2Y7IA

Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
228
structure length
228
Chain Sequence
b'ASVSARTLHFGTSATYAPYEFVDADNKIVGFDIDVANAVCKEMQAECSFTNQSFDSLIPSLRFKKFDAVIAGMDMTPKREQQVSFSQPYYEGLSAVVVTRKGAYHTFADLKGKKVGLENGTTHQRYLQDKQQAITPVAYDSYLNAFTDLKNNRLEGVFGDVAAIGKWLKNNPDYAIMDERASDPDYYGKGLGIAVRKDNDALLQEINAALDKVKASPEYAQMQEKWFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STM4351
publication title Crystallographic and Microcalorimetric Analyses Reveal the Structural Basis for High Arginine Specificity in the Salmonella Enterica Serovar Typhimurium Periplasmic Binding Protein Stm4351.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica
molecule tags Arginine-binding protein
total genus 83
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2y7iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2y7iA02
4OERA 2DXYA 1BKAA 2I49A 5DYHA 2QMWA 4I1DA 2CZLA 1B3GA 1UIVA 3PMWA 5BWJA 3TDJA 1MY2A 2H99A 3P7IA 4I9DA 2QMXA 4IO7A 2Z22A 4NMYA 3VLUA 1ATGA 3R26A 3C32A 2OWSA 4XKPA 1NNTA 1VR5A 3M8UA 3BFTA 4UA8A 1TFDA 1IZ1A 2A5SA 2PVUA 3ILTB 1N3XA 5I57A 1Y4CA 2F7BA 1PEBA 2AL5A 3EHTA 4R2FA 1POY1 5JEIA 1IIWA 4OYVA 1A54A 2YJPA 3HHGA 4G8NA 3SESA 3UIFA 3MP1A 4Q8RA 3TODA 5DVJA 3SDFA 2E0SA 5FHMA 3VVDA 3MVWA 4ZEKA 2X7QA 1MY0A 3RGYA 3TMGA 3KBRA 4TQUQ 1LFHA 5H8SA 2P0SA 3UN6A 1B3EA 4RXLA 1AH5A 1LCFA 1FTJA 1MY1A 3G3FA 4DIGA 1B7HA 4GD5A 1B4ZA 2V84A 3T66A 4QFLA 1NNFA 4YB6A 1XHYA 2XX7A 5H8FA 3VXCA 1B52A 4KYDA 2BJJX 4M4GA 4LZ8A 2O1MA 3Q29A 1B2HA 1UTBA 4OESA 2I4BA 2F36A 2UVIA 1N04A 3IOWA 1FQBA 1F9BA 1SQYA 4EQ9A 1JQFA 1ZU0A 1LFIA 2GFEA 3OELA 3CVGA 3IAZA 4IO3A 4GF8A 1O64A 1JW5A 3RNNA 1PBQA 2O84X 4OFJA 1B51A 4GQOA 2DOJA 1US5A 1JVYA 3VV5A 3JZJA 4PETA 5J1DA 3V5AA 3FVOA 1R1NA 3KFMA 1PB9A 4QFKA 1AL3A 1QJMA 4QFOA 2H25A 2DWJA 3T9VA 1H45A 5AA2A 4GOTA 3PD9A 5I57B 3PMVA 3TELA 1IXCA 4P11A 2QJEA 3PUVE 3OEMA 4DE8A 4FEBA 4RA1A 5L9MA 3LSXA 3MP8A 4ZZAA 3K1MA 4KYEA 3THIA 3V89B 4YKIA 2DS9A 5DVIA 4F22A 4JB7A 2V93A 3LR1A 3K0VA 3BFUA 3RTFB 3N6TA 4ZEBA 2H4IA 1Y4TA 3MZ1A 3CFLA 4ELOA 2GHAA 3PPOA 4TOZA 3ILUB 5AA1A 4G2ZA 3PUXE 4OENA 4YAHX 4ZE9A 4R9GA 5CMBA 1MDP1 5I2KA 3K6VA 4KQPA 2G93A 4JWOA 4BDOA 2I0BA 3KSJA 1D9VA 3Q26A 4H5GA 2QRYA 2QS2A 5TPAB 3TUSA 2ZNUA 4LONB 1ANFA 1SW1A 3OMBA 2I0CA 4POWA 2DWIA 3K6XA 1UTBB 1NMUA 4EUOA 1HSEA 3OO9A 1HSJA 3LUYA 5FHOA 4Z0IA 3H3GA 3E3KA 1M5BA 5TP9A 4M1VA 5AA4A 1EZPA 4N13A 3TTKA 4UACA 1BTJA 4U21A 2Z8EA 4OFOA 5H8QA 4LQ2A 5BUUA 2I6EA 2THIA 3U94A 3TYHA 4RNSA 1B40A 1B3HA 1FCKA 1HSLA 3OEKA 3Q28A 4KPTA 1IXGA 3Q27A 5KDTA 4EDPA 3OO8A 4OWDA 4LQ5A 5I58A 4OTEA 3RTWB 4LUBA 3T96B 1MXWA 5AA2D 5AA2B 3OO7A 5I56A 2X26A 1MPBA 1RYOA 3BKIB 4NF4A 1B0HA 1PBPA 5ISUA 3LSWA 1M5EA 1R9QA 4QHQA 5TU0A 1I6BA 3K1NA 3B6WA 3T93B 2H9BA 1SVXB 3PMXA 4ECFA 4F1VA 4LA9A 3O66A 1JW1A 2D5WA 4ESWA 4R2BA 1OVTA 4XTCQ 2R6GE 4HCYA 3KOSA 4GLIA 2XXXA 3CG3A 3EHUA 4R6KA 1N84A 4WKMA 2HAVA 3V8XB 4ZE8A 1QUJA 5I2KB 2DVCA 3MW0A 1IXIA 2D21A 4KCCA 2O1LA 3G3HA 4TLLB 1TT1A 2CMOA 2REGA 2F97A 3VVFA 1ZKBA 1TFAA 2AIXA 1H44A 4RJZA 4YKPA 1MH4A 2O7UA 2O6AA 3O28A 3TKDA 4YZZA 2FA7A 3K00A 5TP9B 3FJMA 3N6UA 1SW2A 1FQAA 5AA4B 1GV8A 5DTBA 4O3AA 4QSDA 3H7MA 4XKQA 4FORA 2VHAA 5FHNA 3K2DA 1QW0A 4QFNA 2A5TB 5IAIA 4X48A 3GBBA 5KDTB 1B5JA 4ZECA 5I58B 2OCUA 1P99A 3HSTA 2DVZA 3GZGA 1MQHA 3JV9A 5I56B 3HPIA 4NF5B 2RC8A 2DXRA 2YLNA 5B7DA 2DE4A 4R9FA 1RKMA 2RCBA 1URSA 4BDMA 5K2YA 2Z23A 1EZOA 2XXQA 3DLNA 1A8FA 3MVZA 4GXSB 3OOAA 3O29A 3RQTA 1LLSA 3PPRA 5ICQA 4GRKA 3G3IA 2ZNTA 1II5A 1MXXA 2OWTA 1MQJA 1SYIA 4YB7A 2RC9A 3IJOB 3SETA 1LAFE 2OK2A 1OLCA 1OQGA 1S50A 3C31A 1VFEA 1SBPA 4E0WA 3R6UA 3WAEA 1Y3QA 2QPQA 4AB6A 5F1QA 1DTZA 2F35A 3PU5A 1ZIUA 3KOTA 4FE8A 4MLQA 4NWDA 3B6TA 1IEJA 3FUZA 4I62A 4IO6A 3RUMA 3KGCA 1MQDA 3CSBA 4QF9A 4FECA 5I2NA 2XD3A 3VVEA 4X1DA 4FJPA 3G7WA 2PT2A 1IUDA 2O68A 2DE3A 4MF3A 4KFQA 1FTOA 2F6PA 4DDDA 4Q5TA 3FIRA 2ABHA 1MG1A 3M3FA 4DXCA 3MZBA 1UQWA 3VFJA 2Y7RA 2WKYA 3EF7A 1WDNA 1I69A 3KJTA 2AL4A 3H6UA 3UGWA 3MBPA 3T9UA 3UP9A 3MJNA 3H6WA 4FIMA 1EH3A 3I3VA 2XHDA 3RLFE 4IO4A 1B7ZA 5A5XA 2ZYOA 3OENA 4G68C 5EHSA 2HEUA 4F18A 2DWHA 4JXIA 3U1OA 4N6PA 2V3UA 4XKNA 2DQVA 5TPAA 1S7YA 1VFDA 1LSTA 3HV1A 3D4CA 2QS1A 3GLBA 2I4CA 1CE2A 1JW4A 2DE2A 1S9TA 4WEPA 3SKPA 4N07A 2KLFA 3KN7A 1PB8A 3Q25A 3OSRA 1KWHA 3JYRA 3C34A 1NKXA 1SW4A 2XXWA 4DCXA 4G68B 3ODBA 3C33A 1FQEA 1R9LA 4EF2A 1B1XA 1RYXA 4F29A 1P1QA 1ZJLA 4LATA 1B3LA 2Y7WA 5ELVA 2Q8JA 1NL5A 5I2NB 1N3WA 3MC2A 4HS7A 4JSOA 4Q30B 1URDA 3ZKKA 1XC1A 2F8DA 2REJA 1IXHA 3O6HA 1Z7ME 3RT6B 5F7VA 4L17A 3N26A 3ONMA 4BDLA 1MPDA 4RYAA 3C36A 3FGSA 4RPOA 2NUVA 2UVGA 3LSFB 2XXUA 1OLAA 2ZYKA 1SI0A 3L6HA 4R73A 1SI1A 2PT1A 2Z8FA 5HM4B 5CMCA 3MUQA 4EXLA 2LAOA 1DOTA 2ZMBA 5A5XB 2HQ0A 1MQIA 5EHMA 3CI8A 1FQFA 1H76A 4KHZE 1MPCA 4F1YA 4ND9A 2O51A 4GVOA 1YTVA 1N7WA 3FXRA 2Q89A 4OVJA 2F6GA 2DYXA 1EZ9A 3FD3A 1PDAA 3PGFA 2ALUA 3CRBA 4WEDA 4AQ4A 3OO6A 1MS7A 3IB2A 4ELPA 1A99A 2W7YA 2Y84A 4DXBA 2UYFA 1D9YA 3OSQA 3CSGA 4MFIA 5ITPA 1AMFA 4Q0CA 1LB9A 4HTGA 2O69A 4G8MA 1R6ZA 5KCJA 3MZ9A 3O6IA 2Y7IA 4JDFA 2F7CA 1ELJA 4H1XA 4H0WA 3W15C 4F3SA 4OHNA 2A5TA 3TQLA 3S9EA 1FQDA 1QULA 2I3VA 1Y1ZA 1LAHE 1D3KA 4H5FA 3BBRA 3S9LC 1B3FA 3U8QA 4RPNA 3PPNA 3K6WA 1H3DA 1A7LA 4NF5A 4E0XA 4I8CA 4BDRA 2Y7KA 3V83A 1B0LA 3FATA 5DVFA 1PB7A 4EF1A 1JVXA 5K2XA 3I6VA 1T0KA 1VE4A 4LZ7A 3RPWA 1B5IA 5ITOA 1M5CA 3IB0A 5JTYA 2XXTA 4PFTA 5CMMA 4TLMB 4IGTA 1QKBA 2NVUB 4YKKA 4JBZA 3TTNA 1J1NA 4O3BA 4BDNA 1GTKA 4R72A 1Y3PA 3TCGA 4AB5A 3FZVA 2ONRA 2NWJA 3K4UA 3H03A 5H8NA 1Z7NE 4H8JA 1ZTYA 4H67A 3F11A 1TWYA 2DWAA 3K01A 4YKJA 3H4ZA 3AXFA 1NFTA 3LC8A 3G3KA 1Q35A 4KYSA 4PFYA 1A40A 4ELRA 2O7IA 3SEWA 4X9TA 1MDQA 3HN0A 3IO4A 2V3QA 4DXUA 4YMBA 1JNFA 5ICTA 5HBCA 4ESXA 3IORA 4NF6A 1MM7A 3EQ1A 1VSOA 1LBBA 3VXBA 5KCJB 3A3UA 3DP4A 2RC7A 1P1OA 4KCDA 3G3GA 1UIUA 1AIVA 5L8DA 5H8HA 4GL8A 1GGGA 1Y1MA 1YCJA 2ONSA 4IO5A 1M5DA 1M5FA 1XT8A 3SERA 3O6GA 3O97A 1FTMA 1ZBMA 2YPNA 1JEVA 2F5XA 5CC2A 1MXVA 4F19A 2ESNA 4XKRA 4MLVA 4NF8A 1NNKA 1JETA 3PUYE 3CIJA 1B4HA 4Z7EA 1URGA 3D4GA 3TTRA 3A09A 1SW5A 2UYEA 1XS5A 3QYTA 1NNPA 2ZYNA 2HCAA 1GVCA 5CRYA 2QS4A 3MVXA 1SYHA 5JTYB 3HHFA 3KN8A 2R71A 4ZS9A 1N0TA 4FAJA 1BP5A 4BDQA 3QSLA 1A55A 3L6GA 1DTGA 2P1SA 3IJXB 2XX8A 3PD8A 2VD2A 1B7UA 4RK9A 3PPPA 4U22A 3SEUA 5H8NB 3H6VA 4IY6A 1FW0A 2VP1A 1SDXA 4G68A 2B3BA 3G3JA 1D4NA 4IY5A 4QFPA 3A3CA 1WODA 3M3KA 1MH3A 1N76A 1DPEA 4GWOA 2OJTA 3I5OA 1B05A 2Q2AA 3EPEA 1EU8A 1QVSA 2H98A 4NF6B 2UXAA 1XVYA 5I59A 4F3BA 3TFLA 1N7XA 1MXZA 1AOVA 1ZMGA 1IQ7A 3W9WA 2ZYMA 3GBAA 1OVBA 1CB6A 1FQCA 4R6YA 4PP0A 4HW8A 4MH5A 2H5YA 2PMSA 3IOVA 3OXNA 3H06B 5H8HB 3HO7A 4H8IA 3TTLA 4KR5A 3FV2A 3MPLA 2GHBA 5CBRA 3QK6A 1YPNA 2Q88A 4ELQA 4THIA 4EXKA 3GXAA 4NE4A 4ISUA 5JK4A 5DEXA 4EQ7A 3B6QA 4YB5A 4NF8B 4P0GA 2VOZA 3WAFA 2NXOA 4OZ9A 3PPQA 4IO2A 2IA4A 2ONKE 1B6HA 1MY3A 3O2AA 5CI5A 1QUIA 4U4SA 3MPKA 1A8EA 3TAJA 1MM6A 2Q2CA 3DELB 2HFBA 1P1WA 3VLWA 4NTLA 3MAMA 1B1HA 4U1ZA 3FXQA 3S9MC 2F7AA 3SEXA 2XXYA 3VDFA 3CFXA 2D3IA 4OXVA 3U72A 1Y9UA 3IR1A 3E9XA 2R9JA 2GRVA 5CMKA 3PUZE 3T22A 3KEIA 2HZKA 3K6UA 1ZLQA 3IO6A 3UA8A 2UVHA 3ZKLA 3KZGA 4R75A 2XXVA 4OMBA 4U4XA 1OIBA 3ECRA 4F3GA 3FV1A 3IL1B 2P2AA 5I59B 1XVXA 3FVNA 2X7PA 2XXHA 4ZZEA 1TXFA 4C1UA 4K3FA 5CBSA 2FYIA 3TQWA 3PUWE 1BIYA 3QIMA 3VLVA 1POTA 4FATA 1USYH 4G4PA 4F2QA 5HPQA 4HCWA 2Q9TA 4GXAA 2ZNSA 1O7TA 4DZ1A 3RN8A 1YAEA 4OQOA 5DEXB 2DP8A 4KD5A 2XXIA 3K02A 4OEVA 1DMBA 2B3FA 4RY1A 1OMPA 3S9NC 4ZEDA 5KZTA 3LBSA 1DSNA 3TPAA 3B7DA 4POXA 4QRZA 4O3CA 2F78A 3N94A 4YU0A 3CG1A 3W9VA 4F39A 3K1PA 5I84A 4LVQA 3R7XA 3C35A 4NEDA 4U23A 4C1TA 4G77A 4OETA 2VGQA 3OD7A 3IOTA 2ZXTA 1NH8A 2DSFA 3IK6B 4EQBA 3C4MA 2ANJA 1PC3A 2FNCA 3DP8A 3FXUA 2G29A 4DCYA 2XXPA 5H8FB 4PFWA 2HZLA 2OZZA 3DP6A 2NOOA 3N5LA 2HXWA 5FTHA 1Y3NA 4ZEFA 3H6TA 1P1UA 2I48A 2AYSA 1B5HA 1Q1KA 4GIZA 1FTLA 2RKMA 2IEEA 3TEPA 4PFUA 3SEVA 3RT8A 3UK4A 4BLAA 2RCAA 3FVKA 2PBWA 4XXUA 1SD3A 4IGRA 1LGBC 2RF1A 2E1SA 3C9HA 3SEYA 4R6HA 1MRPA 4ONYA 3ZSFA 1FTKA 4G8HA 3KN3A 3O9PA 3S4UA 2OLBA 5EYFA 1MQGA 2B65A 4QSEA 5LOMA 3IB1A 1H43A 4QSCA 4H6DA 4KI0E 1O63A 3TTMA 1LAGE 2GH9A 2F34A 3U92A 1UTHA 2V3TA 4ZDMA 5AE4A 1I6AA 5M2VA 3DM0A 4XIGQ 3QAXA 4F31B 1JEUA 3U93A 3QUJA 1Y20A 1USYE 3TCFA 4PQJA 4ZEIA 4P0IA 2PYYA 3EHSA 1B46A 4WXJA 3LSLA 2QSXA 4X1BA 1XOCA 2M8CA 3HCQA 3CFZA 2XX9A 1OQHA 5IKBA 2QL3A 4U2RA 1LAXA 1BLFA 1MY4A 4DLDA 3RY3A 1US4A 1WVJA 3M3LA 2I58A 1P1NA 4JSDA 1LFGA 3ZS6A 2XD2A 3T9XB 1B58A 4F3PA 3KJ7A 5L9SA 1MXUA 2I3WA 1I6QA 3MVYA 1LB8A 4NWCA 3TZAA 4OFLA 2OBGA 4LZ5A 3CR9A 3FJ7A 2VD3A 4GFRA 1LBCA 3PV0E 2UVJA 5DT6A 4PE5B 5H8QB 3KSXA 3FASA 2V25A 3QXMA 1B9JA 3S2VA 1LCTA 3UORA 1QKAA 3KG2A 4RK2A 3TCHA 4MBPA 3IOUA 3FVGA 4YMAA 2HAUA 1QUKA 1B32A 1DPPA 3E4RA 2QS3A 2Y7PA 4H65A 4R74A 4F1UA 4NF4B 2PX1A 4U1OA 5FTIA 4C0RA 1UTHB 2XXRA 4JWYA 3MQ9A 1MXYA 5CM6A 3MP6A 1NH7A 4IB2A 3USDA 4JWXA 3EN3A 3FJGA 1GR2A 3VE1B 5L9OA 4F2OA 3T9HB 5B70A 2Z8DA 4GL0A 3QUFA 4LP2B 3MWBA 4YICA 1L5TA 5AA3A 4OEUA 4FEDA 3E13X 3IX1A 1IITA 2RINA
