2Y7YA

Aplysia californica achbp in apo state
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
205
structure length
203
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X-Ray Analysis.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 50
structure length 203
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2y7yA00
5BP0A 3ZDHA 4NPPA 2XQ8A 5TVCA 5AFLA 4HFCA 5HEGA 4QH1A 3GUAA 2YN6A 5KZUA 2Y58A 4UM3P 4ILAA 4QH5A 3TLUA 5CFBA 1UW6A 3U8KA 3WTOA 2XZ5A 3RIFA 4ILBA 3UU8A 4AFGA 2VL0A 5HEOA 4ZZCA 5SYOA 1UX2A 2XQ7A 2QC1B 5J5IA 5L4EA 2BYPA 2XNVA 2BYNA 3U8LA 5JMEA 3WTJA 4WV9A 2BYRA 2WNJA 4LMKA 4TWHA 3WTNA 3ZKRA 4AFHA 4ZK1A 3TLTA 3T4MA 2Y56A 4ZZBA 3PMZA 4COFA 5AINA 5LXBA 4QACA 2C9TA 3RQUA 2W8GA 2XQ5A 4PIRA 3UU6A 3P50A 2WNLA 2XYTA 4HFDA 5J5FA 4HFEA 2YKSA 3UU3A 2BG9A 2W8FA 5KE4A 2X00D 4HFBA 5LG3A 4HQPA 2BYQA 2YMDA 4LMLA 5L4HA 3RI5A 4EZ1A 2XQAA 4LMJA 5J0ZA 3EAMA 4TWDA 4ILCA 4XK9A 3SQ6A 4DBMA 4UM1A 2XZ6A 3UUBA 5CO5A 3JADA 2BR7A 3P4WA 4QH4A 4X5TA 5HCJA 2XQ9A 3UU5A 2XNUA 4AFTA 4IL4A 5AFMA 4BFQA 3EI0A 2YMEA 4A98A 1UV6A 2BR8A 1I9BA 3U8NA 4NZBA 3WTIA 2XNTA 3C84A 4HFHA 3UQ7A 4ZRUA 5AFHA 3JAEA 3WIPA 2WZYA 3TLWA 2XQ3A 5HCMA 5AFKA 5AFNA 2BJ0A 4XHEA 3SIOA 3RQWA 4UM3S 3EHZA 5L47A 2Y7YA 2Y54A 5HEUA 4B5DA 5J5GA 2X00A 4ZJTA 3WTKA 4ZK4A 2XYSA 3U8JA 2BG9B 3JAFA 4UXUA 4TNVA 4UM3A 4Z91A 5BRXA 4IL9A 4F8HA 2XQ6A 2BG9C 3PEOA 3RIAA 3TLVA 5HEHA 4A97A 4FRRA 5HEJA 2BYSA 4ZR6A 3U8MA 3SQ9A 5J5HA 2PGZA 3LSVA 2XQ4A 3WTHA 4UY2A 4ZJSA 3IGQA 5AFMB 3RHWA 5FJVA 3TLSA 2ZJVA 2WNCA 2WN9A 4QAAA 3UQ4A 4ALXA 2PH9A 2UZ6A 5BW2A 3WTMA 2YOEA 4HFIA 4IREA 4QABA 5AFJA 4BQTA 3UU4A 3SH1A 2ZJUA 4TWFA 4Z90A 5IUXA 3WTLA 4D01A 2Y57A 2BG9E 4TNWA 3ZDGA 3C79A
chains in the Genus database with same CATH superfamily
5BP0A 3ZDHA 4NPPA 2XQ8A 5TVCA 5AFLA 4HFCA 5HEGA 4QH1A 3GUAA 2YN6A 5KZUA 2Y58A 4UM3P 4ILAA 4QH5A 3TLUA 5CFBA 1UW6A 3U8KA 3WTOA 2XZ5A 3RIFA 4ILBA 3UU8A 4AFGA 2VL0A 5HEOA 4ZZCA 5SYOA 1UX2A 2XQ7A 2QC1B 5J5IA 5L4EA 2BYPA 2XNVA 2BYNA 3U8LA 5JMEA 3WTJA 4WV9A 2BYRA 2WNJA 4LMKA 4TWHA 3WTNA 3ZKRA 4AFHA 4ZK1A 3TLTA 3T4MA 2Y56A 4ZZBA 3PMZA 4COFA 5AINA 5LXBA 4QACA 2C9TA 3RQUA 2W8GA 2XQ5A 4PIRA 3UU6A 