2Y8YA

Structure b of crispr endoribonuclease cse3 bound to 19 nt rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
215
structure length
201
Chain Sequence
GTGAMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSE3
publication title An RNA-Induced Conformational Change Required for Crispr RNA Cleavage by the Endoribonuclease Cse3.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase/rna
total genus 51
structure length 201
sequence length 215
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 2y8yA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 2y8yA02
4U7UD 5H9FK 2Y8WA 4DZDA 2Y8YA 3QRRA 5CD4A 4QYZK 2Y9HA 3QRQA 1WJ9A 3QRPA 5H9EK
chains in the Genus database with same CATH superfamily
1H38A 3BV8A 2P6SA 4KIAA 1RSCA 3GFHA 4QU7A 3K2YA 4J9UE 4KJIA 3BGRB 3D5MA 3M05A 2PT0A 4NCAA 1VQOS 3MMAB 1JJHA 3W5YA 5KFHA 1BC6A 1SI9A 3O2IA 3UQSA 1FXRA 4IO1A 2ADCA 3ETOA 1M5SA 1BHNA 4DX5A 4ILLA 3M2VB 4UUWA 2WZ1A 3MAQA 3K8VA 1SL1A 3P49B 1FKPB 1RTIB 4P9SA 2MHEA 1BUXA 2CQGA 2RU3A 1J5OB 2OPSA 4Z2XA 1U4BA 1AYEA 3PO5A 3EYZA 5DGAA 2W2QP 4A8OA 2LEBA 3CMAS 4NE9C 3HHLA 2I5JA 1FWLA 3CCTA 2UVUA 2QTWA 1RA7A 5HBMA 3PX4A 4DR1F 1RT6A 5KFAA 2ACMA 2Q66A 3EWGA 5A2QU 3CT9A 3Q86A 5I3QA 3PX6A 4MTPA 1LFWA 4ED6A 4ZPCA 2CFXA 2ZKTA 4I2QB 1FVSA 3K17A 1FKAF 2GVZB 2UP1A 2JHEA 4ZCLA 1VQNS 3PHEA 1K1SA 3G8TA 1EAYC 3VAIA 3SSSA 1S49A 4B3SJ 2MMYA 3DI6B 2HSEB 3MTJA 3PJ9A 1VMBA 5D6GA 3NP5A 3FSYA 3OSNA 2LCWA 5EHHA 4ICLA 1X31C 2HRYA 1MU2B 1U0HA 3R5DA 3NCRA 2JFKA 3R6GB 1P9YA 2DNQA 1ZBTA 1H2VZ 4HHHA 3MWBA 3Q8RB 4QIEA 4ECTA 2ZC3A 2HHQA 1HBUB 2W7OA 1SUQA 2DHGA 5DG8A 3CCUS 2XULA 3LO3A 2QL7B 1ZAVA 1HQEA 3QT8A 4NRTA 3DFEA 5KG0A 3HSDA 4PYDA 3DHWC 4GVBB 2Z0GA 2V63A 4DX8H 3G6XA 4OZ1A 1TL4A 2JVOA 2AZ3A 4YDDB 1U2RA 2QRRA 1HBNB 3TANA 1VYAA 4OHWA 4A8QA 4DV7J 4KH1B 1FFSB 1MG7A 5E7OB 2DPIA 4I6YA 2J0XA 5FDLB 3WX8A 4RLEA 3DYAA 5HLFA 1SH2A 5HMWA 1PBAA 2JC0A 1F60B 4ZVQB 4YHHF 4LSZB 5ETLA 2MKKA 2BW2A 2FHOB 3DKDA 5DETA 2NR0A 3NNHA 2J0QD 2FC9A 5IZHA 2Q43A 3BSAA 3QT5A 2C2OB 3CDUA 1X4CA 5AE2A 3BB5A 2IAJA 2WCXA 1FT8A 2DNLA 5J2NB 2LVWA 3MR2A 3J7YU 4U8VA 3Q8YA 3DOMB 1HBOA 5HL7Q 5HK4A 2IM1A 2DO0A 2OSRA 3KG4A 2O67A 1KQFB 2W9BB 4LREA 4WE1A 3PRVA 2Q1LA 3C19A 1WC0A 4N77A 3C16B 4HI2A 1U6BA 2AV5A 4RNHA 1T11A 2DGOA 3M8SA 1QY7A 2F8MA 3W8PA 4DQRA 2ZKUA 4ZCIA 3GMGA 3Q24A 3ZNUA 3AD7C 4RW6A 2EK6A 3Q0AA 1NK4A 1MN9A 2BABA 3D54A 4UOCA 3EVOA 2M8HA 3T9ZA 3JYTA 1NH7A 2QT7A 3MEKA 3Q89A 3DDKA 3AFGA 3IS9A 3UR3C 4WFXA 4C3MA 2Z8QA 1FRIA 3T5KA 3FBCA 4WFBQ 3EPGA 3SI8A 1L3KA 3M30B 2CYYA 3G8SA 3RYLA 1FX2A 1M5VC 2MZRA 3DOLA 3VGUA 1RE1B 1ZZFA 4LSNB 2WVBA 3FBBA 2J6TA 3OTBA 3S01A 3K59A 5I42B 4Y65A 1U6ZA 3KFWX 1YK9A 3RAXA 3QWUA 2IRYA 3FBEA 2DXFA 1JLFB 3MMBB 1Q81T 1WDDA 3VAFA 3TZYA 1YIJS 4OX6A 2FJXA 3OLAA 3O5TB 2FY8A 4ZPDA 3D67A 1HPZB 2JEIA 2DGSA 4P6QA 3H25A 2MZTA 5L9NA 5H9FJ 1VHFA 2WOMA 3DDNA 1HWUA 1RT1B 2XSFA 3VHQA 1FF2A 3MEGA 3CC2S 1S79A 1OYDA 1RT7A 2W7AA 3SCIE 3ZZ0A 1WHVA 3SQGB 5HROB 5A8KB 5J2MB 5IWAF 1Y5LB 3SCJE 4DL4A 2DGVA 2G1HA 2HHVA 1R7IA 4RW9A 1YTYA 4F04B 5KFCA 3TJ8A 2HBQB 4C97A 3AJDA 1A6LA 5B08A 4NX9A 2ZOFA 2HIYA 2M7SA 4LF7F 4C48A 2N4DA 1SQGA 2UU9J 4Z7CA 3PCOB 1I1GA 4C0BA 1RADB 3QGIA 2R7SA 4ELTA 1VQPS 2KKHA 3I0SB 1TL1B 3GJQB 2QEXS 1IJEB 2YPZA 3SFGA 2EWHA 2KG0A 5ITHA 2L41A 1FERA 1RWXB 4IUFA 4EBCA 2IRUA 5MLCV 5LM7E 2EFNA 4YY3J 3NGKA 4K5SA 1R43A 2DNRA 2DGUA 4C8ZA 4CTAB 4CYUB 4HYKA 3GYNA 2NXJA 5D0HA 1WOOA 4NLPA 3RRKA 4ANEA 4MKAA 1EETB 4BC9A 3IBFB 4LSLB 3GV8B 3KJFB 2K7JA 4KAIA 5D78A 5CCLA 1A0OB 1N6QB 2C2MB 3POTA 2VICA 3ILLA 3AXKA 3I5BA 1QAJA 1CQNA 3I4PA 5DO2A 4TYAA 1NKEA 1WDTA 2ASDA 4LT6A 1TMMA 4O4RA 1W2IA 1RI7A 3ILIA 4J37A 5KT2A 3ZC4A 3QRQA 4K4YA 1U26A 1C4CA 3OR2B 1RT2A 1AUSL 1UW4A 3T1YF 2RT3A 2F8EX 2JFDA 1UCNA 1DURA 2MQNA 5C25A 2OFHX 2DR5A 5LMNJ 2RQMA 3KOAA 4F8RA 2DIUA 4YS2A 3F73A 5DZ6A 1E6VB 4GVLA 2HQDA 4HACA 4IFYB 4PABA 3GPAA 1UPMB 1JLAB 2MSTA 2ZZMA 3DMJA 2FVPA 3FSXA 1Q5VA 5E2QA 1RKIA 3ZTSA 2HNZB 4UQTA 1KHVA 4WP8A 1NDKA 1KNZA 1NAQA 4Q8FA 1I94F 5ETQA 3ZNJ1 4XO0A 3T6JA 5RUBA 5C24B 2YKOA 3MUVP 3LWMA 1LV5A 3CJTA 1QAYA 3UO0A 2B4UA 1NJIT 5AE1A 4NLXA 4DSKA 3G6ES 3OPKA 1HA1A 1FDBA 2ZH3A 2UU9F 1EARA 1J5EF 4PWUA 2Q6BA 1HNZJ 1XERA 5DZ7A 4FBTA 4G1IA 4DJBA 3DGPB 1QUVA 3S6EA 4PUOA 1U45A 5ETOA 4E0DA 2Z2LA 2J8AA 2M2BA 4LFAJ 3GYXB 2GGPA 2MZ1A 1PC4A 1GXTA 4J7CA 1JJ4A 2XEXA 1BD6A 2LMIA 3SFUA 4MH8A 1RWUA 2YWKA 4GO7X 3P45B 4CH7A 3QGGA 3MR6A 2UXCJ 2QGFB 2GQCA 4M5DA 2HZCA 1SJRA 1VDHA 4MFBA 3MDFA 4ID5B 4H4MB 1D3WA 1E6YB 5EWGA 2WONA 3Q8PB 2QFJA 1RWOB 2V8PA 2IFXA 4FXWA 2AEMA 1PG5B 3K7RA 4WK3A 5F0WA 2WSCC 2FQQB 1IQTA 3AXMA 3CUNA 5BYRA 4DI6A 2V4JA 3SSRA 3VR1A 4L3KA 5HATA 3TQEA 1RJJA 2DITA 4A8MP 2HYIB 4YEAA 2B4PA 4CZCA 2CPYA 2VV5A 2LEPA 2PE8A 2OKQA 2Y8YA 5A8WA 2GIQA 2PA3A 2YNFA 4JI6J 2VPWB 1X4GA 3DRSA 5F3ZA 4B3MJ 3KK3A 1AA1B 2C2NA 2MKYA 4JV5F 2EG2A 4LIWA 4PG5A 3H5UA 3EGNA 2DVIA 1SH3A 3J7ZT 4NWBA 4A8YA 1YJNS 3UDVA 1UP1A 1Y10A 5BR8J 3AA8A 4X65J 4I56A 2D3OR 2R7OA 2IJRA 1EIYB 4DMZA 4BC7A 3MM5B 1UFKA 2CWKA 1Y11A 4G65A 4DSJA 3OQ2A 4OI1A 2H9ZA 2PGCA 2UVVA 2J0WA 4KO0A 1KRPA 4BS2A 3HDSA 1YKWA 3NWRA 2D9PA 5T14A 4NZ6A 4B9TA 5CQGA 2JL9A 4ERDA 2X7IA 3MPUB 1G6BA 4TU8A 4X4OA 2HZVA 4C8OA 2XZWA 4HVZA 4ELUA 3CJSA 4AXIA 1L5UA 1X4EA 2E5GA 2RS8A 1BQNB 3BGUA 4ZJOA 4ECZA 4F02A 1K0TA 3GG0A 3QGPA 2DH9A 4B17A 3C6UA 1DQ8A 3THTA 4I0WA 2OUGA 2UXCF 3N6LA 5GAHU 4FF3A 4WXOA 3JSRA 2CJKA 2ZE2B 1YSJA 4L72B 1OPIA 4IG0B 2G0CA 2HBZB 2RAQA 2P9EA 3EJMA 2UUBF 3ISNC 4ZITA 4N5SA 5IS2A 1T3NA 3BDEA 2UUAJ 1VRUB 1YGYA 4ZLNA 1IKXB 1A9NB 4RNMA 1U1NA 3M2RB 1ZAXA 5AXLA 4WPAA 2VONA 1RTHA 2WVFA 1FEHA 3QQCD 5B09A 5KG1A 3F41A 1RTJA 2HQ3A 2A18A 1TMJA 1LWXA 4I6WA 1TQLA 4IQXA 2UXBF 2E9RX 2DHAA 1OO0B 2E9ZA 2A3JA 4IOAQ 4MK7A 2C3MA 3HVWA 1U1MA 3PIOQ 2JZ5A 4NLWA 5KFZA 3FSIA 2VQFJ 3U27A 1LXNA 1Y5NB 4WIIA 3HVTA 2MB0B 4WBFA 2XY7A 3I32A 2FY1A 2VC0A 4AYBD 3M32B 4DG1A 5CABA 1KWMA 1O6XA 3H2VE 2LQ5A 3D0GE 2AHOB 5J1EA 3MOJB 4PZVA 4F4XA 3FJ2A 1X5OA 3PIPQ 3PR4A 1UPPA 3PW0A 1IVZA 2IA6A 3ENAA 4J9NA 3KLIA 3CD7A 4PQUB 2BKOA 4F4KA 3KJVB 2RKIA 1T9VA 3PEJA 4H4OB 4I2PB 3HX9A 2PA8D 1IBMF 5HVHA 3MM6B 1QTNB 1B0PA 4FNIA 3SCLE 4O3SA 4DUYJ 2N7YA 1MWQA 3VVTA 3NMRA 5C42B 4O23A 1WOSA 2R4FA 1TR0A 3M8QB 2B5JA 1KSPA 2B7BB 3HHDA 4OHXA 3IWNC 2R7VA 1HMVA 1HHQA 1U8WA 1P27B 3T41A 3UD4P 2ATCB 3OJUA 3MFHA 4JI4F 1N36F 4Q45A 1QE1A 3R27A 1OS5A 2EW9A 3HT0A 3VGSA 1PCAA 3H42A 1DTQA 3GCXP 1FJ7A 4HH0A 2V94A 4GKJF 1HYSA 1CJKA 2VIHA 2XMUA 3MM9A 2C3YA 1HWLA 2M9KA 5L39A 4JI1F 4MIBA 1NXIA 1HNXJ 2GX8A 2E5LJ 3TVZA 2NS1B 