2Y7IA

Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
228
structure length
228
Chain Sequence
ASVSARTLHFGTSATYAPYEFVDADNKIVGFDIDVANAVCKEMQAECSFTNQSFDSLIPSLRFKKFDAVIAGMDMTPKREQQVSFSQPYYEGLSAVVVTRKGAYHTFADLKGKKVGLENGTTHQRYLQDKQQAITPVAYDSYLNAFTDLKNNRLEGVFGDVAAIGKWLKNNPDYAIMDERASDPDYYGKGLGIAVRKDNDALLQEINAALDKVKASPEYAQMQEKWFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Microcalorimetric Analyses Reveal the Structural Basis for High Arginine Specificity in the Salmonella Enterica Serovar Typhimurium Periplasmic Binding Protein Stm4351.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica
molecule tags Arginine-binding protein
molecule keywords STM4351
total genus 83
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2y7iA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2y7iA02
3O66A 5KZTA 5HBCA 2AYSA 1NNTA 2RCBA 4E0XA 3LUYA 4U4SA 1D4NA 4FAJA 1USYE 1SD3A 2Z8FA 2IEEA 4QSDA 3Q28A 2YLNA 2ANJA 2UXAA 3FVKA 4R6KA 1MY1A 1SVXB 3BBRA 5L8DA 4GFRA 4F3SA 4QRZA 4U1OA 5L9OA 4P0IA 2A5TB 1IXCA 4Z7EA 4LUBA 2ONSA 3A3CA 2UYFA 3EHUA 3PU5A 2DVZA 1H44A 3MVXA 3IB1A 1PB9A 1DPPA 5AA3A 5LOMA 1TFDA 1NNFA 2XXYA 2PBWA 3H6TA 4IO6A 1IITA 2VGQA 5H8QB 1M5BA 3SEXA 2PVUA 4P11A 2H4IA 3FV2A 3CG1A 4YKPA 5ITOA 3N6TA 3SESA 4QF9A 3C4MA 4MF3A 3MP6A 4OMBA 2XHDA 4F3BA 1QKBA 4G68B 4WEPA 1IEJA 3B6TA 4WEDA 1Y9UA 4PP0A 5K2YA 3T9XB 4ZEDA 1KWHA 4IGRA 3TTKA 3CI8A 1SYIA 4ELOA 1A99A 2XX7A 2Z8DA 1L5TA 5TP9A 4FJPA 1FW0A 3R7XA 4F22A 2HAUA 2I6EA 2REJA 3K01A 3L6HA 4FIMA 1B40A 4KD5A 3IOUA 3SEWA 2H25A 4ZEBA 4KYEA 1XVYA 1EU8A 4BDOA 1DMBA 1MXVA 4YICA 5H8NA 1JNFA 1SBPA 3PD9A 1DTGA 1FQCA 3MP1A 3R6UA 1N7XA 2DSFA 4LZ8A 4RK9A 4LQ2A 3TFLA 3C32A 1UTBA 4F31B 1AL3A 4LQ5A 3GBAA 2OCUA 5CM6A 4F39A 1FTOA 1WVJA 2PMSA 2ZYKA 4JWOA 4DDDA 4ZEKA 5AA4A 2H98A 2F78A 3B6QA 4AB6A 1B7HA 1GTKA 2GH9A 3TYHA 4F2QA 3PPQA 1PB8A 1S50A 5KDTB 4XXUA 2CMOA 1H43A 3TMGA 1A8EA 3KBRA 2XXRA 5JTYA 3N94A 2O1LA 2D3IA 4RK2A 1N7WA 2E0SA 3IJOB 2DWHA 1B3EA 4HTGA 4ZECA 3B6WA 3UN6A 3WAEA 4BLAA 3H06B 2RF1A 1URGA 3QAXA 4RXLA 2G93A 2ZYMA 1PEBA 1CB6A 3CIJA 2DE2A 3KGCA 2IA4A 3Q27A 4QSEA 4R9GA 1B46A 1MG1A 4BDLA 1XHYA 4DE8A 4U1ZA 1N76A 1MDP1 4DIGA 4LONB 1XVXA 2NWJA 3RQTA 3CFLA 3S9EA 1POTA 2QMXA 2XXWA 2ZNSA 3DP4A 1MY4A 3K6UA 3MQ9A 4M1VA 4MLVA 3VDFA 2Y7KA 1HSEA 4LVQA 4JWXA 3OELA 1QJMA 4TLLB 3M3LA 1LLSA 4YZZA 4TQUQ 1GR2A 3PPPA 4ZZEA 2V93A 3O97A 4DLDA 3H6WA 4H5GA 4NF4B 1SW4A 3H6VA 3BKIB 3EN3A 2B3FA 3HHGA 2XD3A 2VOZA 2V3UA 2I3VA 3CSGA 3TELA 1LAHE 5FHMA 1TFAA 3O9PA 2QS1A 2XD2A 3OEKA 5CRYA 2FYIA 4AQ4A 3KN7A 3G3GA 4F19A 2H99A 3RNNA 3TTMA 5DEXA 2Q2CA 4GVOA 1IXIA 3H03A 2I58A 4EQBA 2NOOA 4IY6A 2R9JA 5H8HB 3LR1A 4LA9A 4O3AA 4BDQA 3HV1A 1ZIUA 4KR5A 1YCJA 3Q25A 4NF8A 2PT1A 3IO6A 3PUWE 3EF7A 2QS3A 1B5HA 1F9BA 5AE4A 1P99A 4KPTA 1MM7A 1I6QA 3MZ1A 1PB7A 3FVNA 1FQBA 4R2FA 3UIFA 1EZOA 2I0CA 4NEDA 2O84X 3EHTA 2H9BA 2X7PA 3K6VA 1A8FA 3Q26A 5F1QA 3U8QA 2VD3A 4EXLA 5J1DA 1GGGA 1ATGA 4R72A 3DM0A 4XKPA 1I6BA 2REGA 3G3KA 1UTBB 2F6PA 4GF8A 4ONYA 5EHSA 2Y7RA 1D9VA 2FNCA 4TOZA 3TDJA 3PPRA 3UK4A 2GFEA 3RTWB 4WKMA 5I57B 3AXFA 4MFIA 2B3BA 2A5TA 3FASA 3MVYA 3O6HA 1N04A 3DELB 5DVJA 5FHOA 2Q8JA 5CBSA 3ZS6A 3EHSA 2X7QA 5L9SA 1R9LA 2GRVA 4IO7A 5CMBA 1RKMA 5H8FA 3FVOA 3Q29A 2FA7A 4R75A 5ICQA 1NKXA 4GRKA 1SDXA 1OVBA 1AH5A 1LFIA 1QULA 1Y3QA 2W7YA 3KN3A 3M3FA 3QSLA 1OVTA 4YKKA 4BDRA 4QSCA 3E4RA 4XTCQ 3ZKKA 2E1SA 4H67A 4I9DA 5B7DA 1YPNA 1P1WA 4NF5B 3VVFA 1MH3A 2THIA 3SERA 2UVJA 4YKIA 5AA2D 4KCCA 4GL8A 4JSDA 3JYRA 5DYHA 3SEYA 2V25A 4MBPA 3T93B 4F29A 5ITPA 4DZ1A 4XIGQ 4OFLA 1M5CA 3CFZA 3CRBA 5EHMA 5I2KA 2O51A 2DWAA 2F5XA 1IXGA 3H4ZA 1BIYA 1O64A 3HPIA 4HCWA 4IO5A 4H5FA 4OYVA 3TKDA 4DCXA 2O1MA 1A40A 3BFUA 3T96B 4ELQA 4G8HA 2R6GE 3GBBA 3N5LA 1XT8A 2I3WA 3RT6B 3T9HB 4ECFA 3N6UA 1TWYA 4H65A 4PETA 3T9UA 3S9MC 1VFDA 3HO7A 4N6PA 1B1HA 3VVEA 3VXBA 1B5IA 1B7UA 3RUMA 1EZ9A 4ZE9A 2NXOA 3SEVA 5KDTA 1RYOA 3V89B 4MLQA 4KI0E 4I62A 4LATA 1NFTA 4H1XA 1B3FA 3RLFE 2DVCA 1FTLA 5H8FB 1JETA 5AA4B 2I48A 3V83A 4JBZA 5HM4B 5AA2A 1JVYA 2XXQA 1BTJA 3JZJA 4QFLA 3S9LC 1FQEA 3MVWA 1VSOA 2RC7A 3CVGA 1VFEA 3WAFA 4G4PA 3CG3A 4L17A 2ESNA 1MQDA 1MQGA 1FCKA 1B52A 4JSOA 5JTYB 3VVDA 4C1UA 2D5WA 3O29A 1M5FA 4RYAA 4F3GA 4U23A 1MQJA 1Y4CA 4JB7A 3RN8A 1ANFA 2P1SA 1NNPA 1B7ZA 1MDQA 2H5YA 1D3KA 3DP6A 3IOVA 3KEIA 4RPNA 2ALUA 4PFUA 1B9JA 3PMWA 4GXAA 1AOVA 4ELRA 4NWDA 5I59A 3PMXA 5I2NB 3OMBA 1Q1KA 2DE4A 5JK4A 2QJEA 2DOJA 4H0WA 1N3XA 3SKPA 1BP5A 4X48A 3A09A 1WDNA 3V5AA 5F7VA 3PD8A 5EYFA 5A5XB 1HSLA 5FTIA 1RYXA 4QHQA 3VLVA 4BDMA 1MY2A 4EQ7A 4BDNA 2VHAA 2XX9A 3ILTB 3IL1B 1LBCA 2HZLA 2QPQA 4R6YA 4F18A 4YB7A 1LBBA 2QSXA 2D21A 2HEUA 2PT2A 2Z22A 3GZGA 4OWDA 1IQ7A 4IY5A 4OENA 2Z8EA 1JQFA 3U93A 3TEPA 2F7CA 1UIUA 3BFTA 3D4GA 3JV9A 4OQOA 2AIXA 3IORA 3VE1B 5BWJA 3S9NC 1R9QA 2B65A 4G68A 2DE3A 4G8MA 2ONKE 5DTBA 3RGYA 2F7BA 1MS7A 5ELVA 1T0KA 1B3GA 2QRYA 2YPNA 3LBSA 4Q5TA 1MM6A 3VXCA 2F8DA 3G3FA 5I56A 2Q89A 1Y20A 4EXKA 3FUZA 2UVHA 1LAFE 3MZ9A 4FE8A 1B6HA 1LSTA 1QKAA 4OTEA 4QFPA 2XXIA 3RT8A 1OMPA 1O7TA 1PDAA 1UQWA 4KYSA 2ABHA 1QVSA 2O68A 3DP8A 3TTRA 4X9TA 5DEXB 3TCGA 2P2AA 3C31A 4POXA 4Q8RA 1O63A 3PUZE 4ZDMA 3VV5A 3B7DA 3OO7A 4OEVA 1SI1A 3KSJA 4FEBA 4H6DA 3G3IA 1LB9A 3MC2A 3N26A 4H8IA 2DWJA 4PFTA 5DVFA 4DXUA 1USYH 3C34A 2R71A 4Q0CA 1UIVA 2BJJX 4U22A 5CBRA 4MH5A 2HFBA 1Y4TA 2XXUA 3OENA 4RJZA 1SYHA 1ZJLA 2GHBA 1DTZA 4G68C 2KLFA 1OLCA 2HCAA 5DT6A 1LB8A 1Y3NA 2DQVA 4THIA 4OESA 1P1QA 2RINA 4PE5B 4XKQA 3IB0A 4YB5A 2XXXA 5I58A 5KCJA 3LSXA 4ESXA 2F36A 1DOTA 5CI5A 1ZU0A 3HSTA 4YMBA 3CR9A 3TQWA 5I59B 1H45A 3IOWA 3VLWA 3SDFA 1MXWA 1FQDA 2M8CA 1JVXA 3E3KA 2O6AA 4JDFA 3MAMA 5HPQA 3MZBA 2RC9A 2DP8A 1B4ZA 3GLBA 3HHFA 3MPLA 4OEUA 3ILUB 5H8NB 3UORA 3K2DA 3RY3A 3W15C 4N13A 4FECA 1MXYA 2YJPA 4HS7A 4FORA 1MRPA 4OXVA 3USDA 3V8XB 2UVIA 3TZAA 1Z7ME 2ONRA 4KQPA 4IO4A 4DXBA 3M8UA 3OEMA 2NUVA 3L6GA 4KFQA 3HN0A 1MQIA 1B0LA 4P0GA 4G8NA 4YKJA 4ELPA 2I4BA 2DYXA 3K1MA 4GLIA 4IGTA 5AA1A 4PQJA 4F3PA 4EF1A 1N84A 1OQGA 1MXUA 1MXXA 1NL5A 3MJNA 1H3DA 4JXIA 1US5A 3MVZA 5FHNA 2HXWA 2V3QA 1FTMA 3FJGA 1A7LA 1ZMGA 3KJ7A 3ONMA 1P1UA 1B3LA 5I57A 5ISUA 3PV0E 4YB6A 4OFOA 3THIA 1XS5A 3MP8A 4NF6B 3MW0A 1FTJA 1POY1 1TT1A 1N0TA 3IX1A 3O2AA 4OFJA 2WKYA 2RKMA 4TLMB 2DWIA 3TODA 4GWOA 1D9YA 1MY3A 1MQHA 2XXVA 2HAVA 3FATA 2OWSA 3FXRA 1I69A 3OO9A 4C0RA 1S9TA 2ZXTA 4M4GA 3T22A 4YMAA 3KJTA 4LZ5A 5ICTA 1LCTA 3OXNA 1DSNA 1URSA 1IXHA 2V3TA 1SW1A 2XXPA 4ND9A 3LC8A 4NMYA 2V84A 4RA1A 3SETA 1BKAA 1MXZA 2QL3A 3K00A 3K1NA 4NF8B 2ZNTA 1M5DA 2Y7WA 5JEIA 4OETA 4YU0A 2HZKA 2Q2AA 3PGFA 3IAZA 3U94A 2DXYA 1YTVA 4E0WA 3MWBA 2PX1A 1H76A 1TXFA 4F1YA 3D4CA 3G3HA 1SI0A 4X1BA 4F1UA 5DVIA 1P1OA 4U4XA 4HW8A 2PYYA 5A5XA 1I6AA 1LFHA 5BUUA 3U92A 2Y84A 2I49A 4R9FA 1YAEA 1B0HA 1ZLQA 3FXQA 1HSJA 1BLFA 2A5SA 3C36A 4QFNA 1B32A 3I6VA 1OIBA 1B5JA 1Y1MA 3PUYE 4UA8A 4FEDA 4LP2B 5TPAA 4GD5A 3H6UA 2P0SA 1LGBC 4KHZE 5IAIA 2DXRA 3OOAA 4R74A 5H8SA 4N07A 1JW5A 1II5A 2Z23A 2GHAA 1OLAA 4G2ZA 2QS2A 5AA2B 2F35A 3I3VA 3RTFB 2UVGA 3H7MA 4LZ7A 4POWA 1IUDA 3TUSA 4NE4A 4C1TA 3HCQA 4U21A 2F6GA 3RPWA 1B51A 3KFMA 1JW1A 4Q30B 3CFXA 4EUOA 3K02A 2RCAA 1Z7NE 1R6ZA 3F11A 4F2OA 3C9HA 1DPEA 5CC2A 2ZNUA 3TCFA 2ZYNA 2XXTA 3P7IA 5H8HA 2Y7PA 4R6HA 4F1VA 3EPEA 5CMKA 4PFWA 1R1NA 4PFYA 3EQ1A 2NVUB 4RNSA 3O6IA 3FJMA 1NH7A 3KG2A 1A54A 1UTHA 2F97A 2X26A 3LSFB 3QUFA 4NF4A 4QFKA 4IO3A 3KOSA 3OSQA 1NNKA 4EDPA 1QUKA 1S7YA 4OERA 3KSXA 5I84A 4NTLA 1MH4A 3PMVA 5K2XA 1LFGA 2VP1A 4WXJA 2CZLA 2OZZA 5M2VA 4FATA 5FTHA 1IIWA 3PUXE 3TTLA 4ZZAA 3UGWA 3K6WA 5KCJB 1LAGE 1B4HA 1NMUA 2G29A 2ZYOA 3FZVA 2OLBA 3LSWA 3MUQA 4GIZA 3ECRA 1LCFA 3IJXB 1J1NA 4YAHX 1FQAA 3FGSA 3IOTA 4R73A 4OVJA 4KCDA 1JEVA 1MPDA 5TU0A 4O3CA 4I8CA 3QXMA 4O3BA 5I2KB 3T9VA 1P1NA 3A3UA 1ZBMA 4ZE8A 5B70A 2XX8A 3SEUA 1EZPA 4H8JA 1SW2A 4UACA 2OBGA 2Q88A 4GL0A 3H3GA 2O69A 4ZEIA 2AL4A 2I0BA 3ZKLA 1PC3A 3K6XA 1B1XA 1VE4A 3G3JA 5I2NA 4HCYA 3PUVE 4OZ9A 3R26A 2QMWA 1EH3A 1M5EA 4DXCA 3FD3A 4GQOA 1XOCA 4NWCA 1B2HA 3TCHA 5H8QA 4GOTA 2LAOA 3O28A 5CMMA 4IO2A 1CE2A 1GV8A 3G7WA 4IB2A 1N3WA 2F7AA 3LSLA 4K3FA 5IKBA 3K0VA 3M3KA 3TTNA 3MBPA 1OQHA 2O7UA 2Y7IA 3ODBA 2OK2A 1Y1ZA 3DLNA 3QUJA 3CSBA 4ZS9A 2HQ0A 4Z0IA 4XKRA 3UP9A 1B58A 4KYDA 3S4UA 1XC1A 3UA8A 4AB5A 2Q9TA 3KN8A 3S2VA 1IZ1A 3W9VA 1ZKBA 2OWTA 3FJ7A 1QW0A 1PBQA 4XKNA 4NF6A 1MPCA 3IR1A 3QK6A 4ZEFA 3C35A 2XXHA 5CMCA 3QYTA 1A55A 3TQLA 1Y3PA 4EF2A 2OJTA 4OHNA 3E13X 1ELJA 1Q35A 3PPOA 1QUJA 3IB2A 1NH8A 4GXSB 3E9XA 3W9WA 2UYEA 3I5OA 3C33A 1SQYA 4X1DA 1B05A 1WODA 1ZTYA 4RPOA 5TP9B 3TAJA 4ISUA 4G77A 3U1OA 3OSRA 3ZSFA 1B3HA 4ESWA 3TPAA 4DCYA 2AL5A 3IO4A 3PPNA 1JEUA 1VR5A 3KOTA 3O6GA 1QUIA 3K1PA 3FV1A 3VFJA 2VD2A 3IK6B 3FIRA 2I4CA 4RY1A 5TPAB 2QS4A 2RC8A 3GXAA 3U72A 4EQ9A 1FTKA 3OD7A 2ZMBA 1MY0A 3KZGA 1AIVA 4U2RA 3OO8A 1MPBA 2DS9A 3FXUA 1UTHB 3QIMA 4QFOA 1GVCA 1FQFA 2O7IA 3K4UA 1SW5A 1AMFA 3VLUA 3FVGA 1JW4A 1LAXA 4R2BA 4I1DA 3T66A 2F34A 5I58B 3MPKA 1US4A 4NF5A 5L9MA 4JWYA 5I56B 1URDA 3OO6A 1PBPA