3P50A 2WNLA 2XYTA 4HFDA 5J5FA 4HFEA 2YKSA 3UU3A 2BG9A 2W8FA 5KE4A 2X00D 4HFBA 5LG3A 4HQPA 2BYQA 2YMDA 4LMLA 5L4HA 3RI5A 4EZ1A 2XQAA 4LMJA 5J0ZA 3EAMA 4TWDA 4ILCA 4XK9A 3SQ6A 4DBMA 4UM1A 2XZ6A 3UUBA 5CO5A 3JADA 2BR7A 3P4WA 4QH4A 4X5TA 5HCJA 2XQ9A 3UU5A 2XNUA 4AFTA 4IL4A 5AFMA 4BFQA 3EI0A 2YMEA 4A98A 1UV6A 2BR8A 1I9BA 3U8NA 4NZBA 3WTIA 2XNTA 3C84A 4HFHA 3UQ7A 4ZRUA 5AFHA 3JAEA 3WIPA 2WZYA 3TLWA 2XQ3A 5HCMA 5AFKA 5AFNA 2BJ0A 4XHEA 3SIOA 3RQWA 4UM3S 3EHZA 5L47A 2Y7YA 2Y54A 5HEUA 4B5DA 5J5GA 2X00A 4ZJTA 3WTKA 4ZK4A 2XYSA 3U8JA 2BG9B 3JAFA 4UXUA 4TNVA 4UM3A 4Z91A 5BRXA 4IL9A 4F8HA 2XQ6A 2BG9C 3PEOA 3RIAA 3TLVA 5HEHA 4A97A 4FRRA 5HEJA 2BYSA 4ZR6A 3U8MA 3SQ9A 5J5HA 2PGZA 3LSVA 2XQ4A 3WTHA 4UY2A 4ZJSA 3IGQA 5AFMB 3RHWA 5FJVA 3TLSA 2ZJVA 2WNCA 2WN9A 4QAAA 3UQ4A 4ALXA 2PH9A 2UZ6A 5BW2A 3WTMA 2YOEA 4HFIA 4IREA 4QABA 5AFJA 4BQTA 3UU4A 3SH1A 2ZJUA 4TWFA 4Z90A 5IUXA 3WTLA 4D01A 2Y57A 2BG9E 4TNWA 3ZDGA 3C79A
chains in the Genus database with same CATH topology
5BP0A 3ZDHA 4NPPA 2XQ8A 5TVCA 5AFLA 4HFCA 5HEGA 4QH1A 3GUAA 2YN6A 5KZUA 2Y58A 4UM3P 4ILAA 4QH5A 3TLUA 5CFBA 1UW6A 3U8KA 3WTOA 2XZ5A 3RIFA 4ILBA 3UU8A 4AFGA 2VL0A 5HEOA 4ZZCA 5SYOA 1UX2A 2XQ7A 2QC1B 5J5IA 5L4EA 2BYPA 2XNVA 2BYNA 3U8LA 5JMEA 3WTJA 4WV9A 2BYRA 2WNJA 4LMKA 4TWHA 3WTNA 3ZKRA 4AFHA 4ZK1A 3TLTA 3T4MA 2Y56A 4ZZBA 3PMZA 4COFA 5AINA 5LXBA 4QACA 2C9TA 3RQUA 2W8GA 2XQ5A 4PIRA 3UU6A 3P50A 2WNLA 2XYTA 4HFDA 5J5FA 4HFEA 2YKSA 3UU3A 2BG9A 2W8FA 5KE4A 2X00D 4HFBA 5LG3A 4HQPA 2BYQA 2YMDA 4LMLA 5L4HA 3RI5A 4EZ1A 2XQAA 4LMJA 5J0ZA 3EAMA 4TWDA 4ILCA 4XK9A 3SQ6A 4DBMA 4UM1A 2XZ6A 3UUBA 5CO5A 3JADA 2BR7A 3P4WA 4QH4A 4X5TA 5HCJA 2XQ9A 3UU5A 2XNUA 4AFTA 4IL4A 5AFMA 4BFQA 3EI0A 2YMEA 4A98A 1UV6A 2BR8A 1I9BA 3U8NA 4NZBA 3WTIA 2XNTA 3C84A 4HFHA 3UQ7A 4ZRUA 5AFHA 3JAEA 3WIPA 2WZYA 3TLWA 2XQ3A 5HCMA 5AFKA 5AFNA 2BJ0A 4XHEA 3SIOA 3RQWA 4UM3S 3EHZA 5L47A 2Y7YA 2Y54A 5HEUA 4B5DA 5J5GA 2X00A 4ZJTA 3WTKA 4ZK4A 2XYSA 3U8JA 2BG9B 3JAFA 4UXUA 4TNVA 4UM3A 4Z91A 5BRXA 4IL9A 4F8HA 2XQ6A 2BG9C 3PEOA 3RIAA 3TLVA 5HEHA 4A97A 4FRRA 5HEJA 2BYSA 4ZR6A 3U8MA 3SQ9A 5J5HA 2PGZA 3LSVA 2XQ4A 3WTHA 4UY2A 4ZJSA 3IGQA 5AFMB 3RHWA 5FJVA 