chains in the Genus database with same CATH superfamily
4OERA 2DXYA 1BKAA 2I49A 5DYHA 2QMWA 4AS5A 4I1DA 2CZLA 1B3GA 1UIVA 3PMWA 5BWJA 3TDJA 1MY2A 2H99A 3P7IA 4I9DA 2QMXA 4IO7A 2Z22A 2B4LA 4NMYA 3VLUA 1ATGA 3R26A 3C32A 2OWSA 4XKPA 1NNTA 1VR5A 3M8UA 3BFTA 4UA8A 4N15A 1TFDA 1IZ1A 4PGNA 2A5SA 2PVUA 3ILTB 1N3XA 5I57A 4I3EA 1Y4CA 2F7BA 1PEBA 2AL5A 3EHTA 4R2FA 1POY1 5JEIA 1IIWA 4OYVA 1A54A 2YJPA 3HHGA 4G8NA 3SESA 3UIFA 2CZKA 3MP1A 3B8BA 4Q8RA 3TODA 5DVJA 3SDFA 2E0SA 5FHMA 3VVDA 3MVWA 4P8BA 4ZEKA 2X7QA 1MY0A 1XI6A 3RGYA 3TMGA 5DW8A 3KBRA 4TQUQ 1LFHA 5H8SA 2P0SA 3UN6A 1B3EA 4RXLA 1AH5A 1LCFA 4GWUA 1FTJA 2B4MA 2FVZA 1MY1A 3G3FA 4DIGA 1B7HA 4GD5A 1B4ZA 4NGUA 2V84A 3T66A 1NUXA 5EQAA 2FIEA 1FSAA 1NNFA 4QFLA 4YB6A 5IZ1A 1XHYA 2XX7A 5H8FA 3VXCA 1B52A 4KYDA 2BJJX 4M4GA 4LZ8A 2O1MA 3Q29A 1B2HA 1UTBA 4OESA 2I4BA 2F36A 2UVIA 1N04A 3IOWA 1FQBA 1FJ6A 1F9BA 1SQYA 4EQ9A 1JQFA 1ZU0A 1LFIA 2GFEA 3OELA 3CVGA 3IAZA 4IO3A 4GF8A 1O64A 1FPJA 1JW5A 3RNNA 2WYPA 1PBQA 2O84X 4OFJA 1B51A 4GQOA 2DOJA 1US5A 1JVYA 3VV5A 3JZJA 4PETA 5J1DA 4DI4B 4GWSA 3V5AA 3FVOA 1R1NA 3KFMA 1PB9A 4QFKA 4MCOA 1AL3A 1QJMA 4QFOA 2H25A 2DWJA 3T9VA 1H45A 5AA2A 4GOTA 3PD9A 5I57B 3PMVA 3TELA 1IXCA 4X8RA 4P11A 2QJEA 3PUVE 3OEMA 4DE8A 4FEBA 4RA1A 5L9MA 3LSXA 3MP8A 4ZZAA 3K1MA 4KYEA 3THIA 3V89B 4YKIA 2DS9A 5DVIA 4F22A 4PDDA 4PFBA 4JB7A 2V93A 3LR1A 1NI9A 3K0VA 3BFUA 3RTFB 3N6TA 4ZEBA 2H4IA 3KC0A 1Y4TA 3MZ1A 2R8TA 3CFLA 4ELOA 2GHAA 3PPOA 4TOZA 3ILUB 5AA1A 4G2ZA 5EQ8A 4NX1A 3PUXE 4OENA 4YAHX 2ZZXA 4ZE9A 4R9GA 5CMBA 1MDP1 3T1BA 5I2KA 3K6VA 1FPKA 4KQPA 2G93A 4JWOA 4BDOA 2I0BA 2VPOA 4MHFA 4PCDA 3KSJA 1D9VA 3Q26A 4H5GA 2QRYA 2QS2A 5TPAB 3CHGA 2ZNUA 3TUSA 4LONB 2V4CA 1ANFA 1SW1A 3OMBA 4N17A 2I0CA 4POWA 2DWIA 3K6XA 1UTBB 1NMUA 1K9ZA 2F3BA 4EUOA 4PAIA 1HSEA 3OO9A 2XWVA 1HSJA 3LUYA 5FHOA 4Z0IA 3H3GA 4GWZA 3E3KA 1M5BA 5TP9A 4M1VA 4MEVA 2XWOA 5AA4A 1EZPA 4N13A 3TTKA 4UACA 1BTJA 4U21A 2Z8EA 4OFOA 5H8QA 4LQ2A 5BUUA 2I6EA 2THIA 3U94A 3TYHA 4RNSA 1B40A 1B3HA 1FCKA 1HSLA 3OEKA 3Q28A 4KPTA 1IXGA 3Q27A 5KDTA 4EDPA 3OO8A 4OWDA 4LQ5A 5I58A 4OTEA 3RTWB 4LUBA 3T96B 1MXWA 5AA2D 4MNIA 5AA2B 3OO7A 5I56A 2X26A 1FPFA 1MPBA 1RYOA 3BKIB 4NF4A 1B0HA 1FPIA 5IZZA 4GX3A 1PBPA 5ISUA 3LSWA 1M5EA 1R9QA 4QHQA 5TU0A 1I6BA 3K1NA 3B6WA 3T93B 4N4UA 2H9BA 1SVXB 3PMXA 2CEXA 4ECFA 4F1VA 4LA9A 2BJIA 1D9QA 3O66A 1JW1A 2D5WA 4ESWA 4R2BA 1OVTA 5ET8A 4XTCQ 1NUYA 2R6GE 4HCYA 3KOSA 4GLIA 2XXXA 3CG3A 3EHUA 5LDZA 4R6KA 1N84A 4I3YA 1FBDA 4WKMA 2HAVA 3V8XB 4ZE8A 1QUJA 2FHYA 2WBBA 5I2KB 2DVCA 3MW0A 1IXIA 2D21A 4KCCA 2O1LA 3G3HA 4TLLB 4HE1A 1TT1A 2CMOA 2REGA 2F97A 3VVFA 2KQZA 1ZKBA 4P3LA 1TFAA 2AIXA 1H44A 2CZHA 4RJZA 4YKPA 5I7IA 1IMBA 1MH4A 2O7UA 2XWKA 2O6AA 3O28A 3TKDA 4YZZA 2FA7A 3K00A 5EYGA 5TP9B 3FJMA 3N6UA 1SW2A 1FQAA 5AA4B 1GV8A 5DTBA 4O3AA 4QSDA 3H7MA 3B50A 3KBZA 4P47A 4XKQA 4FORA 5IM2A 2VHAA 3MYUA 4GBWA 5FHNA 3K2DA 1QW0A 4QFNA 2A5TB 5IAIA 4X48A 3GBBA 5KDTB 1B5JA 4PC9A 4ZECA 2VT5A 4OVRA 5I58B 2OCUA 1P99A 3HSTA 2DVZA 3GZGA 4PGPA 1MQHA 3JV9A 5I56B 3HFUA 3HPIA 4NF5B 2RC8A 2DXRA 4OVPA 2YLNA 5B7DA 2DE4A 4R9FA 1RKMA 2RCBA 1URSA 3MSTA 4BDMA 5K2YA 2Z23A 1EZOA 2XXQA 3DLNA 1A8FA 3MVZA 4GXSB 3OOAA 3O29A 3RQTA 4QBAA 1LLSA 3PPRA 5ICQA 4GRKA 3G3IA 2ZNTA 1II5A 1MXXA 2OWTA 1MQJA 1SYIA 4YB7A 2PFZA 2RC9A 3IJOB 3SETA 1LAFE 2OK2A 4HE0A 1OLCA 1OQGA 1S50A 3C31A 1VFEA 1NV7A 1SBPA 4E0WA 3R6UA 3WAEA 1Y3QA 2QPQA 4AB6A 5F1QA 1DTZA 2F35A 3PU5A 1ZIUA 1FPGA 3KOTA 4FE8A 4MLQA 4NWDA 3B6TA 1IEJA 5IZ3A 1NV5A 3FUZA 4I62A 4FBPA 4IO6A 3RUMA 4PF8A 3KGCA 1MQDA 3CSBA 4QF9A 1IMDA 1G0HA 4FECA 1FRPA 5I2NA 2XD3A 3VVEA 4X1DA 4FJPA 1KA1A 3G7WA 2PT2A 1IUDA 2O68A 2DE3A 4MF3A 4KFQA 1FTOA 2F6PA 4DDDA 4Q5TA 3E79A 3FIRA 2ABHA 5ET7A 1MG1A 3M3FA 4DXCA 3MZBA 1UQWA 3VFJA 2Y7RA 2WKYA 3EF7A 1I69A 1WDNA 1RDYA 4JVCA 3KJTA 2AL4A 3H6UA 3UGWA 3LUZA 3MBPA 3T9UA 3UP9A 3MJNA 3H6WA 4FIMA 1EH3A 2PCRA 3I3VA 2XHDA 3RLFE 4IO4A 4P56A 1B7ZA 5A5XA 3FXBA 4XF5A 2ZYOA 4PAKA 3OENA 4G68C 5EHSA 2HEUA 4F18A 2DWHA 4JXIA 3U1OA 4P1EA 4OVSA 2P3VA 1LBVA 4N6PA 2V3UA 3QMFA 4XKNA 2DQVA 5TPAA 1S7YA 1VFDA 1LSTA 3HV1A 1AWBA 3D4CA 2QS1A 3GLBA 2I4CA 1CE2A 3E78A 1JW4A 4PF6A 2OWZA 2DE2A 1S9TA 4WEPA 3SKPA 4N07A 2KLFA 3KN7A 1PB8A 3Q25A 3OSRA 1KWHA 3JYRA 3C34A 1NKXA 1SW4A 2XXWA 4DCXA 4G68B 3ODBA 3C33A 1FQEA 1R9LA 4EF2A 5LTCA 1B1XA 1RYXA 4F29A 1P1QA 5IZ3B 1BK4A 1ZJLA 4LATA 1B3LA 2Y7WA 5ELVA 2Q8JA 3ROJA 1NL5A 5I2NB 3BIGA 4GX6A 1N3WA 3MC2A 4HS7A 4JSOA 4Q30B 1URDA 3ZKKA 3EKIA 1XC1A 2F8DA 2REJA 1IXHA 3O6HA 1Z7ME 3RT6B 5F7VA 4L17A 3N26A 3ONMA 4N6KA 4BDLA 1MPDA 4RYAA 2L5VA 3C36A 4NAPA 3FGSA 4RPOA 2NUVA 4NF0A 2UVGA 3FBPA 1YXIA 3LSFB 2XXUA 1OLAA 2CEYA 2MKZA 2ZYKA 1SI0A 1VDWA 3L6HA 4R73A 3PTYA 1SI1A 2PT1A 2Z8FA 5HM4B 5CMCA 1LEVA 3MUQA 4EXLA 2LAOA 1IMAA 1DOTA 2ZMBA 5A5XB 2HQ0A 1MQIA 5EHMA 3CI8A 1FQFA 1H76A 4KHZE 1MPCA 4F1YA 4ND9A 2O51A 2P3NA 4GVOA 1YTVA 1N7WA 3FXRA 2Q89A 4OVJA 2F6GA 4MX6A 2DYXA 1EZ9A 3FD3A 1PDAA 3PGFA 2ALUA 3CRBA 4WEDA 1YYZA 4AQ4A 3OO6A 1MS7A 4QXDA 3IB2A 4OVQA 4ELPA 1A99A 2W7YA 2Y84A 3RYDA 4DXBA 2FBPA 3D1RA 2UYFA 1D9YA 3OSQA 3CSGA 4PAFA 4P9KA 4MFIA 1SPIA 5ITPA 1AMFA 4Q0CA 1LB9A 4HTGA 2O69A 4G8MA 1R6ZA 2FIXA 5KCJA 3MZ9A 3O6IA 1JP4A 2Y7IA 5EQ7A 4JDFA 2F7CA 1ELJA 1KZ8A 4H1XA 4H0WA 4N6DA 3W15C 4GWXA 4F3SA 4OHNA 2A5TA 3TQLA 3S9EA 1FQDA 1QULA 2I3VA 1Y1ZA 5F24A 5ESYA 1LAHE 1D3KA 4H5FA 3BBRA 1FJ9A 1NV0A 3S9LC 1B3FA 3U8QA 4RPNA 3PPNA 3K6WA 1H3DA 1A7LA 4NF5A 4E0XA 4I8CA 4BDRA 2Y7KA 3V83A 1B0LA 3FATA 5DVFA 1PB7A 4EF1A 1JVXA 5K2XA 1IMEA 3I6VA 1T0KA 5T3JA 1VE4A 4LZ7A 3RPWA 1B5IA 5ITOA 1M5CA 3IB0A 5JTYA 2XXTA 2HXRA 4PFTA 5CMMA 4TLMB 4IGTA 1QKBA 2NVUB 4YKKA 4NQ8A 4JBZA 3TTNA 1J1NA 4O3BA 2JJKA 4BDNA 3IFAA 4HE2A 4HXVA 1GTKA 4R72A 1Y3PA 3TCGA 4AB5A 3FZVA 2ONRA 2NWJA 3K4UA 1FBCA 3H03A 5H8NA 1Z7NE 4H8JA 1ZTYA 4H67A 3F11A 1TWYA 2DWAA 3K01A 4YKJA 3H4ZA 1LBYA 3AXFA 1NFTA 2CZIA 3LC8A 1NV4A 3G3KA 1Q35A 4MNPA 4KYSA 4PFYA 1A40A 4ELRA 2O7IA 3SEWA 4X9TA 1MDQA 3HN0A 3IO4A 2V3QA 4DXUA 4YMBA 1JNFA 5ICTA 5HBCA 3RPLA 4H46A 4ESXA 3IORA 4NF6A 1MM7A 3EQ1A 1VSOA 1LBBA 3VXBA 5KCJB 3A3UA 3DP4A 2RC7A 1P1OA 2XWIA 4N91A 4KCDA 4G61A 3G3GA 1NUZA 1UIUA 1AIVA 5L8DA 5H8HA 4GL8A 5A5LA 1GGGA 2GQ1A 1Y1MA 1YCJA 1K9YA 2ONSA 4IO5A 1M5DA 1M5FA 1XT8A 3SERA 4MIJA 3O6GA 3O97A 1FTMA 1ZBMA 2YPNA 4MMPA 1JEVA 2F5XA 5CC2A 1MXVA 4F19A 2ESNA 4XKRA 4MLVA 4NF8A 4PBHA 3NOHA 1NNKA 2HPGA 1JETA 3PUYE 3CIJA 1B4HA 4Z7EA 1URGA 3D4GA 3TTRA 3A09A 1SW5A 2UYEA 1XS5A 3QYTA 1NNPA 2ZYNA 2HCAA 1GVCA 5CRYA 2QS4A 3MVXA 1SYHA 5JTYB 3HHFA 3KN8A 2R71A 4ZS9A 1N0TA 4FAJA 1BP5A 4BDQA 3QSLA 1FBGA 1A55A 3L6GA 1FBEA 1DTGA 2P1SA 3IJXB 2XX8A 3PD8A 2VD2A 1B7UA 4RK9A 3PPPA 4U22A 4OANA 3SEUA 5H8NB 3H6VA 4IY6A 1FW0A 2VP1A 1SDXA 1NV3A 4G68A 1FTAA 2B3BA 3G3JA 1D4NA 4IY5A 4QFPA 3A3CA 1WODA 1FPDA 3M3KA 2WBDA 1MH3A 1N76A 4AS4A 1DPEA 4GWOA 2OJTA 3I5OA 1B05A 2Q2AA 3EPEA 1EU8A 3RPLB 1QVSA 2H98A 4NF6B 2UXAA 1XVYA 5I59A 4F3BA 3TFLA 1N7XA 1EYKA 1MXZA 4H45A 1AOVA 1ZMGA 1IQ7A 3W9WA 3IFCA 2ZYMA 4JVIA 3GBAA 1OVBA 1CB6A 1FQCA 4R6YA 4PP0A 4HW8A 4MH5A 2H5YA 3IOVA 4GBVA 2PMSA 1IMFA 3H06B 3OXNA 5H8HB 1RDZA 3HO7A 4H8IA 3TTLA 4PTKA 4KR5A 3BIHA 3FV2A 3MPLA 2GHBA 4PDHA 5CBRA 3QK6A 1YPNA 2Q88A 4ELQA 4THIA 4EXKA 3GXAA 4NE4A 4ISUA 2OX3A 5JK4A 5DEXA 4EQ7A 3B6QA 4O94A 4YB5A 4LN5A 4NF8B 4P0GA 2XXKA 1LBXA 2VOZA 1EYJA 1DCUA 3WAFA 2NXOA 4OZ9A 3PPQA 4IO2A 2IA4A 2ONKE 4UABA 1B6HA 1MY3A 3O2AA 2HHMA 1FPEA 5CI5A 1QUIA 4U4SA 4XFEA 3MPKA 1A8EA 3TAJA 1MM6A 2Q2CA 3DELB 2HFBA 1P1WA 4N8YA 3VLWA 4NTLA 3MAMA 1B1HA 4U1ZA 3FXQA 3S9MC 2F7AA 3SEXA 2XXYA 3VDFA 3CFXA 5ET5A 2D3IA 4OXVA 4PFRA 1Y9UA 3U72A 3IR1A 3E9XA 2R9JA 3T0JA 1EYIA 2GRVA 5CMKA 5I3SA 3PUZE 1FBHA 3T22A 4PFIA 3KEIA 2HZKA 4I40A 3K6UA 1ZLQA 2Q8MA 4GWYA 3IO6A 3UA8A 1FBPA 2QVVA 2UVHA 