chains in the Genus database with same CATH superfamily
5HBCA 1NNTA 2RCBA 4U4SA 1USYE 2Z8FA 2ANJA 2UXAA 3BBRA 4GFRA 4P1LA 4QRZA 4Z7EA 2DVZA 2PVUA 3CG1A 4YKPA 4QF9A 3C4MA 2XWVA 3RPLA 4G68B 1IEJA 3B6TA 4WEDA 1Y9UA 3TTKA 3CI8A 4FJPA 3R7XA 4F22A 2HAUA 2REJA 4OANA 4KD5A 3IOUA 4O7IA 4KYEA 3PD9A 3TFLA 2DSFA 4LZ8A 4NGUA 4F31B 1FTOA 4JWOA 4DDDA 4ZEKA 5AA4A 4AB6A 1B7HA 3PPQA 1FRPA 2QVUA 3IJOB 3IFCA 4N6KA 2RF1A 4RXLA 3CIJA 2IA4A 5F24A 2CZIA 2NWJA 3CFLA 4M1VA 3VDFA 2Y7KA 1YXIA 4G61A 1GR2A 2V93A 4NF4B 1IMDA 1SW4A 3BKIB 3HHGA 2B3FA 3CSGA 3OEKA 5CRYA 2FVZA 2I58A 4IY6A 5H8HB 4LA9A 4O3AA 2FBPA 3RPLB 4KR5A 1YCJA 3Q25A 2PT1A 4LN5A 1IMEA 1B5HA 1P99A 1MM7A 3MZ1A 1FQBA 2F3BA 1A8FA 2WX9A 5F1QA 2VD3A 1ATGA 4R72A 1FJ9A 4GF8A 3UK4A 1KA1A 2A5TA 1N04A 2ZZWA 4NX1A 1R9LA 5H8FA 1NKXA 4GRKA 1SDXA 4YMBA 1Y3QA 2W7YA 1OVTA 3E4RA 4XTCQ 2E1SA 4I9DA 5B7DA 1P1WA 1NUWA 2UVJA 4KCCA 5DYHA 3JYRA 4F29A 5EQ8A 4OFLA 3CRBA 4GWWA 5I2KA 3H4ZA 4DCXA 4HCWA 4H5FA 2O1MA 2KQZA 3GBBA 3N5LA 1XT8A 2DDKA 2I3WA 3T9HB 3N6UA 3HO7A 1LBWA 1RYOA 4GWSA 1FTLA 3S9LC 2XXQA 5EQ7A 3MVWA 1VSOA 1MQGA 4U23A 1Y4CA 4JB7A 1ANFA 1MDQA 2H5YA 4RPNA 1B9JA 5I59A 3PMXA 2DOJA 4X48A 5F7VA 3PD8A 3LUZA 4HE2A 4BDNA 1LBCA 2HZLA 4YB7A 2QSXA 2D21A 2HEUA 2Z22A 4OWDA 1IQ7A 2Z8EA 3TEPA 2F7CA 4MNIA 3RGYA 2F7BA 1MS7A 5ELVA 2QRYA 3G3FA 3MSTA 4OTEA 1OMPA 1O7TA 2ABHA 3DP8A 4X9TA 5DEXB 4POXA 4Q8RA 3PUZE 4FEBA 4H6DA 3G3IA 1LB9A 1UIVA 5CBRA 4MH5A 3U65A 4RJZA 2GHBA 1NV0A 1JP4A 1KA0A 5DT6A 4XKQA 5LDZA 4ESXA 5I59B 3IOWA 3SDFA 1MXWA 3MAMA 2RC9A 3HHFA 5H8NB 4P8BA 4FECA 1MXYA 2YJPA 4FORA 3USDA 4IO4A 4DXBA 3M8UA 2NUVA 5IZ3A 4ELPA 2DYXA 5AA1A 1MXXA 1H3DA 1US5A 4PBQA 1FTMA 3FJGA 1P1UA 3SZPA 3PV0E 3MW0A 1POY1 2PFYA 1N0TA 4OFJA 4PE3A 4GWZA 5ET6A 4JVIA 4MHFA 3FXRA 2HAVA 3FATA 2OWSA 5CC2A 1S9TA 3T22A 3OXNA 1IXHA 2V3TA 4RA1A 1NV6A 2GQ1A 2QL3A 4NAPA 2ZNTA 4NF8B 2Y7WA 4OETA 3U94A 2DXYA 4E0WA 2PX1A 1LBXA 2HXRA 1SI0A 4X1BA 1I6AA 2WYPA 2Q8JA 1YAEA 1B0HA 1BLFA 2A5SA 3C36A 4QFNA 4UA8A 4FEDA 2DXRA 3OOAA 1JW5A 3RTFB 4POWA 1FPEA 3HCQA 3RPWA 1JW1A 3CFXA 4EUOA 3F11A 3C9HA 2XXTA 3B50A 5H8HA 2Y7PA 4R6HA 5CMKA 5IGAA 2NVUB 4RNSA 3KG2A 1NH7A 3QUFA 1XI6A 1NNKA 4I40A 1QUKA 3KSXA 1MH4A 4FATA 2CZLA 3UGWA 4GIZA 3LSWA 2ZYOA 3ECRA 3IJXB 1FQAA 4OVJA 4O3BA 1P1NA 5B70A 2XX8A 3SEUA 4UACA 2OBGA 4ZEIA 2AL4A 3K6XA 4HE0A 4HCYA 1D9QA 1NV7A 4MCOA 4OZ9A 3R26A 4DXCA 1YZ0A 2JJKA 5H8QA 5CMMA 1CE2A 2F7AA 4K3FA 3MBPA 3QUJA 4PGNA 1Y1ZA 3DLNA 4ZS9A 3CSBA 2HQ0A 1B58A 4KYDA 1FPJA 3KN8A 2OWTA 1QW0A 1MPCA 3IR1A 2WBBA 2XXHA 4HE1A 3TQLA 4OHNA 1QUJA 1NH8A 4GXSB 3E9XA 4JVDA 3I5OA 4X1DA 1B05A 3HFUA 4ISUA 4G77A 4DCYA 3PPNA 4UABA 1VR5A 3K1PA 4PFRA 5ITPA 2I4CA 4RY1A 3GXAA 1FTKA 3OD7A 1FBFA 5DW8A 1FQFA 5A5LA 4N4UA 3VLUA 3FVGA 3T66A 5I58B 2DVCA 4Q30B 3OO6A 5KZTA 4OVPA 2BJIA 3LUYA 4FAJA 3Q28A 4R6KA 4U1OA 4P0IA 3T1BA 3A3CA 3MVXA 1PB9A 2HPGA 4P1EA 3H6TA 3SEXA 3MP6A 4PP0A 3BIGA 4IGRA 4ELOA 2XWOA 5TP9A 2I6EA 4XEQA 1AWBA 4ZEBA 1XVYA 1EU8A 4BDOA 4YICA 1FTAA 1SBPA 1FQCA 3MP1A 3R6UA 1IMCA 4RK9A 5CM6A 4F39A 2PMSA 3ISPA 2GH9A 4F2QA 2CMOA 1A8EA 3KBRA 1DCUA 2O1LA 2KR0A 2DWHA 2V4CA 3B6WA 3UN6A 3H06B 2ZYMA 3U8QA 1CB6A 3KGCA 4R9GA 2FHYA 3FBPA 4DIGA 3DP4A 4JWXA 1LLSA 3O97A 3H6VA 3EN3A 3O9PA 2QS1A 4I3YA 4AQ4A 4F19A 5T3JA 3G3GA 3RNNA 2Q2CA 4GVOA 1IXIA 4EQBA 2R9JA 3LR1A 4BDQA 1RDXA 3IO6A 2QS3A 1I6QA 1NV4A 1PB7A 1EZOA 2O84X 2OWZA 2H9BA 1I6BA 4ONYA 1D9VA 3PPRA 2GFEA 4WKMA 5I57B 3O6HA 5DVJA 5FHOA 3DELB 4H45A 3ZS6A 3EHSA 4KXPA 4N17A 1OVBA 1LFIA 3M3FA 4YKKA 1K9YA 4DI4B 3ZKKA 1MH3A 4MIJA 3SEYA 2V25A 3T93B 4DZ1A 1M5CA 5EHMA 2DWAA 1BIYA 1NUXA 4IO5A 4ELQA 4ECFA 1LBZA 3RUMA 2NXOA 3V89B 4I62A 4LATA 5IZ3B 3RLFE 2I48A 3V83A 4JBZA 1JVYA 1FQEA 4O8MA 4G4PA 3CG3A 1MQDA 1FCKA 5JTYB 3LV0A 3O29A 1M5FA 4RYAA 3KEIA 3DP6A 1NNPA 2ALUA 1AOVA 3KC1A 3OMBA 1FPDA 4H0WA 1N3XA 3SKPA 1WDNA 3V5AA 5A5XB 4QHQA 2VHAA 1RDZA 2XX9A 3ILTB 3IL1B 2PT2A 1DK4A 1JQFA 3NOHA 2AIXA 2HHMA 3S9NC 3TUSA 2DE3A 2ONKE 4Q5TA 1MM6A 2F8DA 4FBPA 2UVHA 4FE8A 3MZ9A 4QFPA 3RT8A 1QVSA 2P2AA 3MC2A 3N26A 4DXUA 4OVQA 1USYH 2HFBA 4MMPA 4G68C 4PBHA 1LB8A 1Y3NA 2DQVA 4THIA 5I3SA 5I58A 2F36A 5CI5A 3TQWA 1H45A 2M8CA 3ILUB 4N13A 2CZKA 1Z7ME 1FBEA 4PDHA 3L6GA 4P0GA 1B0LA 4G8NA 4YKJA 2I4BA 3K1MA 4PQJA 1N84A 4JXIA 2HXWA 1ZMGA 5ISUA 4YB6A 2Q8MA 1TT1A 3O2AA 3MYUA 1NI9A 4GWOA 1MY3A 2ZXTA 4N15A 3KJTA 1LCTA 4MNCA 1SW1A 2XXPA 2V84A 3SETA 1BKAA 3K00A 5JEIA 2HZKA 2Q2AA 3PGFA 3IAZA 3D4CA 4OA4A 2L5VA 4OVRA 1LFHA 4U4XA 3QMFA 5A5XA 5BUUA 4AS5A 2Y84A 4R9FA 3PUYE 5TPAA 4LP2B 1G0HA 1II5A 4JVCA 4U21A 4N91A 4F2OA 1DPEA 2ZNUA 3TCFA 2ZYNA 3BIHA 4F1VA 3EPEA 4PFWA 1QGXA 4NF4A 3RYDA 1NV1A 4OERA 2Q74A 1YYZA 1LFGA 2VP1A 5M2VA 1KZ8A 5FTHA 5KCJB 3K6WA 1B4HA 3FGSA 5I7IA 1JEVA 4O3CA 1ZBMA 4ZE8A 1SW2A 5J16A 2WBDA 1VE4A 3G3JA 5I2NA 2QMWA 1EH3A 1NV5A 3FD3A 2P3NA 3O28A 1GV8A 3G7WA 4PAFA 1N3WA 3LSLA 5IKBA 3M3KA 2OK2A 4XKRA 3IFAA 2WEFA 5FBPA 3S2VA 1IZ1A 3FJ7A 4XKNA 2PFZA 4ZEFA 3C35A 4EF2A 2OJTA 3E13X 1ELJA 3W9WA 3KC0A 1VDWA 1NV3A 2XXKA 3TAJA 3U1OA 2AL5A 3VFJA 5TPAB 4PF6A 2QS4A 2ZMBA 1MY0A 4U2RA 3OO8A 3QIMA 1GVCA 2DS9A 3FXUA 1LAXA 4R2BA 2ZZXA 2F34A 1US4A 5L9MA 4PAIA 4JWYA 3O66A 2AYSA 4E0XA 4HXVA 4GWXA 1MY1A 1SVXB 5EYGA 4LUBA 2ONSA 1CNQA 3EHUA 3PU5A 3IB1A 1DPPA 1NNFA 1FPGA 2PBWA 1IITA 1M5BA 5ITOA 3N6TA 3SESA 1NV2A 4F3BA 4MEVA 3T9XB 4PDDA 4ZEDA 1A99A 3ROJA 3K01A 4FIMA 1B40A 3A29A 3SEWA 2H25A 1DMBA 1MXVA 1JNFA 5IM2A 1AL3A 2ZYKA 2H98A 2F78A 3B6QA 4XXUA 1H43A 3TMGA 2XXRA 5JTYA 2D3IA 4PCDA 4RK2A 1INPA 4HTGA 4BLAA 1URGA 3QAXA 2G93A 1PEBA 4QSEA 4BDLA 5LTCA 4GWUA 1XHYA 4DE8A 4U1ZA 1N76A 5IZ1A 1MDP1 1DBZA 4LONB 3S9EA 1POTA 1NUZA 2QMXA 2XXWA 2ZNSA 3K6UA 3MQ9A 4MLVA 4GBVA 4LVQA 4TLLB 3M3LA 4TQUQ 3PPPA 4PFBA 4H5GA 2XD3A 2VOZA 2V3UA 4N6DA 1TFAA 2FYIA 3KN7A 2H99A 3TTMA 5DEXA 3H03A 2NOOA 3HV1A 1LBYA 4NF8A 3PUWE 4KPTA 2Y5KA 4NEDA 5AA4B 2X7PA 3Q26A 1FBPA 4EXLA 1GGGA 4XKPA 3DM0A 3G3KA 4P9KA 5EHSA 3FASA 3MVYA 5L9SA 2GRVA 1RKMA 2FA7A 4R75A 5ICQA 3T0JA 3KN3A 3QSLA 5ET7A 4QSCA 4H67A 1YPNA 2THIA 4JSDA 4MBPA 4XIGQ 1A40A 4G8HA 2R6GE 3RT6B 4H65A 1TWYA 3S9MC 1VFDA 3VVEA 3VXBA 1B5IA 1EZ9A 4KI0E 1NFTA 4H1XA 1JETA 5HM4B 3JZJA 2RC7A 3CVGA 4L17A 2ESNA 1B52A 4JSOA 3VVDA 2D5WA 3E79A 2P1SA 1B7ZA 1D3KA 4GXAA 4ELRA 5I2NB 1Q1KA 4GBWA 1BK4A 3A09A 1FPFA 5EYFA 1HSLA 5FTIA 1RYXA 3VLVA 4BDMA 2QPQA 1LBBA 1LBVA 4OENA 3BFTA 3D4GA 4OQOA 5BWJA 3IORA 1R9QA 5DTBA 1T0KA 3LBSA 2YPNA 3VXCA 4P3LA 2Q89A 4EXKA 1LAFE 1B6HA 1PDAA 1UQWA 2O68A 3TTRA 3TCGA 4ZDMA 3B7DA 4OEVA 1SI1A 3KSJA 4H8IA 4PFTA 5DVFA 2DWJA 3C34A 2R71A 4Q0CA 2BJJX 1FPBA 4U22A 1Y4TA 2XXUA 3OENA 1SYHA 1ZJLA 1DTZA 2HCAA 4OESA 3IB0A 4YB5A 2XXXA 3LSXA 1ZU0A 1JVXA 3E3KA 2PCRA 3UORA 4XF5A 3V8XB 2ONRA 4KQPA 3OEMA 4X8RA 4KFQA 1MQIA 4GLIA 4F3PA 1FPIA 4X04A 1EYJA 2V3QA 3KJ7A 3ONMA 1A7LA 5I57A 3FXBA 4PAKA 2WKYA 2RKMA 2DWIA 4NQ8A 3TODA 5EQAA 1D9YA 1FPKA 1MQHA 2XXVA 3OO9A 4C0RA 4P56A 1URSA 3LC8A 1MXZA 1YTVA 1H76A 4F1YA 4QBAA 4HW8A 2I49A 3FXQA 1B32A 2R8TA 1OIBA 4GD5A 2P0SA 4R74A 2GHAA 1OLAA 2QS2A 3H7MA 4LZ7A 1IUDA 2Y5LA 1B51A 1R6ZA 2CEYA 4NHBA 3P7IA 5I5PA 4MX6A 4PFYA 4PTKA 3O6IA 1A54A 1UTHA 2X26A 3LSFB 3KOSA 3OSQA 5I84A 1K9ZA 3PMVA 1IIWA 3PUXE 3TTLA 1LAGE 1L5TA 1NMUA 2G29A 2OLBA 3MUQA 4YAHX 1J1NA 3QXMA 5I2KB 3T9VA 2Q88A 4GL0A 3H3GA 4XFEA 2I0BA 2MKZA 1B1XA 1Q9DA 1M5EA 4NWCA 4IO2A 2XWKA 4IB2A 4GX6A 3TTNA 2Y7IA 4F1UA 4AB5A 1XC1A 3UA8A 2CZHA 4NF6A 4PF8A 5CMCA 1Y3PA 1Q35A 3PPOA 3IB2A 1SQYA 4RPOA 1B3HA 4ESWA 3O6GA 3FV1A 2RC8A 2VT5A 3U72A 1AIVA 1MPBA 1UTHB 4QXDA 3K4UA 1SW5A 1AMFA 1JW4A 1PBPA 3MPKA 3SERA 1D4NA 1SD3A 2IEEA 4QSDA 2YLNA 3FVKA 5L8DA 4F3SA 5L9OA 2A5TB 1IXCA 2UYFA 1H44A 5EYHA 5AA3A 5LOMA 1TFDA 2XXYA 4IO6A 2VGQA 5H8QB 4P11A 2H4IA 3FV2A 4MF3A 4OMBA 2XHDA 1QKBA 4WEPA 5K2YA 1KWHA 1SYIA 2XX7A 2Z8DA 1FW0A 