3TA0A 3JSMA 5DM7Q 3KK2A 3HJFA 3SEOA 2DRBA 1XC9A 5LJ3Y 4HKQA 1H74A 2Z2YB 2MQOA 6AT1B 3KG1A 2J7WA 2OO4A 2G1DA 3WX4A 4HDGA 3KHHA 4NLSA 4ZDNA 2ALZA 3CC7S 4OI0A 4Y2IA 4P2FA 1UEUA 1UFWA 3OXLA 4B08A 3LAKA 4ZP9A 4FBUA 2RF2A 4LQ9A 2V4QA 4ED1A 4M5LA 1GK8A 3T6BA 1WWHA 2YXLA 4FXVA 4CNYA 2VKRA 2VQFF 1X9SA 3H0PA 3G2XA 3RB0A 4C6AA 3V6JA 1M1HA 2AYBA 4URSA 2YQ1A 2OPSB 3KUGA 3BQ1A 3CW2C 2NUUG 5D4LA 1WUUA 2IA0A 1WOPA 3UNYA 2RVJA 4CO1A 1DRZA 4U96A 4IDKA 5C7PA 4P71A 2CNLB 3HHLB 2I5JB 3M8ZA 2V34A 2FLOA 5HBMB 1PKUA 1RT6B 4OYZA 1RXOB 1Q5YA 1N32J 2BANA 1AW0A 5KFTA 3B8HA 5DQGA 1S72S 4DV6F 1U8SA 4X64J 4DUYF 2OPQA 5FD1A 1Y5IB 3QLHA 1Q0NA 3ZZTA 2ZWOA 3WDOA 4DL6A 1I6JA 3AAWB 3M9NB 1V6HA 2DNYA 3F0NA 3GJTB 1DY3A 4DV2F 4ICLB 1B99A 4KY3A 2IM0A 1U0HB 4FN5A 4X4TA 5E3AA 4DL2A 1TAQA 2C2DA 1RABB 2AX1A 1N4LA 4HR2A 6FDRA 1F9HA 2R7UA 1SUQB 3FGVA 5IFMA 1N34J 1HNXF 2HGLA 1DARA 2GMLA 1RHRB 1CULA 3WIVA 1SJFA 1HQEB 2YKNA 1WNEA 4L76A 3OT9A 4KFBA 4DQSA 3LQVA 4X4VA 2L3MA 4FYDA 4ZIWA 1IXKA 1FHTA 3N4WA 4ER8A 2Y1LB 2FYXA 4JI2J 4A8WA 2QC3A 5KFRA 2HFSA 4OX7A 1ZH5A 4KPCA 4URGA 1DFDA 1R8CA 4MK8A 1WC6A 3EUNA 5JUMA 2EK1A 1HIYA 1TKXA 2FHJD 3DYAB 5HLFB 2HMIA 3FZBA 4OLOA 4ZMMA 1UVNA 3MEEA 5D15A 2N82B 2OP5A 3QMQA 2EBGA 1I3OB 4FF1A 1WF2A 2RRNA 3PW7A 3CCZA 2V2QA 4NCBA 1VQLS 2QN6B 3BR9A 3KHRA 3KHGA 5KFNA 3M6VA 1HNVA 2X3DA 1KVIA 2FIUA 3R3TA 4I7FA 1I5OB 4UY85 2IAJB 5IXUA 1JXLA 3I56S 4USIA 4N7TA 4F4WA 1VBYA 2NLWA 4JV2A 3EM1A 4H4KA 2MY8A 5CYMA 4RU2A 1N54B 1HBOB 1SKUB 2H48B 5M2RA 3HHEA 1FESA 1KFSA 2K8GA 1FRKA 2GIFA 2J9CA 3MFIA 1SC6A 4TU9A 4E98A 4NEYA 3V6KA 3GP9A 1DQ9A 5EWFA 3NOCA 3J80Y 3J81Y 2VBYA 2IYIA 5KFQA 4LBHA 3RR8A 2ZNYA 4ZVOB 5KT5A 3BH7B 4RW6B 1WHYA 3UW1A 4A48A 2ZBIA 5A6PA 3V2UC 1O0PA 2ZD1A 2I2YA 4CNZA 3JYTB 4TKTA 3VWSA 2HBYB 5ETPA 3IS9B 2FLLA 4PXBA 2VG7A 2B6AA 5L1IA 1GXUA 1F0XA 4JI2F 3KHLA 5LXYA 1L3TA 3OLBA 1FRLA 3SIPB 1X60A 3R5BA 3DOLB 1PYOB 1RA6A 2YWWA 3I31A 2HWIA 3M2UA 1PILA 4ZP7A 5E3PA 1S7HA 1X4DA 3UVJA 3GFXA 3DRYA 2LA6A 1XIQA 1XTZA 2YNIA 3FRZA 5LMUF 4ZLJA 3TWZA 1HNWF 4ZOSA 2AQ4A 3W9HA 4ILMA 1FTRA 3R8YA 3FCHA 3B4MA 4WFAQ 2CPDA 3NRBA 2G2YA 3G87A 3I82A 2AEFA 4JI0F 3GQCA 4U9RA 2KFZA 1TFYA 4K4ZA 2EC0A 3MZIA 2CPXA 4UY8T 2WOMB 4LMZA 1T7PA 3UCZP 2QA2A 4K2XA 4ETZA 2HVIA 1IBKF 4F3QA 4AFFA 4OI2A 2CQBA 3MEGB 3H5YA 4DR3J 1RT7B 3TUJC 1VISA 2OTJS 2B4VA 2OEMA 4RU9A 2Z2ZA 1WEYA 4KE5A 3E3XA 7FDRA 1Q8IA 2M70A 2DEJA 3UDLA 1HWJA 2CQ4A 1NKCA 1FJCA 1NEEA 4WFZA 5F0UA 3KLFA 5CYQA 1N48A 4Q7AA 1XNQJ 1VJQA 1WKJA 3WC2A 3IAM9 2VFVA 3FZ2A 3R1LA 4DN0A 3EICA 4WIQA 1Y7PA 4LF9J 2RQKA 3UWTA 2V2ZA 1XWLA 4OI3A 3TOQA 5GADU 3ADAC 1BQMA 1WJ9A 2Q79A 1ZM3A 2EXUA 3DHXA 3MAHA 4ZPAA 1EX8A 3KUHA 5L8RC 3L7OA 4J9KA 3DC2A 1S76D 2FPHX 3TVYA 4OZ0A 4K50A 2E5IA 2Y0SD 2VPYB 2PI4A 4WP9A 3OR1A 1FD2A 1HARA 1HQUA 1D9AA 4DV3F 4XTTA 2ZH4A 4TNOA 3POTB 2KTQA 2V6AA 4WU2A 1EZZB 4QIFA 4N47A 4J9MA 4O3NA 2Y1RI 3HM9A 4LR8A 2QA4S 3C6TA 4F67A 1U2FA 2XS7A 2CQHA 2HVHA 4PR6A 3FBFA 1RT2B 4UF4A 4WJBA 1N56A 2R8KA 3AHPA 5C25B 3BF4A 3PNIA 4HT7A 1VJWA 4ECRA 2BDPA 3MOZA 3BEGB 5HANA 1UVLA 2E9TA 2YNHA 1T03A 4HACB 1WC1A 4OYOA 2O66A 3DLBA 3OL7A 2GAHC 1LNQA 3MR3A 3C46A 3DMJB 3ZTRA 2KT2A 2BRLA 2PD1A 2ZJRQ 3CJ3A 2XG8A 3ILJA 3NY0A 3PFOA 4JI3F 4DF8A 4YMEA 1BLUA 3I87A 2PMHA 4FKXA 1C0TA 2MTLA 4LUBA 2GQ2A 1JQGA 2MJUA 3H5XA 4Y3CA 2A2CA 1JIHA 5CAAA 3M9OB 3JS9A 5I3PA 3J81U 1QDUB 2MEWA 3IR5B 2DTJA 1VHIA 1UJ5A 3UD3P 2AW0A 2CDRB 3TO8A 2W24A 2L08A 4FYYB 1Q8BA 1H2UX 4YQWA 2XMKA 2IMWP 1TKZA 4PPZA 4P74A 3H20A 2H5IB 3VGTA 4ZJQA 1VQ6S 3A3PB 1YWXA 3EDQB 4GKKJ 1WACA 4W92B 4Y2CA 4KGXB 4C8NA 3M8WA 4BWJA 3HD2A 4PUOB 3ILOA 3D1QA 2NYHA 1XMBA 1JX4A 1JLCA 1EP4A 3OVAA 4FF2A 1XMOJ 1JJCB 3MURP 2GGPB 4DQPA 2W1BA 4G1QA 3ZO7A 4MT1A 1XQIA 4DV4J 4PRFA 4DFPA 3HFKA 4KHPJ 1TK5A 4M95A 5E0OA 3N5FA 4M5DB 5H1SV 1NPKA 4NA2A 4MFBB 5D77A 4AD6A 2DB1A 2CADA 1M0SA 3VAMA 4FYWB 3A3OB 2HLTA 3PVXA 2WONB 2DT9A 4MYTA 3U02A 2JDJA 1PJ5A 4QW9A 5CD4H 1D8YA 4ECSA 1X9WA 2V68A 1RU1A 3TYTA 2OLWA 1UL3A 2ZH8A 2ATLA 3CDWA 4OX8A 4EK2A 1N5TA 2V4JB 4V19X 2WVCA 1Y00A 3VAHA 3R2DJ 1WSVA 4A46A 1ZM2A 4NXNJ 3V81A 3CCJS 1OY6A 2ZZNA 4ZPWR 3GCWP 5LSOA 2DHXA 5A8WB 4LBIA 2HS4A 2YNFB 3PHTA 2B8PA 2R42A 4MJKA 2V8DA 3DRSB 3Q8SB 2NUHA 3KJNB 3KK3B 3AT1B 4JI8J 4FS1A 9RUBA 1VI7A 3GLJA 4DOZA 4B3RF 1UJ6A 3D0IE 3KKFA 2ZM6J 2RHSB 4LFBJ 1FDNA 1SL2A 1GEHA 1IKVA 2AD9A 2KHDA 4U7UK 2WVEA 4DSEA 1LWFA 4EGLA 3CNQP 4DSFA 3RGIA 1RT5A 4ED8A 4KGVB 3NGSA 1VQ4S 3DLLQ 3LOUA 3CJQA 3T5LA 5F3TA 2IDLA 4CO4A 2UXDJ 2JLEA 3GILA 3TP2A 3QZ7A 5I3UA 4QBUA 2NQPA 4WZQA 4OI6A 2DHSA 2PIIA 4KYZA 3ITHA 2XYHB 4DHVA 2NZ4A 4LQ3A 1FWPA 1EJ7L 3M8PA 1RWPB 2MKCA 1KN6A 3BO4A 4WF9Q 1S57A 1N0UA 3TVKA 1IBLF 1R31A 3SYZA 1YDLA 1GMWD 3C6UB 1FX4A 1XN9A 4R25A 2CJQA 2GS8A 4KKOA 2J7KA 2GVDA 2K7KA 3DM2A 5K14A 1R6YA 3NNAA 4MKBA 4RJVA 2F7VA 2DCLA 2VASA 1VRQC 2ZHOA 4U95A 4LRAA 2KG1A 4DCJB 3DDIA 2NXCA 2ZH7A 1L3UA 2VOOA 2A6MA 3OL8A 2DGTA 2XMTA 5KG7A 1TZ0A 4ED0A 4I68A 4ZVPB 3W1YC 1HW9A 2MLXA 4X4QA 3SV3A 4RUAA 2YKMA 3A4TA 4LRBA 3DU6A 3C15A 3TEGA 2W7PA 1RTHB 3BQ2A 4ETXA 2IVYA 1SCJB 3E01A 3G6VA 3VV2B 4DPXA 4NXNF 5HQ8A 4CRJA 3CTRA 4QR2A 1FXLA 5ETSA 5KOWA 1RTJB 2AJ4A 3HXMA 5J1NA 1HHSA 4MK9A 3BJYA 2KRRA 3LWLA 1M5OC 3EVMA 2QLWA 2RS2A 3SV4A 1PGZA 3NS6A 2LXUA 3NGUA 3ZTOA 3IGNA 1C1BA 4F26A 2HG4A 2GHWA 2OGUA 3I55S 3VAJA 1QAXA 4CLLA 8AT1B 1NLKL 2RNEA 5J2QA 4X4PA 2AGQA 3KNGA 4KGZB 3HVTB 4P75A 1GTHA 1XMQF 4JYAJ 2QMWA 2E1RA 4DG1B 1PIEA 1Z2ZA 5D4OA 1CEZA 3GIMA 5J1EB 1B64A 1CC8A 1H2TZ 2XMVA 3CIZA 5KFXA 3KLIB 2VPZB 1RAAB 2VA3A 2RKIB 4F2RA 1S4EA 2CJ9A 3BYPA 4EUVA 1F5CA 4M5HA 4L6V3 2A0FB 2YX1A 4M5NA 2P8IA 4EBEA 2L9NA 3CMQA 3FCWA 5L1JA 3K8WA 4CCHA 1OSCA 4K0KJ 3MD3A 1HMVB 2HIQA 5CD4A 1TL7A 1W2BR 1VIOA 2CUYA 2FVQA 5KFDA 2OI2A 2NCKL 3ZZRA 1QE1B 3I9V9 4C0OC 2I6WA 1YJWS 2G4BA 3LP2A 3CPWR 2YQ0A 1DTQB 2VF3A 1HYSB 1CJKB 1OPZA 1SKWA 3MM9B 2Y8WA 2YKAA 1HQ2A 4K5RA 5K8NA 2C3UA 3FQKA 3T1HJ 2MSSA 2HHHF 2BQUA 2CPIA 1X5SA 1S6QB 3DXBA 4NCGA 2HPUA 1PAUB 3JSMB 3KK2B 1F9EB 2FHJA 1S59A 2QMUB 2FLNA 3D1OA 5DDOC 2YWEA 4WXWA 3VCDA 1R0CB 2VOPA 1VQYA 4LF2A 4HH1A 2RF2B 1R8PA 1RWKB 1G7CB 3PJXA 2ZH2A 1TFWA 4LF8J 2RRAA 1D09B 2HBRB 5KFJA 1S1UA 5LJ5Y 1WI6A 1OQ3A 4K8RA 3IFEA 1R0BG 5J2PA 2CKWA 3KLVA 2W4DA 4IDKB 4QYRA 3PRBA 4NA3A 4TN2A 2KT5A 1Q86T 1VRTA 2HZAA 2RUSA 4ZP8A 2YPYA 3BO2A 2H3EB 2BANB 1FRXA 1JKHA 2Z56B 1FRMA 4Q2LA 3TAPA 2HQIA 1O51A 3G9CA 5IT0A 3W64A 3OHAA 1ICEB 4G1PA 2UUWA 1TKTA 3RAQA 4DR4F 2OPQB 1AZSA 2PMZD 3QLHB 3TZZA 2CJBA 5E3QA 3AOBA 2RIJA 3QATA 5HJXA 4ZVFA 1S4FA 4DR1J 3H5SA 2J6UA 2FJAB 4B9VA 2DNNA 2C22A 5KFSA 5SUHA 