2Y7YA

Aplysia californica achbp in apo state
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
205
structure length
203
Chain Sequence
b'QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSPEPYIDVNLVVKFRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X-Ray Analysis.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 50
structure length 203
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2y7yA00
5LG3A 2XNTA 3GUAA 4QH1A 4ZZCA 2PGZA 2BR8A 2W8GA 5L4EA 3ZKRA 3U8MA 4QAAA 4IL4A 3TLSA 2XZ6A 4UXUA 5AFNA 5IUXA 4AFHA 4A97A 3TLTA 3EAMA 5AFHA 2BG9C 2Y58A 5LXBA 3SH1A 4TWFA 4QACA 5FJVA 2Y54A 5HCMA 5L4HA 4BFQA 4LMLA 3WTHA 3U8NA 3WTMA 3TLVA 2BR7A 2WNCA 3ZDHA 4ALXA 4PIRA 4ZJTA 2BJ0A 4UM3S 3UU5A 3UU3A 2XYSA 3C79A 4AFTA 4TWHA 5SYOA 3JAEA 3RI5A 4A98A 2YKSA 4TNVA 2XQAA 3RHWA 4ZZBA 2BYNA 5HEUA 4DBMA 2PH9A 3WTOA 2XQ9A 4ILAA 2XYTA 5AFMB 3RIFA 2W8FA 4ILCA 3IGQA 3P4WA 5J5GA 4HFCA 2WNLA 3U8KA 5J5FA 5AFMA 5AINA 3SIOA 2WZYA 4UY2A 4HFEA 5AFJA 3WTJA 1UV6A 2XZ5A 4HFDA 3SQ9A 2XNVA 5HEHA 3UQ4A 5L47A 2XQ4A 4ZRUA 3PMZA 2X00A 3U8JA 2XQ5A 2VL0A 2YMDA 5J5IA 4QH4A 3UQ7A 2XQ8A 3UU6A 1I9BA 2BYRA 2UZ6A 3T4MA 2BYPA 5J0ZA 3RQWA 5KZUA 3WTLA 5AFKA 3TLUA 4ZK1A 5BW2A 2QC1B 2C9TA 4HFIA 4NPPA 2ZJUA 4QH5A 2BYSA 2XQ3A 2YN6A 5J5HA 2YMEA 3SQ6A 3LSVA 4D01A 4Z91A 2X00D 3JAFA 5AFLA 4AFGA 4IL9A 4XHEA 4ILBA 4LMKA 4TNWA 4IREA 4ZJSA 3C84A 4BQTA 3WIPA 5HEGA 2BG9B 1UW6A 3RQUA 2XQ7A 4F8HA 3P50A 3WTNA 4Z90A 4HFHA 2Y7YA 2BG9A 4EZ1A 2XNUA 4B5DA 2WN9A 4UM3A 4NZBA 3UU8A 2Y56A 5TVCA 4WV9A 4ZK4A 3EHZA 4UM1A 4ZR6A 3WTKA 3PEOA 1UX2A 2BG9E 5JMEA 5HEOA 3ZDGA 3EI0A 3UUBA 4COFA 5BP0A 3RIAA 2WNJA 3UU4A 4HQPA 5BRXA 5HEJA 2BYQA 4XK9A 5KE4A 2Y57A 4QABA 2YOEA 3WTIA 5HCJA 4X5TA 2ZJVA 4TWDA 5CO5A 4UM3P 3TLWA 4LMJA 3JADA 3U8LA 4HFBA 2XQ6A 4FRRA 5CFBA
chains in the Genus database with same CATH superfamily
5LG3A 2XNTA 3GUAA 4QH1A 4ZZCA 2PGZA 2BR8A 2W8GA 5L4EA 3ZKRA 3U8MA 4QAAA 4IL4A 3TLSA 2XZ6A 4UXUA 5AFNA 5IUXA 4AFHA 4A97A 3TLTA 3EAMA 5AFHA 2BG9C 2Y58A 5LXBA 3SH1A 4TWFA 4QACA 5FJVA 2Y54A 5HCMA 5L4HA 4BFQA 4LMLA 3WTHA 3U8NA 3WTMA 3TLVA 2BR7A 2WNCA 3ZDHA 4ALXA 4PIRA 4ZJTA 2BJ0A 4UM3S 3UU5A 3UU3A 2XYSA 3C79A 4AFTA 4TWHA 5SYOA 