3L6HA 5H8NA 1DTGA 1N7XA 1EYIA 4LQ2A 1URDA 1UTBA 4PGPA 2QVRA 1LEVA 4LQ5A 2OCUA 1WVJA 1GTKA 3TYHA 3B8BA 1PB8A 1S50A 5KDTB 3N94A 3PTYA 1FBDA 1N7WA 2E0SA 4ZECA 1B3EA 3WAEA 2DE2A 3Q27A 1B46A 1MG1A 4O94A 1XVXA 3RQTA 1MY4A 2F3DA 3KBZA 1HSEA 4AS4A 3OELA 1QJMA 3EKIA 4YZZA 4ZZEA 4DLDA 3H6WA 3TELA 2I3VA 1LAHE 5FHMA 2XD2A 2QVVA 1ZIUA 3EF7A 2FIXA 3E78A 1F9BA 5AE4A 5ET5A 3FVNA 3UIFA 4R2FA 2I0CA 1FBHA 3EHTA 3K6VA 4GX4A 5J1DA 4OVTA 1IMBA 2REGA 1UTBB 2F6PA 2Y7RA 3TDJA 2FNCA 2XWIA 4TOZA 3RTWB 3AXFA 4MFIA 2B3BA 4DI3D 5CBSA 3GYYA 4OVSA 1FBCA 4I3EA 2X7QA 4IO7A 5CMBA 3FVOA 3Q29A 1AH5A 1QULA 4BDRA 1SPIA 4NF5B 3VVFA 5AA2D 4YKIA 4GL8A 3CFZA 2O51A 2F5XA 1IXGA 3HPIA 1O64A 4GX3A 4OYVA 3TKDA 3T96B 3BFUA 4PETA 3T9UA 4N6PA 1B1HA 1B7UA 4ZE9A 3SEVA 4MLQA 4H46A 1B3FA 5H8FB 1BTJA 4QFLA 1VFEA 3WAFA 4C1UA 4F3GA 1MQJA 1G0IA 3RN8A 5AA2A 3IOVA 4PFUA 3PMWA 4NWDA 3CHGA 2DE4A 5JK4A 2QJEA 1BP5A 2FIEA 2OX3A 5ESYA 4EQ7A 1MY2A 2VPOA 4R6YA 4F18A 4NN3A 3GZGA 4IY5A 3U93A 1UIUA 3JV9A 3VE1B 2B65A 4G68A 4G8MA 1B3GA 5I56A 1Y20A 3FUZA 1RDYA 1LSTA 1QKAA 4GWYA 2XXIA 4KYSA 3C31A 2ZZVA 1O63A 3VV5A 3OO7A 2KLFA 1OLCA 2B4MA 1IMAA 1P1QA 2RINA 4PE5B 5KCJA 1DOTA 3HSTA 3CR9A 3VLWA 1FQDA 4JDFA 2O6AA 5HPQA 3MZBA 2DP8A 1B4ZA 3GLBA 3MPLA 4OEUA 4IR8A 3K2DA 3RY3A 3W15C 3D1RA 4HS7A 1MRPA 4OXVA 5EQ9A 4NG7A 2UVIA 3TZAA 4P47A 3HN0A 5KDTA 4IGTA 4EF1A 1OQGA 1MXUA 1NL5A 3MJNA 3MVZA 5FHNA 1B3LA 4OFOA 3THIA 1XS5A 3MP8A 4NF6B 1FTJA 3IX1A 4PC9A 4TLMB 2QFLA 5I56B 1I69A 4M4GA 4YMAA 4LZ5A 5ICTA 1NUYA 1DSNA 4ND9A 4MAGA 4NMYA 3K1NA 4N81A 1M5DA 4YU0A 2XA5A 3MWBA 1TXFA 3G3HA 5DVIA 1P1OA 2PYYA 3U92A 1ZLQA 1HSJA 3I6VA 1Y1MA 1B5JA 3H6UA 4NF0A 2P3VA 1LGBC 4KHZE 5IAIA 4N07A 2Z23A 2CEXA 4G2ZA 5AA2B 1FBGA 2F35A 3I3VA 2UVGA 4NE4A 4C1TA 2F6GA 3KFMA 1EYKA 4N8YA 3K02A 2RCAA 1Z7NE 1R1NA 3EQ1A 2VPNA 1FPLA 3FJMA 2F97A 4QFKA 4IO3A 4EDPA 1S7YA 4NTLA 5K2XA 4WXJA 2OZZA 4MNPA 4PFIA 4ZZAA 3FZVA 2WYKA 5H8SA 1LCFA 2B4LA 3IOTA 4R73A 4KCDA 1MPDA 5TU0A 4I8CA 3A3UA 1EZPA 4H8JA 2O69A 3ZKLA 1PC3A 4O7MA 3PUVE 4GQOA 1XOCA 1B2HA 3TCHA 4GOTA 2LAOA 1IMFA 3K0VA 1OQHA 2O7UA 3ODBA 4Z0IA 3UP9A 3S4UA 2Q9TA 3W9VA 1ZKBA 1PBQA 3QK6A 3QYTA 1A55A 5ET8A 2UYEA 3C33A 5TP9B 1WODA 1ZTYA 3ZSFA 3OSRA 3TPAA 1FSAA 3IO4A 1JEUA 3KOTA 1QUIA 1FJ6A 2VD2A 3IK6B 3FIRA 4EQ9A 3KZGA 5IZZA 4QFOA 2O7IA 4MJOA 4N8GA 4I1DA 4NF5A 3C32A 3GBAA
chains in the Genus database with same CATH topology
3O66A 5KZTA 5HBCA 2AYSA 1NNTA 2RCBA 4E0XA 3LUYA 4U4SA 1D4NA 4FAJA 1USYE 1SD3A 2Z8FA 2IEEA 4QSDA 3Q28A 2YLNA 2ANJA 2UXAA 3FVKA 4R6KA 1MY1A 1SVXB 3BBRA 5L8DA 4GFRA 4F3SA 4QRZA 4U1OA 5L9OA 4P0IA 2A5TB 1IXCA 4Z7EA 4LUBA 2ONSA 3A3CA 2UYFA 3EHUA 3PU5A 2DVZA 1H44A 3MVXA 3IB1A 1PB9A 1DPPA 5AA3A 5LOMA 1TFDA 1NNFA 2XXYA 2PBWA 3H6TA 4IO6A 1IITA 2VGQA 5H8QB 1M5BA 3SEXA 2PVUA 4P11A 2H4IA 3FV2A 3CG1A 4YKPA 5ITOA 3N6TA 3SESA 4QF9A 3C4MA 4MF3A 3MP6A 4OMBA 2XHDA 4F3BA 1QKBA 4G68B 4WEPA 1IEJA 3B6TA 4WEDA 1Y9UA 4PP0A 5K2YA 3T9XB 4ZEDA 1KWHA 4IGRA 3TTKA 3CI8A 1SYIA 4ELOA 1A99A 2XX7A 2Z8DA 1L5TA 5TP9A 4FJPA 1FW0A 3R7XA 4F22A 2HAUA 2I6EA 2REJA 3K01A 3L6HA 4FIMA 1B40A 4KD5A 3IOUA 3SEWA 2H25A 4ZEBA 4KYEA 1XVYA 1EU8A 4BDOA 1DMBA 1MXVA 4YICA 5H8NA 1JNFA 1SBPA 3PD9A 1DTGA 1FQCA 3MP1A 3R6UA 1N7XA 2DSFA 4LZ8A 4RK9A 4LQ2A 3TFLA 3C32A 1UTBA 4F31B 1AL3A 4LQ5A 3GBAA 2OCUA 5CM6A 4F39A 1FTOA 1WVJA 2PMSA 2ZYKA 4JWOA 4DDDA 4ZEKA 5AA4A 2H98A 2F78A 3B6QA 4AB6A 1B7HA 1GTKA 2GH9A 3TYHA 4F2QA 3PPQA 1PB8A 1S50A 5KDTB 4XXUA 2CMOA 1H43A 3TMGA 1A8EA 3KBRA 2XXRA 5JTYA 3N94A 2O1LA 2D3IA 4RK2A 1N7WA 2E0SA 3IJOB 2DWHA 1B3EA 4HTGA 4ZECA 3B6WA 3UN6A 3WAEA 4BLAA 3H06B 2RF1A 1URGA 3QAXA 4RXLA 2G93A 2ZYMA 1PEBA 1CB6A 3CIJA 2DE2A 3KGCA 2IA4A 3Q27A 4QSEA 4R9GA 1B46A 1MG1A 4BDLA 1XHYA 4DE8A 4U1ZA 1N76A 1MDP1 4DIGA 4LONB 1XVXA 2NWJA 3RQTA 3CFLA 3S9EA 1POTA 2QMXA 2XXWA 2ZNSA 3DP4A 1MY4A 3K6UA 3MQ9A 4M1VA 4MLVA 3VDFA 2Y7KA 1HSEA 4LVQA 4JWXA 3OELA 1QJMA 4TLLB 3M3LA 1LLSA 4YZZA 4TQUQ 1GR2A 3PPPA 4ZZEA 2V93A 3O97A 4DLDA 3H6WA 4H5GA 4NF4B 1SW4A 3H6VA 3BKIB 3EN3A 2B3FA 3HHGA 2XD3A 2VOZA 2V3UA 2I3VA 3CSGA 3TELA 1LAHE 5FHMA 1TFAA 3O9PA 2QS1A 2XD2A 3OEKA 5CRYA 2FYIA 4AQ4A 3KN7A 3G3GA 4F19A 2H99A 3RNNA 3TTMA 5DEXA 2Q2CA 4GVOA 1IXIA 3H03A 2I58A 4EQBA 2NOOA 4IY6A 2R9JA 5H8HB 3LR1A 4LA9A 4O3AA 4BDQA 3HV1A 1ZIUA 4KR5A 1YCJA 3Q25A 4NF8A 2PT1A 3IO6A 3PUWE 3EF7A 2QS3A 1B5HA 1F9BA 5AE4A 1P99A 4KPTA 1MM7A 1I6QA 3MZ1A 1PB7A 3FVNA 1FQBA 4R2FA 3UIFA 1EZOA 2I0CA 4NEDA 2O84X 3EHTA 2H9BA 2X7PA 3K6VA 1A8FA 3Q26A 5F1QA 3U8QA 2VD3A 4EXLA 5J1DA 1GGGA 1ATGA 4R72A 3DM0A 4XKPA 1I6BA 2REGA 3G3KA 1UTBB 2F6PA 4GF8A 4ONYA 5EHSA 2Y7RA 1D9VA 2FNCA 4TOZA 3TDJA 3PPRA 3UK4A 2GFEA 3RTWB 4WKMA 5I57B 3AXFA 4MFIA 2B3BA 2A5TA 3FASA 3MVYA 3O6HA 1N04A 3DELB 5DVJA 5FHOA 2Q8JA 5CBSA 3ZS6A 3EHSA 2X7QA 5L9SA 1R9LA 2GRVA 4IO7A 5CMBA 1RKMA 5H8FA 3FVOA 3Q29A 2FA7A 4R75A 5ICQA 1NKXA 4GRKA 1SDXA 1OVBA 1AH5A 1LFIA 1QULA 1Y3QA 2W7YA 3KN3A 3M3FA 3QSLA 1OVTA 4YKKA 4BDRA 4QSCA 3E4RA 4XTCQ 3ZKKA 2E1SA 4H67A 4I9DA 5B7DA 1YPNA 1P1WA 4NF5B 3VVFA 1MH3A 2THIA 3SERA 2UVJA 4YKIA 5AA2D 4KCCA 4GL8A 4JSDA 3JYRA 5DYHA 3SEYA 2V25A 4MBPA 3T93B 4F29A 5ITPA 4DZ1A 4XIGQ 4OFLA 1M5CA 3CFZA 3CRBA 5EHMA 5I2KA 2O51A 2DWAA 2F5XA 1IXGA 3H4ZA 1BIYA 1O64A 3HPIA 4HCWA 4IO5A 4H5FA 4OYVA 3TKDA 4DCXA 2O1MA 1A40A 3BFUA 3T96B 4ELQA 4G8HA 2R6GE 3GBBA 3N5LA 1XT8A 2I3WA 3RT6B 3T9HB 4ECFA 3N6UA 1TWYA 4H65A 4PETA 3T9UA 3S9MC 1VFDA 3HO7A 4N6PA 1B1HA 3VVEA 3VXBA 1B5IA 1B7UA 3RUMA 1EZ9A 4ZE9A 2NXOA 3SEVA 5KDTA 1RYOA 3V89B 4MLQA 4KI0E 4I62A 4LATA 1NFTA 4H1XA 1B3FA 3RLFE 2DVCA 1FTLA 5H8FB 1JETA 5AA4B 2I48A 3V83A 4JBZA 5HM4B 5AA2A 1JVYA 2XXQA 1BTJA 3JZJA 4QFLA 3S9LC 1FQEA 3MVWA 1VSOA 2RC7A 3CVGA 1VFEA 3WAFA 4G4PA 3CG3A 4L17A 2ESNA 1MQDA 1MQGA 1FCKA 1B52A 4JSOA 5JTYB 3VVDA 4C1UA 2D5WA 3O29A 1M5FA 4RYAA 4F3GA 4U23A 1MQJA 1Y4CA 4JB7A 3RN8A 1ANFA 2P1SA 1NNPA 1B7ZA 1MDQA 2H5YA 1D3KA 3DP6A 3IOVA 3KEIA 4RPNA 2ALUA 4PFUA 1B9JA 3PMWA 4GXAA 1AOVA 4ELRA 4NWDA 5I59A 3PMXA 5I2NB 3OMBA 1Q1KA 2DE4A 5JK4A 2QJEA 2DOJA 4H0WA 1N3XA 3SKPA 1BP5A 4X48A 3A09A 1WDNA 3V5AA 5F7VA 3PD8A 5EYFA 5A5XB 1HSLA 5FTIA 1RYXA 4QHQA 3VLVA 4BDMA 1MY2A 4EQ7A 4BDNA 2VHAA 2XX9A 3ILTB 3IL1B 1LBCA 2HZLA 2QPQA 4R6YA 4F18A 4YB7A 1LBBA 2QSXA 2D21A 2HEUA 2PT2A 2Z22A 3GZGA 4OWDA 1IQ7A 4IY5A 4OENA 2Z8EA 1JQFA 3U93A 3TEPA 2F7CA 1UIUA 3BFTA 3D4GA 3JV9A 4OQOA 2AIXA 3IORA 3VE1B 5BWJA 3S9NC 1R9QA 2B65A 4G68A 2DE3A 4G8MA 2ONKE 5DTBA 3RGYA 2F7BA 1MS7A 5ELVA 1T0KA 1B3GA 2QRYA 2YPNA 3LBSA 4Q5TA 1MM6A 3VXCA 2F8DA 3G3FA 5I56A 2Q89A 1Y20A 4EXKA 3FUZA 2UVHA 1LAFE 3MZ9A 4FE8A 1B6HA 1LSTA 1QKAA 4OTEA 4QFPA 2XXIA 3RT8A 1OMPA 1O7TA 1PDAA 1UQWA 4KYSA 2ABHA 1QVSA 2O68A 3DP8A 3TTRA 4X9TA 5DEXB 3TCGA 2P2AA 3C31A 4POXA 4Q8RA 1O63A 3PUZE 4ZDMA 3VV5A 3B7DA 3OO7A 4OEVA 1SI1A 3KSJA 4FEBA 4H6DA 3G3IA 1LB9A 3MC2A 3N26A 4H8IA 2DWJA 4PFTA 5DVFA 4DXUA 1USYH 3C34A 2R71A 4Q0CA 1UIVA 2BJJX 4U22A 5CBRA 4MH5A 2HFBA 1Y4TA 2XXUA 3OENA 4RJZA 1SYHA 1ZJLA 2GHBA 1DTZA 4G68C 2KLFA 1OLCA 2HCAA 5DT6A 1LB8A 1Y3NA 2DQVA 4THIA 4OESA 1P1QA 2RINA 4PE5B 4XKQA 3IB0A 4YB5A 2XXXA 5I58A 5KCJA 3LSXA 4ESXA 2F36A 1DOTA 5CI5A 1ZU0A 3HSTA 4YMBA 3CR9A 3TQWA 5I59B 1H45A 3IOWA 3VLWA 3SDFA 1MXWA 1FQDA 2M8CA 1JVXA 3E3KA 2O6AA 4JDFA 3MAMA 5HPQA 3MZBA 2RC9A 2DP8A 1B4ZA 3GLBA 3HHFA 3MPLA 4OEUA 3ILUB 5H8NB 3UORA 3K2DA 3RY3A 3W15C 4N13A 4FECA 1MXYA 2YJPA 4HS7A 4FORA 1MRPA 4OXVA 3USDA 3V8XB 2UVIA 3TZAA 1Z7ME 2ONRA 4KQPA 4IO4A 4DXBA 3M8UA 3OEMA 2NUVA 3L6GA 4KFQA 3HN0A 1MQIA 1B0LA 4P0GA 4G8NA 4YKJA 4ELPA 2I4BA 2DYXA 3K1MA 4GLIA 4IGTA 5AA1A 4PQJA 4F3PA 4EF1A 1N84A 1OQGA 1MXUA 1MXXA 1NL5A 3MJNA 1H3DA 4JXIA 1US5A 3MVZA 5FHNA 2HXWA 2V3QA 1FTMA 3FJGA 1A7LA 1ZMGA 3KJ7A 3ONMA 1P1UA 1B3LA 5I57A 5ISUA 3PV0E 4YB6A 4OFOA 3THIA 1XS5A 3MP8A 4NF6B 3MW0A 1FTJA 1POY1 1TT1A 1N0TA 3IX1A 3O2AA 4OFJA 2WKYA 2RKMA 4TLMB 2DWIA 3TODA 4GWOA 1D9YA 1MY3A 1MQHA 2XXVA 2HAVA 3FATA 2OWSA 3FXRA 1I69A 3OO9A 4C0RA 1S9TA 2ZXTA 4M4GA 3T22A 4YMAA 3KJTA 4LZ5A 5ICTA 1LCTA 3OXNA 1DSNA 1URSA 1IXHA 2V3TA 1SW1A 2XXPA 4ND9A 3LC8A 4NMYA 2V84A 4RA1A 3SETA 1BKAA 1MXZA 2QL3A 3K00A 3K1NA 4NF8B 2ZNTA 1M5DA 2Y7WA 5JEIA 4OETA 4YU0A 2HZKA 2Q2AA 3PGFA 3IAZA 3U94A 2DXYA 1YTVA 4E0WA 3MWBA 2PX1A 1H76A 1TXFA 4F1YA 3D4CA 3G3HA 1SI0A 4X1BA 4F1UA 5DVIA 1P1OA 4U4XA 4HW8A 2PYYA 5A5XA 1I6AA 1LFHA 5BUUA 3U92A 2Y84A 2I49A 4R9FA 1YAEA 1B0HA 1ZLQA 3FXQA 1HSJA 1BLFA 2A5SA 3C36A 4QFNA 1B32A 