2MGZA 2HNDA 5GMDA 4J5OA 2BJ8A 1PYTA 5KFPA 3HT3A 1YRUA 2MQMA 2IJNA 1RLDA 1ACMB 3I96A 3Q2TC 2FJBB 5JVHQ 4OQJA 1GT8A 2IC3A 3QBCA 1CULB 3KMSA 2YKNB 2COLA 2E7WA 1T9WA 1YBTA 2GC8A 3LANA 2XZTB 3R5AA 4ILRA 4KFBB 3ET6A 2L48A 1S9EA 1NMEB 3MR7A 3KNAA 4LJMA 2AJ2A 1NO8A 3HVAA 3NCQA 2CQ3A 1FEEA 3A8JA 4CT9A 2AMCB 2QSWA 1NRKA 5HSPA 1ZS6A 2MLYA 2UUTA 3SBMA 3G96A 4OV1A 3MHYA 2EKNA 3HHLC 3QRPA 3H59A 4LF8F 2J5AA 4DR7F 1KQKA 4K4TA 3CCWA 3E2EA 1RHQB 1TKXB 1FRHA 4XIUA 2ZC4A 2HMIB 2CZVC 3MEEB 3ZZUA 5DG9A 2WSEC 3QIPA 4USHA 4Y00A 1KP6A 4L75A 3Q2SC 4QQBA 4B9NA 2QLJB 3TUPA 2WB4A 5KFWA 5F8IA 4DUTA 1YZ6A 2RU9A 4QWDA 3DOKA 2BQ3A 1HNVB 4F2SA 2W2NP 1RYSA 3I9ZA 3RR7A 3BGOP 2HFOA 4C8LA 2ZJPQ 2JC1A 4I7FB 4WKYA 2D7SA 5JMNA 3DLEA 1S99A 3DU5A 3S8SA 1JLBA 1SJ3P 4DV0F 2MPUA 1CBKA 1MMNA 5CYMB 1S9GA 2CRLA 4FVCA 3R9LA 3UN2A 3O8WA 1NB2A 3KK1A 4YHHJ 4DS4A 1CLFA 2QLBB 4ITSA 4P73A 3BN4A 4RBTA 2HAIA 5CH7B 3E51A 2M0GB 1VQ7S 1URRA 3NXZA 2MKIA 2ZH9A 3QRRA 1O5JA 2LDYA 3RRHA 3GR0A 4KTQA 3KUEA 2WRMA 3R7SB 4FXDA 4L3NA 4I4BA 2EFQA 5HO4A 3C8YA 4L74A 3BYRA 2OTLS 4NOHA 4W4MA 2ZHAA 5E3RA 3KJQB 2ZD1B 2ROGA 2FGOA 2BACA 3EXYA 2RDJA 2D3ZA 3NEKA 2VG6A 4OJGA 1SJQA 2ZBPA 3D6TB 3FFIA 4AE5A 2VG7B 3H8YA 2GNKA 3D1HA 1KTVA 1WG1A 1WSRA 2B6AB 2P9CA 1R8BA 2AYMA 2W2PP 1QVFR 1XNRF 1B70B 3HHLD 2I38A 3AD9C 4OHVA 3DXSX 1GX5A 4OMFG 3KLGA 4DFJA 2M3DA 3M2UB 2VB6A 4CLPA 5DLGA 1NKBA 2ZWPA 1U48A 3MTKA 4OV6A 4KGKA 2JOQA 3UVJB 1VK8A 1CPZA 4P7TA 1RDRA 1Y3KA 1RU2A 2ZFHA 2YNIB 3CMES 4QZVB 4WWSA 5IM0A 3BSOA 2W25A 3VALA 2VD3A 3E8OA 2KH9A 2ZNZA 5IC4B 2H4YB 2WK4A 4OZNA 2PO4A 1S1WA 3D0HE 2BE2A 3GG1A 2IBOA 1IM4A 3KXDA 3RU0A 4I1TA 1LWEB 4RW4A 1JLGA 1Q7YT 4EBDA 3OL6A 3HK2A 1X4HA 1ZAWA 4K4WA 2KFNA 4NLYA 2POKA 3TNVA 3TJ9A 4ZP6A 1DBDA 1N0VC 5L1KA 2C28A 4PXEA 2BV3A 2V2KA 1SH0A 5EX3A 3EGWB 3ENVA 3EE3A 4DS5A 3FK4A 2GV1A 4WCEQ 2ZVSA 7FD1A 3AQOA 3GV7B 2Q6CA 5H9FK 4RKUC 3KLFB 5CYQB 3UPFA 4WTYA 3ZZYA 3RB4A 2LKZA 2V9WA 4IG3A 4TLRA 1VC0A 3GFZA 1JMTA 3IMQJ 4DQQA 4EEYA 1C2PA 1W26A 3MPYA 2WHOA 2F4FA 4N8OA 4DV5F 3PV8A 3CJ4A 3EDRB 2HQCA 4L73A 2BR0A 1HNIB 4F0MA 4USWA 5IWAJ 1FNMA 2E1AA 1LOUA 4DZ6A 2H1YA 4XK8C 3M8YA 1BQMB 1CC7A 3PFEA 3X3UA 3U1MA 1NJYA 3G4SS 5B7WA 3QT7A 1GAOA 4M1KA 1WF0A 2E44A 3VAKA 1RWWB 2HHWA 2FTRA 2G13A 4LF7J 2F9JA 2GMJA 3MMCA 5ETKA 4C11A 2JLFA 3OR1B 1HQUB 3KDNA 3JTPA 4K59A 1IWAA 2GIRA 1AT1B 2KHCA 3KYLA 4WZMA 3C2PA 1Y3JA 2KYXA 2OELA 1B3TA 5KFMA 1AB8A 3C6TB 5G0RA 4FPRA 1X5PA 4PWWA 3KDOA 2AWZA 4RW8A 2CJAA 1N5VA 4O3QA 2CG4A 5M2PA 1FFWB 3BBBA 4RW7A 2CQ0A 1T05A 2DIVA 1GX6A 1SL0A 3G86A 2ZDPA 1JLEA 4OLPA 1NCLA 1YJ7A 2YNHB 1T03B 1RAJA 5K8MA 1YRTA 4ZVUB 3OW2R 1HI1A 3C14A 1SPBP 4USKA 1RBAA 2RB7A 2XMWA 1PC5A 1KLMA 2M8DB 1TUGB 3TZWA 3US5A 1N8RT 1RZMA 5KT3A 4MIWA 1C0TB 2R7XA 3W5XA 3T1YJ 4ZPTR 5DG7A 5F8HA 4X66F 3BZQA 3THVA 1D9DA 1UKUA 5KG5A 2XHCA 1WG5A 5HJYA 2QV6A 2HQFA 1RUSA 3AJ1A 3GWCA 4A8XA 5LSLA 4CP5A 1TKZB 2ZITA 4NLQA 5MAOA 1WTFA 4PQAA 5LOQA 1GMVA 3CJ0A 1LWCA 1Q8KA 3QZ8A 3MF5A 2CAJA 5LXRA 4HLBA 2HFUA 5F8NA 3PG9A 2VFSA 1JLCB 1I94J 1H98A 1EP4B 3WIUA 3EPIA 4LF5J 2APOA 4EZ9A 1IQZA 4G1QB 3RW7A 2DXDA 3IO1A 1B4SA 3FQLA 3CGIA 4OZ5A 2AYEA 2QYCA 1J5EJ 3QFWA 2LYVA 5DDQC 4DL5A 5A8RA 1JJ2R 3B54A 2XO6A 2OPRA 2A6OA 3CCQS 2A10A 3MECA 3GSIA 3T5JA 4RUCA 2Y9HA 1C4AA 3CJKA 3MEDA 3W2VA 3CVKA 2HK2A 2HFZA 3KWMA 1RHJB 1MNEA 1N5QA 3HZEA 2YH0A 2GW8A 1T9XA 4KT0C 4D3HA 1P8GA 4OFZA 2QL9B 1P1LA 4DR6F 4C4WA 4P52A 2XZDB 1QLNA 4UTGA 2CA9A 2E5JA 3V81B 3RW6A 4RNFA 2W4CA 3RG6A 1RYRA 3OL9A 5DQHA 3IRWP 2PI5A 4YP3A 3BSCA 1Q79A 3NBPA 3D2WA 1LXJA 1SV5A 4FVMA 1FCAA 1A7GE 1VLOA 2MXYA 4NI2A 2VFRA 1JXVA 3QFHA 4ZS6A 1IKVB 2M4MA 1LK7A 3RRGA 2YX7A 2X1AA 4K4VA 1MSWD 2OHDA 4LF4F 2ROPA 1LWFB 3TQ1A 4B3OA 4F0HA 4FF4A 4NZ0A 4C8KA 5DLFA 1RT5B 5ADZA 3DCAA 1N5YA 1ZOTA 3GIIA 4DPTA 1HR0J 4NXMJ 2NXEA 2CG8A 4EO6A 2UVRA 4NRUA 1S7IA 3A8EA 4QCLA 3DRPA 2XLKA 1BGXT 5I3UB 1MN7A 1TAUA 2XYPB 2AT1B 2YQ3A 3GE9A 1L3VA 1WKLA 2C3PA 2LECA 3IP0A 3ITHB 4JV5J 4DPWA 1CS4A 2AU0A 4Y6IA 4ATNA 5ETRA 4GC6A 2CQPA 2B9EA 3M8PB 1CJTA 3J7Z5 5HQLA 2DHHA 2J6SA 3UDCA 1YJUA 4LF5F 3DLGA 1NSQA 3BKFA 1X7VA 4N76A 1YRXA 1V3SA 3CULA 2X1FA 2YNGA 4KKOB 5HI7A 2GVDB 1NJWA 3DM2B 5K14B 5ETVA 3RAMA 2FZKB 1Q16B 1HKAA 3CD5A 1Y0HA 1NH8A 2CVEA 4NASA 4WYWA 3L3CA 2QZ8A 3GB0A 4Q0BA 3R5CA 4OJ3A 4K4UA 5HP1A 2DNZA 4UOGA 1UVJA 3V4IA 3CCSS 3CE8A 1RQ0A 1K8AT 4JI5F 1CSJA 2RILA 1EHWA 1IJFB 4F7VA 4EWTA 2HAFA 3IM9A 4NYOA 2R9LA 2YKMB 2GHVC 3CCES 2VQEF 3C15B 2BJDA 3O3LA 2XWXA 2FZGB 3GJSB 2XSJA 4PG4A 4B3TF 4DLGA 5KFOA 5A2QY 4RX6A 3E01B 2HLUA 1NDLA 4PXCA 2AKWB 3SSQA 2LFVA 3W66A 4PWDA 3MPWA 1UVMA 2UUBJ 5KFFA 3UCGA 4J9QA 3T9NA 5T7LA 5GAEI 1C1BB 1UMJA 1T94A 3R5GA 2IPOB 2KM8B 4QIVA 3BPSP 3OTOF 2BA9A 2F4VF 2QLXA 4CLTA 1D1UA 1JLQA 2UUCJ 3MD1A 5J2QB 2ZVIA 1RBLA 2O5DA 3PYEA 3MPVA 4NZ7A 2WVDA 5H9EJ 3BGFA 2BRKA 4U67Q 2DK2A 2V4RA 1M5KC 3NS7B 4HI1A 3DLJA 2ILYA 4OYWA 1TKDA 1HR0F 4NXMF 3C66A 2DCUB 2VA2A 1UETA 4DR5F 1VBZA 5HN0A 3MUMP 1ROFA 4KH0B 4BCAA 2UXBJ 3B6BA 3QJLA 2H4WB 4DZDA 2HGMA 2RDIA 3Q8UA 2CIMA 5CZXA 1C0UA 3EZUA 1TV6A 2I1RA 4OZLA 2Z58B 5KT6A 2KJVA 5KTQA 2VJVA 2LP4A 4K7QA 1K44A 1VQ8S 3B82A 5JJBA 2G2ZA 3TW0A 3M1VA 3NOGA 3PX0A 2HGNA 2XLJA 1TL7B 4X4SA 3HSGA 4TYBA 3CCLS 5F8JA 3QWPA 3ZFVA 1DTTA 2QLFB 2YBVA 3CJ2A 4NA1A 4FKYA 3LP2B 5IC6B 3NAHA 4R5PA 4ED2A 2VC1A 2DR6A 1IBMJ 3CCVS 1OJ4A 3A8KA 1RTZA 3JQMA 4ZN1A 3MCOA 4KGMA 1YI2S 1MWZA 3HJVA 4DR2J 4AQYF 5HVGA 2JRSA 4LRDA 1UZHA 4NCGB 2O3DA 4ZPVR 2VBWA 5DM6Q 4BWMA 1LQ9A 2OFGX 1TUWA 1FDDA 1KC8T 3LP1A 1N36J 4JI4J 5CXTA 2GCFA 2LQ8A 3ZTQA 3GIJA 4UW2A 4W90B 2KZMA 1NDCA 3UNGC 4ECQA 5B0GA 5ETNA 4GKJJ 2VU5A 1J27A 5IV4A 4IQMA 4J9SA 3FUYA 4JB8B 5F9LA 1UVIA 1QAIA 3PDNA 4UT4A 2P9GA 4JI1J 5FIIA 1MMDA 2UUCF 1V3RA 2ROEA 4GRSA 3IBWA 1S1UB 3DLHA 4CM2A 4P10A 4DX6A 1F5BA 1RAEB 4JP8A 4Q8EA 5J2PB 3RBXA 3HO1A 2AIRB 2ZBQA 2FHKA 1N33F 3LUYA 3MCMA 4U7CA 4O44A 2CVIA 5M2UA 2H65B 3NKYA 2NXNA 1VRTB 3A12A 5EX0A 2P5VA 5GAEU 4OI4A 2LEAA 2F5GA 5KFGA 3UI3A 4ZN3A 1JKHB 3MAAA 3HI9A 2FVRA 4X62F 1DQAA 1QUPA 1PSDA 4WTOB 1TKTB 3GTYX 1AZSB 2KRBA 5ETTA 2E5HA 3NAIA 3MCNA 4JBCA 4LF6F 2JSXA 2MZSA 4RPFA 1S1TA 3J7YI 4A8SA 3KG0A 2CJYB 2XY6A 4GO5X 4P2SA 2R7QA 2J8SA 4F0KA 1LEOA 2QSFA 2MHNA 3CJRA 1CJVA 2RE1A 5A6WA 2U2FA 2MGZB 2HNDB 3R5JB 3I0RB 2FLPA 2KZZA 4DV6J 1WELA 1TL5A 3HCXA 4CO2A 4CQ1A 4ES3A 1FVQA 2ZHBA 4DR2F 1LFPA 4DUZF 4YR0A 2UV8A 2IC3B 3LPEA 2N7CA 5IV3A 3K89A 3WHIA 3JXOA 4F4AA 2CDQA 3BQ0A 3NWGA 4TY8A 4WFNQ 3ISND 3ET6B 1S9EB 2Y1JA 2XM3A 1H3DA 4DV2J 4O3PA 5AXNA 1FD8A 4CIOA 3G8QA 4YB6A 2X51A 3THPA 1RP5A 5BYSA 1U24A 3ZZPA 2XI2A 