3JAEA 3RI5A 4A98A 2YKSA 4TNVA 2XQAA 3RHWA 4ZZBA 2BYNA 5HEUA 4DBMA 2PH9A 3WTOA 2XQ9A 4ILAA 2XYTA 5AFMB 3RIFA 2W8FA 4ILCA 3IGQA 3P4WA 5J5GA 4HFCA 2WNLA 3U8KA 5J5FA 5AFMA 5AINA 3SIOA 2WZYA 4UY2A 4HFEA 5AFJA 3WTJA 1UV6A 2XZ5A 4HFDA 3SQ9A 2XNVA 5HEHA 3UQ4A 5L47A 2XQ4A 4ZRUA 3PMZA 2X00A 3U8JA 2XQ5A 2VL0A 2YMDA 5J5IA 4QH4A 3UQ7A 2XQ8A 3UU6A 1I9BA 2BYRA 2UZ6A 3T4MA 2BYPA 5J0ZA 3RQWA 5KZUA 3WTLA 5AFKA 3TLUA 4ZK1A 5BW2A 2QC1B 2C9TA 4HFIA 4NPPA 2ZJUA 4QH5A 2BYSA 2XQ3A 2YN6A 5J5HA 2YMEA 3SQ6A 3LSVA 4D01A 4Z91A 2X00D 3JAFA 5AFLA 4AFGA 4IL9A 4XHEA 4ILBA 4LMKA 4TNWA 4IREA 4ZJSA 3C84A 4BQTA 3WIPA 5HEGA 2BG9B 1UW6A 3RQUA 2XQ7A 4F8HA 3P50A 3WTNA 4Z90A 4HFHA 2Y7YA 2BG9A 4EZ1A 2XNUA 4B5DA 2WN9A 4UM3A 4NZBA 3UU8A 2Y56A 5TVCA 4WV9A 4ZK4A 3EHZA 4UM1A 4ZR6A 3WTKA 3PEOA 1UX2A 2BG9E 5JMEA 5HEOA 3ZDGA 3EI0A 3UUBA 4COFA 5BP0A 3RIAA 2WNJA 3UU4A 4HQPA 5BRXA 5HEJA 2BYQA 4XK9A 5KE4A 2Y57A 4QABA 2YOEA 3WTIA 5HCJA 4X5TA 2ZJVA 4TWDA 5CO5A 4UM3P 3TLWA 4LMJA 3JADA 3U8LA 4HFBA 2XQ6A 4FRRA 5CFBA
chains in the Genus database with same CATH topology
5LG3A 2XNTA 3GUAA 4QH1A 4ZZCA 2PGZA 2BR8A 2W8GA 5L4EA 3ZKRA 3U8MA 4QAAA 4IL4A 3TLSA 2XZ6A 4UXUA 5AFNA 5IUXA 4AFHA 4A97A 3TLTA 3EAMA 5AFHA 2BG9C 2Y58A 5LXBA 3SH1A 4TWFA 4QACA 5FJVA 2Y54A 5HCMA 5L4HA 4BFQA 4LMLA 3WTHA 3U8NA 3WTMA 3TLVA 2BR7A 2WNCA 3ZDHA 4ALXA 4PIRA 4ZJTA 2BJ0A 4UM3S 3UU5A 3UU3A 2XYSA 3C79A 4AFTA 4TWHA 5SYOA 3JAEA 3RI5A 4A98A 2YKSA 4TNVA 2XQAA 3RHWA 4ZZBA 2BYNA 5HEUA 4DBMA 2PH9A 3WTOA 2XQ9A 4ILAA 2XYTA 5AFMB 3RIFA 2W8FA 4ILCA 3IGQA 3P4WA 5J5GA 4HFCA 2WNLA 3U8KA 5J5FA 5AFMA 5AINA 3SIOA 2WZYA 4UY2A 4HFEA 5AFJA 3WTJA 1UV6A 2XZ5A 4HFDA 3SQ9A 2XNVA 5HEHA 3UQ4A 5L47A 2XQ4A 4ZRUA 3PMZA 2X00A 3U8JA 2XQ5A 2VL0A 2YMDA 5J5IA 4QH4A 3UQ7A 2XQ8A 3UU6A 1I9BA 2BYRA 2UZ6A 3T4MA 2BYPA 5J0ZA 3RQWA 5KZUA 3WTLA 5AFKA 3TLUA 4ZK1A 5BW2A 2QC1B 2C9TA 4HFIA 4NPPA 2ZJUA 4QH5A 2BYSA 2XQ3A 2YN6A 5J5HA 2YMEA 3SQ6A 3LSVA 4D01A 4Z91A 2X00D 3JAFA 5AFLA 4AFGA 4IL9A 4XHEA 4ILBA 4LMKA 4TNWA 4IREA 4ZJSA 3C84A 4BQTA 3WIPA 5HEGA 2BG9B 1UW6A 3RQUA 2XQ7A 4F8HA 3P50A 3WTNA 4Z90A 4HFHA 2Y7YA 2BG9A 4EZ1A 2XNUA 4B5DA 2WN9A 4UM3A 4NZBA 3UU8A 2Y56A 5TVCA 4WV9A 4ZK4A 3EHZA 4UM1A 