3ZKLA 2QVRA 3KZGA 4R75A 2XXVA 4OMBA 1NUWA 4U4XA 1OIBA 3ECRA 4F3GA 3FV1A 3IL1B 2P2AA 3U65A 5I59B 1XVXA 3FVNA 2X7PA 2XXHA 4ZZEA 1TXFA 4C1UA 2WX9A 4K3FA 5CBSA 2FYIA 4MJOA 3TQWA 4O7IA 3PUWE 1BIYA 3QIMA 3VLVA 1POTA 4FATA 2ZZWA 1USYH 4G4PA 4F2QA 5HPQA 4HCWA 4O7MA 1QGXA 2Q9TA 4GXAA 5ET6A 2ZNSA 1O7TA 4DZ1A 4IR8A 3RN8A 1YAEA 4OQOA 5DEXB 2DP8A 4KD5A 2XXIA 3K02A 4OEVA 1DMBA 2B3FA 4RY1A 1YZ0A 1OMPA 3S9NC 4ZEDA 5KZTA 3LBSA 2VPNA 1DSNA 3TPAA 3B7DA 4POXA 1LBWA 4QRZA 4O3CA 2F78A 3N94A 2F3DA 4YU0A 1DBZA 3CG1A 3W9VA 4F39A 4N8GA 3K1PA 5I84A 4LVQA 3R7XA 3C35A 4NEDA 4U23A 4C1TA 4G77A 4OETA 2QFLA 2VGQA 3OD7A 3IOTA 2ZXTA 1NH8A 2DSFA 2ZZVA 1IMCA 1FBFA 3IK6B 4EQBA 3C4MA 2ANJA 1LBZA 1PC3A 3KC1A 2FNCA 1FPBA 4DI3D 3DP8A 4NN3A 3FXUA 2G29A 4DCYA 2XXPA 5H8FB 4PFWA 1G0IA 2HZLA 2OZZA 3DP6A 2NOOA 3N5LA 2HXWA 5FTHA 1Y3NA 4PE3A 4ZEFA 3H6TA 1P1UA 5J16A 2I48A 2AYSA 4XEQA 1B5HA 1Q1KA 4GIZA 1FTLA 2RKMA 2IEEA 3TEPA 4PFUA 3SEVA 3RT8A 3UK4A 4BLAA 2RCAA 3FVKA 2PBWA 4XXUA 1SD3A 4GWWA 4IGRA 1LGBC 2RF1A 2E1SA 4MAGA 4NG7A 3C9HA 3SEYA 4R6HA 1MRPA 4ONYA 3SZPA 3ZSFA 1FTKA 4G8HA 3KN3A 3O9PA 3S4UA 2OLBA 1NV6A 2Y5LA 3ISPA 5IGAA 5EYFA 1MQGA 2B65A 4QSEA 5LOMA 4N81A 3IB1A 1H43A 1KA0A 4QSCA 4H6DA 4KI0E 1O63A 3TTMA 1LAGE 2GH9A 2F34A 3U92A 1UTHA 5I5PA 3GYYA 2V3TA 4ZDMA 5AE4A 1I6AA 5M2VA 3DM0A 4XIGQ 1Q9DA 1INPA 3QAXA 4F31B 1JEUA 3U93A 3QUJA 4GX4A 4JVDA 1Y20A 1USYE 2DDKA 3TCFA 4PQJA 2QVUA 4OA4A 4ZEIA 2Y5KA 4P0IA 2PYYA 3EHSA 1B46A 4WXJA 1NV1A 3LSLA 2QSXA 4X1BA 1XOCA 2M8CA 3HCQA 3CFZA 2XX9A 1OQHA 5IKBA 2QL3A 4NHBA 4U2RA 1LAXA 1BLFA 1MY4A 2KR0A 1DK4A 4DLDA 3RY3A 1US4A 1WVJA 3M3LA 2I58A 1P1NA 4JSDA 1LFGA 3ZS6A 2XD2A 3T9XB 1B58A 1NV2A 4F3PA 3KJ7A 5L9SA 1MXUA 2I3WA 2Q74A 1I6QA 3MVYA 1RDXA 1LB8A 4NWCA 3TZAA 4OFLA 2OBGA 4LZ5A 3CR9A 3FJ7A 2VD3A 4GFRA 1LBCA 3A29A 3PV0E 4OVTA 2UVJA 5DT6A 4PE5B 5EQ9A 5H8QB 3KSXA 3FASA 2V25A 3QXMA 1B9JA 3S2VA 1LCTA 3UORA 1QKAA 2WEFA 3KG2A 4RK2A 3TCHA 4MBPA 3IOUA 3FVGA 4YMAA 2HAUA 1QUKA 2PFYA 1B32A 1DPPA 3E4RA 2QS3A 2Y7PA 4H65A 4R74A 4F1UA 4NF4B 2PX1A 4U1OA 3LV0A 5FTIA 4C0RA 4X04A 1UTHB 2XXRA 4O8MA 4JWYA 3MQ9A 1MXYA 5CM6A 3MP6A 1NH7A 1FPLA 4PBQA 4IB2A 3USDA 4JWXA 3EN3A 3FJGA 5EYHA 1GR2A 3VE1B 5L9OA 2XA5A 3T9HB 4F2OA 5B70A 2Z8DA 4KXPA 2WYKA 4GL0A 3QUFA 4LP2B 1CNQA 4P1LA 3MWBA 5FBPA 4YICA 1L5TA 5AA3A 4OEUA 4FEDA 3E13X 3IX1A 4MNCA 1IITA 2RINA
chains in the Genus database with same CATH topology
4OERA 2DXYA 1BKAA 2I49A 5DYHA 2QMWA 4I1DA 2CZLA 1B3GA 1UIVA 3PMWA 5BWJA 3TDJA 1MY2A 2H99A 3P7IA 4I9DA 2QMXA 4IO7A 2Z22A 4NMYA 3VLUA 1ATGA 3R26A 3C32A 2OWSA 4XKPA 1NNTA 1VR5A 3M8UA 3BFTA 4UA8A 1TFDA 1IZ1A 2A5SA 2PVUA 3ILTB 1N3XA 5I57A 1Y4CA 2F7BA 1PEBA 2AL5A 3EHTA 4R2FA 1POY1 5JEIA 1IIWA 4OYVA 1A54A 2YJPA 3HHGA 4G8NA 3SESA 3UIFA 3MP1A 4Q8RA 3TODA 5DVJA 3SDFA 2E0SA 5FHMA 3VVDA 3MVWA 4ZEKA 2X7QA 1MY0A 3RGYA 3TMGA 3KBRA 4TQUQ 1LFHA 5H8SA 2P0SA 3UN6A 1B3EA 4RXLA 1AH5A 1LCFA 1FTJA 1MY1A 3G3FA 4DIGA 1B7HA 4GD5A 1B4ZA 2V84A 3T66A 4QFLA 1NNFA 4YB6A 1XHYA 2XX7A 5H8FA 3VXCA 1B52A 4KYDA 2BJJX 4M4GA 4LZ8A 2O1MA 3Q29A 1B2HA 1UTBA 4OESA 2I4BA 2F36A 2UVIA 1N04A 3IOWA 1FQBA 1F9BA 1SQYA 4EQ9A 1JQFA 1ZU0A 1LFIA 2GFEA 3OELA 3CVGA 3IAZA 4IO3A 4GF8A 1O64A 1JW5A 3RNNA 1PBQA 2O84X 4OFJA 1B51A 4GQOA 2DOJA 1US5A 1JVYA 3VV5A 3JZJA 4PETA 5J1DA 3V5AA 3FVOA 1R1NA 3KFMA 1PB9A 4QFKA 1AL3A 1QJMA 4QFOA 2H25A 2DWJA 3T9VA 1H45A 5AA2A 4GOTA 3PD9A 5I57B 3PMVA 3TELA 1IXCA 4P11A 2QJEA 3PUVE 3OEMA 4DE8A 4FEBA 4RA1A 5L9MA 3LSXA 3MP8A 4ZZAA 3K1MA 4KYEA 3THIA 3V89B 4YKIA 2DS9A 5DVIA 4F22A 4JB7A 2V93A 3LR1A 3K0VA 3BFUA 3RTFB 3N6TA 4ZEBA 2H4IA 1Y4TA 3MZ1A 3CFLA 4ELOA 2GHAA 3PPOA 4TOZA 3ILUB 5AA1A 4G2ZA 3PUXE 4OENA 4YAHX 4ZE9A 4R9GA 5CMBA 1MDP1 5I2KA 3K6VA 4KQPA 2G93A 4JWOA 4BDOA 2I0BA 3KSJA 1D9VA 3Q26A 4H5GA 2QRYA 2QS2A 5TPAB 3TUSA 2ZNUA 4LONB 1ANFA 1SW1A 3OMBA 2I0CA 4POWA 2DWIA 3K6XA 1UTBB 1NMUA 4EUOA 1HSEA 3OO9A 1HSJA 3LUYA 5FHOA 4Z0IA 3H3GA 3E3KA 1M5BA 5TP9A 4M1VA 5AA4A 1EZPA 4N13A 3TTKA 4UACA 1BTJA 4U21A 2Z8EA 4OFOA 5H8QA 4LQ2A 5BUUA 2I6EA 2THIA 3U94A 3TYHA 4RNSA 1B40A 1B3HA 1FCKA 1HSLA 3OEKA 3Q28A 4KPTA 1IXGA 3Q27A 5KDTA 4EDPA 3OO8A 4OWDA 4LQ5A 5I58A 4OTEA 3RTWB 4LUBA 3T96B 1MXWA 5AA2D 5AA2B 3OO7A 5I56A 2X26A 1MPBA 1RYOA 3BKIB 4NF4A 1B0HA 1PBPA 5ISUA 3LSWA 1M5EA 1R9QA 4QHQA 5TU0A 1I6BA 3K1NA 3B6WA 3T93B 2H9BA 1SVXB 3PMXA 4ECFA 4F1VA 4LA9A 3O66A 1JW1A 2D5WA 4ESWA 4R2BA 1OVTA 4XTCQ 2R6GE 4HCYA 3KOSA 4GLIA 2XXXA 3CG3A 3EHUA 4R6KA 1N84A 4WKMA 2HAVA 3V8XB 4ZE8A 1QUJA 5I2KB 2DVCA 3MW0A 1IXIA 2D21A 4KCCA 2O1LA 3G3HA 4TLLB 1TT1A 2CMOA 2REGA 2F97A 3VVFA 1ZKBA 1TFAA 2AIXA 1H44A 4RJZA 4YKPA 1MH4A 2O7UA 2O6AA 3O28A 3TKDA 4YZZA 2FA7A 3K00A 5TP9B 3FJMA 3N6UA 1SW2A 1FQAA 5AA4B 1GV8A 5DTBA 4O3AA 4QSDA 3H7MA 4XKQA 4FORA 2VHAA 5FHNA 3K2DA 1QW0A 4QFNA 2A5TB 5IAIA 4X48A 3GBBA 5KDTB 1B5JA 4ZECA 5I58B 2OCUA 1P99A 3HSTA 2DVZA 3GZGA 1MQHA 3JV9A 5I56B 3HPIA 4NF5B 2RC8A 2DXRA 2YLNA 5B7DA 2DE4A 4R9FA 1RKMA 2RCBA 1URSA 4BDMA 5K2YA 2Z23A 1EZOA 2XXQA 3DLNA 1A8FA 3MVZA 4GXSB 3OOAA 3O29A 3RQTA 1LLSA 3PPRA 5ICQA 4GRKA 3G3IA 2ZNTA 1II5A 1MXXA 2OWTA 1MQJA 1SYIA 4YB7A 2RC9A 3IJOB 3SETA 1LAFE 2OK2A 1OLCA 1OQGA 1S50A 3C31A 1VFEA 1SBPA 4E0WA 3R6UA 3WAEA 1Y3QA 2QPQA 4AB6A 5F1QA 1DTZA 2F35A 3PU5A 1ZIUA 3KOTA 4FE8A 4MLQA 4NWDA 3B6TA 1IEJA 3FUZA 4I62A 4IO6A 3RUMA 3KGCA 1MQDA 3CSBA 4QF9A 4FECA 5I2NA 2XD3A 3VVEA 4X1DA 4FJPA 3G7WA 2PT2A 1IUDA 2O68A 2DE3A 4MF3A 4KFQA 1FTOA 2F6PA 4DDDA 4Q5TA 3FIRA 2ABHA 1MG1A 3M3FA 4DXCA 3MZBA 1UQWA 3VFJA 2Y7RA 2WKYA 3EF7A 1WDNA 1I69A 3KJTA 2AL4A 3H6UA 3UGWA 3MBPA 3T9UA 3UP9A 3MJNA 3H6WA 4FIMA 1EH3A 3I3VA 2XHDA 3RLFE 4IO4A 1B7ZA 5A5XA 2ZYOA 3OENA 4G68C 5EHSA 2HEUA 4F18A 2DWHA 4JXIA 3U1OA 4N6PA 2V3UA 4XKNA 2DQVA 5TPAA 1S7YA 1VFDA 1LSTA 3HV1A 3D4CA 2QS1A 3GLBA 2I4CA 1CE2A 1JW4A 2DE2A 1S9TA 4WEPA 3SKPA 4N07A 2KLFA 3KN7A 1PB8A 3Q25A 3OSRA 1KWHA 3JYRA 3C34A 1NKXA 1SW4A 2XXWA 4DCXA 4G68B 3ODBA 3C33A 1FQEA 1R9LA 4EF2A 1B1XA 1RYXA 4F29A 1P1QA 1ZJLA 4LATA 1B3LA 2Y7WA 5ELVA 2Q8JA 1NL5A 5I2NB 1N3WA 3MC2A 4HS7A 4JSOA 4Q30B 1URDA 3ZKKA 1XC1A 2F8DA 2REJA 1IXHA 3O6HA 1Z7ME 3RT6B 5F7VA 4L17A 3N26A 3ONMA 4BDLA 1MPDA 4RYAA 3C36A 3FGSA 4RPOA 2NUVA 2UVGA 3LSFB 2XXUA 1OLAA 2ZYKA 1SI0A 3L6HA 4R73A 1SI1A 2PT1A 2Z8FA 5HM4B 5CMCA 3MUQA 4EXLA 2LAOA 1DOTA 2ZMBA 5A5XB 2HQ0A 1MQIA 5EHMA 3CI8A 1FQFA 1H76A 4KHZE 1MPCA 4F1YA 4ND9A 2O51A 4GVOA 1YTVA 1N7WA 3FXRA 2Q89A 4OVJA 2F6GA 2DYXA 1EZ9A 3FD3A 1PDAA 3PGFA 2ALUA 3CRBA 4WEDA 4AQ4A 3OO6A 1MS7A 3IB2A 4ELPA 1A99A 2W7YA 2Y84A 4DXBA 2UYFA 1D9YA 3OSQA 3CSGA 4MFIA 5ITPA 1AMFA 4Q0CA 1LB9A 4HTGA 2O69A 4G8MA 1R6ZA 5KCJA 3MZ9A 3O6IA 2Y7IA 4JDFA 2F7CA 1ELJA 4H1XA 4H0WA 3W15C 4F3SA 4OHNA 2A5TA 3TQLA 3S9EA 1FQDA 1QULA 2I3VA 1Y1ZA 1LAHE 1D3KA 4H5FA 3BBRA 3S9LC 1B3FA 3U8QA 4RPNA 3PPNA 3K6WA 1H3DA 1A7LA 4NF5A 4E0XA 4I8CA 4BDRA 2Y7KA 3V83A 1B0LA 3FATA 5DVFA 1PB7A 4EF1A 1JVXA 5K2XA 3I6VA 1T0KA 1VE4A 4LZ7A 3RPWA 1B5IA 5ITOA 1M5CA 3IB0A 5JTYA 2XXTA 4PFTA 5CMMA 4TLMB 4IGTA 1QKBA 2NVUB 4YKKA 4JBZA 3TTNA 1J1NA 4O3BA 4BDNA 1GTKA 4R72A 1Y3PA 3TCGA 4AB5A 3FZVA 2ONRA 2NWJA 3K4UA 3H03A 5H8NA 1Z7NE 4H8JA 1ZTYA 4H67A 3F11A 1TWYA 2DWAA 3K01A 4YKJA 3H4ZA 3AXFA 1NFTA 3LC8A 3G3KA 1Q35A 4KYSA 4PFYA 1A40A 4ELRA 2O7IA 3SEWA 4X9TA 1MDQA 3HN0A 3IO4A 2V3QA 4DXUA 4YMBA 1JNFA 5ICTA 5HBCA 4ESXA 3IORA 4NF6A 1MM7A 3EQ1A 1VSOA 1LBBA 3VXBA 5KCJB 3A3UA 3DP4A 2RC7A 1P1OA 4KCDA 3G3GA 1UIUA 1AIVA 5L8DA 5H8HA 4GL8A 1GGGA 1Y1MA 1YCJA 2ONSA 4IO5A 1M5DA 1M5FA 1XT8A 3SERA 3O6GA 3O97A 1FTMA 1ZBMA 2YPNA 1JEVA 2F5XA 5CC2A 1MXVA 4F19A 2ESNA 4XKRA 4MLVA 4NF8A 1NNKA 1JETA 3PUYE 3CIJA 1B4HA 4Z7EA 1URGA 3D4GA 3TTRA 3A09A 1SW5A 2UYEA 1XS5A 3QYTA 1NNPA 2ZYNA 2HCAA 1GVCA 5CRYA 2QS4A 3MVXA 1SYHA 5JTYB 3HHFA 3KN8A 2R71A 4ZS9A 1N0TA 4FAJA 1BP5A 4BDQA 3QSLA 1A55A 3L6GA 1DTGA 2P1SA 3IJXB 2XX8A 3PD8A 2VD2A 1B7UA 4RK9A 3PPPA 4U22A 3SEUA 5H8NB 3H6VA 4IY6A 1FW0A 2VP1A 1SDXA 4G68A 2B3BA 3G3JA 1D4NA 4IY5A 4QFPA 3A3CA 1WODA 3M3KA 1MH3A 1N76A 1DPEA 4GWOA 2OJTA 3I5OA 1B05A 2Q2AA 3EPEA 1EU8A 1QVSA 2H98A 4NF6B 2UXAA 1XVYA 5I59A 4F3BA 3TFLA 1N7XA 1MXZA 1AOVA 1ZMGA 1IQ7A 3W9WA 2ZYMA 3GBAA 1OVBA 1CB6A 1FQCA 4R6YA 4PP0A 4HW8A 4MH5A 2H5YA 2PMSA 3IOVA 3OXNA 3H06B 5H8HB 3HO7A 4H8IA 3TTLA 4KR5A 3FV2A 3MPLA 2GHBA 5CBRA 3QK6A 1YPNA 2Q88A 4ELQA 4THIA 4EXKA 3GXAA 4NE4A 4ISUA 5JK4A 5DEXA 4EQ7A 3B6QA 4YB5A 4NF8B 4P0GA 2VOZA 3WAFA 2NXOA 4OZ9A 3PPQA 4IO2A 