2YWHA 4KV8A 4J9PA 1OWXA 3RB3A 2D1CA 5B0DA 3R7BB 4BBYA 1S6QA 2AJQA 2D3O1 2W4PA 1P9QC 3D6HB 4CLYA 4I67A 3LAMA 2PEBA 4GMKA 1EB0A 3SCKE 4ZPBA 1R0AA 3QIPB 5EDWA 1RAIB 3Q22A 4DFKA 2BJ9A 1NB7A 1KVJA 3FDSA 2BBEA 3M9MB 4KHRA 4DDFA 1MMLA 1S0NA 3DOKB 1IKYA 5DS7A 1S0MA 3A13A 4O0IA 4DL7A 3IAS9 3P8BB 3DLEB 3NL0A 1U0SA 7AT1B 3QO9A 1JLBB 3W62A 3HHKA 2KI2A 3W63A 1H0HB 3O1LA 3NGTA 2GA7A 2BJ3A 1V9OA 1S9GB 4IYQA 2CPJA 3KK1B 2XGQA 2D74B 2E7XA 2HS3A 1F3VA 2E29A 3RUBL 4TLQA 4O0NA 3TA1A 2OMOA 2DD8S 2GAGC 2K1RA 1OY9A 3OFFA 3PY8A 3UD5A 4HTJA 2XS2A 1T02A 2EG1A 1RTDA 1G3OA 4NLUA 2ZH5A 3MPDA 4X4NA 1TVRA 1VQ9S 2LXFA 2YKQA 4BDPA 2DRAA 1BXNA 1SXLA 4N8NA 2VG6B 3DGVA 4DBQA 4RWXA 2CZ4A 3FFIB 5A0YA 2EFVA 4LBPA 1L3SA 2XTJP 3D28A 4ZVTB 1BWEA 4B3SF 3R97A 2L9WA 2KB2A 4U6PA 1U47A 2XBPA 2RDDA 3KLGB 2KDOA 5HMYA 3VQTA 1VCTA 2RSQA 3RBDA 1RISA 3JQKA 4MIAA 4Y34A 3R6LB 2YX4A 2QYGA 1S6PA 1YITS 3P5BP 4FNHA 4WP3A 2F63A 3AJ2A 1RAFB 5IM0B 2E7VA 4LRFA 1H72C 1S1WB 4X84A 2CZ9A 2FDNA 5KT7A 1ELOA 1YX2A 2MDAA 5L1LA 2G0JA 3N0VA 4H4KC 4TVAB 3HP6A 1M1KT 4FZVA 4Q43A 2WW8A 1Q95G 4QOTA 3L7UA 2BE2B 2XNQA 3D9BA 1NK0A 1X4AA 5DQIA 3VTIA 1KQGB 1VBXA 4RW4B 1JLGB 3RBEA 3P96A 1KOOA 1UVKA 1S77D 4NLTA 3O6QA 1G1XA 1U2CA 4QU6A 5LMUJ 3DRRA 1NDPA 1PAEX 4DV7F 3I6PA 1HNWJ 2A1BA 2J9DE 2DNOA 4IFVA 3PKYA 2D9OA 3IGVA 2ZBRA 3K58A 3V6DA 3MM7A 4F50A 1DLOB 1K1QA 4F3OA 2N3LA 1U6FA 2EKYA 2QJ3A 3MM8B 3TA2A 1SKSA 4F36A 4JI0J 1FWKA 2VH7A 1HD0A 2GJIA 3WBZA 4NLVA 3AOCA 3AH6A 3RTVA 5LSRA 2XCPA 4IG3B 3LP0A 4USMA 1FJGJ 3P4UB 2FC8A 4U8YA 4RZRA 1IBKJ 3OXFA 5BYQA 4HL9A 3TX0A 3EGZA 4JI7J 1OMSA 1XJWB 3FVYA 2EPIA 4N56A 2ASJA 1OIAA 1DHMA 2IMOA 2RMLA 3RBZA 2Z57B 1Q53A 2DNGA 2ZZTA 1NUEA 4ZVEA 2X1GA 4AT1B 4R0JA 4M8LA 1RCOB 2B51A 1ZYQA 3L9ZA 3K57A 3MMCB 1O8BA 1RT4A 4YDXA 1KVKA 5JXSA 4C11B 3EVWA 4M5IA 2MY7A 1WHWA 2PC6A 3A1YG 5D4NA 3BGLA 1APSA 3N28A 1VQMS 1MROA 4NYPA 4YUDA 2XLIA 5G0RB 2WAQD 2HVDA 1Q8LA 4LIRA 2BUNA 8ATCB 4RW8B 4PAAA 2OJ3A 4IRDA 1NK8A 4EU0A 5ETMA 1NBEB 4RW7B 4YR3A 2F8HA 1T05B 3U1NA 1TELA 3UFCX 5BXIA 1JLEB 3W2WA 1HBMA 2N4CA 3A3NB 1RLCL 1UAWA 2J0SD 4DV3J 1U1LA 1F2HA 4J9OA 4NPOA 2HFVA 1REVB 4NLRA 2LU2A 5F8GA 3C14B 2PN6A 4ANCA 2K3KA 6FD1A 1KOHA 3UR0A 1KLMB 1R27B 1P6TA 1VC6A 3GZ7A 2DRDA 1IN0A 3OHBA 2MYFA 1YBAA 1AFIA 2DEIA 4Z7YA 3D6FB 4OYIA 4IR9A 3UDEA 2V8HA 2D3UA 1G2EA 2DXEA 2QX0A 4C0HA 4M5JA 4WK1A 1YHQS 1PBUA 5I4MA 1QVGR 1FRJA 1LWEA 2FJWA 1WKKA 1FJGF 4KC5A 5KAKA 2Q3PA 2OPPA 5JVGQ 1U25A 1LWCB 4O4GA 4JI3J 1V3ZA 4ZVRB 4JI7F 3W3SA 1FK9A 1NSKL 2NXUA 4ZKAA 1IKWA 2XB2D 3QIDA 5F41A 3SMZA 4V19J 3QNWB 4LRCA 2BKPA 4NLGA 3D6MB 2NSBA 3TEHB 2I8EA 4C2MA 2VBZA 3K5LA 3TI0A 2KFYA 4WFYA 3CXCR 4G6VB 2WBRA 1NZAA 2VG5A 2PSZA 2VJUA 5A8RB 2ASYA 5CCMA 4ANDA 1LW2A 1U1OA 3CDBA 4OYMA 2OPRB 2HW3A 2HFNA 1SIWB 2DKOB 3MECB 1HNIA 3I5AA 5GAHI 3K5NA 3CJKB 2F40A 1QD1A 3MEDB 3QPIA 3GIKA 4XDDA 2VODA 3W2VB 1N52B 3VZIA 1SQFA 3HSJA 1TK8A 4IH6A 3IWLA 4XPEA 3OTEA 2ILZA 3CC4S 4CLWA 2LU1A 4ECUA 2QO3A 3FKBA 3D3CJ 3H40A 2HK3A 5E5NA 4YY3F 4IOCQ 5F8LA 3M6WA 4DN9A 3NNCA 2UVWA 2MLZA 1B7YB 2P2CB 5AT1B 1WTBA 3NBPB 1SV5B 4OL8A 2HVZA 4C3KA 4NI2B 3RJMB 4PG8A 4A4JA 2BE9B 3NGRA 3KLHA 2ZH6A 2IM2A 4NEZA 1GQEA 4B3OB 2AGPA 2VDIA 2QMXA 5D0EA 5CZVA 1N5YB 3CD0A 3QJPA 4OJ1A 4K2JA 1FI4A 4LVOP 1OY8A 3D66A 5IQ6A 4J91A 1IR2A 3J7A1 1KFDA 3DRPB 5LMNF 1IR1A 2CPEA 1FKOA 2GJFA 3QGHA 2FB0A 4B3RJ 2CPHA 3AB4B 1CS4B 4MKVA 2ADBA 2KU7A 2IM3A 3W7BA 1CJTB 1KDNA 3DLGB 4FPIA 2W9CA 2CNNB 3EX7B 4RL1A 1RKJA 2HURA 3J80U 2R7WA 2YNGB 1IUJA 2K3IA 1NJXA 3FCVA 1MWYA 1RBOB 3OBIA 3SXLA 2LA4A 2EBEA 5D4PA 4OIXA 4JOUA 3MMJA 1VIXA 1VFJA 5B0BA 2OAUA 2RHQB 2R7RA 4IRKA 4Q0BB 2SXLA 4YB1P 2FHMA 1FE4A 1S6UA 4QYZK 5HP1B 4PXDA 1LKZA 3V4IB 1HNZF 4KBIA 4F25A 4Q44A 2MZJA 4DWIA 2ZDOA 2ABYA 3M6XA 2BJEA 4R8UA 1IBLJ 2LQBA 2HHTA 3IG1A 1S48A 3CJ5A 5K20B 1KD1T 4ED4A 2XSJB 1CQMA 1UEKA 5C2GA 4LFAF 4Q2MA 2JX2A 4CWBA 2NPIA 1SQEA 2G2OA 4QWCA 2IVMA 4ZVSB 4HHJA 3MR5A 4PWDB 1X4BA 3H90A 3TAQA 4Y28C 3OFHA 4GC7A 5AXKA 5T7LB 3JAMY 2XC9A 3R1HA 1ZETA 2U1AA 2ZOGA 2VKZG 2F65A 1T3OA 1JLQB 3BBCA 3P6YC 3FEZA 3H2UB 1M5HA 2NYIA 5A76A 3QT6A 3MI7X 1QSSA 2B9XA 2PMWA 1T8EA 1PO6A 3KTQA 4JV0A 4UZBA 3BS9A 1S1VA 4DSIA 3ICLA 4TY9A 4E2FB 3AA9A 3CSKA 1RHUB 1JK9B 3ENQA 3HFZB 4KHMA 2FVSA 1VBKA 3KLEA 4JI6F 3P5TL 1RAGB 1C0UB 1U49A 3OUYA 1TV6B 3HLUA 4B3MF 3IR7B 4G3IA 1XMQJ 3L09A 5L46A 1TUVA 2GQQA 3H98A 1WI8A 3HMJG 2R2UA 4ES2A 3GJRB 3M1VB 5BR8F 4S0MA 4X65F 4M5MA 1RWNB 2BX6A 2O1PA 4J90A 3TJAA 3F44A 4OYXA 5IT9Y 1NU4A 1DTTB 2XYGB 1D8ZA 4C7QA 3O44A 3IM8A 3SDEA 4USVA 2ZBCA 1VQKS 3J7AN 3V6HA 4DFMA 1OSDA 5DGBA 4R5PB 1ULRA 5U47A 3MCSA 4QYZJ 3D7SB 3GU0A 2EEYA 4CT8A 2VPXB 1JB0C 2OD4A 1GTEA 3EZOA 2JNJA 1VS3A 1RB0A 1Z1ZA 1WEZA 2EFOA 3ZXWA 3QAEA 2KM8C 2W2OP 1ZPWX 1HFEL 4KRWA 2G9OA 1YJVA 4I64A 3AODA 3K0JA 4RUBA 2W8KA 2KT3A 3IR6B 3LP1B 2FVCA 3JTOA 4NLOA 3QSYB 3PTWA 1LK5A 1FXDA 5D3GB 2BMBA 2DY1A 2CNOB 4PG7A 2RQCA 2RH3A 3UN5A 3DN9A 2DY9A 3BDPA 1MW7A 1TL3A 2RQ4A 2AX0A 1RWVB 4PPDA 1CG2A 3LGHA 2HHHJ 1ZTTA 4HHUA 4ZLLA 2RUGA 4KQZA 2XI3A 4O3OA 4KPYA 2QE5A 3ETMA 3D68A 1NJZA 4ZVGA 4TQRA 1REGX 1S1XA 3ZZZA 2UUAF 1KONA 4XAKA 1VC5A 2DYAA 4C8MA 2E66A 4O44B 5FJ4A 1UWBA 2AJFE 2MQLA 2VDHA 3LPYA 2B7CB 4J9VA 1X5TA 4DV1J 3Q8VA 4P7VA 4WKRA 1SC3B 2VHGA 3MAAB 2HNYA 3VZHA 2IHR1 2WTFA 1PYSB 3IRXA 4NMXA 2GJ2A 4F3MA 2AGOA 5EGYA 4DXLA 3PR5B 1SC1B 2AF6A 4ZCMA 4ZIVA 4TU7A 1S1TB 3TARA 4UOHA 3A8IA 4CH1A 2BOPA 3N01A 4OYPA 2HKEA 1LW0A 4HT5A 2V9KA 1CJVB 4I69A 3TAMA 1URNA 1S10A 1S6OA 4ZK7M 2GO8A 1SC4B 2LQJA 1Y9OA 4AL6A 4USJC 4W98A 2B9YA 2IDEA 2J9DA 1KLNA 1QTMA 2C2EA 4DR4J 4ED3A 4P2MA 1S97A 1U1QA 2WSFC 1NHVA 2IVFB 1C1CA 1GH8A 3G82A 4TY8B 1VGYA 3LA0A 2Y1IA 2HS0A 1UFLA 2OSQA 3H4DA 3BN7A 3BR8A 4B9UA 1CJUA 3FMWA 5AJ3J 4DPOA 4D3GA 3JAMU 1BE4A 3OFEA 1VK3A 1QM9A 2R8HA 4RNNA 4B02A 1NHKL 2C2KB 4USUA 4IOBA 1NM2A 4KV8B 4QIWD 5J1PA 1FNXH 3C3LA 2CPFA 2R8GA 2V0NA 2BZ2A 1YJRA 1UA1A 4TXSA 2GMHA 4USTA 1R0AB 2B0GA 2OIHA 4IH7A 4LVNP 4NYZA 2K2PA 5HMXA 4ZHRA 2VL1A 1U1PA 2E5LF 2DNHA 1RT3A 5KFBA 3MXHP 1HD1A 1ZPVA 4FYVB 2O01C 2XWYA 2H51B 3P3DA 3TRGA 3MUTP 1IKYB 4DV1F 1W25A 3DLKA 1Z4UA 5KFUA 5CA5A 1V5IB 3K5MA 1FTCA 3OTDA 4DU7A 4CO5A 1AFJA 3QO9B 4DR7J 2BM0A 2DH8A 5CYJA 3L7PA 3FC9A 3LTOA 2JH3A 2KVQE 2W9AA 1NNDA 2JEFA 4YOEA 1FO1A 1EKSA 5BJRA 2HQGA 2GHPA 4OZ3A 5L38A 2MQPA 5IT9U 4B9MA 4C9DA 3W9JA 3OSPA 2CQ1A 2K1RB 3PW4A 2C2RA 1KR4A 3NS5A 3JTNA 4J9LA 4X2BA 2R2TA 2KO1A 1VQSA 2I9SA 2KJWA 3VAGA 2LDIA 3W8GA 4QIGA 1FNOA 4V1Ak 3BGRA 1WD6A 3HF5A 4XDCA 3V5RA 1RTDB 4DV0J 3MGJA 3MMAA 3OVBA 1WEXA 2NSCA 1N32F 3G71S 2BQRA 1TVRB 3W65A 