4ZR6A 3WTKA 3PEOA 1UX2A 2BG9E 5JMEA 5HEOA 3ZDGA 3EI0A 3UUBA 4COFA 5BP0A 3RIAA 2WNJA 3UU4A 4HQPA 5BRXA 5HEJA 2BYQA 4XK9A 5KE4A 2Y57A 4QABA 2YOEA 3WTIA 5HCJA 4X5TA 2ZJVA 4TWDA 5CO5A 4UM3P 3TLWA 4LMJA 3JADA 3U8LA 4HFBA 2XQ6A 4FRRA 5CFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LG3 A;  2XNT A;  3GUA A;  4QH1 A;  4ZZC A;  2PGZ A;  2BR8 A;  2W8G A;  5L4E A;  3ZKR A;  3U8M A;  4QAA A;  4IL4 A;  3TLS A;  2XZ6 A;  4UXU A;  5AFN A;  5IUX A;  4AFH A;  4A97 A;  3TLT A;  3EAM A;  5AFH A;  2BG9 C;  2Y58 A;  5LXB A;  3SH1 A;  4TWF A;  4QAC A;  5FJV A;  2Y54 A;  5HCM A;  5L4H A;  4BFQ A;  4LML A;  3WTH A;  3U8N A;  3WTM A;  3TLV A;  2BR7 A;  2WNC A;  3ZDH A;  4ALX A;  4PIR A;  4ZJT A;  2BJ0 A;  4UM3 S;  3UU5 A;  3UU3 A;  2XYS A;  3C79 A;  4AFT A;  4TWH A;  5SYO A;  3JAE A;  3RI5 A;  4A98 A;  2YKS A;  4TNV A;  2XQA A;  3RHW A;  4ZZB A;  2BYN A;  5HEU A;  4DBM A;  2PH9 A;  3WTO A;  2XQ9 A;  4ILA A;  2XYT A;  5AFM B;  3RIF A;  2W8F A;  4ILC A;  3IGQ A;  3P4W A;  5J5G A;  4HFC A;  2WNL A;  3U8K A;  5J5F A;  5AFM A;  5AIN A;  3SIO A;  2WZY A;  4UY2 A;  4HFE A;  5AFJ A;  3WTJ A;  1UV6 A;  2XZ5 A;  4HFD A;  3SQ9 A;  2XNV A;  5HEH A;  3UQ4 A;  5L47 A;  2XQ4 A;  4ZRU A;  3PMZ A;  2X00 A;  3U8J A;  2XQ5 A;  2VL0 A;  2YMD A;  5J5I A;  4QH4 A;  3UQ7 A;  2XQ8 A;  3UU6 A;  1I9B A;  2BYR A;  2UZ6 A;  3T4M A;  2BYP A;  5J0Z A;  3RQW A;  5KZU A;  3WTL A;  5AFK A;  3TLU A;  4ZK1 A;  5BW2 A;  2QC1 B;  2C9T A;  4HFI A;  4NPP A;  2ZJU A;  4QH5 A;  2BYS A;  2XQ3 A;  2YN6 A;  5J5H A;  2YME A;  3SQ6 A;  3LSV A;  4D01 A;  4Z91 A;  2X00 D;  3JAF A;  5AFL A;  4AFG A;  4IL9 A;  4XHE A;  4ILB A;  4LMK A;  4TNW A;  4IRE A;  4ZJS A;  3C84 A;  4BQT A;  3WIP A;  5HEG A;  2BG9 B;  1UW6 A;  3RQU A;  2XQ7 A;  4F8H A;  3P50 A;  3WTN A;  4Z90 A;  4HFH A;  2Y7Y A;  2BG9 A;  4EZ1 A;  2XNU A;  4B5D A;  2WN9 A;  4UM3 A;  4NZB A;  3UU8 A;  2Y56 A;  5TVC A;  4WV9 A;  4ZK4 A;  3EHZ A;  4UM1 A;  4ZR6 A;  3WTK A;  3PEO A;  1UX2 A;  2BG9 E;  5JME A;  5HEO A;  3ZDG A;  3EI0 A;  3UUB A;  4COF A;  5BP0 A;  3RIA A;  2WNJ A;  3UU4 A;  4HQP A;  5BRX A;  5HEJ A;  2BYQ A;  4XK9 A;  5KE4 A;  2Y57 A;  4QAB A;  2YOE A;  3WTI A;  5HCJ A;  4X5T A;  2ZJV A;  4TWD A;  5CO5 A;  4UM3 P;  3TLW A;  4LMJ A;  3JAD A;  3U8L A;  4HFB A;  2XQ6 A;  4FRR A;  5CFB A; 