2IA4A 2ONKE 1B6HA 1MY3A 3O2AA 5CI5A 1QUIA 4U4SA 3MPKA 1A8EA 3TAJA 1MM6A 2Q2CA 3DELB 2HFBA 1P1WA 3VLWA 4NTLA 3MAMA 1B1HA 4U1ZA 3FXQA 3S9MC 2F7AA 3SEXA 2XXYA 3VDFA 3CFXA 2D3IA 4OXVA 3U72A 1Y9UA 3IR1A 3E9XA 2R9JA 2GRVA 5CMKA 3PUZE 3T22A 3KEIA 2HZKA 3K6UA 1ZLQA 3IO6A 3UA8A 2UVHA 3ZKLA 3KZGA 4R75A 2XXVA 4OMBA 4U4XA 1OIBA 3ECRA 4F3GA 3FV1A 3IL1B 2P2AA 5I59B 1XVXA 3FVNA 2X7PA 2XXHA 4ZZEA 1TXFA 4C1UA 4K3FA 5CBSA 2FYIA 3TQWA 3PUWE 1BIYA 3QIMA 3VLVA 1POTA 4FATA 1USYH 4G4PA 4F2QA 5HPQA 4HCWA 2Q9TA 4GXAA 2ZNSA 1O7TA 4DZ1A 3RN8A 1YAEA 4OQOA 5DEXB 2DP8A 4KD5A 2XXIA 3K02A 4OEVA 1DMBA 2B3FA 4RY1A 1OMPA 3S9NC 4ZEDA 5KZTA 3LBSA 1DSNA 3TPAA 3B7DA 4POXA 4QRZA 4O3CA 2F78A 3N94A 4YU0A 3CG1A 3W9VA 4F39A 3K1PA 5I84A 4LVQA 3R7XA 3C35A 4NEDA 4U23A 4C1TA 4G77A 4OETA 2VGQA 3OD7A 3IOTA 2ZXTA 1NH8A 2DSFA 3IK6B 4EQBA 3C4MA 2ANJA 1PC3A 2FNCA 3DP8A 3FXUA 2G29A 4DCYA 2XXPA 5H8FB 4PFWA 2HZLA 2OZZA 3DP6A 2NOOA 3N5LA 2HXWA 5FTHA 1Y3NA 4ZEFA 3H6TA 1P1UA 2I48A 2AYSA 1B5HA 1Q1KA 4GIZA 1FTLA 2RKMA 2IEEA 3TEPA 4PFUA 3SEVA 3RT8A 3UK4A 4BLAA 2RCAA 3FVKA 2PBWA 4XXUA 1SD3A 4IGRA 1LGBC 2RF1A 2E1SA 3C9HA 3SEYA 4R6HA 1MRPA 4ONYA 3ZSFA 1FTKA 4G8HA 3KN3A 3O9PA 3S4UA 2OLBA 5EYFA 1MQGA 2B65A 4QSEA 5LOMA 3IB1A 1H43A 4QSCA 4H6DA 4KI0E 1O63A 3TTMA 1LAGE 2GH9A 2F34A 3U92A 1UTHA 2V3TA 4ZDMA 5AE4A 1I6AA 5M2VA 3DM0A 4XIGQ 3QAXA 4F31B 1JEUA 3U93A 3QUJA 1Y20A 1USYE 3TCFA 4PQJA 4ZEIA 4P0IA 2PYYA 3EHSA 1B46A 4WXJA 3LSLA 2QSXA 4X1BA 1XOCA 2M8CA 3HCQA 3CFZA 2XX9A 1OQHA 5IKBA 2QL3A 4U2RA 1LAXA 1BLFA 1MY4A 4DLDA 3RY3A 1US4A 1WVJA 3M3LA 2I58A 1P1NA 4JSDA 1LFGA 3ZS6A 2XD2A 3T9XB 1B58A 4F3PA 3KJ7A 5L9SA 1MXUA 2I3WA 1I6QA 3MVYA 1LB8A 4NWCA 3TZAA 4OFLA 2OBGA 4LZ5A 3CR9A 3FJ7A 2VD3A 4GFRA 1LBCA 3PV0E 2UVJA 5DT6A 4PE5B 5H8QB 3KSXA 3FASA 2V25A 3QXMA 1B9JA 3S2VA 1LCTA 3UORA 1QKAA 3KG2A 4RK2A 3TCHA 4MBPA 3IOUA 3FVGA 4YMAA 2HAUA 1QUKA 1B32A 1DPPA 3E4RA 2QS3A 2Y7PA 4H65A 4R74A 4F1UA 4NF4B 2PX1A 4U1OA 5FTIA 4C0RA 1UTHB 2XXRA 4JWYA 3MQ9A 1MXYA 5CM6A 3MP6A 1NH7A 4IB2A 3USDA 4JWXA 3EN3A 3FJGA 1GR2A 3VE1B 5L9OA 4F2OA 3T9HB 5B70A 2Z8DA 4GL0A 3QUFA 4LP2B 3MWBA 4YICA 1L5TA 5AA3A 4OEUA 4FEDA 3E13X 3IX1A 1IITA 2RINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OER A;  2DXY A;  1BKA A;  2I49 A;  5DYH A;  2QMW A;  4I1D A;  2CZL A;  1B3G A;  1UIV A;  3PMW A;  5BWJ A;  3TDJ A;  1MY2 A;  2H99 A;  3P7I A;  4I9D A;  2QMX A;  4IO7 A;  2Z22 A;  4NMY A;  3VLU A;  1ATG A;  3R26 A;  3C32 A;  2OWS A;  4XKP A;  1NNT A;  1VR5 A;  3M8U A;  3BFT A;  4UA8 A;  1TFD A;  1IZ1 A;  2A5S A;  2PVU A;  3ILT B;  1N3X A;  5I57 A;  1Y4C A;  2F7B A;  1PEB A;  2AL5 A;  3EHT A;  4R2F A;  1POY 1;  5JEI A;  1IIW A;  4OYV A;  1A54 A;  2YJP A;  3HHG A;  4G8N A;  3SES A;  3UIF A;  3MP1 A;  4Q8R A;  3TOD A;  5DVJ A;  3SDF A;  2E0S A;  5FHM A;  3VVD A;  3MVW A;  4ZEK A;  2X7Q A;  1MY0 A;  3RGY A;  3TMG A;  3KBR A;  4TQU Q;  1LFH A;  5H8S A;  2P0S A;  3UN6 A;  1B3E A;  4RXL A;  1AH5 A;  1LCF A;  1FTJ A;  1MY1 A;  3G3F A;  4DIG A;  1B7H A;  4GD5 A;  1B4Z A;  2V84 A;  3T66 A;  4QFL A;  1NNF A;  4YB6 A;  1XHY A;  2XX7 A;  5H8F A;  3VXC A;  1B52 A;  4KYD A;  2BJJ X;  4M4G A;  4LZ8 A;  2O1M A;  3Q29 A;  1B2H A;  1UTB A;  4OES A;  2I4B A;  2F36 A;  2UVI A;  1N04 A;  3IOW A;  1FQB A;  1F9B A;  1SQY A;  4EQ9 A;  1JQF A;  1ZU0 A;  1LFI A;  2GFE A;  3OEL A;  3CVG A;  3IAZ A;  4IO3 A;  4GF8 A;  1O64 A;  1JW5 A;  3RNN A;  1PBQ A;  2O84 X;  4OFJ A;  1B51 A;  4GQO A;  2DOJ A;  1US5 A;  1JVY A;  3VV5 A;  3JZJ A;  4PET A;  5J1D A;  3V5A A;  3FVO A;  1R1N A;  3KFM A;  1PB9 A;  4QFK A;  1AL3 A;  1QJM A;  4QFO A;  2H25 A;  2DWJ A;  3T9V A;  1H45 A;  5AA2 A;  4GOT A;  3PD9 A;  5I57 B;  3PMV A;  3TEL A;  1IXC A;  4P11 A;  2QJE A;  3PUV E;  3OEM A;  4DE8 A;  4FEB A;  4RA1 A;  5L9M A;  3LSX A;  3MP8 A;  4ZZA A;  3K1M A;  4KYE A;  3THI A;  3V89 B;  4YKI A;  2DS9 A;  5DVI A;  4F22 A;  4JB7 A;  2V93 A;  3LR1 A;  3K0V A;  3BFU A;  3RTF B;  3N6T A;  4ZEB A;  2H4I A;  1Y4T A;  3MZ1 A;  3CFL A;  4ELO A;  2GHA A;  3PPO A;  4TOZ A;  3ILU B;  5AA1 A;  4G2Z A;  3PUX E;  4OEN A;  4YAH X;  4ZE9 A;  4R9G A;  5CMB A;  1MDP 1;  5I2K A;  3K6V A;  4KQP A;  2G93 A;  4JWO A;  4BDO A;  2I0B A;  3KSJ A;  1D9V A;  3Q26 A;  4H5G A;  2QRY A;  2QS2 A;  5TPA B;  3TUS A;  2ZNU A;  4LON B;  1ANF A;  1SW1 A;  3OMB A;  2I0C A;  4POW A;  2DWI A;  3K6X A;  1UTB B;  1NMU A;  4EUO A;  1HSE A;  3OO9 A;  1HSJ A;  3LUY A;  5FHO A;  4Z0I A;  3H3G A;  3E3K A;  1M5B A;  5TP9 A;  4M1V A;  5AA4 A;  1EZP A;  4N13 A;  3TTK A;  4UAC A;  1BTJ A;  4U21 A;  2Z8E A;  4OFO A;  5H8Q A;  4LQ2 A;  5BUU A;  2I6E A;  2THI A;  3U94 A;  3TYH A;  4RNS A;  1B40 A;  1B3H A;  1FCK A;  1HSL A;  3OEK A;  3Q28 A;  4KPT A;  1IXG A;  3Q27 A;  5KDT A;  4EDP A;  3OO8 A;  4OWD A;  4LQ5 A;  5I58 A;  4OTE A;  3RTW B;  4LUB A;  3T96 B;  1MXW A;  5AA2 D;  5AA2 B;  3OO7 A;  5I56 A;  2X26 A;  1MPB A;  1RYO A;  3BKI B;  4NF4 A;  1B0H A;  1PBP A;  5ISU A;  3LSW A;  1M5E A;  1R9Q A;  4QHQ A;  5TU0 A;  1I6B A;  3K1N A;  3B6W A;  3T93 B;  2H9B A;  1SVX B;  3PMX A;  4ECF A;  4F1V A;  4LA9 A;  3O66 A;  1JW1 A;  2D5W A;  4ESW A;  4R2B A;  1OVT A;  4XTC Q;  2R6G E;  4HCY A;  3KOS A;  4GLI A;  2XXX A;  3CG3 A;  3EHU A;  4R6K A;  1N84 A;  4WKM A;  2HAV A;  3V8X B;  4ZE8 A;  1QUJ A;  5I2K B;  2DVC A;  3MW0 A;  1IXI A;  2D21 A;  4KCC A;  2O1L A;  3G3H A;  4TLL B;  1TT1 A;  2CMO A;  2REG A;  2F97 A;  3VVF A;  1ZKB A;  1TFA A;  2AIX A;  1H44 A;  4RJZ A;  4YKP A;  1MH4 A;  2O7U A;  2O6A A;  3O28 A;  3TKD A;  4YZZ A;  2FA7 A;  3K00 A;  5TP9 B;  3FJM A;  3N6U A;  1SW2 A;  1FQA A;  5AA4 B;  1GV8 A;  5DTB A;  4O3A A;  4QSD A;  3H7M A;  4XKQ A;  4FOR A;  2VHA A;  5FHN A;  3K2D A;  1QW0 A;  4QFN A;  2A5T B;  5IAI A;  4X48 A;  3GBB A;  5KDT B;  1B5J A;  4ZEC A;  5I58 B;  2OCU A;  1P99 A;  3HST A;  2DVZ A;  3GZG A;  1MQH A;  3JV9 A;  5I56 B;  3HPI A;  4NF5 B;  2RC8 A;  2DXR A;  2YLN A;  5B7D A;  2DE4 A;  4R9F A;  1RKM A;  2RCB A;  1URS A;  4BDM A;  5K2Y A;  2Z23 A;  1EZO A;  2XXQ A;  3DLN A;  1A8F A;  3MVZ A;  4GXS B;  3OOA A;  3O29 A;  3RQT A;  1LLS A;  3PPR A;  5ICQ A;  4GRK A;  3G3I A;  2ZNT A;  1II5 A;  1MXX A;  2OWT A;  1MQJ A;  1SYI A;  4YB7 A;  2RC9 A;  3IJO B;  3SET A;  1LAF E;  2OK2 A;  1OLC A;  1OQG A;  1S50 A;  3C31 A;  1VFE A;  1SBP A;  4E0W A;  3R6U A;  3WAE A;  1Y3Q A;  2QPQ A;  4AB6 A;  5F1Q A;  1DTZ A;  2F35 A;  3PU5 A;  1ZIU A;  3KOT A;  4FE8 A;  4MLQ A;  4NWD A;  3B6T A;  1IEJ A;  3FUZ A;  4I62 A;  4IO6 A;  3RUM A;  3KGC A;  1MQD A;  3CSB A;  4QF9 A;  4FEC A;  5I2N A;  2XD3 A;  3VVE A;  4X1D A;  4FJP A;  3G7W A;  2PT2 A;  1IUD A;  2O68 A;  2DE3 A;  4MF3 A;  4KFQ A;  1FTO A;  2F6P A;  4DDD A;  4Q5T A;  3FIR A;  2ABH A;  1MG1 A;  3M3F A;  4DXC A;  3MZB A;  1UQW A;  3VFJ A;  2Y7R A;  2WKY A;  3EF7 A;  1WDN A;  1I69 A;  3KJT A;  2AL4 A;  3H6U A;  3UGW A;  3MBP A;  3T9U A;  3UP9 A;  3MJN A;  3H6W A;  4FIM A;  1EH3 A;  3I3V A;  2XHD A;  3RLF E;  4IO4 A;  1B7Z A;  5A5X A;  2ZYO A;  3OEN A;  4G68 C;  5EHS A;  2HEU A;  4F18 A;  2DWH A;  4JXI A;  3U1O A;  4N6P A;  2V3U A;  4XKN A;  2DQV A;  5TPA A;  1S7Y A;  1VFD A;  1LST A;  3HV1 A;  3D4C A;  2QS1 A;  3GLB A;  2I4C A;  1CE2 A;  1JW4 A;  2DE2 A;  1S9T A;  4WEP A;  3SKP A;  4N07 A;  2KLF A;  3KN7 A;  1PB8 A;  3Q25 A;  3OSR A;  1KWH A;  3JYR A;  3C34 A;  1NKX A;  1SW4 A;  2XXW A;  4DCX A;  4G68 B;  3ODB A;  3C33 A;  1FQE A;  1R9L A;  4EF2 A;  1B1X A;  1RYX A;  4F29 A;  1P1Q A;  1ZJL A;  4LAT A;  1B3L A;  2Y7W A;  5ELV A;  2Q8J A;  1NL5 A;  5I2N B;  1N3W A;  3MC2 A;  4HS7 A;  4JSO A;  4Q30 B;  1URD A;  3ZKK A;  1XC1 A;  2F8D A;  2REJ A;  1IXH A;  3O6H A;  1Z7M E;  3RT6 B;  5F7V A;  4L17 A;  3N26 A;  3ONM A;  4BDL A;  1MPD A;  4RYA A;  3C36 A;  3FGS A;  4RPO A;  2NUV A;  2UVG A;  3LSF B;  2XXU A;  1OLA A;  2ZYK A;  1SI0 A;  3L6H A;  4R73 A;  1SI1 A;  2PT1 A;  2Z8F A;  5HM4 B;  5CMC A;  3MUQ A;  4EXL A;  2LAO A;  1DOT A;  2ZMB A;  5A5X B;  2HQ0 A;  1MQI A;  5EHM A;  3CI8 A;  1FQF A;  1H76 A;  4KHZ E;  1MPC A;  4F1Y A;  4ND9 A;  2O51 A;  4GVO A;  1YTV A;  1N7W A;  3FXR A;  2Q89 A;  4OVJ A;  2F6G A;  2DYX A;  1EZ9 A;  3FD3 A;  1PDA A;  3PGF A;  2ALU A;  3CRB A;  4WED A;  4AQ4 A;  3OO6 A;  1MS7 A;  3IB2 A;  4ELP A;  1A99 A;  2W7Y A;  2Y84 A;  4DXB A;  2UYF A;  1D9Y