3I6VA 1OIBA 1B5JA 1Y1MA 3PUYE 4UA8A 4FEDA 4LP2B 5TPAA 4GD5A 3H6UA 2P0SA 1LGBC 4KHZE 5IAIA 2DXRA 3OOAA 4R74A 5H8SA 4N07A 1JW5A 1II5A 2Z23A 2GHAA 1OLAA 4G2ZA 2QS2A 5AA2B 2F35A 3I3VA 3RTFB 2UVGA 3H7MA 4LZ7A 4POWA 1IUDA 3TUSA 4NE4A 4C1TA 3HCQA 4U21A 2F6GA 3RPWA 1B51A 3KFMA 1JW1A 4Q30B 3CFXA 4EUOA 3K02A 2RCAA 1Z7NE 1R6ZA 3F11A 4F2OA 3C9HA 1DPEA 5CC2A 2ZNUA 3TCFA 2ZYNA 2XXTA 3P7IA 5H8HA 2Y7PA 4R6HA 4F1VA 3EPEA 5CMKA 4PFWA 1R1NA 4PFYA 3EQ1A 2NVUB 4RNSA 3O6IA 3FJMA 1NH7A 3KG2A 1A54A 1UTHA 2F97A 2X26A 3LSFB 3QUFA 4NF4A 4QFKA 4IO3A 3KOSA 3OSQA 1NNKA 4EDPA 1QUKA 1S7YA 4OERA 3KSXA 5I84A 4NTLA 1MH4A 3PMVA 5K2XA 1LFGA 2VP1A 4WXJA 2CZLA 2OZZA 5M2VA 4FATA 5FTHA 1IIWA 3PUXE 3TTLA 4ZZAA 3UGWA 3K6WA 5KCJB 1LAGE 1B4HA 1NMUA 2G29A 2ZYOA 3FZVA 2OLBA 3LSWA 3MUQA 4GIZA 3ECRA 1LCFA 3IJXB 1J1NA 4YAHX 1FQAA 3FGSA 3IOTA 4R73A 4OVJA 4KCDA 1JEVA 1MPDA 5TU0A 4O3CA 4I8CA 3QXMA 4O3BA 5I2KB 3T9VA 1P1NA 3A3UA 1ZBMA 4ZE8A 5B70A 2XX8A 3SEUA 1EZPA 4H8JA 1SW2A 4UACA 2OBGA 2Q88A 4GL0A 3H3GA 2O69A 4ZEIA 2AL4A 2I0BA 3ZKLA 1PC3A 3K6XA 1B1XA 1VE4A 3G3JA 5I2NA 4HCYA 3PUVE 4OZ9A 3R26A 2QMWA 1EH3A 1M5EA 4DXCA 3FD3A 4GQOA 1XOCA 4NWCA 1B2HA 3TCHA 5H8QA 4GOTA 2LAOA 3O28A 5CMMA 4IO2A 1CE2A 1GV8A 3G7WA 4IB2A 1N3WA 2F7AA 3LSLA 4K3FA 5IKBA 3K0VA 3M3KA 3TTNA 3MBPA 1OQHA 2O7UA 2Y7IA 3ODBA 2OK2A 1Y1ZA 3DLNA 3QUJA 3CSBA 4ZS9A 2HQ0A 4Z0IA 4XKRA 3UP9A 1B58A 4KYDA 3S4UA 1XC1A 3UA8A 4AB5A 2Q9TA 3KN8A 3S2VA 1IZ1A 3W9VA 1ZKBA 2OWTA 3FJ7A 1QW0A 1PBQA 4XKNA 4NF6A 1MPCA 3IR1A 3QK6A 4ZEFA 3C35A 2XXHA 5CMCA 3QYTA 1A55A 3TQLA 1Y3PA 4EF2A 2OJTA 4OHNA 3E13X 1ELJA 1Q35A 3PPOA 1QUJA 3IB2A 1NH8A 4GXSB 3E9XA 3W9WA 2UYEA 3I5OA 3C33A 1SQYA 4X1DA 1B05A 1WODA 1ZTYA 4RPOA 5TP9B 3TAJA 4ISUA 4G77A 3U1OA 3OSRA 3ZSFA 1B3HA 4ESWA 3TPAA 4DCYA 2AL5A 3IO4A 3PPNA 1JEUA 1VR5A 3KOTA 3O6GA 1QUIA 3K1PA 3FV1A 3VFJA 2VD2A 3IK6B 3FIRA 2I4CA 4RY1A 5TPAB 2QS4A 2RC8A 3GXAA 3U72A 4EQ9A 1FTKA 3OD7A 2ZMBA 1MY0A 3KZGA 1AIVA 4U2RA 3OO8A 1MPBA 2DS9A 3FXUA 1UTHB 3QIMA 4QFOA 1GVCA 1FQFA 2O7IA 3K4UA 1SW5A 1AMFA 3VLUA 3FVGA 1JW4A 1LAXA 4R2BA 4I1DA 3T66A 2F34A 5I58B 3MPKA 1US4A 4NF5A 5L9MA 4JWYA 5I56B 1URDA 3OO6A 1PBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O66 A;  5KZT A;  5HBC A;  2AYS A;  1NNT A;  2RCB A;  4E0X A;  3LUY A;  4U4S A;  1D4N A;  4FAJ A;  1USY E;  1SD3 A;  2Z8F A;  2IEE A;  4QSD A;  3Q28 A;  2YLN A;  2ANJ A;  2UXA A;  3FVK A;  4R6K A;  1MY1 A;  1SVX B;  3BBR A;  5L8D A;  4GFR A;  4F3S A;  4QRZ A;  4U1O A;  5L9O A;  4P0I A;  2A5T B;  1IXC A;  4Z7E A;  4LUB A;  2ONS A;  3A3C A;  2UYF A;  3EHU A;  3PU5 A;  2DVZ A;  1H44 A;  3MVX A;  3IB1 A;  1PB9 A;  1DPP A;  5AA3 A;  5LOM A;  1TFD A;  1NNF A;  2XXY A;  2PBW A;  3H6T A;  4IO6 A;  1IIT A;  2VGQ A;  5H8Q B;  1M5B A;  3SEX A;  2PVU A;  4P11 A;  2H4I A;  3FV2 A;  3CG1 A;  4YKP A;  5ITO A;  3N6T A;  3SES A;  4QF9 A;  3C4M A;  4MF3 A;  3MP6 A;  4OMB A;  2XHD A;  4F3B A;  1QKB A;  4G68 B;  4WEP A;  1IEJ A;  3B6T A;  4WED A;  1Y9U A;  4PP0 A;  5K2Y A;  3T9X B;  4ZED A;  1KWH A;  4IGR A;  3TTK A;  3CI8 A;  1SYI A;  4ELO A;  1A99 A;  2XX7 A;  2Z8D A;  1L5T A;  5TP9 A;  4FJP A;  1FW0 A;  3R7X A;  4F22 A;  2HAU A;  2I6E A;  2REJ A;  3K01 A;  3L6H A;  4FIM A;  1B40 A;  4KD5 A;  3IOU A;  3SEW A;  2H25 A;  4ZEB A;  4KYE A;  1XVY A;  1EU8 A;  4BDO A;  1DMB A;  1MXV A;  4YIC A;  5H8N A;  1JNF A;  1SBP A;  3PD9 A;  1DTG A;  1FQC A;  3MP1 A;  3R6U A;  1N7X A;  2DSF A;  4LZ8 A;  4RK9 A;  4LQ2 A;  3TFL A;  3C32 A;  1UTB A;  4F31 B;  1AL3 A;  4LQ5 A;  3GBA A;  2OCU A;  5CM6 A;  4F39 A;  1FTO A;  1WVJ A;  2PMS A;  2ZYK A;  4JWO A;  4DDD A;  4ZEK A;  5AA4 A;  2H98 A;  2F78 A;  3B6Q A;  4AB6 A;  1B7H A;  1GTK A;  2GH9 A;  3TYH A;  4F2Q A;  3PPQ A;  1PB8 A;  1S50 A;  5KDT B;  4XXU A;  2CMO A;  1H43 A;  3TMG A;  1A8E A;  3KBR A;  2XXR A;  5JTY A;  3N94 A;  2O1L A;  2D3I A;  4RK2 A;  1N7W A;  2E0S A;  3IJO B;  2DWH A;  1B3E A;  4HTG A;  4ZEC A;  3B6W A;  3UN6 A;  3WAE A;  4BLA A;  3H06 B;  2RF1 A;  1URG A;  3QAX A;  4RXL A;  2G93 A;  2ZYM A;  1PEB A;  1CB6 A;  3CIJ A;  2DE2 A;  3KGC A;  2IA4 A;  3Q27 A;  4QSE A;  4R9G A;  1B46 A;  1MG1 A;  4BDL A;  1XHY A;  4DE8 A;  4U1Z A;  1N76 A;  1MDP 1;  4DIG A;  4LON B;  1XVX A;  2NWJ A;  3RQT A;  3CFL A;  3S9E A;  1POT A;  2QMX A;  2XXW A;  2ZNS A;  3DP4 A;  1MY4 A;  3K6U A;  3MQ9 A;  4M1V A;  4MLV A;  3VDF A;  2Y7K A;  1HSE A;  4LVQ A;  4JWX A;  3OEL A;  1QJM A;  4TLL B;  3M3L A;  1LLS A;  4YZZ A;  4TQU Q;  1GR2 A;  3PPP A;  4ZZE A;  2V93 A;  3O97 A;  4DLD A;  3H6W A;  4H5G A;  4NF4 B;  1SW4 A;  3H6V A;  3BKI B;  3EN3 A;  2B3F A;  3HHG A;  2XD3 A;  2VOZ A;  2V3U A;  2I3V A;  3CSG A;  3TEL A;  1LAH E;  5FHM A;  1TFA A;  3O9P A;  2QS1 A;  2XD2 A;  3OEK A;  5CRY A;  2FYI A;  4AQ4 A;  3KN7 A;  3G3G A;  4F19 A;  2H99 A;  3RNN A;  3TTM A;  5DEX A;  2Q2C A;  4GVO A;  1IXI A;  3H03 A;  2I58 A;  4EQB A;  2NOO A;  4IY6 A;  2R9J A;  5H8H B;  3LR1 A;  4LA9 A;  4O3A A;  4BDQ A;  3HV1 A;  1ZIU A;  4KR5 A;  1YCJ A;  3Q25 A;  4NF8 A;  2PT1 A;  3IO6 A;  3PUW E;  3EF7 A;  2QS3 A;  1B5H A;  1F9B A;  5AE4 A;  1P99 A;  4KPT A;  1MM7 A;  1I6Q A;  3MZ1 A;  1PB7 A;  3FVN A;  1FQB A;  4R2F A;  3UIF A;  1EZO A;  2I0C A;  4NED A;  2O84 X;  3EHT A;  2H9B A;  2X7P A;  3K6V A;  1A8F A;  3Q26 A;  5F1Q A;  3U8Q A;  2VD3 A;  4EXL A;  5J1D A;  1GGG A;  1ATG A;  4R72 A;  3DM0 A;  4XKP A;  1I6B A;  2REG A;  3G3K A;  1UTB B;  2F6P A;  4GF8 A;  4ONY A;  5EHS A;  2Y7R A;  1D9V A;  2FNC A;  4TOZ A;  3TDJ A;  3PPR A;  3UK4 A;  2GFE A;  3RTW B;  4WKM A;  5I57 B;  3AXF A;  4MFI A;  2B3B A;  2A5T A;  3FAS A;  3MVY A;  3O6H A;  1N04 A;  3DEL B;  5DVJ A;  5FHO A;  2Q8J A;  5CBS A;  3ZS6 A;  3EHS A;  2X7Q A;  5L9S A;  1R9L A;  2GRV A;  4IO7 A;  5CMB A;  1RKM A;  5H8F A;  3FVO A;  3Q29 A;  2FA7 A;  4R75 A;  5ICQ A;  1NKX A;  4GRK A;  1SDX A;  1OVB A;  1AH5 A;  1LFI A;  1QUL A;  1Y3Q A;  2W7Y A;  3KN3 A;  3M3F A;  3QSL A;  1OVT A;  4YKK A;  4BDR A;  4QSC A;  3E4R A;  4XTC Q;  3ZKK A;  2E1S A;  4H67 A;  4I9D A;  5B7D A;  1YPN A;  1P1W A;  4NF5 B;  3VVF A;  1MH3 A;  2THI A;  3SER A;  2UVJ A;  4YKI A;  5AA2 D;  4KCC A;  4GL8 A;  4JSD A;  3JYR A;  5DYH A;  3SEY A;  2V25 A;  4MBP A;  3T93 B;  4F29 A;  5ITP A;  4DZ1 A;  4XIG Q;  4OFL A;  1M5C A;  3CFZ A;  3CRB A;  5EHM A;  5I2K A;  2O51 A;  2DWA A;  2F5X A;  1IXG A;  3H4Z A;  1BIY A;  1O64 A;  3HPI A;  4HCW A;  4IO5 A;  4H5F A;  4OYV A;  3TKD A;  4DCX A;  2O1M A;  1A40 A;  3BFU A;  3T96 B;  4ELQ A;  4G8H A;  2R6G E;  3GBB A;  3N5L A;  1XT8 A;  2I3W A;  3RT6 B;  3T9H B;  4ECF A;  3N6U A;  1TWY A;  4H65 A;  4PET A;  3T9U A;  3S9M C;  1VFD A;  3HO7 A;  4N6P A;  1B1H A;  3VVE A;  3VXB A;  1B5I A;  1B7U A;  3RUM A;  1EZ9 A;  4ZE9 A;  2NXO A;  3SEV A;  5KDT A;  1RYO A;  3V89 B;  4MLQ A;  4KI0 E;  4I62 A;  4LAT A;  1NFT A;  4H1X A;  1B3F A;  3RLF E;  2DVC A;  1FTL A;  5H8F B;  1JET A;  5AA4 B;  2I48 A;  3V83 A;  4JBZ A;  5HM4 B;  5AA2 A;  1JVY A;  2XXQ A;  1BTJ A;  3JZJ A;  4QFL A;  3S9L C;  1FQE A;  3MVW A;  1VSO A;  2RC7 A;  3CVG A;  1VFE A;  3WAF A;  4G4P A;  3CG3 A;  4L17 A;  2ESN A;  1MQD A;  1MQG A;  1FCK A;  1B52 A;  4JSO A;  5JTY B;  3VVD A;  4C1U A;  2D5W A;  3O29 A;  1M5F A;  4RYA A;  4F3G A;  4U23 A;  1MQJ A;  1Y4C A;  4JB7 A;  3RN8 A;  1ANF A;  2P1S A;  1NNP A;  1B7Z A;  1MDQ A;  2H5Y A;  1D3K A;  3DP6 A;  3IOV A;  3KEI A;  4RPN A;  2ALU A;  4PFU A;  1B9J A;  3PMW A;  4GXA A;  1AOV A;  4ELR A;  4NWD A;  5I59 A;  3PMX A;  5I2N B;  3OMB A;  1Q1K A;  2DE4 A;  5JK4 A;  2QJE A;  2DOJ A;  4H0W A;  1N3X A;  3SKP A;  1BP5 A;  4X48 A;  3A09 A;  1WDN A;  3V5A A;  5F7V A;  3PD8 A;  5EYF A;  5A5X B;  1HSL A;  5FTI A;  1RYX A;  4QHQ A;  3VLV A;  4BDM A;  1MY2 A;  4EQ7 A;  4BDN A;  2VHA A;  2XX9 A;  3ILT B;  3IL1 B;  1LBC A;  2HZL A;  2QPQ A;  4R6Y A;  4F18 A;  4YB7 A;  1LBB A;  2QSX A;  2D21 A;  2HEU A;  2PT2 A;  2Z22 A;  3GZG A;  4OWD A;  1IQ7 A;  4IY5 A;  4OEN A;  2Z8E A;  1JQF A;  3U93 A;  3TEP A;  2F7C A;  1UIU A;  3BFT A;  3D4G A;  3JV9 A;  4OQO A;  2AIX A;  3IOR A;  3VE1 B;  5BWJ A;  3S9N C;  1R9Q A;  2B65 A;  4G68 A;  2DE3 A;  4G8M A;  2ONK E;  5DTB A;  3RGY A;  2F7B A;  1MS7 A;  5ELV A;  1T0K A;  1B3G A;  2QRY A;  2YPN A;  3LBS A;  4Q5T A;  1MM6 A;  3VXC A;  2F8D A;  3G3F A;  5I56 A;  2Q89 A;  