#chains in the Genus database with same CATH topology
 5LG3 A;  2XNT A;  3GUA A;  4QH1 A;  4ZZC A;  2PGZ A;  2BR8 A;  2W8G A;  5L4E A;  3ZKR A;  3U8M A;  4QAA A;  4IL4 A;  3TLS A;  2XZ6 A;  4UXU A;  5AFN A;  5IUX A;  4AFH A;  4A97 A;  3TLT A;  3EAM A;  5AFH A;  2BG9 C;  2Y58 A;  5LXB A;  3SH1 A;  4TWF A;  4QAC A;  5FJV A;  2Y54 A;  5HCM A;  5L4H A;  4BFQ A;  4LML A;  3WTH A;  3U8N A;  3WTM A;  3TLV A;  2BR7 A;  2WNC A;  3ZDH A;  4ALX A;  4PIR A;  4ZJT A;  2BJ0 A;  4UM3 S;  3UU5 A;  3UU3 A;  2XYS A;  3C79 A;  4AFT A;  4TWH A;  5SYO A;  3JAE A;  3RI5 A;  4A98 A;  2YKS A;  4TNV A;  2XQA A;  3RHW A;  4ZZB A;  2BYN A;  5HEU A;  4DBM A;  2PH9 A;  3WTO A;  2XQ9 A;  4ILA A;  2XYT A;  5AFM B;  3RIF A;  2W8F A;  4ILC A;  3IGQ A;  3P4W A;  5J5G A;  4HFC A;  2WNL A;  3U8K A;  5J5F A;  5AFM A;  5AIN A;  3SIO A;  2WZY A;  4UY2 A;  4HFE A;  5AFJ A;  3WTJ A;  1UV6 A;  2XZ5 A;  4HFD A;  3SQ9 A;  2XNV A;  5HEH A;  3UQ4 A;  5L47 A;  2XQ4 A;  4ZRU A;  3PMZ A;  2X00 A;  3U8J A;  2XQ5 A;  2VL0 A;  2YMD A;  5J5I A;  4QH4 A;  3UQ7 A;  2XQ8 A;  3UU6 A;  1I9B A;  2BYR A;  2UZ6 A;  3T4M A;  2BYP A;  5J0Z A;  3RQW A;  5KZU A;  3WTL A;  5AFK A;  3TLU A;  4ZK1 A;  5BW2 A;  2QC1 B;  2C9T A;  4HFI A;  4NPP A;  2ZJU A;  4QH5 A;  2BYS A;  2XQ3 A;  2YN6 A;  5J5H A;  2YME A;  3SQ6 A;  3LSV A;  4D01 A;  4Z91 A;  2X00 D;  3JAF A;  5AFL A;  4AFG A;  4IL9 A;  4XHE A;  4ILB A;  4LMK A;  4TNW A;  4IRE A;  4ZJS A;  3C84 A;  4BQT A;  3WIP A;  5HEG A;  2BG9 B;  1UW6 A;  3RQU A;  2XQ7 A;  4F8H A;  3P50 A;  3WTN A;  4Z90 A;  4HFH A;  2Y7Y A;  2BG9 A;  4EZ1 A;  2XNU A;  4B5D A;  2WN9 A;  4UM3 A;  4NZB A;  3UU8 A;  2Y56 A;  5TVC A;  4WV9 A;  4ZK4 A;  3EHZ A;  4UM1 A;  4ZR6 A;  3WTK A;  3PEO A;  1UX2 A;  2BG9 E;  5JME A;  5HEO A;  3ZDG A;  3EI0 A;  3UUB A;  4COF A;  5BP0 A;  3RIA A;  2WNJ A;  3UU4 A;  4HQP A;  5BRX A;  5HEJ A;  2BYQ A;  4XK9 A;  5KE4 A;  2Y57 A;  4QAB A;  2YOE A;  3WTI A;  5HCJ A;  4X5T A;  2ZJV A;  4TWD A;  5CO5 A;  4UM3 P;  3TLW A;  4LMJ A;  3JAD A;  3U8L A;  4HFB A;  2XQ6 A;  4FRR A;  5CFB A; 