4CLSA 5D0GA 3M2VA 1CVJA 4HEA9 2H54B 1JNZB 4F4ZA 3U7JA 2DISA 4X64F 1H73A 1FKPA 3Q83A 4JUZA 1RTIA 2B56A 4CI0B 3CB4A 1J5OA 4PCQA 5A0YB 5AJ3F 5GADI 2AZ1A 3I0RA 4WE1B 3KMQA 2M5YA 5KG6A 4FS2A 4K4SA 3B4DA 1RWMB 3DNCA 1QSLA 4ECVA 4RUHA 3QSIA 4ENOA 1TU0B 2EVZA 1S6PB 2CQDA 3BBFA 3FMBA 1PJ7A 4I2QA 3HKZD 5DJBA 2GO9A 3PRDA 3EZ5A 2GVZA 1N34F 1AROP 2W2MP 3S7RA 2YKPA 4Y0FA 1XNRJ 1P1TA 1NK6A 3CDAA 2HRTA 1GNKA 2VUGA 5HMZA 3DI6A 5IT4A 4ECXA 3I4HX 2DO4A 3CCMS 3L95X 2PFFB 1M90T 1FFGB 1XEZA 1VOMA 2X3GA 2V5HG 1WG4A 1GFWB 1F6TA 2IYGA 1M1GA 1WHXA 1MU2A 3IA0A 3M8RA 2OD6A 1Q7LB 1J2VA 1XR6A 5LT5A 4LFCJ 3DRRB 3ELHA 1HBUA 1R6VA 4IFVB 1BQXA 3I5CA 3CCRS 3V6DB 3MM7B 3PYGA 5EN1A 5KFIA 4DSLA 2FJVA 5KT4A 2JWNA 3TR5A 3IWXA 1WF1A 4GVBA 1Q4RA 2BKNA 2DGQA 3AB2B 2F1FA 3LP0B 8RUCA 3AQPA 1WC3A 3HKWA 5F8MA 1HBNA 4UOFA 3BKUA 1YZ7A 1IR0A 9ATCB 2DJWA 2FJDB 4DPYA 2ZUGA 1DAXA 1RHMB 2NREA 1XR5A 5FDLA 4ZLPA 1YBUA 3TZXA 3NLCA 1KQSR 3CIMA 1YJ9S 3HULA 1KS2A 4C3LA 5GAGI 1F2GA 2R3VA 2YTCA 1H7XA 2HHPA 3NMAA 1RT4B 3T19A 3VGVA 3N79A 3N5BA 3AD8C 4RW9B 4DV5J 4DF4A 4XPCA 2VBXA 4OX9J 1D9FA 4HTIA 3EXCX 1MROB 2Y3YA 5KFKA 3GONA 3VQSA 4CDIA 1H7WA 5J2NA 2RRBA 5KG3A 2UV8G 2EI5A 4BHQA 5KFEA 2XHWA 3N6NA 3DOMA 4NL5A 1S9FA 2XQCA 5GVQA 3PZPA 2XGPA 1UWAA 1Q1KA 4NMLA 2FZCB 4Q5VA 4CLZA 2W9BA 4YB5A 3BPDA 1JWWA 4MAKA 1R8AA 3W2WB 1HBMB 2DNKA 4RWWA 2QG9B 1N5SA 3CF5Q 4Y2AA 3C16A 4DEZA 1DJ0A 1NPPA 1X4FA 1SKRA 4M5GA 2FUG9 4CO3A 3CD6S 1EQ0A 1S5ZA 4LFCF 3CO9A 2X1BA 1G4CA 5K8OA 1XK8A 3TUIC 2ASLA 1U02A 1HWKA 3PEHA 2J76E 2ZH1A 1SJ4P 1B0VA 4MKYA 4ELVA 2Z30B 4OHYA 1UJ4A 1VQ5S 1RACB 4DCOB 2KXNB 2AEJA 3M30A 1Y4ZB 3M6UA 1YQHA 2OPPB 1KHWA 4O4GB 4B9SA 2XY5A 4YFUA 4LSNA 1FK9B 4ID8A 5FLXY 4M63A 2IJFA 1UW9A 2A2DA 1OQ6A 2YWGA 1DLOA 5I42A 3PYFA 1IKWB 4CLFA 3FNNA 4X66J 3MM8A 2MKSA 4DR3F 1QJHA 1SB6A 1KEKA 4HDHA 2ZUAA 2F3JA 1V5VA 1TK0A 1S0VA 1GXLA 4DL3A 4QR0A 1JLFA 3MMBA 5GMEA 2VG5B 3DRXA 2XO7A 5F9NA 2DBBA 1NSPA 5THWA 3QJJA 3BM7A 1LW2B 5K5MA 4DPUA 2WW4A 3ZTPA 2V2VA 2J9EA 1HWIA 1HPZA 1Z2LA 2GZOA 3PJWA 4PG6A 4OX9F 1FA0A 1ZZNA 1RT1A 4C8YA 3OD2A 2QIFA 2AJ1A 1PJ6A 1SBRA 3X1LB 2UZAA 1XNQF 3WZ0A 4OYAA 4UQGA 1UZDA 3NCPA 1K0VA 3H4BA 2E1PA 4IO9Q 4LF9F 3IBCB 5B0FA 3SQGA 5HQMA 5HROA 1RCXB 5A8KA 5J2MA 4EYHB 1SJ1A 2MKHA 4OZ2A 3BKTA 1R3NA 2HWHA 1ZA1B 4PEOA 5GAGU 3SZ2A 2OEJA 1T9TA 2R7TA 5IOLA 1SIZA 2P6TA 5E41A 3LH2S 4OHZA 4EZ6A 1MLAA 2YY3A 4X4RA 1RGVA 4EO8A 3EGVA 2V69A 4AXJA 4QW8A 3HPOA 4F4YA 2HEKA 1H6KX 5D0RA 3HSZA 2F9DA 4ECWA 3LGMA 2PFDA 4ZCKA 3PW5A 1YG0A 4CLUA 1HHTP 4RR5A 3I0SA 1TL1A 2KYZA 4AL7A 3KLHB 1YLXA 4RBUA 1M5PC 3W60A 2D69A 1TTHB 1ZM4A 4QJVA 3J81j 1VLYA 4ED7A 2YWFA 4NLDA 4DR6J 4RO0A 2KVIA 3JQJA 5DDPC 4CTAA 4CYUA 2L9DA 4QWEA 1UA0A 2BEFA 1REVA 2AJ0A 2E1CA 1EETA 2HVEA 1FKOB 4LSLA 4EMDA 5GMKa 2G0IA 3OJSA 1N6QA 2CWXA 3IN5A 2FD2A 2MKJA 1BWVA 1R89A 2KXHA 4IRCA 5IQQA 3JSYA 2W9CB 4LF4J 3AOAA 1W7WA 4QPTA 2BVZA 1EKRA 3OV7A 2DR8A 2WB1D 3UE2A 3PW2A 5AE3A 4PYAA 3GFYA 2JJ4D 3N9UC 3OR2A 2ACYA 4MMOA 4YN3B 4RNOA 1GMWA 2AYGA 3W61A 3IC1A 2I0XA 4URQU 5B0CA 4EYIB 4FYXB 2KXFA 5DRKA 1FJEB 1S12A 1E6VA 4IFYA 2ZJQQ 1JLAA 3R7NB 2CPZA 1HI0P 2R2SA 5HVFA 5K9FA 4P2XA 4KO0B 2E1MC 1ZTWA 4GKKF 2HNZA 4R8UB 4AUKA 4K4XA 2C3OA 3IG1B 4OYBA 5KG4A 1HL6A 3TUZC 4IR1A 1XMOF 4RBVA 5C24A 2VFUA 3UCUP 4LR9A 3CWJA 5EUHA 5SZTA 5K8PA 1NSAA 3PM9A 2GFFA 4DV4F 2JEGA 3LGNA 2FGCA 4KHPF 1NK9A 2OH2A 4IKAA 1YJTA 3JSBA 4N41A 5DDRC 1DZ5A 3FRYA 4M5KA 2IRXA 4JI5J 4JV1A 1KKHA 1HW8A 2HRUA 3DGPA 4QWBA 1NPRA 2MJNA 3GYGA 4CLKA 1IWGA 2VQEJ 4C98A 1HI8A 3UN3A 3GIRA 4UZCA 3D4JA 2PEHA 2C1EB 1QSYA 4PKDB 4B3TJ 2J7UA 4A47A 5KFLA 4DCPB 2W8LA 2BE7D 2B8QA 1S0OA 2DNMA 1TP7A 4CO0A 4IH5A 1BMQB 1S1VB 4QWAA 1RHKB 4I6AA 1F1BB 2DR7A 3BSNA 2YVSA 1RAOA 3ONQA 5FLXU 2B4OA 2VFTA 2CXEA 2XMMA 2EFGA 4FP9A 4ID5A 1F9FA 4H4MA 1BY9A 1R8HA 5EWEA 3OTOJ 3KLEB 2F4VJ 1E6YA 5E3CA 1F3FA 3OUYB 2R2RA 2FJEB 2H5EA 4JI8F 1NHUA 5H9EK 2XCAA 3OXGA 2BXJA 1UTAA 1T9YA 2D41A 2ZM6F 2XS5A 1EQMA 4LFBF 2IIHA 4UUXA 2QL5B 5CHCB 4A8KA 2HHXA 4QR1A 2R8IA 2HWTA 3HZGA 4OZJA 1T0TV 2LXIA 4ZJLA 3LALA 3LF0A 3ZZOA 4R0EA 2BYCA 2ALYB 3K5OA 2PDAA 4DR5J 4TQSA 1AUDA 2LLZA 1KBRA 3SDEB 2B43A 2ZOMA 3NG8A 5HAOA 2QA4G 2OEKA 3W9IA 3OVSA 2UXDF 2JLGA 3F56A 4M94A 3WQPA 5B0AA 2V50A 1ZA2B 2XMAA 3PKMA 4KSEB 2QA1A 2BW7A 2N3OA 2Z4PA 3K5PA 2DH7A 1U1RA 5C2CA 2C42A 3R2CJ 2AP6A 3GSDA 3OFGA 4CH0S 3QYYA 1F5AA 1RAHB 4WU3A 1I51B 5D8HB 4LF1A 4DU8A 1RK8A 3MM5A 1NK7A 1X0FA 2B5JB 1UEVA 5T41A 3CO0P 4KR0B 2XNRA 3IXQA 1Q78A 3D3BJ 1TL3B 2RJZA 3GR1A 1JNRB 2C2ZB 4AQYJ 1XR7A 3PO4A 1B0TA 3HD1A 1OYEA 3BO3A 3TX8A 2EFPA 4E8UA 5B0EA 1S1XB 1BQNA 2K06A 1ITPA 2DGXA 2QFIA 3W5ZA 3Q23A 2JVRA 2ZEJA 1GMUA 4ZVHA 3PXGa 4H54A 1UWBB 3SQOP 1B7FA 4J9RA 5E33A 4B9LA 4DL0C 3NGDA 1FDAA 2ZE2A 3OTCA 5KFVA 4Z37A 3LW5C 2DGWA 3H7HB 2NPFA 3HFVA 4IG0A 3FEYB 2CNKB 2HNYB 3U1LA 3V4MA 2IY5B 3IRXB 1SVDA 1KTQA 1K73T 2V67A 2BOAA 3BH6B 5LL6d 1HLWA 1IM6A 1JXEA 1VRUA 3L4BC 2LQ9A 2RD5C 1U09A 4DLEA 2R8JA 1IKXA 2KL8A 4EI2A 3ISZA 3M2RA 1N33J 3T5HA 2XMJA 4JYAF 4ES1A 2V8VA 1LW0B 1VR6A 3QAUA 4BLGA 2HHSA 3JB9k 3M7VA 3TAMB 2JEJA 2VZ9A 2BM1A 2Y0BB 3VVUA 3ULHA 1D0EA 5KFYA 3GV5B 1X9MA 4Y2MA 1FE0A 4X62J 2MZQA 1WC4A 2BJ7A 5KG2A 2MQ8A 1ZM9A 3H2LA 5L9XA 2EC2A 4LF6J 2OMLA 4A8FA 2DNPA 1C1CB 3G82B 3S1TA 2YH1A 3RZAA 3WC0A 3VF0B 3M32A 2Z2MA 2M88A 2CJXB 1CJUB 4Y2KA 1AXQA 4K0KF 3PACA 3CDEA 3CEDA 4FDFA 4OJHA 3AY0A 3RB6A 2CQ2A 4DUZJ 2CQCA 4PQUA 2WBMA 3KJVA 2BJ1A 4H4OA 4I2PA 1NK5A 3EMTA 3PYDA 4LR7A 4P72A 3MM6A 4DX7A 4AL5A 4X4UA 4O3RA 3G6YA 3T1HF 3Q8QB 1X8DA 4ZHRB 5C42A 3N6MA 2HHUA 1NZ8A 4KB7A 3M8QA 2CQIA 2IBKA 3HHNB 1RT3B 5D3GA 2KN4A 1X0PA 4DQIA 1T95A 1IBCB 4ECYA 2NZCA 4WYLA 5KOXA 3DLKB 2DPJA 3M4XA 3BREA 2MQQA 4ED5A 2B9WA 4QPXA 3ENWA 1WORA 1U7LA 5C5JA 3CJ8A 2W01A 1U1KA 4YR2A 2B3TB 1XBWA 3FEXB 3B78A 5AXMA 4ZA1A 3HVRA 2M52A 4YB7A 4MYUA 2DR9A 1K9MT 4EFAC 1Q82T 2H5JB 4ALZA 4U7UD 5G4DA 3T1AA 3T3FA 1N88A 2V8GA 1WC5A 1T9UA 1YVFA 2ERRA 1K47A 4CM0A
chains in the Genus database with same CATH topology
4U7UD 5H9FK 2Y8WA 4DZDA 2Y8YA 3QRRA 5CD4A 4QYZK 2Y9HA 3QRQA 1WJ9A 3QRPA 5H9EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U7U D;  5H9F K;  2Y8W A;  4DZD A;  2Y8Y A;  3QRR A;  5CD4 A;  4QYZ K;  2Y9H A;  3QRQ A;  1WJ9 A;  3QRP A;  5H9E K; 
#chains in the Genus database with same CATH topology