A;  3OSQ A;  3CSG A;  4MFI A;  5ITP A;  1AMF A;  4Q0C A;  1LB9 A;  4HTG A;  2O69 A;  4G8M A;  1R6Z A;  5KCJ A;  3MZ9 A;  3O6I A;  2Y7I A;  4JDF A;  2F7C A;  1ELJ A;  4H1X A;  4H0W A;  3W15 C;  4F3S A;  4OHN A;  2A5T A;  3TQL A;  3S9E A;  1FQD A;  1QUL A;  2I3V A;  1Y1Z A;  1LAH E;  1D3K A;  4H5F A;  3BBR A;  3S9L C;  1B3F A;  3U8Q A;  4RPN A;  3PPN A;  3K6W A;  1H3D A;  1A7L A;  4NF5 A;  4E0X A;  4I8C A;  4BDR A;  2Y7K A;  3V83 A;  1B0L A;  3FAT A;  5DVF A;  1PB7 A;  4EF1 A;  1JVX A;  5K2X A;  3I6V A;  1T0K A;  1VE4 A;  4LZ7 A;  3RPW A;  1B5I A;  5ITO A;  1M5C A;  3IB0 A;  5JTY A;  2XXT A;  4PFT A;  5CMM A;  4TLM B;  4IGT A;  1QKB A;  2NVU B;  4YKK A;  4JBZ A;  3TTN A;  1J1N A;  4O3B A;  4BDN A;  1GTK A;  4R72 A;  1Y3P A;  3TCG A;  4AB5 A;  3FZV A;  2ONR A;  2NWJ A;  3K4U A;  3H03 A;  5H8N A;  1Z7N E;  4H8J A;  1ZTY A;  4H67 A;  3F11 A;  1TWY A;  2DWA A;  3K01 A;  4YKJ A;  3H4Z A;  3AXF A;  1NFT A;  3LC8 A;  3G3K A;  1Q35 A;  4KYS A;  4PFY A;  1A40 A;  4ELR A;  2O7I A;  3SEW A;  4X9T A;  1MDQ A;  3HN0 A;  3IO4 A;  2V3Q A;  4DXU A;  4YMB A;  1JNF A;  5ICT A;  5HBC A;  4ESX A;  3IOR A;  4NF6 A;  1MM7 A;  3EQ1 A;  1VSO A;  1LBB A;  3VXB A;  5KCJ B;  3A3U A;  3DP4 A;  2RC7 A;  1P1O A;  4KCD A;  3G3G A;  1UIU A;  1AIV A;  5L8D A;  5H8H A;  4GL8 A;  1GGG A;  1Y1M A;  1YCJ A;  2ONS A;  4IO5 A;  1M5D A;  1M5F A;  1XT8 A;  3SER A;  3O6G A;  3O97 A;  1FTM A;  1ZBM A;  2YPN A;  1JEV A;  2F5X A;  5CC2 A;  1MXV A;  4F19 A;  2ESN A;  4XKR A;  4MLV A;  4NF8 A;  1NNK A;  1JET A;  3PUY E;  3CIJ A;  1B4H A;  4Z7E A;  1URG A;  3D4G A;  3TTR A;  3A09 A;  1SW5 A;  2UYE A;  1XS5 A;  3QYT A;  1NNP A;  2ZYN A;  2HCA A;  1GVC A;  5CRY A;  2QS4 A;  3MVX A;  1SYH A;  5JTY B;  3HHF A;  3KN8 A;  2R71 A;  4ZS9 A;  1N0T A;  4FAJ A;  1BP5 A;  4BDQ A;  3QSL A;  1A55 A;  3L6G A;  1DTG A;  2P1S A;  3IJX B;  2XX8 A;  3PD8 A;  2VD2 A;  1B7U A;  4RK9 A;  3PPP A;  4U22 A;  3SEU A;  5H8N B;  3H6V A;  4IY6 A;  1FW0 A;  2VP1 A;  1SDX A;  4G68 A;  2B3B A;  3G3J A;  1D4N A;  4IY5 A;  4QFP A;  3A3C A;  1WOD A;  3M3K A;  1MH3 A;  1N76 A;  1DPE A;  4GWO A;  2OJT A;  3I5O A;  1B05 A;  2Q2A A;  3EPE A;  1EU8 A;  1QVS A;  2H98 A;  4NF6 B;  2UXA A;  1XVY A;  5I59 A;  4F3B A;  3TFL A;  1N7X A;  1MXZ A;  1AOV A;  1ZMG A;  1IQ7 A;  3W9W A;  2ZYM A;  3GBA A;  1OVB A;  1CB6 A;  1FQC A;  4R6Y A;  4PP0 A;  4HW8 A;  4MH5 A;  2H5Y A;  2PMS A;  3IOV A;  3OXN A;  3H06 B;  5H8H B;  3HO7 A;  4H8I A;  3TTL A;  4KR5 A;  3FV2 A;  3MPL A;  2GHB A;  5CBR A;  3QK6 A;  1YPN A;  2Q88 A;  4ELQ A;  4THI A;  4EXK A;  3GXA A;  4NE4 A;  4ISU A;  5JK4 A;  5DEX A;  4EQ7 A;  3B6Q A;  4YB5 A;  4NF8 B;  4P0G A;  2VOZ A;  3WAF A;  2NXO A;  4OZ9 A;  3PPQ A;  4IO2 A;  2IA4 A;  2ONK E;  1B6H A;  1MY3 A;  3O2A A;  5CI5 A;  1QUI A;  4U4S A;  3MPK A;  1A8E A;  3TAJ A;  1MM6 A;  2Q2C A;  3DEL B;  2HFB A;  1P1W A;  3VLW A;  4NTL A;  3MAM A;  1B1H A;  4U1Z A;  3FXQ A;  3S9M C;  2F7A A;  3SEX A;  2XXY A;  3VDF A;  3CFX A;  2D3I A;  4OXV A;  3U72 A;  1Y9U A;  3IR1 A;  3E9X A;  2R9J A;  2GRV A;  5CMK A;  3PUZ E;  3T22 A;  3KEI A;  2HZK A;  3K6U A;  1ZLQ A;  3IO6 A;  3UA8 A;  2UVH A;  3ZKL A;  3KZG A;  4R75 A;  2XXV A;  4OMB A;  4U4X A;  1OIB A;  3ECR A;  4F3G A;  3FV1 A;  3IL1 B;  2P2A A;  5I59 B;  1XVX A;  3FVN A;  2X7P A;  2XXH A;  4ZZE A;  1TXF A;  4C1U A;  4K3F A;  5CBS A;  2FYI A;  3TQW A;  3PUW E;  1BIY A;  3QIM A;  3VLV A;  1POT A;  4FAT A;  1USY H;  4G4P A;  4F2Q A;  5HPQ A;  4HCW A;  2Q9T A;  4GXA A;  2ZNS A;  1O7T A;  4DZ1 A;  3RN8 A;  1YAE A;  4OQO A;  5DEX B;  2DP8 A;  4KD5 A;  2XXI A;  3K02 A;  4OEV A;  1DMB A;  2B3F A;  4RY1 A;  1OMP A;  3S9N C;  4ZED A;  5KZT A;  3LBS A;  1DSN A;  3TPA A;  3B7D A;  4POX A;  4QRZ A;  4O3C A;  2F78 A;  3N94 A;  4YU0 A;  3CG1 A;  3W9V A;  4F39 A;  3K1P A;  5I84 A;  4LVQ A;  3R7X A;  3C35 A;  4NED A;  4U23 A;  4C1T A;  4G77 A;  4OET A;  2VGQ A;  3OD7 A;  3IOT A;  2ZXT A;  1NH8 A;  2DSF A;  3IK6 B;  4EQB A;  3C4M A;  2ANJ A;  1PC3 A;  2FNC A;  3DP8 A;  3FXU A;  2G29 A;  4DCY A;  2XXP A;  5H8F B;  4PFW A;  2HZL A;  2OZZ A;  3DP6 A;  2NOO A;  3N5L A;  2HXW A;  5FTH A;  1Y3N A;  4ZEF A;  3H6T A;  1P1U A;  2I48 A;  2AYS A;  1B5H A;  1Q1K A;  4GIZ A;  1FTL A;  2RKM A;  2IEE A;  3TEP A;  4PFU A;  3SEV A;  3RT8 A;  3UK4 A;  4BLA A;  2RCA A;  3FVK A;  2PBW A;  4XXU A;  1SD3 A;  4IGR A;  1LGB C;  2RF1 A;  2E1S A;  3C9H A;  3SEY A;  4R6H A;  1MRP A;  4ONY A;  3ZSF A;  1FTK A;  4G8H A;  3KN3 A;  3O9P A;  3S4U A;  2OLB A;  5EYF A;  1MQG A;  2B65 A;  4QSE A;  5LOM A;  3IB1 A;  1H43 A;  4QSC A;  4H6D A;  4KI0 E;  1O63 A;  3TTM A;  1LAG E;  2GH9 A;  2F34 A;  3U92 A;  1UTH A;  2V3T A;  4ZDM A;  5AE4 A;  1I6A A;  5M2V A;  3DM0 A;  4XIG Q;  3QAX A;  4F31 B;  1JEU A;  3U93 A;  3QUJ A;  1Y20 A;  1USY E;  3TCF A;  4PQJ A;  4ZEI A;  4P0I A;  2PYY A;  3EHS A;  1B46 A;  4WXJ A;  3LSL A;  2QSX A;  4X1B A;  1XOC A;  2M8C A;  3HCQ A;  3CFZ A;  2XX9 A;  1OQH A;  5IKB A;  2QL3 A;  4U2R A;  1LAX A;  1BLF A;  1MY4 A;  4DLD A;  3RY3 A;  1US4 A;  1WVJ A;  3M3L A;  2I58 A;  1P1N A;  4JSD A;  1LFG A;  3ZS6 A;  2XD2 A;  3T9X B;  1B58 A;  4F3P A;  3KJ7 A;  5L9S A;  1MXU A;  2I3W A;  1I6Q A;  3MVY A;  1LB8 A;  4NWC A;  3TZA A;  4OFL A;  2OBG A;  4LZ5 A;  3CR9 A;  3FJ7 A;  2VD3 A;  4GFR A;  1LBC A;  3PV0 E;  2UVJ A;  5DT6 A;  4PE5 B;  5H8Q B;  3KSX A;  3FAS A;  2V25 A;  3QXM A;  1B9J A;  3S2V A;  1LCT A;  3UOR A;  1QKA A;  3KG2 A;  4RK2 A;  3TCH A;  4MBP A;  3IOU A;  3FVG A;  4YMA A;  2HAU A;  1QUK A;  1B32 A;  1DPP A;  3E4R A;  2QS3 A;  2Y7P A;  4H65 A;  4R74 A;  4F1U A;  4NF4 B;  2PX1 A;  4U1O A;  5FTI A;  4C0R A;  1UTH B;  2XXR A;  4JWY A;  3MQ9 A;  1MXY A;  5CM6 A;  3MP6 A;  1NH7 A;  4IB2 A;  3USD A;  4JWX A;  3EN3 A;  3FJG A;  1GR2 A;  3VE1 B;  5L9O A;  4F2O A;  3T9H B;  5B70 A;  2Z8D A;  4GL0 A;  3QUF A;  4LP2 B;  3MWB A;  4YIC A;  1L5T A;  5AA3 A;  4OEU A;  4FED A;  3E13 X;  3IX1 A;  1IIT A;  2RIN A; 
#chains in the Genus database with same CATH topology
 4OER A;  2DXY A;  1BKA A;  2I49 A;  5DYH A;  2QMW A;  4AS5 A;  4I1D A;  2CZL A;  1B3G A;  1UIV A;  3PMW A;  5BWJ A;  3TDJ A;  1MY2 A;  2H99 A;  3P7I A;  4I9D A;  2QMX A;  4IO7 A;  2Z22 A;  2B4L A;  4NMY A;  3VLU A;  1ATG A;  3R26 A;  3C32 A;  2OWS A;  4XKP A;  1NNT A;  1VR5 A;  3M8U A;  3BFT A;  4UA8 A;  4N15 A;  1TFD A;  1IZ1 A;  4PGN A;  2A5S A;  2PVU A;  3ILT B;  1N3X A;  5I57 A;  4I3E A;  1Y4C A;  2F7B A;  1PEB A;  2AL5 A;  3EHT A;  4R2F A;  1POY 1;  5JEI A;  1IIW A;  4OYV A;  1A54 A;  2YJP A;  3HHG A;  4G8N A;  3SES A;  3UIF A;  2CZK A;  3MP1 A;  3B8B A;  4Q8R A;  3TOD A;  5DVJ A;  3SDF A;  2E0S A;  5FHM A;  3VVD A;  3MVW A;  4P8B A;  4ZEK A;  2X7Q A;  1MY0 A;  1XI6 A;  3RGY A;  3TMG A;  5DW8 A;  3KBR A;  4TQU Q;  1LFH A;  5H8S A;  2P0S A;  3UN6 A;  1B3E A;  4RXL A;  1AH5 A;  1LCF A;  4GWU A;  1FTJ A;  2B4M A;  2FVZ A;  1MY1 A;  3G3F A;  4DIG A;  1B7H A;  4GD5 A;  1B4Z A;  4NGU A;  2V84 A;  3T66 A;  1NUX A;  5EQA A;  2FIE A;  1FSA A;  1NNF A;  4QFL A;  4YB6 A;  5IZ1 A;  1XHY A;  2XX7 A;  5H8F A;  3VXC A;  1B52 A;  4KYD A;  2BJJ X;  4M4G A;  4LZ8 A;  2O1M A;  3Q29 A;  1B2H A;  1UTB A;  4OES A;  2I4B A;  2F36 A;  2UVI A;  1N04 A;  3IOW A;  1FQB A;  1FJ6 A;  1F9B A;  1SQY A;  4EQ9 A;  1JQF A;  1ZU0 A;  1LFI A;  2GFE A;  3OEL A;  3CVG A;  3IAZ A;  4IO3 A;  4GF8 A;  1O64 A;  1FPJ A;  1JW5 A;  3RNN A;  2WYP A;  1PBQ A;  2O84 X;  4OFJ A;  1B51 A;  4GQO A;  2DOJ A;  1US5 A;  1JVY A;  3VV5 A;  3JZJ A;  4PET A;  5J1D A;  4DI4 B;  4GWS A;  3V5A A;  3FVO A;  1R1N A;  3KFM A;  1PB9 A;  4QFK A;  4MCO A;  1AL3 A;  1QJM A;  4QFO A;  2H25 A;  2DWJ A;  3T9V A;  1H45 A;  5AA2 A;  4GOT A;  3PD9 A;  5I57 B;  3PMV A;  3TEL A;  1IXC A;  4X8R A;  4P11 A;  2QJE A;  3PUV E;  3OEM A;  4DE8 A;  4FEB A;  4RA1 A;  5L9M A;  3LSX A;  3MP8 A;  4ZZA A;  3K1M A;  4KYE A;  3THI A;  3V89 B;  4YKI A;  2DS9 A;  5DVI A;  4F22 A;  4PDD A;  4PFB A;  4JB7 A;  2V93 A;  3LR1 A;  1NI9 A;  3K0V A;  3BFU A;  3RTF B;  3N6T A;  4ZEB A;  2H4I A;  3KC0 A;  1Y4T A;  3MZ1 A;  2R8T A;  3CFL A;  4ELO A;  2GHA A;  3PPO A;  4TOZ A;  3ILU B;  5AA1 A;  4G2Z A;  5EQ8 A;  4NX1 A;  3PUX E;  4OEN A;  4YAH X;  2ZZX A;  4ZE9 A;  4R9G A;  5CMB A;  1MDP 1;  3T1B A;  