3TLSA 2ZJVA 2WNCA 2WN9A 4QAAA 3UQ4A 4ALXA 2PH9A 2UZ6A 5BW2A 3WTMA 2YOEA 4HFIA 4IREA 4QABA 5AFJA 4BQTA 3UU4A 3SH1A 2ZJUA 4TWFA 4Z90A 5IUXA 3WTLA 4D01A 2Y57A 2BG9E 4TNWA 3ZDGA 3C79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BP0 A;  3ZDH A;  4NPP A;  2XQ8 A;  5TVC A;  5AFL A;  4HFC A;  5HEG A;  4QH1 A;  3GUA A;  2YN6 A;  5KZU A;  2Y58 A;  4UM3 P;  4ILA A;  4QH5 A;  3TLU A;  5CFB A;  1UW6 A;  3U8K A;  3WTO A;  2XZ5 A;  3RIF A;  4ILB A;  3UU8 A;  4AFG A;  2VL0 A;  5HEO A;  4ZZC A;  5SYO A;  1UX2 A;  2XQ7 A;  2QC1 B;  5J5I A;  5L4E A;  2BYP A;  2XNV A;  2BYN A;  3U8L A;  5JME A;  3WTJ A;  4WV9 A;  2BYR A;  2WNJ A;  4LMK A;  4TWH A;  3WTN A;  3ZKR A;  4AFH A;  4ZK1 A;  3TLT A;  3T4M A;  2Y56 A;  4ZZB A;  3PMZ A;  4COF A;  5AIN A;  5LXB A;  4QAC A;  2C9T A;  3RQU A;  2W8G A;  2XQ5 A;  4PIR A;  3UU6 A;  3P50 A;  2WNL A;  2XYT A;  4HFD A;  5J5F A;  4HFE A;  2YKS A;  3UU3 A;  2BG9 A;  2W8F A;  5KE4 A;  2X00 D;  4HFB A;  5LG3 A;  4HQP A;  2BYQ A;  2YMD A;  4LML A;  5L4H A;  3RI5 A;  4EZ1 A;  2XQA A;  4LMJ A;  5J0Z A;  3EAM A;  4TWD A;  4ILC A;  4XK9 A;  3SQ6 A;  4DBM A;  4UM1 A;  2XZ6 A;  3UUB A;  5CO5 A;  3JAD A;  2BR7 A;  3P4W A;  4QH4 A;  4X5T A;  5HCJ A;  2XQ9 A;  3UU5 A;  2XNU A;  4AFT A;  4IL4 A;  5AFM A;  4BFQ A;  3EI0 A;  2YME A;  4A98 A;  1UV6 A;  2BR8 A;  1I9B A;  3U8N A;  4NZB A;  3WTI A;  2XNT A;  3C84 A;  4HFH A;  3UQ7 A;  4ZRU A;  5AFH A;  3JAE A;  3WIP A;  2WZY A;  3TLW A;  2XQ3 A;  5HCM A;  5AFK A;  5AFN A;  2BJ0 A;  4XHE A;  3SIO A;  3RQW A;  4UM3 S;  3EHZ A;  5L47 A;  2Y7Y A;  2Y54 A;  5HEU A;  4B5D A;  5J5G A;  2X00 A;  4ZJT A;  3WTK A;  4ZK4 A;  2XYS A;  3U8J A;  2BG9 B;  3JAF A;  4UXU A;  4TNV A;  4UM3 A;  4Z91 A;  5BRX A;  4IL9 A;  4F8H A;  2XQ6 A;  2BG9 C;  3PEO A;  3RIA A;  3TLV A;  5HEH A;  4A97 A;  4FRR A;  5HEJ A;  2BYS A;  4ZR6 A;  3U8M A;  3SQ9 A;  5J5H A;  2PGZ A;  3LSV A;  2XQ4 A;  3WTH A;  4UY2 A;  4ZJS A;  3IGQ A;  5AFM B;  3RHW A;  5FJV A;  3TLS A;  2ZJV A;  2WNC A;  2WN9 A;  4QAA A;  3UQ4 A;  4ALX A;  2PH9 A;  2UZ6 A;  5BW2 A;  3WTM A;  2YOE A;  4HFI A;  4IRE A;  4QAB A;  5AFJ A;  4BQT A;  3UU4 A;  3SH1 A;  2ZJU A;  4TWF A;  4Z90 A;  5IUX A;  3WTL A;  4D01 A;  2Y57 A;  2BG9 E;  4TNW A;  3ZDG A;  3C79 A; 