1Y20 A;  4EXK A;  3FUZ A;  2UVH A;  1LAF E;  3MZ9 A;  4FE8 A;  1B6H A;  1LST A;  1QKA A;  4OTE A;  4QFP A;  2XXI A;  3RT8 A;  1OMP A;  1O7T A;  1PDA A;  1UQW A;  4KYS A;  2ABH A;  1QVS A;  2O68 A;  3DP8 A;  3TTR A;  4X9T A;  5DEX B;  3TCG A;  2P2A A;  3C31 A;  4POX A;  4Q8R A;  1O63 A;  3PUZ E;  4ZDM A;  3VV5 A;  3B7D A;  3OO7 A;  4OEV A;  1SI1 A;  3KSJ A;  4FEB A;  4H6D A;  3G3I A;  1LB9 A;  3MC2 A;  3N26 A;  4H8I A;  2DWJ A;  4PFT A;  5DVF A;  4DXU A;  1USY H;  3C34 A;  2R71 A;  4Q0C A;  1UIV A;  2BJJ X;  4U22 A;  5CBR A;  4MH5 A;  2HFB A;  1Y4T A;  2XXU A;  3OEN A;  4RJZ A;  1SYH A;  1ZJL A;  2GHB A;  1DTZ A;  4G68 C;  2KLF A;  1OLC A;  2HCA A;  5DT6 A;  1LB8 A;  1Y3N A;  2DQV A;  4THI A;  4OES A;  1P1Q A;  2RIN A;  4PE5 B;  4XKQ A;  3IB0 A;  4YB5 A;  2XXX A;  5I58 A;  5KCJ A;  3LSX A;  4ESX A;  2F36 A;  1DOT A;  5CI5 A;  1ZU0 A;  3HST A;  4YMB A;  3CR9 A;  3TQW A;  5I59 B;  1H45 A;  3IOW A;  3VLW A;  3SDF A;  1MXW A;  1FQD A;  2M8C A;  1JVX A;  3E3K A;  2O6A A;  4JDF A;  3MAM A;  5HPQ A;  3MZB A;  2RC9 A;  2DP8 A;  1B4Z A;  3GLB A;  3HHF A;  3MPL A;  4OEU A;  3ILU B;  5H8N B;  3UOR A;  3K2D A;  3RY3 A;  3W15 C;  4N13 A;  4FEC A;  1MXY A;  2YJP A;  4HS7 A;  4FOR A;  1MRP A;  4OXV A;  3USD A;  3V8X B;  2UVI A;  3TZA A;  1Z7M E;  2ONR A;  4KQP A;  4IO4 A;  4DXB A;  3M8U A;  3OEM A;  2NUV A;  3L6G A;  4KFQ A;  3HN0 A;  1MQI A;  1B0L A;  4P0G A;  4G8N A;  4YKJ A;  4ELP A;  2I4B A;  2DYX A;  3K1M A;  4GLI A;  4IGT A;  5AA1 A;  4PQJ A;  4F3P A;  4EF1 A;  1N84 A;  1OQG A;  1MXU A;  1MXX A;  1NL5 A;  3MJN A;  1H3D A;  4JXI A;  1US5 A;  3MVZ A;  5FHN A;  2HXW A;  2V3Q A;  1FTM A;  3FJG A;  1A7L A;  1ZMG A;  3KJ7 A;  3ONM A;  1P1U A;  1B3L A;  5I57 A;  5ISU A;  3PV0 E;  4YB6 A;  4OFO A;  3THI A;  1XS5 A;  3MP8 A;  4NF6 B;  3MW0 A;  1FTJ A;  1POY 1;  1TT1 A;  1N0T A;  3IX1 A;  3O2A A;  4OFJ A;  2WKY A;  2RKM A;  4TLM B;  2DWI A;  3TOD A;  4GWO A;  1D9Y A;  1MY3 A;  1MQH A;  2XXV A;  2HAV A;  3FAT A;  2OWS A;  3FXR A;  1I69 A;  3OO9 A;  4C0R A;  1S9T A;  2ZXT A;  4M4G A;  3T22 A;  4YMA A;  3KJT A;  4LZ5 A;  5ICT A;  1LCT A;  3OXN A;  1DSN A;  1URS A;  1IXH A;  2V3T A;  1SW1 A;  2XXP A;  4ND9 A;  3LC8 A;  4NMY A;  2V84 A;  4RA1 A;  3SET A;  1BKA A;  1MXZ A;  2QL3 A;  3K00 A;  3K1N A;  4NF8 B;  2ZNT A;  1M5D A;  2Y7W A;  5JEI A;  4OET A;  4YU0 A;  2HZK A;  2Q2A A;  3PGF A;  3IAZ A;  3U94 A;  2DXY A;  1YTV A;  4E0W A;  3MWB A;  2PX1 A;  1H76 A;  1TXF A;  4F1Y A;  3D4C A;  3G3H A;  1SI0 A;  4X1B A;  4F1U A;  5DVI A;  1P1O A;  4U4X A;  4HW8 A;  2PYY A;  5A5X A;  1I6A A;  1LFH A;  5BUU A;  3U92 A;  2Y84 A;  2I49 A;  4R9F A;  1YAE A;  1B0H A;  1ZLQ A;  3FXQ A;  1HSJ A;  1BLF A;  2A5S A;  3C36 A;  4QFN A;  1B32 A;  3I6V A;  1OIB A;  1B5J A;  1Y1M A;  3PUY E;  4UA8 A;  4FED A;  4LP2 B;  5TPA A;  4GD5 A;  3H6U A;  2P0S A;  1LGB C;  4KHZ E;  5IAI A;  2DXR A;  3OOA A;  4R74 A;  5H8S A;  4N07 A;  1JW5 A;  1II5 A;  2Z23 A;  2GHA A;  1OLA A;  4G2Z A;  2QS2 A;  5AA2 B;  2F35 A;  3I3V A;  3RTF B;  2UVG A;  3H7M A;  4LZ7 A;  4POW A;  1IUD A;  3TUS A;  4NE4 A;  4C1T A;  3HCQ A;  4U21 A;  2F6G A;  3RPW A;  1B51 A;  3KFM A;  1JW1 A;  4Q30 B;  3CFX A;  4EUO A;  3K02 A;  2RCA A;  1Z7N E;  1R6Z A;  3F11 A;  4F2O A;  3C9H A;  1DPE A;  5CC2 A;  2ZNU A;  3TCF A;  2ZYN A;  2XXT A;  3P7I A;  5H8H A;  2Y7P A;  4R6H A;  4F1V A;  3EPE A;  5CMK A;  4PFW A;  1R1N A;  4PFY A;  3EQ1 A;  2NVU B;  4RNS A;  3O6I A;  3FJM A;  1NH7 A;  3KG2 A;  1A54 A;  1UTH A;  2F97 A;  2X26 A;  3LSF B;  3QUF A;  4NF4 A;  4QFK A;  4IO3 A;  3KOS A;  3OSQ A;  1NNK A;  4EDP A;  1QUK A;  1S7Y A;  4OER A;  3KSX A;  5I84 A;  4NTL A;  1MH4 A;  3PMV A;  5K2X A;  1LFG A;  2VP1 A;  4WXJ A;  2CZL A;  2OZZ A;  5M2V A;  4FAT A;  5FTH A;  1IIW A;  3PUX E;  3TTL A;  4ZZA A;  3UGW A;  3K6W A;  5KCJ B;  1LAG E;  1B4H A;  1NMU A;  2G29 A;  2ZYO A;  3FZV A;  2OLB A;  3LSW A;  3MUQ A;  4GIZ A;  3ECR A;  1LCF A;  3IJX B;  1J1N A;  4YAH X;  1FQA A;  3FGS A;  3IOT A;  4R73 A;  4OVJ A;  4KCD A;  1JEV A;  1MPD A;  5TU0 A;  4O3C A;  4I8C A;  3QXM A;  4O3B A;  5I2K B;  3T9V A;  1P1N A;  3A3U A;  1ZBM A;  4ZE8 A;  5B70 A;  2XX8 A;  3SEU A;  1EZP A;  4H8J A;  1SW2 A;  4UAC A;  2OBG A;  2Q88 A;  4GL0 A;  3H3G A;  2O69 A;  4ZEI A;  2AL4 A;  2I0B A;  3ZKL A;  1PC3 A;  3K6X A;  1B1X A;  1VE4 A;  3G3J A;  5I2N A;  4HCY A;  3PUV E;  4OZ9 A;  3R26 A;  2QMW A;  1EH3 A;  1M5E A;  4DXC A;  3FD3 A;  4GQO A;  1XOC A;  4NWC A;  1B2H A;  3TCH A;  5H8Q A;  4GOT A;  2LAO A;  3O28 A;  5CMM A;  4IO2 A;  1CE2 A;  1GV8 A;  3G7W A;  4IB2 A;  1N3W A;  2F7A A;  3LSL A;  4K3F A;  5IKB A;  3K0V A;  3M3K A;  3TTN A;  3MBP A;  1OQH A;  2O7U A;  2Y7I A;  3ODB A;  2OK2 A;  1Y1Z A;  3DLN A;  3QUJ A;  3CSB A;  4ZS9 A;  2HQ0 A;  4Z0I A;  4XKR A;  3UP9 A;  1B58 A;  4KYD A;  3S4U A;  1XC1 A;  3UA8 A;  4AB5 A;  2Q9T A;  3KN8 A;  3S2V A;  1IZ1 A;  3W9V A;  1ZKB A;  2OWT A;  3FJ7 A;  1QW0 A;  1PBQ A;  4XKN A;  4NF6 A;  1MPC A;  3IR1 A;  3QK6 A;  4ZEF A;  3C35 A;  2XXH A;  5CMC A;  3QYT A;  1A55 A;  3TQL A;  1Y3P A;  4EF2 A;  2OJT A;  4OHN A;  3E13 X;  1ELJ A;  1Q35 A;  3PPO A;  1QUJ A;  3IB2 A;  1NH8 A;  4GXS B;  3E9X A;  3W9W A;  2UYE A;  3I5O A;  3C33 A;  1SQY A;  4X1D A;  1B05 A;  1WOD A;  1ZTY A;  4RPO A;  5TP9 B;  3TAJ A;  4ISU A;  4G77 A;  3U1O A;  3OSR A;  3ZSF A;  1B3H A;  4ESW A;  3TPA A;  4DCY A;  2AL5 A;  3IO4 A;  3PPN A;  1JEU A;  1VR5 A;  3KOT A;  3O6G A;  1QUI A;  3K1P A;  3FV1 A;  3VFJ A;  2VD2 A;  3IK6 B;  3FIR A;  2I4C A;  4RY1 A;  5TPA B;  2QS4 A;  2RC8 A;  3GXA A;  3U72 A;  4EQ9 A;  1FTK A;  3OD7 A;  2ZMB A;  1MY0 A;  3KZG A;  1AIV A;  4U2R A;  3OO8 A;  1MPB A;  2DS9 A;  3FXU A;  1UTH B;  3QIM A;  4QFO A;  1GVC A;  1FQF A;  2O7I A;  3K4U A;  1SW5 A;  1AMF A;  3VLU A;  3FVG A;  1JW4 A;  1LAX A;  4R2B A;  4I1D A;  3T66 A;  2F34 A;  5I58 B;  3MPK A;  1US4 A;  4NF5 A;  5L9M A;  4JWY A;  5I56 B;  1URD A;  3OO6 A;  1PBP A; 
#chains in the Genus database with same CATH topology
 5HBC A;  1NNT A;  2RCB A;  4U4S A;  1USY E;  2Z8F A;  2ANJ A;  2UXA A;  3BBR A;  4GFR A;  4P1L A;  4QRZ A;  4Z7E A;  2DVZ A;  2PVU A;  3CG1 A;  4YKP A;  4QF9 A;  3C4M A;  2XWV A;  3RPL A;  4G68 B;  1IEJ A;  3B6T A;  4WED A;  1Y9U A;  3TTK A;  3CI8 A;  4FJP A;  3R7X A;  4F22 A;  2HAU A;  2REJ A;  4OAN A;  4KD5 A;  3IOU A;  4O7I A;  4KYE A;  3PD9 A;  3TFL A;  2DSF A;  4LZ8 A;  4NGU A;  4F31 B;  1FTO A;  4JWO A;  4DDD A;  4ZEK A;  5AA4 A;  4AB6 A;  1B7H A;  3PPQ A;  1FRP A;  2QVU A;  3IJO B;  3IFC A;  4N6K A;  2RF1 A;  4RXL A;  3CIJ A;  2IA4 A;  5F24 A;  2CZI A;  2NWJ A;  3CFL A;  4M1V A;  3VDF A;  2Y7K A;  1YXI A;  4G61 A;  1GR2 A;  2V93 A;  4NF4 B;  1IMD A;  1SW4 A;  3BKI B;  3HHG A;  2B3F A;  3CSG A;  3OEK A;  5CRY A;  2FVZ A;  2I58 A;  4IY6 A;  5H8H B;  4LA9 A;  4O3A A;  2FBP A;  3RPL B;  4KR5 A;  1YCJ A;  3Q25 A;  2PT1 A;  4LN5 A;  1IME A;  1B5H A;  1P99 A;  1MM7 A;  3MZ1 A;  1FQB A;  2F3B A;  1A8F A;  2WX9 A;  5F1Q A;  2VD3 A;  1ATG A;  4R72 A;  1FJ9 A;  4GF8 A;  3UK4 A;  1KA1 A;  2A5T A;  1N04 A;  2ZZW A;  4NX1 A;  1R9L A;  5H8F A;  1NKX A;  4GRK A;  1SDX A;  4YMB A;  1Y3Q A;  2W7Y A;  1OVT A;  3E4R A;  4XTC Q;  2E1S A;  4I9D A;  5B7D A;  1P1W A;  1NUW A;  2UVJ A;  4KCC A;  5DYH A;  3JYR A;  4F29 A;  5EQ8 A;  4OFL A;  3CRB A;  4GWW A;  5I2K A;  3H4Z A;  4DCX A;  4HCW A;  4H5F A;  2O1M A;  2KQZ A;  3GBB A;  3N5L A;  1XT8 A;  2DDK A;  2I3W A;  3T9H B;  3N6U A;  3HO7 A;  1LBW A;  1RYO A;  4GWS A;  1FTL A;  3S9L C;  2XXQ A;  5EQ7 A;  3MVW A;  1VSO A;  1MQG A;  4U23 A;  1Y4C A;  4JB7 A;  1ANF A;  1MDQ A;  2H5Y A;  4RPN A;  1B9J A;  5I59 A;  3PMX A;  2DOJ A;  4X48 A;  5F7V A;  3PD8 A;  3LUZ A;  4HE2 A;  4BDN A;  1LBC A;  2HZL A;  4YB7 A;  2QSX A;  2D21 A;  2HEU A;  2Z22 A;  4OWD A;  1IQ7 A;  2Z8E A;  3TEP A;  2F7C A;  4MNI A;  3RGY A;  2F7B A;  1MS7 A;  5ELV A;  2QRY A;  3G3F A;  3MST A;  4OTE A;  1OMP A;  1O7T A;  2ABH A;  3DP8 A;  4X9T A;  5DEX B;  4POX A;  4Q8R A;  3PUZ E;  4FEB A;  4H6D A;  3G3I A;  1LB9 A;  1UIV A;  5CBR A;  4MH5 A;  3U65 A;  4RJZ A;  2GHB A;  1NV0 A;  1JP4 A;  1KA0 A;  5DT6 A;  4XKQ A;  5LDZ A;  4ESX A;  5I59 B;  3IOW A;  3SDF A;  1MXW A;  3MAM A;  2RC9 A;  3HHF A;  5H8N B;  4P8B A;  4FEC