5I2K A;  3K6V A;  1FPK A;  4KQP A;  2G93 A;  4JWO A;  4BDO A;  2I0B A;  2VPO A;  4MHF A;  4PCD A;  3KSJ A;  1D9V A;  3Q26 A;  4H5G A;  2QRY A;  2QS2 A;  5TPA B;  3CHG A;  2ZNU A;  3TUS A;  4LON B;  2V4C A;  1ANF A;  1SW1 A;  3OMB A;  4N17 A;  2I0C A;  4POW A;  2DWI A;  3K6X A;  1UTB B;  1NMU A;  1K9Z A;  2F3B A;  4EUO A;  4PAI A;  1HSE A;  3OO9 A;  2XWV A;  1HSJ A;  3LUY A;  5FHO A;  4Z0I A;  3H3G A;  4GWZ A;  3E3K A;  1M5B A;  5TP9 A;  4M1V A;  4MEV A;  2XWO A;  5AA4 A;  1EZP A;  4N13 A;  3TTK A;  4UAC A;  1BTJ A;  4U21 A;  2Z8E A;  4OFO A;  5H8Q A;  4LQ2 A;  5BUU A;  2I6E A;  2THI A;  3U94 A;  3TYH A;  4RNS A;  1B40 A;  1B3H A;  1FCK A;  1HSL A;  3OEK A;  3Q28 A;  4KPT A;  1IXG A;  3Q27 A;  5KDT A;  4EDP A;  3OO8 A;  4OWD A;  4LQ5 A;  5I58 A;  4OTE A;  3RTW B;  4LUB A;  3T96 B;  1MXW A;  5AA2 D;  4MNI A;  5AA2 B;  3OO7 A;  5I56 A;  2X26 A;  1FPF A;  1MPB A;  1RYO A;  3BKI B;  4NF4 A;  1B0H A;  1FPI A;  5IZZ A;  4GX3 A;  1PBP A;  5ISU A;  3LSW A;  1M5E A;  1R9Q A;  4QHQ A;  5TU0 A;  1I6B A;  3K1N A;  3B6W A;  3T93 B;  4N4U A;  2H9B A;  1SVX B;  3PMX A;  2CEX A;  4ECF A;  4F1V A;  4LA9 A;  2BJI A;  1D9Q A;  3O66 A;  1JW1 A;  2D5W A;  4ESW A;  4R2B A;  1OVT A;  5ET8 A;  4XTC Q;  1NUY A;  2R6G E;  4HCY A;  3KOS A;  4GLI A;  2XXX A;  3CG3 A;  3EHU A;  5LDZ A;  4R6K A;  1N84 A;  4I3Y A;  1FBD A;  4WKM A;  2HAV A;  3V8X B;  4ZE8 A;  1QUJ A;  2FHY A;  2WBB A;  5I2K B;  2DVC A;  3MW0 A;  1IXI A;  2D21 A;  4KCC A;  2O1L A;  3G3H A;  4TLL B;  4HE1 A;  1TT1 A;  2CMO A;  2REG A;  2F97 A;  3VVF A;  2KQZ A;  1ZKB A;  4P3L A;  1TFA A;  2AIX A;  1H44 A;  2CZH A;  4RJZ A;  4YKP A;  5I7I A;  1IMB A;  1MH4 A;  2O7U A;  2XWK A;  2O6A A;  3O28 A;  3TKD A;  4YZZ A;  2FA7 A;  3K00 A;  5EYG A;  5TP9 B;  3FJM A;  3N6U A;  1SW2 A;  1FQA A;  5AA4 B;  1GV8 A;  5DTB A;  4O3A A;  4QSD A;  3H7M A;  3B50 A;  3KBZ A;  4P47 A;  4XKQ A;  4FOR A;  5IM2 A;  2VHA A;  3MYU A;  4GBW A;  5FHN A;  3K2D A;  1QW0 A;  4QFN A;  2A5T B;  5IAI A;  4X48 A;  3GBB A;  5KDT B;  1B5J A;  4PC9 A;  4ZEC A;  2VT5 A;  4OVR A;  5I58 B;  2OCU A;  1P99 A;  3HST A;  2DVZ A;  3GZG A;  4PGP A;  1MQH A;  3JV9 A;  5I56 B;  3HFU A;  3HPI A;  4NF5 B;  2RC8 A;  2DXR A;  4OVP A;  2YLN A;  5B7D A;  2DE4 A;  4R9F A;  1RKM A;  2RCB A;  1URS A;  3MST A;  4BDM A;  5K2Y A;  2Z23 A;  1EZO A;  2XXQ A;  3DLN A;  1A8F A;  3MVZ A;  4GXS B;  3OOA A;  3O29 A;  3RQT A;  4QBA A;  1LLS A;  3PPR A;  5ICQ A;  4GRK A;  3G3I A;  2ZNT A;  1II5 A;  1MXX A;  2OWT A;  1MQJ A;  1SYI A;  4YB7 A;  2PFZ A;  2RC9 A;  3IJO B;  3SET A;  1LAF E;  2OK2 A;  4HE0 A;  1OLC A;  1OQG A;  1S50 A;  3C31 A;  1VFE A;  1NV7 A;  1SBP A;  4E0W A;  3R6U A;  3WAE A;  1Y3Q A;  2QPQ A;  4AB6 A;  5F1Q A;  1DTZ A;  2F35 A;  3PU5 A;  1ZIU A;  1FPG A;  3KOT A;  4FE8 A;  4MLQ A;  4NWD A;  3B6T A;  1IEJ A;  5IZ3 A;  1NV5 A;  3FUZ A;  4I62 A;  4FBP A;  4IO6 A;  3RUM A;  4PF8 A;  3KGC A;  1MQD A;  3CSB A;  4QF9 A;  1IMD A;  1G0H A;  4FEC A;  1FRP A;  5I2N A;  2XD3 A;  3VVE A;  4X1D A;  4FJP A;  1KA1 A;  3G7W A;  2PT2 A;  1IUD A;  2O68 A;  2DE3 A;  4MF3 A;  4KFQ A;  1FTO A;  2F6P A;  4DDD A;  4Q5T A;  3E79 A;  3FIR A;  2ABH A;  5ET7 A;  1MG1 A;  3M3F A;  4DXC A;  3MZB A;  1UQW A;  3VFJ A;  2Y7R A;  2WKY A;  3EF7 A;  1I69 A;  1WDN A;  1RDY A;  4JVC A;  3KJT A;  2AL4 A;  3H6U A;  3UGW A;  3LUZ A;  3MBP A;  3T9U A;  3UP9 A;  3MJN A;  3H6W A;  4FIM A;  1EH3 A;  2PCR A;  3I3V A;  2XHD A;  3RLF E;  4IO4 A;  4P56 A;  1B7Z A;  5A5X A;  3FXB A;  4XF5 A;  2ZYO A;  4PAK A;  3OEN A;  4G68 C;  5EHS A;  2HEU A;  4F18 A;  2DWH A;  4JXI A;  3U1O A;  4P1E A;  4OVS A;  2P3V A;  1LBV A;  4N6P A;  2V3U A;  3QMF A;  4XKN A;  2DQV A;  5TPA A;  1S7Y A;  1VFD A;  1LST A;  3HV1 A;  1AWB A;  3D4C A;  2QS1 A;  3GLB A;  2I4C A;  1CE2 A;  3E78 A;  1JW4 A;  4PF6 A;  2OWZ A;  2DE2 A;  1S9T A;  4WEP A;  3SKP A;  4N07 A;  2KLF A;  3KN7 A;  1PB8 A;  3Q25 A;  3OSR A;  1KWH A;  3JYR A;  3C34 A;  1NKX A;  1SW4 A;  2XXW A;  4DCX A;  4G68 B;  3ODB A;  3C33 A;  1FQE A;  1R9L A;  4EF2 A;  5LTC A;  1B1X A;  1RYX A;  4F29 A;  1P1Q A;  5IZ3 B;  1BK4 A;  1ZJL A;  4LAT A;  1B3L A;  2Y7W A;  5ELV A;  2Q8J A;  3ROJ A;  1NL5 A;  5I2N B;  3BIG A;  4GX6 A;  1N3W A;  3MC2 A;  4HS7 A;  4JSO A;  4Q30 B;  1URD A;  3ZKK A;  3EKI A;  1XC1 A;  2F8D A;  2REJ A;  1IXH A;  3O6H A;  1Z7M E;  3RT6 B;  5F7V A;  4L17 A;  3N26 A;  3ONM A;  4N6K A;  4BDL A;  1MPD A;  4RYA A;  2L5V A;  3C36 A;  4NAP A;  3FGS A;  4RPO A;  2NUV A;  4NF0 A;  2UVG A;  3FBP A;  1YXI A;  3LSF B;  2XXU A;  1OLA A;  2CEY A;  2MKZ A;  2ZYK A;  1SI0 A;  1VDW A;  3L6H A;  4R73 A;  3PTY A;  1SI1 A;  2PT1 A;  2Z8F A;  5HM4 B;  5CMC A;  1LEV A;  3MUQ A;  4EXL A;  2LAO A;  1IMA A;  1DOT A;  2ZMB A;  5A5X B;  2HQ0 A;  1MQI A;  5EHM A;  3CI8 A;  1FQF A;  1H76 A;  4KHZ E;  1MPC A;  4F1Y A;  4ND9 A;  2O51 A;  2P3N A;  4GVO A;  1YTV A;  1N7W A;  3FXR A;  2Q89 A;  4OVJ A;  2F6G A;  4MX6 A;  2DYX A;  1EZ9 A;  3FD3 A;  1PDA A;  3PGF A;  2ALU A;  3CRB A;  4WED A;  1YYZ A;  4AQ4 A;  3OO6 A;  1MS7 A;  4QXD A;  3IB2 A;  4OVQ A;  4ELP A;  1A99 A;  2W7Y A;  2Y84 A;  3RYD A;  4DXB A;  2FBP A;  3D1R A;  2UYF A;  1D9Y A;  3OSQ A;  3CSG A;  4PAF A;  4P9K A;  4MFI A;  1SPI A;  5ITP A;  1AMF A;  4Q0C A;  1LB9 A;  4HTG A;  2O69 A;  4G8M A;  1R6Z A;  2FIX A;  5KCJ A;  3MZ9 A;  3O6I A;  1JP4 A;  2Y7I A;  5EQ7 A;  4JDF A;  2F7C A;  1ELJ A;  1KZ8 A;  4H1X A;  4H0W A;  4N6D A;  3W15 C;  4GWX A;  4F3S A;  4OHN A;  2A5T A;  3TQL A;  3S9E A;  1FQD A;  1QUL A;  2I3V A;  1Y1Z A;  5F24 A;  5ESY A;  1LAH E;  1D3K A;  4H5F A;  3BBR A;  1FJ9 A;  1NV0 A;  3S9L C;  1B3F A;  3U8Q A;  4RPN A;  3PPN A;  3K6W A;  1H3D A;  1A7L A;  4NF5 A;  4E0X A;  4I8C A;  4BDR A;  2Y7K A;  3V83 A;  1B0L A;  3FAT A;  5DVF A;  1PB7 A;  4EF1 A;  1JVX A;  5K2X A;  1IME A;  3I6V A;  1T0K A;  5T3J A;  1VE4 A;  4LZ7 A;  3RPW A;  1B5I A;  5ITO A;  1M5C A;  3IB0 A;  5JTY A;  2XXT A;  2HXR A;  4PFT A;  5CMM A;  4TLM B;  4IGT A;  1QKB A;  2NVU B;  4YKK A;  4NQ8 A;  4JBZ A;  3TTN A;  1J1N A;  4O3B A;  2JJK A;  4BDN A;  3IFA A;  4HE2 A;  4HXV A;  1GTK A;  4R72 A;  1Y3P A;  3TCG A;  4AB5 A;  3FZV A;  2ONR A;  2NWJ A;  3K4U A;  1FBC A;  3H03 A;  5H8N A;  1Z7N E;  4H8J A;  1ZTY A;  4H67 A;  3F11 A;  1TWY A;  2DWA A;  3K01 A;  4YKJ A;  3H4Z A;  1LBY A;  3AXF A;  1NFT A;  2CZI A;  3LC8 A;  1NV4 A;  3G3K A;  1Q35 A;  4MNP A;  4KYS A;  4PFY A;  1A40 A;  4ELR A;  2O7I A;  3SEW A;  4X9T A;  1MDQ A;  3HN0 A;  3IO4 A;  2V3Q A;  4DXU A;  4YMB A;  1JNF A;  5ICT A;  5HBC A;  3RPL A;  4H46 A;  4ESX A;  3IOR A;  4NF6 A;  1MM7 A;  3EQ1 A;  1VSO A;  1LBB A;  3VXB A;  5KCJ B;  3A3U A;  3DP4 A;  2RC7 A;  1P1O A;  2XWI A;  4N91 A;  4KCD A;  4G61 A;  3G3G A;  1NUZ A;  1UIU A;  1AIV A;  5L8D A;  5H8H A;  4GL8 A;  5A5L A;  1GGG A;  2GQ1 A;  1Y1M A;  1YCJ A;  1K9Y A;  2ONS A;  4IO5 A;  1M5D A;  1M5F A;  1XT8 A;  3SER A;  4MIJ A;  3O6G A;  3O97 A;  1FTM A;  1ZBM A;  2YPN A;  4MMP A;  1JEV A;  2F5X A;  5CC2 A;  1MXV A;  4F19 A;  2ESN A;  4XKR A;  4MLV A;  4NF8 A;  4PBH A;  3NOH A;  1NNK A;  2HPG A;  1JET A;  3PUY E;  3CIJ A;  1B4H A;  4Z7E A;  1URG A;  3D4G A;  3TTR A;  3A09 A;  1SW5 A;  2UYE A;  1XS5 A;  3QYT A;  1NNP A;  2ZYN A;  2HCA A;  1GVC A;  5CRY A;  2QS4 A;  3MVX A;  1SYH A;  5JTY B;  3HHF A;  3KN8 A;  2R71 A;  4ZS9 A;  1N0T A;  4FAJ A;  1BP5 A;  4BDQ A;  3QSL A;  1FBG A;  1A55 A;  3L6G A;  1FBE A;  1DTG A;  2P1S A;  3IJX B;  2XX8 A;  3PD8 A;  2VD2 A;  1B7U A;  4RK9 A;  3PPP A;  4U22 A;  4OAN A;  3SEU A;  5H8N B;  3H6V A;  4IY6 A;  1FW0 A;  2VP1 A;  1SDX A;  1NV3 A;  4G68 A;  1FTA A;  2B3B A;  3G3J A;  1D4N A;  4IY5 A;  4QFP A;  3A3C A;  1WOD A;  1FPD A;  3M3K A;  2WBD A;  1MH3 A;  1N76 A;  4AS4 A;  1DPE A;  4GWO A;  2OJT A;  3I5O A;  1B05 A;  2Q2A A;  3EPE A;  1EU8 A;  3RPL B;  1QVS A;  2H98 A;  4NF6 B;  2UXA A;  1XVY A;  5I59 A;  4F3B A;  3TFL A;  1N7X A;  1EYK A;  1MXZ A;  4H45 A;  1AOV A;  1ZMG A;  1IQ7 A;  3W9W A;  3IFC A;  2ZYM A;  4JVI A;  3GBA A;  1OVB A;  1CB6 A;  1FQC A;  4R6Y A;  4PP0 A;  4HW8 A;  4MH5 A;  2H5Y A;  3IOV A;  4GBV A;  2PMS A;  1IMF A;  3H06 B;  3OXN A;  5H8H B;  1RDZ A;  3HO7 A;  4H8I A;  3TTL A;  4PTK A;  4KR5 A;  3BIH A;  3FV2 A;  3MPL A;  2GHB A;  