;  4PP0 A;  1Y3P A;  2ONR A;  3SEX A;  1A7L A;  4YKI A;  4F22 A;  1JEV A;  2Z23 A;  4NF6 B;  5FHO A;  2DE3 A;  2ABH A;  2O1L A;  3TMG A;  3KOT A;  4P11 A;  4OXV A;  1MY0 A;  2NXO A;  3LSX A;  5IKB A;  3Q28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...