A;  1MXY A;  2YJP A;  4FOR A;  3USD A;  4IO4 A;  4DXB A;  3M8U A;  2NUV A;  5IZ3 A;  4ELP A;  2DYX A;  5AA1 A;  1MXX A;  1H3D A;  1US5 A;  4PBQ A;  1FTM A;  3FJG A;  1P1U A;  3SZP A;  3PV0 E;  3MW0 A;  1POY 1;  2PFY A;  1N0T A;  4OFJ A;  4PE3 A;  4GWZ A;  5ET6 A;  4JVI A;  4MHF A;  3FXR A;  2HAV A;  3FAT A;  2OWS A;  5CC2 A;  1S9T A;  3T22 A;  3OXN A;  1IXH A;  2V3T A;  4RA1 A;  1NV6 A;  2GQ1 A;  2QL3 A;  4NAP A;  2ZNT A;  4NF8 B;  2Y7W A;  4OET A;  3U94 A;  2DXY A;  4E0W A;  2PX1 A;  1LBX A;  2HXR A;  1SI0 A;  4X1B A;  1I6A A;  2WYP A;  2Q8J A;  1YAE A;  1B0H A;  1BLF A;  2A5S A;  3C36 A;  4QFN A;  4UA8 A;  4FED A;  2DXR A;  3OOA A;  1JW5 A;  3RTF B;  4POW A;  1FPE A;  3HCQ A;  3RPW A;  1JW1 A;  3CFX A;  4EUO A;  3F11 A;  3C9H A;  2XXT A;  3B50 A;  5H8H A;  2Y7P A;  4R6H A;  5CMK A;  5IGA A;  2NVU B;  4RNS A;  3KG2 A;  1NH7 A;  3QUF A;  1XI6 A;  1NNK A;  4I40 A;  1QUK A;  3KSX A;  1MH4 A;  4FAT A;  2CZL A;  3UGW A;  4GIZ A;  3LSW A;  2ZYO A;  3ECR A;  3IJX B;  1FQA A;  4OVJ A;  4O3B A;  1P1N A;  5B70 A;  2XX8 A;  3SEU A;  4UAC A;  2OBG A;  4ZEI A;  2AL4 A;  3K6X A;  4HE0 A;  4HCY A;  1D9Q A;  1NV7 A;  4MCO A;  4OZ9 A;  3R26 A;  4DXC A;  1YZ0 A;  2JJK A;  5H8Q A;  5CMM A;  1CE2 A;  2F7A A;  4K3F A;  3MBP A;  3QUJ A;  4PGN A;  1Y1Z A;  3DLN A;  4ZS9 A;  3CSB A;  2HQ0 A;  1B58 A;  4KYD A;  1FPJ A;  3KN8 A;  2OWT A;  1QW0 A;  1MPC A;  3IR1 A;  2WBB A;  2XXH A;  4HE1 A;  3TQL A;  4OHN A;  1QUJ A;  1NH8 A;  4GXS B;  3E9X A;  4JVD A;  3I5O A;  4X1D A;  1B05 A;  3HFU A;  4ISU A;  4G77 A;  4DCY A;  3PPN A;  4UAB A;  1VR5 A;  3K1P A;  4PFR A;  5ITP A;  2I4C A;  4RY1 A;  3GXA A;  1FTK A;  3OD7 A;  1FBF A;  5DW8 A;  1FQF A;  5A5L A;  4N4U A;  3VLU A;  3FVG A;  3T66 A;  5I58 B;  2DVC A;  4Q30 B;  3OO6 A;  5KZT A;  4OVP A;  2BJI A;  3LUY A;  4FAJ A;  3Q28 A;  4R6K A;  4U1O A;  4P0I A;  3T1B A;  3A3C A;  3MVX A;  1PB9 A;  2HPG A;  4P1E A;  3H6T A;  3SEX A;  3MP6 A;  4PP0 A;  3BIG A;  4IGR A;  4ELO A;  2XWO A;  5TP9 A;  2I6E A;  4XEQ A;  1AWB A;  4ZEB A;  1XVY A;  1EU8 A;  4BDO A;  4YIC A;  1FTA A;  1SBP A;  1FQC A;  3MP1 A;  3R6U A;  1IMC A;  4RK9 A;  5CM6 A;  4F39 A;  2PMS A;  3ISP A;  2GH9 A;  4F2Q A;  2CMO A;  1A8E A;  3KBR A;  1DCU A;  2O1L A;  2KR0 A;  2DWH A;  2V4C A;  3B6W A;  3UN6 A;  3H06 B;  2ZYM A;  3U8Q A;  1CB6 A;  3KGC A;  4R9G A;  2FHY A;  3FBP A;  4DIG A;  3DP4 A;  4JWX A;  1LLS A;  3O97 A;  3H6V A;  3EN3 A;  3O9P A;  2QS1 A;  4I3Y A;  4AQ4 A;  4F19 A;  5T3J A;  3G3G A;  3RNN A;  2Q2C A;  4GVO A;  1IXI A;  4EQB A;  2R9J A;  3LR1 A;  4BDQ A;  1RDX A;  3IO6 A;  2QS3 A;  1I6Q A;  1NV4 A;  1PB7 A;  1EZO A;  2O84 X;  2OWZ A;  2H9B A;  1I6B A;  4ONY A;  1D9V A;  3PPR A;  2GFE A;  4WKM A;  5I57 B;  3O6H A;  5DVJ A;  5FHO A;  3DEL B;  4H45 A;  3ZS6 A;  3EHS A;  4KXP A;  4N17 A;  1OVB A;  1LFI A;  3M3F A;  4YKK A;  1K9Y A;  4DI4 B;  3ZKK A;  1MH3 A;  4MIJ A;  3SEY A;  2V25 A;  3T93 B;  4DZ1 A;  1M5C A;  5EHM A;  2DWA A;  1BIY A;  1NUX A;  4IO5 A;  4ELQ A;  4ECF A;  1LBZ A;  3RUM A;  2NXO A;  3V89 B;  4I62 A;  4LAT A;  5IZ3 B;  3RLF E;  2I48 A;  3V83 A;  4JBZ A;  1JVY A;  1FQE A;  4O8M A;  4G4P A;  3CG3 A;  1MQD A;  1FCK A;  5JTY B;  3LV0 A;  3O29 A;  1M5F A;  4RYA A;  3KEI A;  3DP6 A;  1NNP A;  2ALU A;  1AOV A;  3KC1 A;  3OMB A;  1FPD A;  4H0W A;  1N3X A;  3SKP A;  1WDN A;  3V5A A;  5A5X B;  4QHQ A;  2VHA A;  1RDZ A;  2XX9 A;  3ILT B;  3IL1 B;  2PT2 A;  1DK4 A;  1JQF A;  3NOH A;  2AIX A;  2HHM A;  3S9N C;  3TUS A;  2DE3 A;  2ONK E;  4Q5T A;  1MM6 A;  2F8D A;  4FBP A;  2UVH A;  4FE8 A;  3MZ9 A;  4QFP A;  3RT8 A;  1QVS A;  2P2A A;  3MC2 A;  3N26 A;  4DXU A;  4OVQ A;  1USY H;  2HFB A;  4MMP A;  4G68 C;  4PBH A;  1LB8 A;  1Y3N A;  2DQV A;  4THI A;  5I3S A;  5I58 A;  2F36 A;  5CI5 A;  3TQW A;  1H45 A;  2M8C A;  3ILU B;  4N13 A;  2CZK A;  1Z7M E;  1FBE A;  4PDH A;  3L6G A;  4P0G A;  1B0L A;  4G8N A;  4YKJ A;  2I4B A;  3K1M A;  4PQJ A;  1N84 A;  4JXI A;  2HXW A;  1ZMG A;  5ISU A;  4YB6 A;  2Q8M A;  1TT1 A;  3O2A A;  3MYU A;  1NI9 A;  4GWO A;  1MY3 A;  2ZXT A;  4N15 A;  3KJT A;  1LCT A;  4MNC A;  1SW1 A;  2XXP A;  2V84 A;  3SET A;  1BKA A;  3K00 A;  5JEI A;  2HZK A;  2Q2A A;  3PGF A;  3IAZ A;  3D4C A;  4OA4 A;  2L5V A;  4OVR A;  1LFH A;  4U4X A;  3QMF A;  5A5X A;  5BUU A;  4AS5 A;  2Y84 A;  4R9F A;  3PUY E;  5TPA A;  4LP2 B;  1G0H A;  1II5 A;  4JVC A;  4U21 A;  4N91 A;  4F2O A;  1DPE A;  2ZNU A;  3TCF A;  2ZYN A;  3BIH A;  4F1V A;  3EPE A;  4PFW A;  1QGX A;  4NF4 A;  3RYD A;  1NV1 A;  4OER A;  2Q74 A;  1YYZ A;  1LFG A;  2VP1 A;  5M2V A;  1KZ8 A;  5FTH A;  5KCJ B;  3K6W A;  1B4H A;  3FGS A;  5I7I A;  1JEV A;  4O3C A;  1ZBM A;  4ZE8 A;  1SW2 A;  5J16 A;  2WBD A;  1VE4 A;  3G3J A;  5I2N A;  2QMW A;  1EH3 A;  1NV5 A;  3FD3 A;  2P3N A;  3O28 A;  1GV8 A;  3G7W A;  4PAF A;  1N3W A;  3LSL A;  5IKB A;  3M3K A;  2OK2 A;  4XKR A;  3IFA A;  2WEF A;  5FBP A;  3S2V A;  1IZ1 A;  3FJ7 A;  4XKN A;  2PFZ A;  4ZEF A;  3C35 A;  4EF2 A;  2OJT A;  3E13 X;  1ELJ A;  3W9W A;  3KC0 A;  1VDW A;  1NV3 A;  2XXK A;  3TAJ A;  3U1O A;  2AL5 A;  3VFJ A;  5TPA B;  4PF6 A;  2QS4 A;  2ZMB A;  1MY0 A;  4U2R A;  3OO8 A;  3QIM A;  1GVC A;  2DS9 A;  3FXU A;  1LAX A;  4R2B A;  2ZZX A;  2F34 A;  1US4 A;  5L9M A;  4PAI A;  4JWY A;  3O66 A;  2AYS A;  4E0X A;  4HXV A;  4GWX A;  1MY1 A;  1SVX B;  5EYG A;  4LUB A;  2ONS A;  1CNQ A;  3EHU A;  3PU5 A;  3IB1 A;  1DPP A;  1NNF A;  1FPG A;  2PBW A;  1IIT A;  1M5B A;  5ITO A;  3N6T A;  3SES A;  1NV2 A;  4F3B A;  4MEV A;  3T9X B;  4PDD A;  4ZED A;  1A99 A;  3ROJ A;  3K01 A;  4FIM A;  1B40 A;  3A29 A;  3SEW A;  2H25 A;  1DMB A;  1MXV A;  1JNF A;  5IM2 A;  1AL3 A;  2ZYK A;  2H98 A;  2F78 A;  3B6Q A;  4XXU A;  1H43 A;  3TMG A;  2XXR A;  5JTY A;  2D3I A;  4PCD A;  4RK2 A;  1INP A;  4HTG A;  4BLA A;  1URG A;  3QAX A;  2G93 A;  1PEB A;  4QSE A;  4BDL A;  5LTC A;  4GWU A;  1XHY A;  4DE8 A;  4U1Z A;  1N76 A;  5IZ1 A;  1MDP 1;  1DBZ A;  4LON B;  3S9E A;  1POT A;  1NUZ A;  2QMX A;  2XXW A;  2ZNS A;  3K6U A;  3MQ9 A;  4MLV A;  4GBV A;  4LVQ A;  4TLL B;  3M3L A;  4TQU Q;  3PPP A;  4PFB A;  4H5G A;  2XD3 A;  2VOZ A;  2V3U A;  4N6D A;  1TFA A;  2FYI A;  3KN7 A;  2H99 A;  3TTM A;  5DEX A;  3H03 A;  2NOO A;  3HV1 A;  1LBY A;  4NF8 A;  3PUW E;  4KPT A;  2Y5K A;  4NED A;  5AA4 B;  2X7P A;  3Q26 A;  1FBP A;  4EXL A;  1GGG A;  4XKP A;  3DM0 A;  3G3K A;  4P9K A;  5EHS A;  3FAS A;  3MVY A;  5L9S A;  2GRV A;  1RKM A;  2FA7 A;  4R75 A;  5ICQ A;  3T0J A;  3KN3 A;  3QSL A;  5ET7 A;  4QSC A;  4H67 A;  1YPN A;  2THI A;  4JSD A;  4MBP A;  4XIG Q;  1A40 A;  4G8H A;  2R6G E;  3RT6 B;  4H65 A;  1TWY A;  3S9M C;  1VFD A;  3VVE A;  3VXB A;  1B5I A;  1EZ9 A;  4KI0 E;  1NFT A;  4H1X A;  1JET A;  5HM4 B;  3JZJ A;  2RC7 A;  3CVG A;  4L17 A;  2ESN A;  1B52 A;  4JSO A;  3VVD A;  2D5W A;  3E79 A;  2P1S A;  1B7Z A;  1D3K A;  4GXA A;  4ELR A;  5I2N B;  1Q1K A;  4GBW A;  1BK4 A;  3A09 A;  1FPF A;  5EYF A;  1HSL A;  5FTI A;  1RYX A;  3VLV A;  4BDM A;  2QPQ A;  1LBB A;  1LBV A;  4OEN A;  3BFT A;  3D4G A;  4OQO A;  5BWJ A;  3IOR A;  1R9Q A;  5DTB A;  1T0K A;  3LBS A;  2YPN A;  3VXC A;  4P3L A;  2Q89 A;  4EXK A;  1LAF E;  1B6H A;  1PDA A;  1UQW A;  2O68 A;  3TTR A;  3TCG A;  4ZDM A;  3B7D A;  4OEV A;  1SI1 A;  3KSJ A;  4H8I A;  4PFT A;  5DVF A;  2DWJ A;  3C34 A;  2R71 A;  4Q0C A;  2BJJ X;  1FPB A;  4U22 A;  1Y4T A;  2XXU A;  3OEN A;  1SYH A;  1ZJL A;  1DTZ A;  2HCA A;  4OES A;  3IB0 A;  4YB5 A;  2XXX A;  3LSX A;  1ZU0 A;  1JVX A;  3E3K A;  2PCR A;  3UOR A;  4XF5 A;  3V8X B;  2ONR A;  4KQP A;  3OEM A;  4X8R A;  4KFQ A;  1MQI A;  4GLI A;  4F3P A;  1FPI A;  4X04 A;  1EYJ A;  2V3Q A;  3KJ7 A;  3ONM A;  1A7L A;  5I57 A;  3FXB A;  4PAK A;  2WKY A;  2RKM A;  2DWI A;  4NQ8 A;  3TOD A;  5EQA A;  1D9Y A;  1FPK A;  1MQH A;  2XXV A;  3OO9 A;  4C0R A;  4P56 A;  1URS A;  3LC8 A;  1MXZ A;  1YTV A;  1H76 A;  4F1Y A;  4QBA A;  4HW8 A;  2I49 A;  3FXQ A;  1B32 A;  2R8T A;  1OIB A;  4GD5 A;  2P0S A;  4R74 A;  2GHA A;  1OLA A;  2QS2 A;  3H7M A;  4LZ7 A;  1IUD A;  2Y5L A;  1B51 A;  1R6Z A;  2CEY A;  4NHB A;  3P7I A;  5I5P A;  4MX6 A;  4PFY A;  4PTK A;  3O6I A;  1A54 A;  1UTH A;  2X26 A;  3LSF B;  3KOS A;  3OSQ A;  5I84 A;  1K9Z A;  3PMV A;  1IIW A;  3PUX