4PDH A;  5CBR A;  3QK6 A;  1YPN A;  2Q88 A;  4ELQ A;  4THI A;  4EXK A;  3GXA A;  4NE4 A;  4ISU A;  2OX3 A;  5JK4 A;  5DEX A;  4EQ7 A;  3B6Q A;  4O94 A;  4YB5 A;  4LN5 A;  4NF8 B;  4P0G A;  2XXK A;  1LBX A;  2VOZ A;  1EYJ A;  1DCU A;  3WAF A;  2NXO A;  4OZ9 A;  3PPQ A;  4IO2 A;  2IA4 A;  2ONK E;  4UAB A;  1B6H A;  1MY3 A;  3O2A A;  2HHM A;  1FPE A;  5CI5 A;  1QUI A;  4U4S A;  4XFE A;  3MPK A;  1A8E A;  3TAJ A;  1MM6 A;  2Q2C A;  3DEL B;  2HFB A;  1P1W A;  4N8Y A;  3VLW A;  4NTL A;  3MAM A;  1B1H A;  4U1Z A;  3FXQ A;  3S9M C;  2F7A A;  3SEX A;  2XXY A;  3VDF A;  3CFX A;  5ET5 A;  2D3I A;  4OXV A;  4PFR A;  1Y9U A;  3U72 A;  3IR1 A;  3E9X A;  2R9J A;  3T0J A;  1EYI A;  2GRV A;  5CMK A;  5I3S A;  3PUZ E;  1FBH A;  3T22 A;  4PFI A;  3KEI A;  2HZK A;  4I40 A;  3K6U A;  1ZLQ A;  2Q8M A;  4GWY A;  3IO6 A;  3UA8 A;  1FBP A;  2QVV A;  2UVH A;  3ZKL A;  2QVR A;  3KZG A;  4R75 A;  2XXV A;  4OMB A;  1NUW A;  4U4X A;  1OIB A;  3ECR A;  4F3G A;  3FV1 A;  3IL1 B;  2P2A A;  3U65 A;  5I59 B;  1XVX A;  3FVN A;  2X7P A;  2XXH A;  4ZZE A;  1TXF A;  4C1U A;  2WX9 A;  4K3F A;  5CBS A;  2FYI A;  4MJO A;  3TQW A;  4O7I A;  3PUW E;  1BIY A;  3QIM A;  3VLV A;  1POT A;  4FAT A;  2ZZW A;  1USY H;  4G4P A;  4F2Q A;  5HPQ A;  4HCW A;  4O7M A;  1QGX A;  2Q9T A;  4GXA A;  5ET6 A;  2ZNS A;  1O7T A;  4DZ1 A;  4IR8 A;  3RN8 A;  1YAE A;  4OQO A;  5DEX B;  2DP8 A;  4KD5 A;  2XXI A;  3K02 A;  4OEV A;  1DMB A;  2B3F A;  4RY1 A;  1YZ0 A;  1OMP A;  3S9N C;  4ZED A;  5KZT A;  3LBS A;  2VPN A;  1DSN A;  3TPA A;  3B7D A;  4POX A;  1LBW A;  4QRZ A;  4O3C A;  2F78 A;  3N94 A;  2F3D A;  4YU0 A;  1DBZ A;  3CG1 A;  3W9V A;  4F39 A;  4N8G A;  3K1P A;  5I84 A;  4LVQ A;  3R7X A;  3C35 A;  4NED A;  4U23 A;  4C1T A;  4G77 A;  4OET A;  2QFL A;  2VGQ A;  3OD7 A;  3IOT A;  2ZXT A;  1NH8 A;  2DSF A;  2ZZV A;  1IMC A;  1FBF A;  3IK6 B;  4EQB A;  3C4M A;  2ANJ A;  1LBZ A;  1PC3 A;  3KC1 A;  2FNC A;  1FPB A;  4DI3 D;  3DP8 A;  4NN3 A;  3FXU A;  2G29 A;  4DCY A;  2XXP A;  5H8F B;  4PFW A;  1G0I A;  2HZL A;  2OZZ A;  3DP6 A;  2NOO A;  3N5L A;  2HXW A;  5FTH A;  1Y3N A;  4PE3 A;  4ZEF A;  3H6T A;  1P1U A;  5J16 A;  2I48 A;  2AYS A;  4XEQ A;  1B5H A;  1Q1K A;  4GIZ A;  1FTL A;  2RKM A;  2IEE A;  3TEP A;  4PFU A;  3SEV A;  3RT8 A;  3UK4 A;  4BLA A;  2RCA A;  3FVK A;  2PBW A;  4XXU A;  1SD3 A;  4GWW A;  4IGR A;  1LGB C;  2RF1 A;  2E1S A;  4MAG A;  4NG7 A;  3C9H A;  3SEY A;  4R6H A;  1MRP A;  4ONY A;  3SZP A;  3ZSF A;  1FTK A;  4G8H A;  3KN3 A;  3O9P A;  3S4U A;  2OLB A;  1NV6 A;  2Y5L A;  3ISP A;  5IGA A;  5EYF A;  1MQG A;  2B65 A;  4QSE A;  5LOM A;  4N81 A;  3IB1 A;  1H43 A;  1KA0 A;  4QSC A;  4H6D A;  4KI0 E;  1O63 A;  3TTM A;  1LAG E;  2GH9 A;  2F34 A;  3U92 A;  1UTH A;  5I5P A;  3GYY A;  2V3T A;  4ZDM A;  5AE4 A;  1I6A A;  5M2V A;  3DM0 A;  4XIG Q;  1Q9D A;  1INP A;  3QAX A;  4F31 B;  1JEU A;  3U93 A;  3QUJ A;  4GX4 A;  4JVD A;  1Y20 A;  1USY E;  2DDK A;  3TCF A;  4PQJ A;  2QVU A;  4OA4 A;  4ZEI A;  2Y5K A;  4P0I A;  2PYY A;  3EHS A;  1B46 A;  4WXJ A;  1NV1 A;  3LSL A;  2QSX A;  4X1B A;  1XOC A;  2M8C A;  3HCQ A;  3CFZ A;  2XX9 A;  1OQH A;  5IKB A;  2QL3 A;  4NHB A;  4U2R A;  1LAX A;  1BLF A;  1MY4 A;  2KR0 A;  1DK4 A;  4DLD A;  3RY3 A;  1US4 A;  1WVJ A;  3M3L A;  2I58 A;  1P1N A;  4JSD A;  1LFG A;  3ZS6 A;  2XD2 A;  3T9X B;  1B58 A;  1NV2 A;  4F3P A;  3KJ7 A;  5L9S A;  1MXU A;  2I3W A;  2Q74 A;  1I6Q A;  3MVY A;  1RDX A;  1LB8 A;  4NWC A;  3TZA A;  4OFL A;  2OBG A;  4LZ5 A;  3CR9 A;  3FJ7 A;  2VD3 A;  4GFR A;  1LBC A;  3A29 A;  3PV0 E;  4OVT A;  2UVJ A;  5DT6 A;  4PE5 B;  5EQ9 A;  5H8Q B;  3KSX A;  3FAS A;  2V25 A;  3QXM A;  1B9J A;  3S2V A;  1LCT A;  3UOR A;  1QKA A;  2WEF A;  3KG2 A;  4RK2 A;  3TCH A;  4MBP A;  3IOU A;  3FVG A;  4YMA A;  2HAU A;  1QUK A;  2PFY A;  1B32 A;  1DPP A;  3E4R A;  2QS3 A;  2Y7P A;  4H65 A;  4R74 A;  4F1U A;  4NF4 B;  2PX1 A;  4U1O A;  3LV0 A;  5FTI A;  4C0R A;  4X04 A;  1UTH B;  2XXR A;  4O8M A;  4JWY A;  3MQ9 A;  1MXY A;  5CM6 A;  3MP6 A;  1NH7 A;  1FPL A;  4PBQ A;  4IB2 A;  3USD A;  4JWX A;  3EN3 A;  3FJG A;  5EYH A;  1GR2 A;  3VE1 B;  5L9O A;  2XA5 A;  3T9H B;  4F2O A;  5B70 A;  2Z8D A;  4KXP A;  2WYK A;  4GL0 A;  3QUF A;  4LP2 B;  1CNQ A;  4P1L A;  3MWB A;  5FBP A;  4YIC A;  1L5T A;  5AA3 A;  4OEU A;  4FED A;  3E13 X;  3IX1 A;  4MNC A;  1IIT A;  2RIN A; 
#chains in the Genus database with same CATH homology
 4OER A;  2DXY A;  1BKA A;  2I49 A;  5DYH A;  2QMW A;  4I1D A;  2CZL A;  1B3G A;  1UIV A;  3PMW A;  5BWJ A;  3TDJ A;  1MY2 A;  2H99 A;  3P7I A;  4I9D A;  2QMX A;  4IO7 A;  2Z22 A;  4NMY A;  3VLU A;  1ATG A;  3R26 A;  3C32 A;  2OWS A;  4XKP A;  1NNT A;  1VR5 A;  3M8U A;  3BFT A;  4UA8 A;  1TFD A;  1IZ1 A;  2A5S A;  2PVU A;  3ILT B;  1N3X A;  5I57 A;  1Y4C A;  2F7B A;  1PEB A;  2AL5 A;  3EHT A;  4R2F A;  1POY 1;  5JEI A;  1IIW A;  4OYV A;  1A54 A;  2YJP A;  3HHG A;  4G8N A;  3SES A;  3UIF A;  3MP1 A;  4Q8R A;  3TOD A;  5DVJ A;  3SDF A;  2E0S A;  5FHM A;  3VVD A;  3MVW A;  4ZEK A;  2X7Q A;  1MY0 A;  3RGY A;  3TMG A;  3KBR A;  4TQU Q;  1LFH A;  5H8S A;  2P0S A;  3UN6 A;  1B3E A;  4RXL A;  1AH5 A;  1LCF A;  1FTJ A;  1MY1 A;  3G3F A;  4DIG A;  1B7H A;  4GD5 A;  1B4Z A;  2V84 A;  3T66 A;  4QFL A;  1NNF A;  4YB6 A;  1XHY A;  2XX7 A;  5H8F A;  3VXC A;  1B52 A;  4KYD A;  2BJJ X;  4M4G A;  4LZ8 A;  2O1M A;  3Q29 A;  1B2H A;  1UTB A;  4OES A;  2I4B A;  2F36 A;  2UVI A;  1N04 A;  3IOW A;  1FQB A;  1F9B A;  1SQY A;  4EQ9 A;  1JQF A;  1ZU0 A;  1LFI A;  2GFE A;  3OEL A;  3CVG A;  3IAZ A;  4IO3 A;  4GF8 A;  1O64 A;  1JW5 A;  3RNN A;  1PBQ A;  2O84 X;  4OFJ A;  1B51 A;  4GQO A;  2DOJ A;  1US5 A;  1JVY A;  3VV5 A;  3JZJ A;  4PET A;  5J1D A;  3V5A A;  3FVO A;  1R1N A;  3KFM A;  1PB9 A;  4QFK A;  1AL3 A;  1QJM A;  4QFO A;  2H25 A;  2DWJ A;  3T9V A;  1H45 A;  5AA2 A;  4GOT A;  3PD9 A;  5I57 B;  3PMV A;  3TEL A;  1IXC A;  4P11 A;  2QJE A;  3PUV E;  3OEM A;  4DE8 A;  4FEB A;  4RA1 A;  5L9M A;  3LSX A;  3MP8 A;  4ZZA A;  3K1M A;  4KYE A;  3THI A;  3V89 B;  4YKI A;  2DS9 A;  5DVI A;  4F22 A;  4JB7 A;  2V93 A;  3LR1 A;  3K0V A;  3BFU A;  3RTF B;  3N6T A;  4ZEB A;  2H4I A;  1Y4T A;  3MZ1 A;  3CFL A;  4ELO A;  2GHA A;  3PPO A;  4TOZ A;  3ILU B;  5AA1 A;  4G2Z A;  3PUX E;  4OEN A;  4YAH X;  4ZE9 A;  4R9G A;  5CMB A;  1MDP 1;  5I2K A;  3K6V A;  4KQP A;  2G93 A;  4JWO A;  4BDO A;  2I0B A;  3KSJ A;  1D9V A;  3Q26 A;  4H5G A;  2QRY A;  2QS2 A;  5TPA B;  3TUS A;  2ZNU A;  4LON B;  1ANF A;  1SW1 A;  3OMB A;  2I0C A;  4POW A;  2DWI A;  3K6X A;  1UTB B;  1NMU A;  4EUO A;  1HSE A;  3OO9 A;  1HSJ A;  3LUY A;  5FHO A;  4Z0I A;  3H3G A;  3E3K A;  1M5B A;  5TP9 A;  4M1V A;  5AA4 A;  1EZP A;  4N13 A;  3TTK A;  4UAC A;  1BTJ A;  4U21 A;  2Z8E A;  4OFO A;  5H8Q A;  4LQ2 A;  5BUU A;  2I6E A;  2THI A;  3U94 A;  3TYH A;  4RNS A;  1B40 A;  1B3H A;  1FCK A;  1HSL A;  3OEK A;  3Q28 A;  4KPT A;  1IXG A;  3Q27 A;  5KDT A;  4EDP A;  3OO8 A;  4OWD A;  4LQ5 A;  5I58 A;  4OTE A;  3RTW B;  4LUB A;  3T96 B;  1MXW A;  5AA2 D;  5AA2 B;  3OO7 A;  5I56 A;  2X26 A;  1MPB A;  1RYO A;  3BKI B;  4NF4 A;  1B0H A;  1PBP A;  5ISU A;  3LSW A;  1M5E A;  1R9Q A;  4QHQ A;  5TU0 A;  1I6B A;  3K1N A;  3B6W A;  3T93 B;  2H9B A;  1SVX B;  3PMX A;  4ECF A;  4F1V A;  4LA9 A;  3O66 A;  1JW1 A;  2D5W A;  4ESW A;  4R2B A;  1OVT A;  4XTC Q;  2R6G E;  4HCY A;  3KOS A;  4GLI A;  2XXX A;  3CG3 A;  3EHU A;  4R6K A;  1N84 A;  4WKM A;  2HAV A;  3V8X B;  4ZE8 A;  1QUJ A;  5I2K B;  2DVC A;  3MW0 A;  1IXI A;  2D21 A;  4KCC A;  2O1L A;  3G3H A;  4TLL B;  1TT1 A;  2CMO A;  2REG A;  2F97 A;  3VVF A;  1ZKB A;  1TFA A;  2AIX A;  1H44 A;  4RJZ A;  4YKP A;  1MH4 A;  2O7U A;  2O6A A;  3O28 A;  3TKD A;  4YZZ A;  2FA7 A;  3K00 A;  5TP9 B;  3FJM A;  3N6U A;  1SW2 A;  1FQA A;  5AA4 B;  1GV8 A;  5DTB A;  4O3A A;  4QSD A;  3H7M A;  4XKQ A;  4FOR A;  2VHA A;  5FHN A;  3K2D A;  1QW0 A;  4QFN A;  2A5T B;  5IAI A;  4X48 A;  3GBB A;  5KDT B;  1B5J A;  4ZEC A;  5I58 B;  2OCU A;  1P99 A;  3HST A;  2DVZ A;  3GZG A;  1MQH A;  3JV9 A;  5I56 B;  3HPI A;  4NF5 B;  2RC8 A;  2DXR A;  2YLN A;  5B7D A;  2DE4 A;  4R9F A;  1RKM A;  2RCB A;  1URS A;  4BDM A;  5K2Y A;  2Z23 A;  1EZO A;  2XXQ A;  3DLN A;  1A8F A;  3MVZ A;  