 1H38 A;  3BV8 A;  2P6S A;  4KIA A;  1RSC A;  3GFH A;  4QU7 A;  3K2Y A;  4J9U E;  4KJI A;  3BGR B;  3D5M A;  3M05 A;  2PT0 A;  4NCA A;  1VQO S;  3MMA B;  1JJH A;  3W5Y A;  5KFH A;  1BC6 A;  1SI9 A;  3O2I A;  3UQS A;  1FXR A;  4IO1 A;  2ADC A;  3ETO A;  1M5S A;  1BHN A;  4DX5 A;  4ILL A;  3M2V B;  4UUW A;  2WZ1 A;  3MAQ A;  3K8V A;  1SL1 A;  3P49 B;  1FKP B;  1RTI B;  4P9S A;  2MHE A;  1BUX A;  2CQG A;  2RU3 A;  1J5O B;  2OPS A;  4Z2X A;  1U4B A;  1AYE A;  3PO5 A;  3EYZ A;  5DGA A;  2W2Q P;  4A8O A;  2LEB A;  3CMA S;  4NE9 C;  3HHL A;  2I5J A;  1FWL A;  3CCT A;  2UVU A;  2QTW A;  1RA7 A;  5HBM A;  3PX4 A;  4DR1 F;  1RT6 A;  5KFA A;  2ACM A;  2Q66 A;  3EWG A;  5A2Q U;  3CT9 A;  3Q86 A;  5I3Q A;  3PX6 A;  4MTP A;  1LFW A;  4ED6 A;  4ZPC A;  2CFX A;  2ZKT A;  4I2Q B;  1FVS A;  3K17 A;  1FKA F;  2GVZ B;  2UP1 A;  2JHE A;  4ZCL A;  1VQN S;  3PHE A;  1K1S A;  3G8T A;  1EAY C;  3VAI A;  3SSS A;  1S49 A;  4B3S J;  2MMY A;  3DI6 B;  2HSE B;  3MTJ A;  3PJ9 A;  1VMB A;  5D6G A;  3NP5 A;  3FSY A;  3OSN A;  2LCW A;  5EHH A;  4ICL A;  1X31 C;  2HRY A;  1MU2 B;  1U0H A;  3R5D A;  3NCR A;  2JFK A;  3R6G B;  1P9Y A;  2DNQ A;  1ZBT A;  1H2V Z;  4HHH A;  3MWB A;  3Q8R B;  4QIE A;  4ECT A;  2ZC3 A;  2HHQ A;  1HBU B;  2W7O A;  1SUQ A;  2DHG A;  5DG8 A;  3CCU S;  2XUL A;  3LO3 A;  2QL7 B;  1ZAV A;  1HQE A;  3QT8 A;  4NRT A;  3DFE A;  5KG0 A;  3HSD A;  4PYD A;  3DHW C;  4GVB B;  2Z0G A;  2V63 A;  4DX8 H;  3G6X A;  4OZ1 A;  1TL4 A;  2JVO A;  2AZ3 A;  4YDD B;  1U2R A;  2QRR A;  1HBN B;  3TAN A;  1VYA A;  4OHW A;  4A8Q A;  4DV7 J;  4KH1 B;  1FFS B;  1MG7 A;  5E7O B;  2DPI A;  4I6Y A;  2J0X A;  5FDL B;  3WX8 A;  4RLE A;  3DYA A;  5HLF A;  1SH2 A;  5HMW A;  1PBA A;  2JC0 A;  1F60 B;  4ZVQ B;  4YHH F;  4LSZ B;  5ETL A;  2MKK A;  2BW2 A;  2FHO B;  3DKD A;  5DET A;  2NR0 A;  3NNH A;  2J0Q D;  2FC9 A;  5IZH A;  2Q43 A;  3BSA A;  3QT5 A;  2C2O B;  3CDU A;  1X4C A;  5AE2 A;  3BB5 A;  2IAJ A;  2WCX A;  1FT8 A;  2DNL A;  5J2N B;  2LVW A;  3MR2 A;  3J7Y U;  4U8V A;  3Q8Y A;  3DOM B;  1HBO A;  5HL7 Q;  5HK4 A;  2IM1 A;  2DO0 A;  2OSR A;  3KG4 A;  2O67 A;  1KQF B;  2W9B B;  4LRE A;  4WE1 A;  3PRV A;  2Q1L A;  3C19 A;  1WC0 A;  4N77 A;  3C16 B;  4HI2 A;  1U6B A;  2AV5 A;  4RNH A;  1T11 A;  2DGO A;  3M8S A;  1QY7 A;  2F8M A;  3W8P A;  4DQR A;  2ZKU A;  4ZCI A;  3GMG A;  3Q24 A;  3ZNU A;  3AD7 C;  4RW6 A;  2EK6 A;  3Q0A A;  1NK4 A;  1MN9 A;  2BAB A;  3D54 A;  4UOC A;  3EVO A;  2M8H A;  3T9Z A;  3JYT A;  1NH7 A;  2QT7 A;  3MEK A;  3Q89 A;  3DDK A;  3AFG A;  3IS9 A;  3UR3 C;  4WFX A;  4C3M A;  2Z8Q A;  1FRI A;  3T5K A;  3FBC A;  4WFB Q;  3EPG A;  3SI8 A;  1L3K A;  3M30 B;  2CYY A;  3G8S A;  3RYL A;  1FX2 A;  1M5V C;  2MZR A;  3DOL A;  3VGU A;  1RE1 B;  1ZZF A;  4LSN B;  2WVB A;  3FBB A;  2J6T A;  3OTB A;  3S01 A;  3K59 A;  5I42 B;  4Y65 A;  1U6Z A;  3KFW X;  1YK9 A;  3RAX A;  3QWU A;  2IRY A;  3FBE A;  2DXF A;  1JLF B;  3MMB B;  1Q81 T;  1WDD A;  3VAF A;  3TZY A;  1YIJ S;  4OX6 A;  2FJX A;  3OLA A;  3O5T B;  2FY8 A;  4ZPD A;  3D67 A;  1HPZ B;  2JEI A;  2DGS A;  4P6Q A;  3H25 A;  2MZT A;  5L9N A;  5H9F J;  1VHF A;  2WOM A;  3DDN A;  1HWU A;  1RT1 B;  2XSF A;  3VHQ A;  1FF2 A;  3MEG A;  3CC2 S;  1S79 A;  1OYD A;  1RT7 A;  2W7A A;  3SCI E;  3ZZ0 A;  1WHV A;  3SQG B;  5HRO B;  5A8K B;  5J2M B;  5IWA F;  1Y5L B;  3SCJ E;  4DL4 A;  2DGV A;  2G1H A;  2HHV A;  1R7I A;  4RW9 A;  1YTY A;  4F04 B;  5KFC A;  3TJ8 A;  2HBQ B;  4C97 A;  3AJD A;  1A6L A;  5B08 A;  4NX9 A;  2ZOF A;  2HIY A;  2M7S A;  4LF7 F;  4C48 A;  2N4D A;  1SQG A;  2UU9 J;  4Z7C A;  3PCO B;  1I1G A;  4C0B A;  1RAD B;  3QGI A;  2R7S A;  4ELT A;  1VQP S;  2KKH A;  3I0S B;  1TL1 B;  3GJQ B;  2QEX S;  1IJE B;  2YPZ A;  3SFG A;  2EWH A;  2KG0 A;  5ITH A;  2L41 A;  1FER A;  1RWX B;  4IUF A;  4EBC A;  2IRU A;  5MLC V;  5LM7 E;  2EFN A;  4YY3 J;  3NGK A;  4K5S A;  1R43 A;  2DNR A;  2DGU A;  4C8Z A;  4CTA B;  4CYU B;  4HYK A;  3GYN A;  2NXJ A;  5D0H A;  1WOO A;  4NLP A;  3RRK A;  4ANE A;  4MKA A;  1EET B;  4BC9 A;  3IBF B;  4LSL B;  3GV8 B;  3KJF B;  2K7J A;  4KAI A;  5D78 A;  5CCL A;  1A0O B;  1N6Q B;  2C2M B;  3POT A;  2VIC A;  3ILL A;  3AXK A;  3I5B A;  1QAJ A;  1CQN A;  3I4P A;  5DO2 A;  4TYA A;  1NKE A;  1WDT A;  2ASD A;  4LT6 A;  1TMM A;  4O4R A;  1W2I A;  1RI7 A;  3ILI A;  4J37 A;  5KT2 A;  3ZC4 A;  3QRQ A;  4K4Y A;  1U26 A;  1C4C A;  3OR2 B;  1RT2 A;  1AUS L;  1UW4 A;  3T1Y F;  2RT3 A;  2F8E X;  2JFD A;  1UCN A;  1DUR A;  2MQN A;  5C25 A;  2OFH X;  2DR5 A;  5LMN J;  2RQM A;  3KOA A;  4F8R A;  2DIU A;  4YS2 A;  3F73 A;  5DZ6 A;  1E6V B;  4GVL A;  2HQD A;  4HAC A;  4IFY B;  4PAB A;  3GPA A;  1UPM B;  1JLA B;  2MST A;  2ZZM A;  3DMJ A;  2FVP A;  3FSX A;  1Q5V A;  5E2Q A;  1RKI A;  3ZTS A;  2HNZ B;  4UQT A;  1KHV A;  4WP8 A;  1NDK A;  1KNZ A;  1NAQ A;  4Q8F A;  1I94 F;  5ETQ A;  3ZNJ 1;  4XO0 A;  3T6J A;  5RUB A;  5C24 B;  2YKO A;  3MUV P;  3LWM A;  1LV5 A;  3CJT A;  1QAY A;  3UO0 A;  2B4U A;  1NJI T;  5AE1 A;  4NLX A;  4DSK A;  3G6E S;  3OPK A;  1HA1 A;  1FDB A;  2ZH3 A;  2UU9 F;  1EAR A;  1J5E F;  4PWU A;  2Q6B A;  1HNZ J;  1XER A;  5DZ7 A;  4FBT A;  4G1I A;  4DJB A;  3DGP B;  1QUV A;  3S6E A;  4PUO A;  1U45 A;  5ETO A;  4E0D A;  2Z2L A;  2J8A A;  2M2B A;  4LFA J;  3GYX B;  2GGP A;  2MZ1 A;  1PC4 A;  1GXT A;  4J7C A;  1JJ4 A;  2XEX A;  1BD6 A;  2LMI A;  3SFU A;  4MH8 A;  1RWU A;  2YWK A;  4GO7 X;  3P45 B;  4CH7 A;  3QGG A;  3MR6 A;  2UXC J;  2QGF B;  2GQC A;  4M5D A;  2HZC A;  1SJR A;  1VDH A;  4MFB A;  3MDF A;  4ID5 B;  4H4M B;  1D3W A;  1E6Y B;  5EWG A;  2WON A;  3Q8P B;  2QFJ A;  1RWO B;  2V8P A;  2IFX A;  4FXW A;  2AEM A;  1PG5 B;  3K7R A;  4WK3 A;  5F0W A;  2WSC C;  2FQQ B;  1IQT A;  3AXM A;  3CUN A;  5BYR A;  4DI6 A;  2V4J A;  3SSR A;  3VR1 A;  4L3K A;  5HAT A;  3TQE A;  1RJJ A;  2DIT A;  4A8M P;  2HYI B;  4YEA A;  2B4P A;  4CZC A;  2CPY A;  2VV5 A;  2LEP A;  2PE8 A;  2OKQ A;  2Y8Y A;  5A8W A;  2GIQ A;  2PA3 A;  2YNF A;  4JI6 J;  2VPW B;  1X4G A;  3DRS A;  5F3Z A;  4B3M J;  3KK3 A;  1AA1 B;  2C2N A;  2MKY A;  4JV5 F;  2EG2 A;  4LIW A;  4PG5 A;  3H5U A;  3EGN A;  2DVI A;  1SH3 A;  3J7Z T;  4NWB A;  4A8Y A;  1YJN S;  3UDV A;  1UP1 A;  1Y10 A;  5BR8 J;  3AA8 A;  4X65 J;  4I56 A;  2D3O R;  2R7O A;  2IJR A;  1EIY B;  4DMZ A;  4BC7 A;  3MM5 B;  1UFK A;  2CWK A;  1Y11 A;  4G65 A;  4DSJ A;  3OQ2 A;  4OI1 A;  2H9Z A;  2PGC A;  2UVV A;  2J0W A;  4KO0 A;  1KRP A;  4BS2 A;  3HDS A;  1YKW A;  3NWR A;  2D9P A;  5T14 A;  4NZ6 A;  4B9T A;  5CQG A;  2JL9 A;  4ERD A;  2X7I A;  3MPU B;  1G6B A;  4TU8 A;  4X4O A;  2HZV A;  4C8O A;  2XZW A;  4HVZ A;  4ELU A;  3CJS A;  4AXI A;  1L5U A;  1X4E A;  2E5G A;  2RS8 A;  1BQN B;  3BGU A;  4ZJO