E;  3TTL A;  1LAG E;  1L5T A;  1NMU A;  2G29 A;  2OLB A;  3MUQ A;  4YAH X;  1J1N A;  3QXM A;  5I2K B;  3T9V A;  2Q88 A;  4GL0 A;  3H3G A;  4XFE A;  2I0B A;  2MKZ A;  1B1X A;  1Q9D A;  1M5E A;  4NWC A;  4IO2 A;  2XWK A;  4IB2 A;  4GX6 A;  3TTN A;  2Y7I A;  4F1U A;  4AB5 A;  1XC1 A;  3UA8 A;  2CZH A;  4NF6 A;  4PF8 A;  5CMC A;  1Y3P A;  1Q35 A;  3PPO A;  3IB2 A;  1SQY A;  4RPO A;  1B3H A;  4ESW A;  3O6G A;  3FV1 A;  2RC8 A;  2VT5 A;  3U72 A;  1AIV A;  1MPB A;  1UTH B;  4QXD A;  3K4U A;  1SW5 A;  1AMF A;  1JW4 A;  1PBP A;  3MPK A;  3SER A;  1D4N A;  1SD3 A;  2IEE A;  4QSD A;  2YLN A;  3FVK A;  5L8D A;  4F3S A;  5L9O A;  2A5T B;  1IXC A;  2UYF A;  1H44 A;  5EYH A;  5AA3 A;  5LOM A;  1TFD A;  2XXY A;  4IO6 A;  2VGQ A;  5H8Q B;  4P11 A;  2H4I A;  3FV2 A;  4MF3 A;  4OMB A;  2XHD A;  1QKB A;  4WEP A;  5K2Y A;  1KWH A;  1SYI A;  2XX7 A;  2Z8D A;  1FW0 A;  3L6H A;  5H8N A;  1DTG A;  1N7X A;  1EYI A;  4LQ2 A;  1URD A;  1UTB A;  4PGP A;  2QVR A;  1LEV A;  4LQ5 A;  2OCU A;  1WVJ A;  1GTK A;  3TYH A;  3B8B A;  1PB8 A;  1S50 A;  5KDT B;  3N94 A;  3PTY A;  1FBD A;  1N7W A;  2E0S A;  4ZEC A;  1B3E A;  3WAE A;  2DE2 A;  3Q27 A;  1B46 A;  1MG1 A;  4O94 A;  1XVX A;  3RQT A;  1MY4 A;  2F3D A;  3KBZ A;  1HSE A;  4AS4 A;  3OEL A;  1QJM A;  3EKI A;  4YZZ A;  4ZZE A;  4DLD A;  3H6W A;  3TEL A;  2I3V A;  1LAH E;  5FHM A;  2XD2 A;  2QVV A;  1ZIU A;  3EF7 A;  2FIX A;  3E78 A;  1F9B A;  5AE4 A;  5ET5 A;  3FVN A;  3UIF A;  4R2F A;  2I0C A;  1FBH A;  3EHT A;  3K6V A;  4GX4 A;  5J1D A;  4OVT A;  1IMB A;  2REG A;  1UTB B;  2F6P A;  2Y7R A;  3TDJ A;  2FNC A;  2XWI A;  4TOZ A;  3RTW B;  3AXF A;  4MFI A;  2B3B A;  4DI3 D;  5CBS A;  3GYY A;  4OVS A;  1FBC A;  4I3E A;  2X7Q A;  4IO7 A;  5CMB A;  3FVO A;  3Q29 A;  1AH5 A;  1QUL A;  4BDR A;  1SPI A;  4NF5 B;  3VVF A;  5AA2 D;  4YKI A;  4GL8 A;  3CFZ A;  2O51 A;  2F5X A;  1IXG A;  3HPI A;  1O64 A;  4GX3 A;  4OYV A;  3TKD A;  3T96 B;  3BFU A;  4PET A;  3T9U A;  4N6P A;  1B1H A;  1B7U A;  4ZE9 A;  3SEV A;  4MLQ A;  4H46 A;  1B3F A;  5H8F B;  1BTJ A;  4QFL A;  1VFE A;  3WAF A;  4C1U A;  4F3G A;  1MQJ A;  1G0I A;  3RN8 A;  5AA2 A;  3IOV A;  4PFU A;  3PMW A;  4NWD A;  3CHG A;  2DE4 A;  5JK4 A;  2QJE A;  1BP5 A;  2FIE A;  2OX3 A;  5ESY A;  4EQ7 A;  1MY2 A;  2VPO A;  4R6Y A;  4F18 A;  4NN3 A;  3GZG A;  4IY5 A;  3U93 A;  1UIU A;  3JV9 A;  3VE1 B;  2B65 A;  4G68 A;  4G8M A;  1B3G A;  5I56 A;  1Y20 A;  3FUZ A;  1RDY A;  1LST A;  1QKA A;  4GWY A;  2XXI A;  4KYS A;  3C31 A;  2ZZV A;  1O63 A;  3VV5 A;  3OO7 A;  2KLF A;  1OLC A;  2B4M A;  1IMA A;  1P1Q A;  2RIN A;  4PE5 B;  5KCJ A;  1DOT A;  3HST A;  3CR9 A;  3VLW A;  1FQD A;  4JDF A;  2O6A A;  5HPQ A;  3MZB A;  2DP8 A;  1B4Z A;  3GLB A;  3MPL A;  4OEU A;  4IR8 A;  3K2D A;  3RY3 A;  3W15 C;  3D1R A;  4HS7 A;  1MRP A;  4OXV A;  5EQ9 A;  4NG7 A;  2UVI A;  3TZA A;  4P47 A;  3HN0 A;  5KDT A;  4IGT A;  4EF1 A;  1OQG A;  1MXU A;  1NL5 A;  3MJN A;  3MVZ A;  5FHN A;  1B3L A;  4OFO A;  3THI A;  1XS5 A;  3MP8 A;  4NF6 B;  1FTJ A;  3IX1 A;  4PC9 A;  4TLM B;  2QFL A;  5I56 B;  1I69 A;  4M4G A;  4YMA A;  4LZ5 A;  5ICT A;  1NUY A;  1DSN A;  4ND9 A;  4MAG A;  4NMY A;  3K1N A;  4N81 A;  1M5D A;  4YU0 A;  2XA5 A;  3MWB A;  1TXF A;  3G3H A;  5DVI A;  1P1O A;  2PYY A;  3U92 A;  1ZLQ A;  1HSJ A;  3I6V A;  1Y1M A;  1B5J A;  3H6U A;  4NF0 A;  2P3V A;  1LGB C;  4KHZ E;  5IAI A;  4N07 A;  2Z23 A;  2CEX A;  4G2Z A;  5AA2 B;  1FBG A;  2F35 A;  3I3V A;  2UVG A;  4NE4 A;  4C1T A;  2F6G A;  3KFM A;  1EYK A;  4N8Y A;  3K02 A;  2RCA A;  1Z7N E;  1R1N A;  3EQ1 A;  2VPN A;  1FPL A;  3FJM A;  2F97 A;  4QFK A;  4IO3 A;  4EDP A;  1S7Y A;  4NTL A;  5K2X A;  4WXJ A;  2OZZ A;  4MNP A;  4PFI A;  4ZZA A;  3FZV A;  2WYK A;  5H8S A;  1LCF A;  2B4L A;  3IOT A;  4R73 A;  4KCD A;  1MPD A;  5TU0 A;  4I8C A;  3A3U A;  1EZP A;  4H8J A;  2O69 A;  3ZKL A;  1PC3 A;  4O7M A;  3PUV E;  4GQO A;  1XOC A;  1B2H A;  3TCH A;  4GOT A;  2LAO A;  1IMF A;  3K0V A;  1OQH A;  2O7U A;  3ODB A;  4Z0I A;  3UP9 A;  3S4U A;  2Q9T A;  3W9V A;  1ZKB A;  1PBQ A;  3QK6 A;  3QYT A;  1A55 A;  5ET8 A;  2UYE A;  3C33 A;  5TP9 B;  1WOD A;  1ZTY A;  3ZSF A;  3OSR A;  3TPA A;  1FSA A;  3IO4 A;  1JEU A;  3KOT A;  1QUI A;  1FJ6 A;  2VD2 A;  3IK6 B;  3FIR A;  4EQ9 A;  3KZG A;  5IZZ A;  4QFO A;  2O7I A;  4MJO A;  4N8G A;  4I1D A;  4NF5 A;  3C32 A;  3GBA A; 
#chains in the Genus database with same CATH homology
 3O66 A;  5KZT A;  5HBC A;  2AYS A;  1NNT A;  2RCB A;  4E0X A;  3LUY A;  4U4S A;  1D4N A;  4FAJ A;  1USY E;  1SD3 A;  2Z8F A;  2IEE A;  4QSD A;  3Q28 A;  2YLN A;  2ANJ A;  2UXA A;  3FVK A;  4R6K A;  1MY1 A;  1SVX B;  3BBR A;  5L8D A;  4GFR A;  4F3S A;  4QRZ A;  4U1O A;  5L9O A;  4P0I A;  2A5T B;  1IXC A;  4Z7E A;  4LUB A;  2ONS A;  3A3C A;  2UYF A;  3EHU A;  3PU5 A;  2DVZ A;  1H44 A;  3MVX A;  3IB1 A;  1PB9 A;  1DPP A;  5AA3 A;  5LOM A;  1TFD A;  1NNF A;  2XXY A;  2PBW A;  3H6T A;  4IO6 A;  1IIT A;  2VGQ A;  5H8Q B;  1M5B A;  3SEX A;  2PVU A;  4P11 A;  2H4I A;  3FV2 A;  3CG1 A;  4YKP A;  5ITO A;  3N6T A;  3SES A;  4QF9 A;  3C4M A;  4MF3 A;  3MP6 A;  4OMB A;  2XHD A;  4F3B A;  1QKB A;  4G68 B;  4WEP A;  1IEJ A;  3B6T A;  4WED A;  1Y9U A;  4PP0 A;  5K2Y A;  3T9X B;  4ZED A;  1KWH A;  4IGR A;  3TTK A;  3CI8 A;  1SYI A;  4ELO A;  1A99 A;  2XX7 A;  2Z8D A;  1L5T A;  5TP9 A;  4FJP A;  1FW0 A;  3R7X A;  4F22 A;  2HAU A;  2I6E A;  2REJ A;  3K01 A;  3L6H A;  4FIM A;  1B40 A;  4KD5 A;  3IOU A;  3SEW A;  2H25 A;  4ZEB A;  4KYE A;  1XVY A;  1EU8 A;  4BDO A;  1DMB A;  1MXV A;  4YIC A;  5H8N A;  1JNF A;  1SBP A;  3PD9 A;  1DTG A;  1FQC A;  3MP1 A;  3R6U A;  1N7X A;  2DSF A;  4LZ8 A;  4RK9 A;  4LQ2 A;  3TFL A;  3C32 A;  1UTB A;  4F31 B;  1AL3 A;  4LQ5 A;  3GBA A;  2OCU A;  5CM6 A;  4F39 A;  1FTO A;  1WVJ A;  2PMS A;  2ZYK A;  4JWO A;  4DDD A;  4ZEK A;  5AA4 A;  2H98 A;  2F78 A;  3B6Q A;  4AB6 A;  1B7H A;  1GTK A;  2GH9 A;  3TYH A;  4F2Q A;  3PPQ A;  1PB8 A;  1S50 A;  5KDT B;  4XXU A;  2CMO A;  1H43 A;  3TMG A;  1A8E A;  3KBR A;  2XXR A;  5JTY A;  3N94 A;  2O1L A;  2D3I A;  4RK2 A;  1N7W A;  2E0S A;  3IJO B;  2DWH A;  1B3E A;  4HTG A;  4ZEC A;  3B6W A;  3UN6 A;  3WAE A;  4BLA A;  3H06 B;  2RF1 A;  1URG A;  3QAX A;  4RXL A;  2G93 A;  2ZYM A;  1PEB A;  1CB6 A;  3CIJ A;  2DE2 A;  3KGC A;  2IA4 A;  3Q27 A;  4QSE A;  4R9G A;  1B46 A;  1MG1 A;  4BDL A;  1XHY A;  4DE8 A;  4U1Z A;  1N76 A;  1MDP 1;  4DIG A;  4LON B;  1XVX A;  2NWJ A;  3RQT A;  3CFL A;  3S9E A;  1POT A;  2QMX A;  2XXW A;  2ZNS A;  3DP4 A;  1MY4 A;  3K6U A;  3MQ9 A;  4M1V A;  4MLV A;  3VDF A;  2Y7K A;  1HSE A;  4LVQ A;  4JWX A;  3OEL A;  1QJM A;  4TLL B;  3M3L A;  1LLS A;  4YZZ A;  4TQU Q;  1GR2 A;  3PPP A;  4ZZE A;  2V93 A;  3O97 A;  4DLD A;  3H6W A;  4H5G A;  4NF4 B;  1SW4 A;  3H6V A;  3BKI B;  3EN3 A;  2B3F A;  3HHG A;  2XD3 A;  2VOZ A;  2V3U A;  2I3V A;  3CSG A;  3TEL A;  1LAH E;  5FHM A;  1TFA A;  3O9P A;  2QS1 A;  2XD2 A;  3OEK A;  5CRY A;  2FYI A;  4AQ4 A;  3KN7 A;  3G3G A;  4F19 A;  2H99 A;  3RNN A;  3TTM A;  5DEX A;  2Q2C A;  4GVO A;  1IXI A;  3H03 A;  2I58 A;  4EQB A;  2NOO A;  4IY6 A;  2R9J A;  5H8H B;  3LR1 A;  4LA9 A;  4O3A A;  4BDQ A;  3HV1 A;  1ZIU A;  4KR5 A;  1YCJ A;  3Q25 A;  4NF8 A;  2PT1 A;  3IO6 A;  3PUW E;  3EF7 A;  2QS3 A;  1B5H A;  1F9B A;  5AE4 A;  1P99 A;  4KPT A;  1MM7 A;  1I6Q A;  3MZ1 A;  1PB7 A;  3FVN A;  1FQB A;  4R2F A;  3UIF A;  1EZO A;  2I0C A;  4NED A;  2O84 X;  3EHT A;  2H9B A;  2X7P A;  3K6V A;  1A8F A;  3Q26 A;  5F1Q A;  3U8Q A;  2VD3 A;  4EXL A;  5J1D A;  1GGG A;  1ATG A;  4R72 A;  3DM0 A;  4XKP A;  1I6B A;  2REG A;  3G3K A;  1UTB B;  2F6P A;  4GF8 A;  4ONY A;  5EHS A;  2Y7R A;  1D9V A;  2FNC A;  4TOZ A;  3TDJ A;  3PPR A;  3UK4 A;  2GFE A;  3RTW B;  4WKM A;  5I57 B;  3AXF A;  4MFI A;  2B3B A;  2A5T A;  3FAS A;  3MVY A;  3O6H A;  1N04 A;  3DEL B;  5DVJ A;  5FHO A;  2Q8J A;  5CBS A;  3ZS6 A;  3EHS A;  2X7Q A;  5L9S A;  1R9L A;  2GRV A;  4IO7 A;  5CMB A;  1RKM A;  5H8F A;  3FVO A;  3Q29 A;  2FA7 A;  4R75 A;  5ICQ A;  1NKX A;  4GRK A;  1SDX A;  1OVB A;  1AH5 A;  1LFI A;  1QUL A;  1Y3Q A;  2W7Y A;  3KN3 A;  3M3F A;  3QSL A;  1OVT A;  4YKK A;  4BDR A;  4QSC A;  3E4R A;  4XTC Q;  3ZKK A;  2E1S A;  4H67 A;  4I9D A;  5B7D A;  1YPN