4GXS B;  3OOA A;  3O29 A;  3RQT A;  1LLS A;  3PPR A;  5ICQ A;  4GRK A;  3G3I A;  2ZNT A;  1II5 A;  1MXX A;  2OWT A;  1MQJ A;  1SYI A;  4YB7 A;  2RC9 A;  3IJO B;  3SET A;  1LAF E;  2OK2 A;  1OLC A;  1OQG A;  1S50 A;  3C31 A;  1VFE A;  1SBP A;  4E0W A;  3R6U A;  3WAE A;  1Y3Q A;  2QPQ A;  4AB6 A;  5F1Q A;  1DTZ A;  2F35 A;  3PU5 A;  1ZIU A;  3KOT A;  4FE8 A;  4MLQ A;  4NWD A;  3B6T A;  1IEJ A;  3FUZ A;  4I62 A;  4IO6 A;  3RUM A;  3KGC A;  1MQD A;  3CSB A;  4QF9 A;  4FEC A;  5I2N A;  2XD3 A;  3VVE A;  4X1D A;  4FJP A;  3G7W A;  2PT2 A;  1IUD A;  2O68 A;  2DE3 A;  4MF3 A;  4KFQ A;  1FTO A;  2F6P A;  4DDD A;  4Q5T A;  3FIR A;  2ABH A;  1MG1 A;  3M3F A;  4DXC A;  3MZB A;  1UQW A;  3VFJ A;  2Y7R A;  2WKY A;  3EF7 A;  1WDN A;  1I69 A;  3KJT A;  2AL4 A;  3H6U A;  3UGW A;  3MBP A;  3T9U A;  3UP9 A;  3MJN A;  3H6W A;  4FIM A;  1EH3 A;  3I3V A;  2XHD A;  3RLF E;  4IO4 A;  1B7Z A;  5A5X A;  2ZYO A;  3OEN A;  4G68 C;  5EHS A;  2HEU A;  4F18 A;  2DWH A;  4JXI A;  3U1O A;  4N6P A;  2V3U A;  4XKN A;  2DQV A;  5TPA A;  1S7Y A;  1VFD A;  1LST A;  3HV1 A;  3D4C A;  2QS1 A;  3GLB A;  2I4C A;  1CE2 A;  1JW4 A;  2DE2 A;  1S9T A;  4WEP A;  3SKP A;  4N07 A;  2KLF A;  3KN7 A;  1PB8 A;  3Q25 A;  3OSR A;  1KWH A;  3JYR A;  3C34 A;  1NKX A;  1SW4 A;  2XXW A;  4DCX A;  4G68 B;  3ODB A;  3C33 A;  1FQE A;  1R9L A;  4EF2 A;  1B1X A;  1RYX A;  4F29 A;  1P1Q A;  1ZJL A;  4LAT A;  1B3L A;  2Y7W A;  5ELV A;  2Q8J A;  1NL5 A;  5I2N B;  1N3W A;  3MC2 A;  4HS7 A;  4JSO A;  4Q30 B;  1URD A;  3ZKK A;  1XC1 A;  2F8D A;  2REJ A;  1IXH A;  3O6H A;  1Z7M E;  3RT6 B;  5F7V A;  4L17 A;  3N26 A;  3ONM A;  4BDL A;  1MPD A;  4RYA A;  3C36 A;  3FGS A;  4RPO A;  2NUV A;  2UVG A;  3LSF B;  2XXU A;  1OLA A;  2ZYK A;  1SI0 A;  3L6H A;  4R73 A;  1SI1 A;  2PT1 A;  2Z8F A;  5HM4 B;  5CMC A;  3MUQ A;  4EXL A;  2LAO A;  1DOT A;  2ZMB A;  5A5X B;  2HQ0 A;  1MQI A;  5EHM A;  3CI8 A;  1FQF A;  1H76 A;  4KHZ E;  1MPC A;  4F1Y A;  4ND9 A;  2O51 A;  4GVO A;  1YTV A;  1N7W A;  3FXR A;  2Q89 A;  4OVJ A;  2F6G A;  2DYX A;  1EZ9 A;  3FD3 A;  1PDA A;  3PGF A;  2ALU A;  3CRB A;  4WED A;  4AQ4 A;  3OO6 A;  1MS7 A;  3IB2 A;  4ELP A;  1A99 A;  2W7Y A;  2Y84 A;  4DXB A;  2UYF A;  1D9Y A;  3OSQ A;  3CSG A;  4MFI A;  5ITP A;  1AMF A;  4Q0C A;  1LB9 A;  4HTG A;  2O69 A;  4G8M A;  1R6Z A;  5KCJ A;  3MZ9 A;  3O6I A;  2Y7I A;  4JDF A;  2F7C A;  1ELJ A;  4H1X A;  4H0W A;  3W15 C;  4F3S A;  4OHN A;  2A5T A;  3TQL A;  3S9E A;  1FQD A;  1QUL A;  2I3V A;  1Y1Z A;  1LAH E;  1D3K A;  4H5F A;  3BBR A;  3S9L C;  1B3F A;  3U8Q A;  4RPN A;  3PPN A;  3K6W A;  1H3D A;  1A7L A;  4NF5 A;  4E0X A;  4I8C A;  4BDR A;  2Y7K A;  3V83 A;  1B0L A;  3FAT A;  5DVF A;  1PB7 A;  4EF1 A;  1JVX A;  5K2X A;  3I6V A;  1T0K A;  1VE4 A;  4LZ7 A;  3RPW A;  1B5I A;  5ITO A;  1M5C A;  3IB0 A;  5JTY A;  2XXT A;  4PFT A;  5CMM A;  4TLM B;  4IGT A;  1QKB A;  2NVU B;  4YKK A;  4JBZ A;  3TTN A;  1J1N A;  4O3B A;  4BDN A;  1GTK A;  4R72 A;  1Y3P A;  3TCG A;  4AB5 A;  3FZV A;  2ONR A;  2NWJ A;  3K4U A;  3H03 A;  5H8N A;  1Z7N E;  4H8J A;  1ZTY A;  4H67 A;  3F11 A;  1TWY A;  2DWA A;  3K01 A;  4YKJ A;  3H4Z A;  3AXF A;  1NFT A;  3LC8 A;  3G3K A;  1Q35 A;  4KYS A;  4PFY A;  1A40 A;  4ELR A;  2O7I A;  3SEW A;  4X9T A;  1MDQ A;  3HN0 A;  3IO4 A;  2V3Q A;  4DXU A;  4YMB A;  1JNF A;  5ICT A;  5HBC A;  4ESX A;  3IOR A;  4NF6 A;  1MM7 A;  3EQ1 A;  1VSO A;  1LBB A;  3VXB A;  5KCJ B;  3A3U A;  3DP4 A;  2RC7 A;  1P1O A;  4KCD A;  3G3G A;  1UIU A;  1AIV A;  5L8D A;  5H8H A;  4GL8 A;  1GGG A;  1Y1M A;  1YCJ A;  2ONS A;  4IO5 A;  1M5D A;  1M5F A;  1XT8 A;  3SER A;  3O6G A;  3O97 A;  1FTM A;  1ZBM A;  2YPN A;  1JEV A;  2F5X A;  5CC2 A;  1MXV A;  4F19 A;  2ESN A;  4XKR A;  4MLV A;  4NF8 A;  1NNK A;  1JET A;  3PUY E;  3CIJ A;  1B4H A;  4Z7E A;  1URG A;  3D4G A;  3TTR A;  3A09 A;  1SW5 A;  2UYE A;  1XS5 A;  3QYT A;  1NNP A;  2ZYN A;  2HCA A;  1GVC A;  5CRY A;  2QS4 A;  3MVX A;  1SYH A;  5JTY B;  3HHF A;  3KN8 A;  2R71 A;  4ZS9 A;  1N0T A;  4FAJ A;  1BP5 A;  4BDQ A;  3QSL A;  1A55 A;  3L6G A;  1DTG A;  2P1S A;  3IJX B;  2XX8 A;  3PD8 A;  2VD2 A;  1B7U A;  4RK9 A;  3PPP A;  4U22 A;  3SEU A;  5H8N B;  3H6V A;  4IY6 A;  1FW0 A;  2VP1 A;  1SDX A;  4G68 A;  2B3B A;  3G3J A;  1D4N A;  4IY5 A;  4QFP A;  3A3C A;  1WOD A;  3M3K A;  1MH3 A;  1N76 A;  1DPE A;  4GWO A;  2OJT A;  3I5O A;  1B05 A;  2Q2A A;  3EPE A;  1EU8 A;  1QVS A;  2H98 A;  4NF6 B;  2UXA A;  1XVY A;  5I59 A;  4F3B A;  3TFL A;  1N7X A;  1MXZ A;  1AOV A;  1ZMG A;  1IQ7 A;  3W9W A;  2ZYM A;  3GBA A;  1OVB A;  1CB6 A;  1FQC A;  4R6Y A;  4PP0 A;  4HW8 A;  4MH5 A;  2H5Y A;  2PMS A;  3IOV A;  3OXN A;  3H06 B;  5H8H B;  3HO7 A;  4H8I A;  3TTL A;  4KR5 A;  3FV2 A;  3MPL A;  2GHB A;  5CBR A;  3QK6 A;  1YPN A;  2Q88 A;  4ELQ A;  4THI A;  4EXK A;  3GXA A;  4NE4 A;  4ISU A;  5JK4 A;  5DEX A;  4EQ7 A;  3B6Q A;  4YB5 A;  4NF8 B;  4P0G A;  2VOZ A;  3WAF A;  2NXO A;  4OZ9 A;  3PPQ A;  4IO2 A;  2IA4 A;  2ONK E;  1B6H A;  1MY3 A;  3O2A A;  5CI5 A;  1QUI A;  4U4S A;  3MPK A;  1A8E A;  3TAJ A;  1MM6 A;  2Q2C A;  3DEL B;  2HFB A;  1P1W A;  3VLW A;  4NTL A;  3MAM A;  1B1H A;  4U1Z A;  3FXQ A;  3S9M C;  2F7A A;  3SEX A;  2XXY A;  3VDF A;  3CFX A;  2D3I A;  4OXV A;  3U72 A;  1Y9U A;  3IR1 A;  3E9X A;  2R9J A;  2GRV A;  5CMK A;  3PUZ E;  3T22 A;  3KEI A;  2HZK A;  3K6U A;  1ZLQ A;  3IO6 A;  3UA8 A;  2UVH A;  3ZKL A;  3KZG A;  4R75 A;  2XXV A;  4OMB A;  4U4X A;  1OIB A;  3ECR A;  4F3G A;  3FV1 A;  3IL1 B;  2P2A A;  5I59 B;  1XVX A;  3FVN A;  2X7P A;  2XXH A;  4ZZE A;  1TXF A;  4C1U A;  4K3F A;  5CBS A;  2FYI A;  3TQW A;  3PUW E;  1BIY A;  3QIM A;  3VLV A;  1POT A;  4FAT A;  1USY H;  4G4P A;  4F2Q A;  5HPQ A;  4HCW A;  2Q9T A;  4GXA A;  2ZNS A;  1O7T A;  4DZ1 A;  3RN8 A;  1YAE A;  4OQO A;  5DEX B;  2DP8 A;  4KD5 A;  2XXI A;  3K02 A;  4OEV A;  1DMB A;  2B3F A;  4RY1 A;  1OMP A;  3S9N C;  4ZED A;  5KZT A;  3LBS A;  1DSN A;  3TPA A;  3B7D A;  4POX A;  4QRZ A;  4O3C A;  2F78 A;  3N94 A;  4YU0 A;  3CG1 A;  3W9V A;  4F39 A;  3K1P A;  5I84 A;  4LVQ A;  3R7X A;  3C35 A;  4NED A;  4U23 A;  4C1T A;  4G77 A;  4OET A;  2VGQ A;  3OD7 A;  3IOT A;  2ZXT A;  1NH8 A;  2DSF A;  3IK6 B;  4EQB A;  3C4M A;  2ANJ A;  1PC3 A;  2FNC A;  3DP8 A;  3FXU A;  2G29 A;  4DCY A;  2XXP A;  5H8F B;  4PFW A;  2HZL A;  2OZZ A;  3DP6 A;  2NOO A;  3N5L A;  2HXW A;  5FTH A;  1Y3N A;  4ZEF A;  3H6T A;  1P1U A;  2I48 A;  2AYS A;  1B5H A;  1Q1K A;  4GIZ A;  1FTL A;  2RKM A;  2IEE A;  3TEP A;  4PFU A;  3SEV A;  3RT8 A;  3UK4 A;  4BLA A;  2RCA A;  3FVK A;  2PBW A;  4XXU A;  1SD3 A;  4IGR A;  1LGB C;  2RF1 A;  2E1S A;  3C9H A;  3SEY A;  4R6H A;  1MRP A;  4ONY A;  3ZSF A;  1FTK A;  4G8H A;  3KN3 A;  3O9P A;  3S4U A;  2OLB A;  5EYF A;  1MQG A;  2B65 A;  4QSE A;  5LOM A;  3IB1 A;  1H43 A;  4QSC A;  4H6D A;  4KI0 E;  1O63 A;  3TTM A;  1LAG E;  2GH9 A;  2F34 A;  3U92 A;  1UTH A;  2V3T A;  4ZDM A;  5AE4 A;  1I6A A;  5M2V A;  3DM0 A;  4XIG Q;  3QAX A;  4F31 B;  1JEU A;  3U93 A;  3QUJ A;  1Y20 A;  1USY E;  3TCF A;  4PQJ A;  4ZEI A;  4P0I A;  2PYY A;  3EHS A;  1B46 A;  4WXJ A;  3LSL A;  2QSX A;  4X1B A;  1XOC A;  2M8C A;  3HCQ A;  3CFZ A;  2XX9 A;  1OQH A;  5IKB A;  2QL3 A;  4U2R A;  1LAX A;  1BLF A;  1MY4 A;  4DLD A;  3RY3 A;  1US4 A;  1WVJ A;  3M3L A;  2I58 A;  1P1N A;  4JSD A;  1LFG A;  3ZS6 A;  2XD2 A;  3T9X B;  1B58 A;  4F3P A;  3KJ7 A;  5L9S A;  1MXU A;  2I3W A;  1I6Q A;  3MVY A;  1LB8 A;  4NWC A;  3TZA A;  4OFL A;  2OBG A;  4LZ5 A;  3CR9 A;  3FJ7 A;  2VD3 A;  4GFR A;  1LBC A;  3PV0 E;  2UVJ A;  5DT6 A;  4PE5 B;  5H8Q B;  3KSX A;  3FAS A;  2V25 A;  3QXM A;  1B9J A;  3S2V A;  1LCT A;  3UOR A;  1QKA A;  3KG2 A;  4RK2 A;  3TCH A;  4MBP A;  3IOU A;  3FVG A;  4YMA A;  2HAU A;  1QUK A;  1B32 A;  1DPP A;  3E4R A;  2QS3 A;  2Y7P A;  4H65 A;  4R74 A;  4F1U A;  4NF4 B;  2PX1 A;  4U1O A;  5FTI A;  4C0R A;  1UTH B;  2XXR A;  4JWY A;  3MQ9 A;  1MXY A;  5CM6 A;  3MP6 A;  1NH7 A;  4IB2 A;  3USD A;  4JWX A;  3EN3 A;  3FJG A;  1GR2 A;  3VE1 B;  5L9O A;  4F2O A;  3T9H B;  5B70 A;  2Z8D A;  4GL0 A;  3QUF A;  4LP2 B;  3MWB A;  4YIC A;  1L5T A;  5AA3 A;  4OEU A;  4FED A;  3E13 X;  3IX1 A;  1IIT A;  2RIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...