A;  4ECZ A;  4F02 A;  1K0T A;  3GG0 A;  3QGP A;  2DH9 A;  4B17 A;  3C6U A;  1DQ8 A;  3THT A;  4I0W A;  2OUG A;  2UXC F;  3N6L A;  5GAH U;  4FF3 A;  4WXO A;  3JSR A;  2CJK A;  2ZE2 B;  1YSJ A;  4L72 B;  1OPI A;  4IG0 B;  2G0C A;  2HBZ B;  2RAQ A;  2P9E A;  3EJM A;  2UUB F;  3ISN C;  4ZIT A;  4N5S A;  5IS2 A;  1T3N A;  3BDE A;  2UUA J;  1VRU B;  1YGY A;  4ZLN A;  1IKX B;  1A9N B;  4RNM A;  1U1N A;  3M2R B;  1ZAX A;  5AXL A;  4WPA A;  2VON A;  1RTH A;  2WVF A;  1FEH A;  3QQC D;  5B09 A;  5KG1 A;  3F41 A;  1RTJ A;  2HQ3 A;  2A18 A;  1TMJ A;  1LWX A;  4I6W A;  1TQL A;  4IQX A;  2UXB F;  2E9R X;  2DHA A;  1OO0 B;  2E9Z A;  2A3J A;  4IOA Q;  4MK7 A;  2C3M A;  3HVW A;  1U1M A;  3PIO Q;  2JZ5 A;  4NLW A;  5KFZ A;  3FSI A;  2VQF J;  3U27 A;  1LXN A;  1Y5N B;  4WII A;  3HVT A;  2MB0 B;  4WBF A;  2XY7 A;  3I32 A;  2FY1 A;  2VC0 A;  4AYB D;  3M32 B;  4DG1 A;  5CAB A;  1KWM A;  1O6X A;  3H2V E;  2LQ5 A;  3D0G E;  2AHO B;  5J1E A;  3MOJ B;  4PZV A;  4F4X A;  3FJ2 A;  1X5O A;  3PIP Q;  3PR4 A;  1UPP A;  3PW0 A;  1IVZ A;  2IA6 A;  3ENA A;  4J9N A;  3KLI A;  3CD7 A;  4PQU B;  2BKO A;  4F4K A;  3KJV B;  2RKI A;  1T9V A;  3PEJ A;  4H4O B;  4I2P B;  3HX9 A;  2PA8 D;  1IBM F;  5HVH A;  3MM6 B;  1QTN B;  1B0P A;  4FNI A;  3SCL E;  4O3S A;  4DUY J;  2N7Y A;  1MWQ A;  3VVT A;  3NMR A;  5C42 B;  4O23 A;  1WOS A;  2R4F A;  1TR0 A;  3M8Q B;  2B5J A;  1KSP A;  2B7B B;  3HHD A;  4OHX A;  3IWN C;  2R7V A;  1HMV A;  1HHQ A;  1U8W A;  1P27 B;  3T41 A;  3UD4 P;  2ATC B;  3OJU A;  3MFH A;  4JI4 F;  1N36 F;  4Q45 A;  1QE1 A;  3R27 A;  1OS5 A;  2EW9 A;  3HT0 A;  3VGS A;  1PCA A;  3H42 A;  1DTQ A;  3GCX P;  1FJ7 A;  4HH0 A;  2V94 A;  4GKJ F;  1HYS A;  1CJK A;  2VIH A;  2XMU A;  3MM9 A;  2C3Y A;  1HWL A;  2M9K A;  5L39 A;  4JI1 F;  4MIB A;  1NXI A;  1HNX J;  2GX8 A;  2E5L J;  3TVZ A;  2NS1 B;  3TA0 A;  3JSM A;  5DM7 Q;  3KK2 A;  3HJF A;  3SEO A;  2DRB A;  1XC9 A;  5LJ3 Y;  4HKQ A;  1H74 A;  2Z2Y B;  2MQO A;  6AT1 B;  3KG1 A;  2J7W A;  2OO4 A;  2G1D A;  3WX4 A;  4HDG A;  3KHH A;  4NLS A;  4ZDN A;  2ALZ A;  3CC7 S;  4OI0 A;  4Y2I A;  4P2F A;  1UEU A;  1UFW A;  3OXL A;  4B08 A;  3LAK A;  4ZP9 A;  4FBU A;  2RF2 A;  4LQ9 A;  2V4Q A;  4ED1 A;  4M5L A;  1GK8 A;  3T6B A;  1WWH A;  2YXL A;  4FXV A;  4CNY A;  2VKR A;  2VQF F;  1X9S A;  3H0P A;  3G2X A;  3RB0 A;  4C6A A;  3V6J A;  1M1H A;  2AYB A;  4URS A;  2YQ1 A;  2OPS B;  3KUG A;  3BQ1 A;  3CW2 C;  2NUU G;  5D4L A;  1WUU A;  2IA0 A;  1WOP A;  3UNY A;  2RVJ A;  4CO1 A;  1DRZ A;  4U96 A;  4IDK A;  5C7P A;  4P71 A;  2CNL B;  3HHL B;  2I5J B;  3M8Z A;  2V34 A;  2FLO A;  5HBM B;  1PKU A;  1RT6 B;  4OYZ A;  1RXO B;  1Q5Y A;  1N32 J;  2BAN A;  1AW0 A;  5KFT A;  3B8H A;  5DQG A;  1S72 S;  4DV6 F;  1U8S A;  4X64 J;  4DUY F;  2OPQ A;  5FD1 A;  1Y5I B;  3QLH A;  1Q0N A;  3ZZT A;  2ZWO A;  3WDO A;  4DL6 A;  1I6J A;  3AAW B;  3M9N B;  1V6H A;  2DNY A;  3F0N A;  3GJT B;  1DY3 A;  4DV2 F;  4ICL B;  1B99 A;  4KY3 A;  2IM0 A;  1U0H B;  4FN5 A;  4X4T A;  5E3A A;  4DL2 A;  1TAQ A;  2C2D A;  1RAB B;  2AX1 A;  1N4L A;  4HR2 A;  6FDR A;  1F9H A;  2R7U A;  1SUQ B;  3FGV A;  5IFM A;  1N34 J;  1HNX F;  2HGL A;  1DAR A;  2GML A;  1RHR B;  1CUL A;  3WIV A;  1SJF A;  1HQE B;  2YKN A;  1WNE A;  4L76 A;  3OT9 A;  4KFB A;  4DQS A;  3LQV A;  4X4V A;  2L3M A;  4FYD A;  4ZIW A;  1IXK A;  1FHT A;  3N4W A;  4ER8 A;  2Y1L B;  2FYX A;  4JI2 J;  4A8W A;  2QC3 A;  5KFR A;  2HFS A;  4OX7 A;  1ZH5 A;  4KPC A;  4URG A;  1DFD A;  1R8C A;  4MK8 A;  1WC6 A;  3EUN A;  5JUM A;  2EK1 A;  1HIY A;  1TKX A;  2FHJ D;  3DYA B;  5HLF B;  2HMI A;  3FZB A;  4OLO A;  4ZMM A;  1UVN A;  3MEE A;  5D15 A;  2N82 B;  2OP5 A;  3QMQ A;  2EBG A;  1I3O B;  4FF1 A;  1WF2 A;  2RRN A;  3PW7 A;  3CCZ A;  2V2Q A;  4NCB A;  1VQL S;  2QN6 B;  3BR9 A;  3KHR A;  3KHG A;  5KFN A;  3M6V A;  1HNV A;  2X3D A;  1KVI A;  2FIU A;  3R3T A;  4I7F A;  1I5O B;  4UY8 5;  2IAJ B;  5IXU A;  1JXL A;  3I56 S;  4USI A;  4N7T A;  4F4W A;  1VBY A;  2NLW A;  4JV2 A;  3EM1 A;  4H4K A;  2MY8 A;  5CYM A;  4RU2 A;  1N54 B;  1HBO B;  1SKU B;  2H48 B;  5M2R A;  3HHE A;  1FES A;  1KFS A;  2K8G A;  1FRK A;  2GIF A;  2J9C A;  3MFI A;  1SC6 A;  4TU9 A;  4E98 A;  4NEY A;  3V6K A;  3GP9 A;  1DQ9 A;  5EWF A;  3NOC A;  3J80 Y;  3J81 Y;  2VBY A;  2IYI A;  5KFQ A;  4LBH A;  3RR8 A;  2ZNY A;  4ZVO B;  5KT5 A;  3BH7 B;  4RW6 B;  1WHY A;  3UW1 A;  4A48 A;  2ZBI A;  5A6P A;  3V2U C;  1O0P A;  2ZD1 A;  2I2Y A;  4CNZ A;  3JYT B;  4TKT A;  3VWS A;  2HBY B;  5ETP A;  3IS9 B;  2FLL A;  4PXB A;  2VG7 A;  2B6A A;  5L1I A;  1GXU A;  1F0X A;  4JI2 F;  3KHL A;  5LXY A;  1L3T A;  3OLB A;  1FRL A;  3SIP B;  1X60 A;  3R5B A;  3DOL B;  1PYO B;  1RA6 A;  2YWW A;  3I31 A;  2HWI A;  3M2U A;  1PIL A;  4ZP7 A;  5E3P A;  1S7H A;  1X4D A;  3UVJ A;  3GFX A;  3DRY A;  2LA6 A;  1XIQ A;  1XTZ A;  2YNI A;  3FRZ A;  5LMU F;  4ZLJ A;  3TWZ A;  1HNW F;  4ZOS A;  2AQ4 A;  3W9H A;  4ILM A;  1FTR A;  3R8Y A;  3FCH A;  3B4M A;  4WFA Q;  2CPD A;  3NRB A;  2G2Y A;  3G87 A;  3I82 A;  2AEF A;  4JI0 F;  3GQC A;  4U9R A;  2KFZ A;  1TFY A;  4K4Z A;  2EC0 A;  3MZI A;  2CPX A;  4UY8 T;  2WOM B;  4LMZ A;  1T7P A;  3UCZ P;  2QA2 A;  4K2X A;  4ETZ A;  2HVI A;  1IBK F;  4F3Q A;  4AFF A;  4OI2 A;  2CQB A;  3MEG B;  3H5Y A;  4DR3 J;  1RT7 B;  3TUJ C;  1VIS A;  2OTJ S;  2B4V A;  2OEM A;  4RU9 A;  2Z2Z A;  1WEY A;  4KE5 A;  3E3X A;  7FDR A;  1Q8I A;  2M70 A;  2DEJ A;  3UDL A;  1HWJ A;  2CQ4 A;  1NKC A;  1FJC A;  1NEE A;  4WFZ A;  5F0U A;  3KLF A;  5CYQ A;  1N48 A;  4Q7A A;  1XNQ J;  1VJQ A;  1WKJ A;  3WC2 A;  3IAM 9;  2VFV A;  3FZ2 A;  3R1L A;  4DN0 A;  3EIC A;  4WIQ A;  1Y7P A;  4LF9 J;  2RQK A;  3UWT A;  2V2Z A;  1XWL A;  4OI3 A;  3TOQ A;  5GAD U;  3ADA C;  1BQM A;  1WJ9 A;  2Q79 A;  1ZM3 A;  2EXU A;  3DHX A;  3MAH A;  4ZPA A;  1EX8 A;  3KUH A;  5L8R C;  3L7O A;  4J9K A;  3DC2 A;  1S76 D;  2FPH X;  3TVY A;  4OZ0 A;  4K50 A;  2E5I A;  2Y0S D;  2VPY B;  2PI4 A;  4WP9 A;  3OR1 A;  1FD2 A;  1HAR A;  1HQU A;  1D9A A;  4DV3 F;  4XTT A;  2ZH4 A;  4TNO A;  3POT B;  2KTQ A;  2V6A A;  4WU2 A;  1EZZ B;  4QIF A;  4N47 A;  4J9M A;  4O3N A;  2Y1R I;  3HM9 A;  4LR8 A;  2QA4 S;  3C6T A;  4F67 A;  1U2F A;  2XS7 A;  2CQH A;  2HVH A;  4PR6 A;  3FBF A;  1RT2 B;  4UF4 A;  4WJB A;  1N56 A;  2R8K A;  3AHP A;  5C25 B;  3BF4 A;  3PNI A;  4HT7 A;  1VJW A;  4ECR A;  2BDP A;  3MOZ A;  3BEG B;  5HAN A;  1UVL A;  2E9T A;  2YNH A;  1T03 A;  4HAC B;  1WC1 A;  4OYO A;  2O66 