#chains in the Genus database with same CATH topology
 5BP0 A;  3ZDH A;  4NPP A;  2XQ8 A;  5TVC A;  5AFL A;  4HFC A;  5HEG A;  4QH1 A;  3GUA A;  2YN6 A;  5KZU A;  2Y58 A;  4UM3 P;  4ILA A;  4QH5 A;  3TLU A;  5CFB A;  1UW6 A;  3U8K A;  3WTO A;  2XZ5 A;  3RIF A;  4ILB A;  3UU8 A;  4AFG A;  2VL0 A;  5HEO A;  4ZZC A;  5SYO A;  1UX2 A;  2XQ7 A;  2QC1 B;  5J5I A;  5L4E A;  2BYP A;  2XNV A;  2BYN A;  3U8L A;  5JME A;  3WTJ A;  4WV9 A;  2BYR A;  2WNJ A;  4LMK A;  4TWH A;  3WTN A;  3ZKR A;  4AFH A;  4ZK1 A;  3TLT A;  3T4M A;  2Y56 A;  4ZZB A;  3PMZ A;  4COF A;  5AIN A;  5LXB A;  4QAC A;  2C9T A;  3RQU A;  2W8G A;  2XQ5 A;  4PIR A;  3UU6 A;  3P50 A;  2WNL A;  2XYT A;  4HFD A;  5J5F A;  4HFE A;  2YKS A;  3UU3 A;  2BG9 A;  2W8F A;  5KE4 A;  2X00 D;  4HFB A;  5LG3 A;  4HQP A;  2BYQ A;  2YMD A;  4LML A;  5L4H A;  3RI5 A;  4EZ1 A;  2XQA A;  4LMJ A;  5J0Z A;  3EAM A;  4TWD A;  4ILC A;  4XK9 A;  3SQ6 A;  4DBM A;  4UM1 A;  2XZ6 A;  3UUB A;  5CO5 A;  3JAD A;  2BR7 A;  3P4W A;  4QH4 A;  4X5T A;  5HCJ A;  2XQ9 A;  3UU5 A;  2XNU A;  4AFT A;  4IL4 A;  5AFM A;  4BFQ A;  3EI0 A;  2YME A;  4A98 A;  1UV6 A;  2BR8 A;  1I9B A;  3U8N A;  4NZB A;  3WTI A;  2XNT A;  3C84 A;  4HFH A;  3UQ7 A;  4ZRU A;  5AFH A;  3JAE A;  3WIP A;  2WZY A;  3TLW A;  2XQ3 A;  5HCM A;  5AFK A;  5AFN A;  2BJ0 A;  4XHE A;  3SIO A;  3RQW A;  4UM3 S;  3EHZ A;  5L47 A;  2Y7Y A;  2Y54 A;  5HEU A;  4B5D A;  5J5G A;  2X00 A;  4ZJT A;  3WTK A;  4ZK4 A;  2XYS A;  3U8J A;  2BG9 B;  3JAF A;  4UXU A;  4TNV A;  4UM3 A;  4Z91 A;  5BRX A;  4IL9 A;  4F8H A;  2XQ6 A;  2BG9 C;  3PEO A;  3RIA A;  3TLV A;  5HEH A;  4A97 A;  4FRR A;  5HEJ A;  2BYS A;  4ZR6 A;  3U8M A;  3SQ9 A;  5J5H A;  2PGZ A;  3LSV A;  2XQ4 A;  3WTH A;  4UY2 A;  4ZJS A;  3IGQ A;  5AFM B;  3RHW A;  5FJV A;  3TLS A;  2ZJV A;  2WNC A;  2WN9 A;  4QAA A;  3UQ4 A;  4ALX A;  2PH9 A;  2UZ6 A;  5BW2 A;  3WTM A;  2YOE A;  4HFI A;  4IRE A;  4QAB A;  5AFJ A;  4BQT A;  3UU4 A;  3SH1 A;  2ZJU A;  4TWF A;  4Z90 A;  5IUX A;  3WTL A;  4D01 A;  2Y57 A;  2BG9 E;  4TNW A;  3ZDG A;  3C79 A; 