#chains in the Genus database with same CATH homology
 5LG3 A;  2XNT A;  3GUA A;  4QH1 A;  4ZZC A;  2PGZ A;  2BR8 A;  2W8G A;  5L4E A;  3ZKR A;  3U8M A;  4QAA A;  4IL4 A;  3TLS A;  2XZ6 A;  4UXU A;  5AFN A;  5IUX A;  4AFH A;  4A97 A;  3TLT A;  3EAM A;  5AFH A;  2BG9 C;  2Y58 A;  5LXB A;  3SH1 A;  4TWF A;  4QAC A;  5FJV A;  2Y54 A;  5HCM A;  5L4H A;  4BFQ A;  4LML A;  3WTH A;  3U8N A;  3WTM A;  3TLV A;  2BR7 A;  2WNC A;  3ZDH A;  4ALX A;  4PIR A;  4ZJT A;  2BJ0 A;  4UM3 S;  3UU5 A;  3UU3 A;  2XYS A;  3C79 A;  4AFT A;  4TWH A;  5SYO A;  3JAE A;  3RI5 A;  4A98 A;  2YKS A;  4TNV A;  2XQA A;  3RHW A;  4ZZB A;  2BYN A;  5HEU A;  4DBM A;  2PH9 A;  3WTO A;  2XQ9 A;  4ILA A;  2XYT A;  5AFM B;  3RIF A;  2W8F A;  4ILC A;  3IGQ A;  3P4W A;  5J5G A;  4HFC A;  2WNL A;  3U8K A;  5J5F A;  5AFM A;  5AIN A;  3SIO A;  2WZY A;  4UY2 A;  4HFE A;  5AFJ A;  3WTJ A;  1UV6 A;  2XZ5 A;  4HFD A;  3SQ9 A;  2XNV A;  5HEH A;  3UQ4 A;  5L47 A;  2XQ4 A;  4ZRU A;  3PMZ A;  2X00 A;  3U8J A;  2XQ5 A;  2VL0 A;  2YMD A;  5J5I A;  4QH4 A;  3UQ7 A;  2XQ8 A;  3UU6 A;  1I9B A;  2BYR A;  2UZ6 A;  3T4M A;  2BYP A;  5J0Z A;  3RQW A;  5KZU A;  3WTL A;  5AFK A;  3TLU A;  4ZK1 A;  5BW2 A;  2QC1 B;  2C9T A;  4HFI A;  4NPP A;  2ZJU A;  4QH5 A;  2BYS A;  2XQ3 A;  2YN6 A;  5J5H A;  2YME A;  3SQ6 A;  3LSV A;  4D01 A;  4Z91 A;  2X00 D;  3JAF A;  5AFL A;  4AFG A;  4IL9 A;  4XHE A;  4ILB A;  4LMK A;  4TNW A;  4IRE A;  4ZJS A;  3C84 A;  4BQT A;  3WIP A;  5HEG A;  2BG9 B;  1UW6 A;  3RQU A;  2XQ7 A;  4F8H A;  3P50 A;  3WTN A;  4Z90 A;  4HFH A;  2Y7Y A;  2BG9 A;  4EZ1 A;  2XNU A;  4B5D A;  2WN9 A;  4UM3 A;  4NZB A;  3UU8 A;  2Y56 A;  5TVC A;  4WV9 A;  4ZK4 A;  3EHZ A;  4UM1 A;  4ZR6 A;  3WTK A;  3PEO A;  1UX2 A;  2BG9 E;  5JME A;  5HEO A;  3ZDG A;  3EI0 A;  3UUB A;  4COF A;  5BP0 A;  3RIA A;  2WNJ A;  3UU4 A;  4HQP A;  5BRX A;  5HEJ A;  2BYQ A;  4XK9 A;  5KE4 A;  2Y57 A;  4QAB A;  2YOE A;  3WTI A;  5HCJ A;  4X5T A;  2ZJV A;  4TWD A;  5CO5 A;  4UM3 P;  3TLW A;  4LMJ A;  3JAD A;  3U8L A;  4HFB A;  2XQ6 A;  4FRR A;  5CFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...