A;  1P1W A;  4NF5 B;  3VVF A;  1MH3 A;  2THI A;  3SER A;  2UVJ A;  4YKI A;  5AA2 D;  4KCC A;  4GL8 A;  4JSD A;  3JYR A;  5DYH A;  3SEY A;  2V25 A;  4MBP A;  3T93 B;  4F29 A;  5ITP A;  4DZ1 A;  4XIG Q;  4OFL A;  1M5C A;  3CFZ A;  3CRB A;  5EHM A;  5I2K A;  2O51 A;  2DWA A;  2F5X A;  1IXG A;  3H4Z A;  1BIY A;  1O64 A;  3HPI A;  4HCW A;  4IO5 A;  4H5F A;  4OYV A;  3TKD A;  4DCX A;  2O1M A;  1A40 A;  3BFU A;  3T96 B;  4ELQ A;  4G8H A;  2R6G E;  3GBB A;  3N5L A;  1XT8 A;  2I3W A;  3RT6 B;  3T9H B;  4ECF A;  3N6U A;  1TWY A;  4H65 A;  4PET A;  3T9U A;  3S9M C;  1VFD A;  3HO7 A;  4N6P A;  1B1H A;  3VVE A;  3VXB A;  1B5I A;  1B7U A;  3RUM A;  1EZ9 A;  4ZE9 A;  2NXO A;  3SEV A;  5KDT A;  1RYO A;  3V89 B;  4MLQ A;  4KI0 E;  4I62 A;  4LAT A;  1NFT A;  4H1X A;  1B3F A;  3RLF E;  2DVC A;  1FTL A;  5H8F B;  1JET A;  5AA4 B;  2I48 A;  3V83 A;  4JBZ A;  5HM4 B;  5AA2 A;  1JVY A;  2XXQ A;  1BTJ A;  3JZJ A;  4QFL A;  3S9L C;  1FQE A;  3MVW A;  1VSO A;  2RC7 A;  3CVG A;  1VFE A;  3WAF A;  4G4P A;  3CG3 A;  4L17 A;  2ESN A;  1MQD A;  1MQG A;  1FCK A;  1B52 A;  4JSO A;  5JTY B;  3VVD A;  4C1U A;  2D5W A;  3O29 A;  1M5F A;  4RYA A;  4F3G A;  4U23 A;  1MQJ A;  1Y4C A;  4JB7 A;  3RN8 A;  1ANF A;  2P1S A;  1NNP A;  1B7Z A;  1MDQ A;  2H5Y A;  1D3K A;  3DP6 A;  3IOV A;  3KEI A;  4RPN A;  2ALU A;  4PFU A;  1B9J A;  3PMW A;  4GXA A;  1AOV A;  4ELR A;  4NWD A;  5I59 A;  3PMX A;  5I2N B;  3OMB A;  1Q1K A;  2DE4 A;  5JK4 A;  2QJE A;  2DOJ A;  4H0W A;  1N3X A;  3SKP A;  1BP5 A;  4X48 A;  3A09 A;  1WDN A;  3V5A A;  5F7V A;  3PD8 A;  5EYF A;  5A5X B;  1HSL A;  5FTI A;  1RYX A;  4QHQ A;  3VLV A;  4BDM A;  1MY2 A;  4EQ7 A;  4BDN A;  2VHA A;  2XX9 A;  3ILT B;  3IL1 B;  1LBC A;  2HZL A;  2QPQ A;  4R6Y A;  4F18 A;  4YB7 A;  1LBB A;  2QSX A;  2D21 A;  2HEU A;  2PT2 A;  2Z22 A;  3GZG A;  4OWD A;  1IQ7 A;  4IY5 A;  4OEN A;  2Z8E A;  1JQF A;  3U93 A;  3TEP A;  2F7C A;  1UIU A;  3BFT A;  3D4G A;  3JV9 A;  4OQO A;  2AIX A;  3IOR A;  3VE1 B;  5BWJ A;  3S9N C;  1R9Q A;  2B65 A;  4G68 A;  2DE3 A;  4G8M A;  2ONK E;  5DTB A;  3RGY A;  2F7B A;  1MS7 A;  5ELV A;  1T0K A;  1B3G A;  2QRY A;  2YPN A;  3LBS A;  4Q5T A;  1MM6 A;  3VXC A;  2F8D A;  3G3F A;  5I56 A;  2Q89 A;  1Y20 A;  4EXK A;  3FUZ A;  2UVH A;  1LAF E;  3MZ9 A;  4FE8 A;  1B6H A;  1LST A;  1QKA A;  4OTE A;  4QFP A;  2XXI A;  3RT8 A;  1OMP A;  1O7T A;  1PDA A;  1UQW A;  4KYS A;  2ABH A;  1QVS A;  2O68 A;  3DP8 A;  3TTR A;  4X9T A;  5DEX B;  3TCG A;  2P2A A;  3C31 A;  4POX A;  4Q8R A;  1O63 A;  3PUZ E;  4ZDM A;  3VV5 A;  3B7D A;  3OO7 A;  4OEV A;  1SI1 A;  3KSJ A;  4FEB A;  4H6D A;  3G3I A;  1LB9 A;  3MC2 A;  3N26 A;  4H8I A;  2DWJ A;  4PFT A;  5DVF A;  4DXU A;  1USY H;  3C34 A;  2R71 A;  4Q0C A;  1UIV A;  2BJJ X;  4U22 A;  5CBR A;  4MH5 A;  2HFB A;  1Y4T A;  2XXU A;  3OEN A;  4RJZ A;  1SYH A;  1ZJL A;  2GHB A;  1DTZ A;  4G68 C;  2KLF A;  1OLC A;  2HCA A;  5DT6 A;  1LB8 A;  1Y3N A;  2DQV A;  4THI A;  4OES A;  1P1Q A;  2RIN A;  4PE5 B;  4XKQ A;  3IB0 A;  4YB5 A;  2XXX A;  5I58 A;  5KCJ A;  3LSX A;  4ESX A;  2F36 A;  1DOT A;  5CI5 A;  1ZU0 A;  3HST A;  4YMB A;  3CR9 A;  3TQW A;  5I59 B;  1H45 A;  3IOW A;  3VLW A;  3SDF A;  1MXW A;  1FQD A;  2M8C A;  1JVX A;  3E3K A;  2O6A A;  4JDF A;  3MAM A;  5HPQ A;  3MZB A;  2RC9 A;  2DP8 A;  1B4Z A;  3GLB A;  3HHF A;  3MPL A;  4OEU A;  3ILU B;  5H8N B;  3UOR A;  3K2D A;  3RY3 A;  3W15 C;  4N13 A;  4FEC A;  1MXY A;  2YJP A;  4HS7 A;  4FOR A;  1MRP A;  4OXV A;  3USD A;  3V8X B;  2UVI A;  3TZA A;  1Z7M E;  2ONR A;  4KQP A;  4IO4 A;  4DXB A;  3M8U A;  3OEM A;  2NUV A;  3L6G A;  4KFQ A;  3HN0 A;  1MQI A;  1B0L A;  4P0G A;  4G8N A;  4YKJ A;  4ELP A;  2I4B A;  2DYX A;  3K1M A;  4GLI A;  4IGT A;  5AA1 A;  4PQJ A;  4F3P A;  4EF1 A;  1N84 A;  1OQG A;  1MXU A;  1MXX A;  1NL5 A;  3MJN A;  1H3D A;  4JXI A;  1US5 A;  3MVZ A;  5FHN A;  2HXW A;  2V3Q A;  1FTM A;  3FJG A;  1A7L A;  1ZMG A;  3KJ7 A;  3ONM A;  1P1U A;  1B3L A;  5I57 A;  5ISU A;  3PV0 E;  4YB6 A;  4OFO A;  3THI A;  1XS5 A;  3MP8 A;  4NF6 B;  3MW0 A;  1FTJ A;  1POY 1;  1TT1 A;  1N0T A;  3IX1 A;  3O2A A;  4OFJ A;  2WKY A;  2RKM A;  4TLM B;  2DWI A;  3TOD A;  4GWO A;  1D9Y A;  1MY3 A;  1MQH A;  2XXV A;  2HAV A;  3FAT A;  2OWS A;  3FXR A;  1I69 A;  3OO9 A;  4C0R A;  1S9T A;  2ZXT A;  4M4G A;  3T22 A;  4YMA A;  3KJT A;  4LZ5 A;  5ICT A;  1LCT A;  3OXN A;  1DSN A;  1URS A;  1IXH A;  2V3T A;  1SW1 A;  2XXP A;  4ND9 A;  3LC8 A;  4NMY A;  2V84 A;  4RA1 A;  3SET A;  1BKA A;  1MXZ A;  2QL3 A;  3K00 A;  3K1N A;  4NF8 B;  2ZNT A;  1M5D A;  2Y7W A;  5JEI A;  4OET A;  4YU0 A;  2HZK A;  2Q2A A;  3PGF A;  3IAZ A;  3U94 A;  2DXY A;  1YTV A;  4E0W A;  3MWB A;  2PX1 A;  1H76 A;  1TXF A;  4F1Y A;  3D4C A;  3G3H A;  1SI0 A;  4X1B A;  4F1U A;  5DVI A;  1P1O A;  4U4X A;  4HW8 A;  2PYY A;  5A5X A;  1I6A A;  1LFH A;  5BUU A;  3U92 A;  2Y84 A;  2I49 A;  4R9F A;  1YAE A;  1B0H A;  1ZLQ A;  3FXQ A;  1HSJ A;  1BLF A;  2A5S A;  3C36 A;  4QFN A;  1B32 A;  3I6V A;  1OIB A;  1B5J A;  1Y1M A;  3PUY E;  4UA8 A;  4FED A;  4LP2 B;  5TPA A;  4GD5 A;  3H6U A;  2P0S A;  1LGB C;  4KHZ E;  5IAI A;  2DXR A;  3OOA A;  4R74 A;  5H8S A;  4N07 A;  1JW5 A;  1II5 A;  2Z23 A;  2GHA A;  1OLA A;  4G2Z A;  2QS2 A;  5AA2 B;  2F35 A;  3I3V A;  3RTF B;  2UVG A;  3H7M A;  4LZ7 A;  4POW A;  1IUD A;  3TUS A;  4NE4 A;  4C1T A;  3HCQ A;  4U21 A;  2F6G A;  3RPW A;  1B51 A;  3KFM A;  1JW1 A;  4Q30 B;  3CFX A;  4EUO A;  3K02 A;  2RCA A;  1Z7N E;  1R6Z A;  3F11 A;  4F2O A;  3C9H A;  1DPE A;  5CC2 A;  2ZNU A;  3TCF A;  2ZYN A;  2XXT A;  3P7I A;  5H8H A;  2Y7P A;  4R6H A;  4F1V A;  3EPE A;  5CMK A;  4PFW A;  1R1N A;  4PFY A;  3EQ1 A;  2NVU B;  4RNS A;  3O6I A;  3FJM A;  1NH7 A;  3KG2 A;  1A54 A;  1UTH A;  2F97 A;  2X26 A;  3LSF B;  3QUF A;  4NF4 A;  4QFK A;  4IO3 A;  3KOS A;  3OSQ A;  1NNK A;  4EDP A;  1QUK A;  1S7Y A;  4OER A;  3KSX A;  5I84 A;  4NTL A;  1MH4 A;  3PMV A;  5K2X A;  1LFG A;  2VP1 A;  4WXJ A;  2CZL A;  2OZZ A;  5M2V A;  4FAT A;  5FTH A;  1IIW A;  3PUX E;  3TTL A;  4ZZA A;  3UGW A;  3K6W A;  5KCJ B;  1LAG E;  1B4H A;  1NMU A;  2G29 A;  2ZYO A;  3FZV A;  2OLB A;  3LSW A;  3MUQ A;  4GIZ A;  3ECR A;  1LCF A;  3IJX B;  1J1N A;  4YAH X;  1FQA A;  3FGS A;  3IOT A;  4R73 A;  4OVJ A;  4KCD A;  1JEV A;  1MPD A;  5TU0 A;  4O3C A;  4I8C A;  3QXM A;  4O3B A;  5I2K B;  3T9V A;  1P1N A;  3A3U A;  1ZBM A;  4ZE8 A;  5B70 A;  2XX8 A;  3SEU A;  1EZP A;  4H8J A;  1SW2 A;  4UAC A;  2OBG A;  2Q88 A;  4GL0 A;  3H3G A;  2O69 A;  4ZEI A;  2AL4 A;  2I0B A;  3ZKL A;  1PC3 A;  3K6X A;  1B1X A;  1VE4 A;  3G3J A;  5I2N A;  4HCY A;  3PUV E;  4OZ9 A;  3R26 A;  2QMW A;  1EH3 A;  1M5E A;  4DXC A;  3FD3 A;  4GQO A;  1XOC A;  4NWC A;  1B2H A;  3TCH A;  5H8Q A;  4GOT A;  2LAO A;  3O28 A;  5CMM A;  4IO2 A;  1CE2 A;  1GV8 A;  3G7W A;  4IB2 A;  1N3W A;  2F7A A;  3LSL A;  4K3F A;  5IKB A;  3K0V A;  3M3K A;  3TTN A;  3MBP A;  1OQH A;  2O7U A;  2Y7I A;  3ODB A;  2OK2 A;  1Y1Z A;  3DLN A;  3QUJ A;  3CSB A;  4ZS9 A;  2HQ0 A;  4Z0I A;  4XKR A;  3UP9 A;  1B58 A;  4KYD A;  3S4U A;  1XC1 A;  3UA8 A;  4AB5 A;  2Q9T A;  3KN8 A;  3S2V A;  1IZ1 A;  3W9V A;  1ZKB A;  2OWT A;  3FJ7 A;  1QW0 A;  1PBQ A;  4XKN A;  4NF6 A;  1MPC A;  3IR1 A;  3QK6 A;  4ZEF A;  3C35 A;  2XXH A;  5CMC A;  3QYT A;  1A55 A;  3TQL A;  1Y3P A;  4EF2 A;  2OJT A;  4OHN A;  3E13 X;  1ELJ A;  1Q35 A;  3PPO A;  1QUJ A;  3IB2 A;  1NH8 A;  4GXS B;  3E9X A;  3W9W A;  2UYE A;  3I5O A;  3C33 A;  1SQY A;  4X1D A;  1B05 A;  1WOD A;  1ZTY A;  4RPO A;  5TP9 B;  3TAJ A;  4ISU A;  4G77 A;  3U1O A;  3OSR A;  3ZSF A;  1B3H A;  4ESW A;  3TPA A;  4DCY A;  2AL5 A;  3IO4 A;  3PPN A;  1JEU A;  1VR5 A;  3KOT A;  3O6G A;  1QUI A;  3K1P A;  3FV1 A;  3VFJ A;  2VD2 A;  3IK6 B;  3FIR A;  2I4C A;  4RY1 A;  5TPA B;  2QS4 A;  2RC8 A;  3GXA A;  3U72 A;  4EQ9 A;  1FTK A;  3OD7 A;  2ZMB A;  1MY0 A;  3KZG A;  1AIV A;  4U2R A;  3OO8 A;  1MPB A;  2DS9 A;  3FXU A;  1UTH B;  3QIM A;  4QFO A;  1GVC A;  1FQF A;  2O7I A;  3K4U A;  1SW5 A;  1AMF A;  3VLU A;  3FVG A;  1JW4 A;  1LAX A;  4R2B A;  4I1D A;  3T66 A;  2F34 A;  5I58 B;  3MPK A;  1US4 A;  4NF5 A;  5L9M A;  4JWY A;  5I56 B;  1URD A;  3OO6 A;  1PBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...