#chains in the Genus database with same CATH homology
 5BP0 A;  3ZDH A;  4NPP A;  2XQ8 A;  5TVC A;  5AFL A;  4HFC A;  5HEG A;  4QH1 A;  3GUA A;  2YN6 A;  5KZU A;  2Y58 A;  4UM3 P;  4ILA A;  4QH5 A;  3TLU A;  5CFB A;  1UW6 A;  3U8K A;  3WTO A;  2XZ5 A;  3RIF A;  4ILB A;  3UU8 A;  4AFG A;  2VL0 A;  5HEO A;  4ZZC A;  5SYO A;  1UX2 A;  2XQ7 A;  2QC1 B;  5J5I A;  5L4E A;  2BYP A;  2XNV A;  2BYN A;  3U8L A;  5JME A;  3WTJ A;  4WV9 A;  2BYR A;  2WNJ A;  4LMK A;  4TWH A;  3WTN A;  3ZKR A;  4AFH A;  4ZK1 A;  3TLT A;  3T4M A;  2Y56 A;  4ZZB A;  3PMZ A;  4COF A;  5AIN A;  5LXB A;  4QAC A;  2C9T A;  3RQU A;  2W8G A;  2XQ5 A;  4PIR A;  3UU6 A;  3P50 A;  2WNL A;  2XYT A;  4HFD A;  5J5F A;  4HFE A;  2YKS A;  3UU3 A;  2BG9 A;  2W8F A;  5KE4 A;  2X00 D;  4HFB A;  5LG3 A;  4HQP A;  2BYQ A;  2YMD A;  4LML A;  5L4H A;  3RI5 A;  4EZ1 A;  2XQA A;  4LMJ A;  5J0Z A;  3EAM A;  4TWD A;  4ILC A;  4XK9 A;  3SQ6 A;  4DBM A;  4UM1 A;  2XZ6 A;  3UUB A;  5CO5 A;  3JAD A;  2BR7 A;  3P4W A;  4QH4 A;  4X5T A;  5HCJ A;  2XQ9 A;  3UU5 A;  2XNU A;  4AFT A;  4IL4 A;  5AFM A;  4BFQ A;  3EI0 A;  2YME A;  4A98 A;  1UV6 A;  2BR8 A;  1I9B A;  3U8N A;  4NZB A;  3WTI A;  2XNT A;  3C84 A;  4HFH A;  3UQ7 A;  4ZRU A;  5AFH A;  3JAE A;  3WIP A;  2WZY A;  3TLW A;  2XQ3 A;  5HCM A;  5AFK A;  5AFN A;  2BJ0 A;  4XHE A;  3SIO A;  3RQW A;  4UM3 S;  3EHZ A;  5L47 A;  2Y7Y A;  2Y54 A;  5HEU A;  4B5D A;  5J5G A;  2X00 A;  4ZJT A;  3WTK A;  4ZK4 A;  2XYS A;  3U8J A;  2BG9 B;  3JAF A;  4UXU A;  4TNV A;  4UM3 A;  4Z91 A;  5BRX A;  4IL9 A;  4F8H A;  2XQ6 A;  2BG9 C;  3PEO A;  3RIA A;  3TLV A;  5HEH A;  4A97 A;  4FRR A;  5HEJ A;  2BYS A;  4ZR6 A;  3U8M A;  3SQ9 A;  5J5H A;  2PGZ A;  3LSV A;  2XQ4 A;  3WTH A;  4UY2 A;  4ZJS A;  3IGQ A;  5AFM B;  3RHW A;  5FJV A;  3TLS A;  2ZJV A;  2WNC A;  2WN9 A;  4QAA A;  3UQ4 A;  4ALX A;  2PH9 A;  2UZ6 A;  5BW2 A;  3WTM A;  2YOE A;  4HFI A;  4IRE A;  4QAB A;  5AFJ A;  4BQT A;  3UU4 A;  3SH1 A;  2ZJU A;  4TWF A;  4Z90 A;  5IUX A;  3WTL A;  4D01 A;  2Y57 A;  2BG9 E;  4TNW A;  3ZDG A;  3C79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...