A;  3DLB A;  3OL7 A;  2GAH C;  1LNQ A;  3MR3 A;  3C46 A;  3DMJ B;  3ZTR A;  2KT2 A;  2BRL A;  2PD1 A;  2ZJR Q;  3CJ3 A;  2XG8 A;  3ILJ A;  3NY0 A;  3PFO A;  4JI3 F;  4DF8 A;  4YME A;  1BLU A;  3I87 A;  2PMH A;  4FKX A;  1C0T A;  2MTL A;  4LUB A;  2GQ2 A;  1JQG A;  2MJU A;  3H5X A;  4Y3C A;  2A2C A;  1JIH A;  5CAA A;  3M9O B;  3JS9 A;  5I3P A;  3J81 U;  1QDU B;  2MEW A;  3IR5 B;  2DTJ A;  1VHI A;  1UJ5 A;  3UD3 P;  2AW0 A;  2CDR B;  3TO8 A;  2W24 A;  2L08 A;  4FYY B;  1Q8B A;  1H2U X;  4YQW A;  2XMK A;  2IMW P;  1TKZ A;  4PPZ A;  4P74 A;  3H20 A;  2H5I B;  3VGT A;  4ZJQ A;  1VQ6 S;  3A3P B;  1YWX A;  3EDQ B;  4GKK J;  1WAC A;  4W92 B;  4Y2C A;  4KGX B;  4C8N A;  3M8W A;  4BWJ A;  3HD2 A;  4PUO B;  3ILO A;  3D1Q A;  2NYH A;  1XMB A;  1JX4 A;  1JLC A;  1EP4 A;  3OVA A;  4FF2 A;  1XMO J;  1JJC B;  3MUR P;  2GGP B;  4DQP A;  2W1B A;  4G1Q A;  3ZO7 A;  4MT1 A;  1XQI A;  4DV4 J;  4PRF A;  4DFP A;  3HFK A;  4KHP J;  1TK5 A;  4M95 A;  5E0O A;  3N5F A;  4M5D B;  5H1S V;  1NPK A;  4NA2 A;  4MFB B;  5D77 A;  4AD6 A;  2DB1 A;  2CAD A;  1M0S A;  3VAM A;  4FYW B;  3A3O B;  2HLT A;  3PVX A;  2WON B;  2DT9 A;  4MYT A;  3U02 A;  2JDJ A;  1PJ5 A;  4QW9 A;  5CD4 H;  1D8Y A;  4ECS A;  1X9W A;  2V68 A;  1RU1 A;  3TYT A;  2OLW A;  1UL3 A;  2ZH8 A;  2ATL A;  3CDW A;  4OX8 A;  4EK2 A;  1N5T A;  2V4J B;  4V19 X;  2WVC A;  1Y00 A;  3VAH A;  3R2D J;  1WSV A;  4A46 A;  1ZM2 A;  4NXN J;  3V81 A;  3CCJ S;  1OY6 A;  2ZZN A;  4ZPW R;  3GCW P;  5LSO A;  2DHX A;  5A8W B;  4LBI A;  2HS4 A;  2YNF B;  3PHT A;  2B8P A;  2R42 A;  4MJK A;  2V8D A;  3DRS B;  3Q8S B;  2NUH A;  3KJN B;  3KK3 B;  3AT1 B;  4JI8 J;  4FS1 A;  9RUB A;  1VI7 A;  3GLJ A;  4DOZ A;  4B3R F;  1UJ6 A;  3D0I E;  3KKF A;  2ZM6 J;  2RHS B;  4LFB J;  1FDN A;  1SL2 A;  1GEH A;  1IKV A;  2AD9 A;  2KHD A;  4U7U K;  2WVE A;  4DSE A;  1LWF A;  4EGL A;  3CNQ P;  4DSF A;  3RGI A;  1RT5 A;  4ED8 A;  4KGV B;  3NGS A;  1VQ4 S;  3DLL Q;  3LOU A;  3CJQ A;  3T5L A;  5F3T A;  2IDL A;  4CO4 A;  2UXD J;  2JLE A;  3GIL A;  3TP2 A;  3QZ7 A;  5I3U A;  4QBU A;  2NQP A;  4WZQ A;  4OI6 A;  2DHS A;  2PII A;  4KYZ A;  3ITH A;  2XYH B;  4DHV A;  2NZ4 A;  4LQ3 A;  1FWP A;  1EJ7 L;  3M8P A;  1RWP B;  2MKC A;  1KN6 A;  3BO4 A;  4WF9 Q;  1S57 A;  1N0U A;  3TVK A;  1IBL F;  1R31 A;  3SYZ A;  1YDL A;  1GMW D;  3C6U B;  1FX4 A;  1XN9 A;  4R25 A;  2CJQ A;  2GS8 A;  4KKO A;  2J7K A;  2GVD A;  2K7K A;  3DM2 A;  5K14 A;  1R6Y A;  3NNA A;  4MKB A;  4RJV A;  2F7V A;  2DCL A;  2VAS A;  1VRQ C;  2ZHO A;  4U95 A;  4LRA A;  2KG1 A;  4DCJ B;  3DDI A;  2NXC A;  2ZH7 A;  1L3U A;  2VOO A;  2A6M A;  3OL8 A;  2DGT A;  2XMT A;  5KG7 A;  1TZ0 A;  4ED0 A;  4I68 A;  4ZVP B;  3W1Y C;  1HW9 A;  2MLX A;  4X4Q A;  3SV3 A;  4RUA A;  2YKM A;  3A4T A;  4LRB A;  3DU6 A;  3C15 A;  3TEG A;  2W7P A;  1RTH B;  3BQ2 A;  4ETX A;  2IVY A;  1SCJ B;  3E01 A;  3G6V A;  3VV2 B;  4DPX A;  4NXN F;  5HQ8 A;  4CRJ A;  3CTR A;  4QR2 A;  1FXL A;  5ETS A;  5KOW A;  1RTJ B;  2AJ4 A;  3HXM A;  5J1N A;  1HHS A;  4MK9 A;  3BJY A;  2KRR A;  3LWL A;  1M5O C;  3EVM A;  2QLW A;  2RS2 A;  3SV4 A;  1PGZ A;  3NS6 A;  2LXU A;  3NGU A;  3ZTO A;  3IGN A;  1C1B A;  4F26 A;  2HG4 A;  2GHW A;  2OGU A;  3I55 S;  3VAJ A;  1QAX A;  4CLL A;  8AT1 B;  1NLK L;  2RNE A;  5J2Q A;  4X4P A;  2AGQ A;  3KNG A;  4KGZ B;  3HVT B;  4P75 A;  1GTH A;  1XMQ F;  4JYA J;  2QMW A;  2E1R A;  4DG1 B;  1PIE A;  1Z2Z A;  5D4O A;  1CEZ A;  3GIM A;  5J1E B;  1B64 A;  1CC8 A;  1H2T Z;  2XMV A;  3CIZ A;  5KFX A;  3KLI B;  2VPZ B;  1RAA B;  2VA3 A;  2RKI B;  4F2R A;  1S4E A;  2CJ9 A;  3BYP A;  4EUV A;  1F5C A;  4M5H A;  4L6V 3;  2A0F B;  2YX1 A;  4M5N A;  2P8I A;  4EBE A;  2L9N A;  3CMQ A;  3FCW A;  5L1J A;  3K8W A;  4CCH A;  1OSC A;  4K0K J;  3MD3 A;  1HMV B;  2HIQ A;  5CD4 A;  1TL7 A;  1W2B R;  1VIO A;  2CUY A;  2FVQ A;  5KFD A;  2OI2 A;  2NCK L;  3ZZR A;  1QE1 B;  3I9V 9;  4C0O C;  2I6W A;  1YJW S;  2G4B A;  3LP2 A;  3CPW R;  2YQ0 A;  1DTQ B;  2VF3 A;  1HYS B;  1CJK B;  1OPZ A;  1SKW A;  3MM9 B;  2Y8W A;  2YKA A;  1HQ2 A;  4K5R A;  5K8N A;  2C3U A;  3FQK A;  3T1H J;  2MSS A;  2HHH F;  2BQU A;  2CPI A;  1X5S A;  1S6Q B;  3DXB A;  4NCG A;  2HPU A;  1PAU B;  3JSM B;  3KK2 B;  1F9E B;  2FHJ A;  1S59 A;  2QMU B;  2FLN A;  3D1O A;  5DDO C;  2YWE A;  4WXW A;  3VCD A;  1R0C B;  2VOP A;  1VQY A;  4LF2 A;  4HH1 A;  2RF2 B;  1R8P A;  1RWK B;  1G7C B;  3PJX A;  2ZH2 A;  1TFW A;  4LF8 J;  2RRA A;  1D09 B;  2HBR B;  5KFJ A;  1S1U A;  5LJ5 Y;  1WI6 A;  1OQ3 A;  4K8R A;  3IFE A;  1R0B G;  5J2P A;  2CKW A;  3KLV A;  2W4D A;  4IDK B;  4QYR A;  3PRB A;  4NA3 A;  4TN2 A;  2KT5 A;  1Q86 T;  1VRT A;  2HZA A;  2RUS A;  4ZP8 A;  2YPY A;  3BO2 A;  2H3E B;  2BAN B;  1FRX A;  1JKH A;  2Z56 B;  1FRM A;  4Q2L A;  3TAP A;  2HQI A;  1O51 A;  3G9C A;  5IT0 A;  3W64 A;  3OHA A;  1ICE B;  4G1P A;  2UUW A;  1TKT A;  3RAQ A;  4DR4 F;  2OPQ B;  1AZS A;  2PMZ D;  3QLH B;  3TZZ A;  2CJB A;  5E3Q A;  3AOB A;  2RIJ A;  3QAT A;  5HJX A;  4ZVF A;  1S4F A;  4DR1 J;  3H5S A;  2J6U A;  2FJA B;  4B9V A;  2DNN A;  2C22 A;  5KFS A;  5SUH A;  2MGZ A;  2HND A;  5GMD A;  4J5O A;  2BJ8 A;  1PYT A;  5KFP A;  3HT3 A;  1YRU A;  2MQM A;  2IJN A;  1RLD A;  1ACM B;  3I96 A;  3Q2T C;  2FJB B;  5JVH Q;  4OQJ A;  1GT8 A;  2IC3 A;  3QBC A;  1CUL B;  3KMS A;  2YKN B;  2COL A;  2E7W A;  1T9W A;  1YBT A;  2GC8 A;  3LAN A;  2XZT B;  3R5A A;  4ILR A;  4KFB B;  3ET6 A;  2L48 A;  1S9E A;  1NME B;  3MR7 A;  3KNA A;  4LJM A;  2AJ2 A;  1NO8 A;  3HVA A;  3NCQ A;  2CQ3 A;  1FEE A;  3A8J A;  4CT9 A;  2AMC B;  2QSW A;  1NRK A;  5HSP A;  1ZS6 A;  2MLY A;  2UUT A;  3SBM A;  3G96 A;  4OV1 A;  3MHY A;  2EKN A;  3HHL C;  3QRP A;  3H59 A;  4LF8 F;  2J5A A;  4DR7 F;  1KQK A;  4K4T A;  3CCW A;  3E2E A;  1RHQ B;  1TKX B;  1FRH A;  4XIU A;  2ZC4 A;  2HMI B;  2CZV C;  3MEE B;  3ZZU A;  5DG9 A;  2WSE C;  3QIP A;  4USH A;  4Y00 A;  1KP6 A;  4L75 A;  3Q2S C;  4QQB A;  4B9N A;  2QLJ B;  3TUP A;  2WB4 A;  5KFW A;  5F8I A;  4DUT A;  1YZ6 A;  2RU9 A;  4QWD A;  3DOK A;  2BQ3 A;  1HNV B;  4F2S A;  2W2N P;  1RYS A;  3I9Z A;  3RR7 A;  3BGO P;  2HFO A;  4C8L A;  2ZJP Q;  2JC1 A;  4I7F B;  4WKY A;  2D7S A;  5JMN A;  3DLE A;  1S99 A;  3DU5 A;  3S8S A;  1JLB A;  1SJ3 P;  4DV0 F;  2MPU A;  1CBK A;  1MMN A;  5CYM B;  1S9G A;  2CRL A;  4FVC A;  3R9L A;  3UN2 A;  3O8W A;  1NB2 A;  3KK1 A;  4YHH J;  4DS4 A;  1CLF A;  2QLB B;  4ITS A;  4P73 A;  3BN4 A;  4RBT A;  2HAI A;  5CH7 B;  3E51 A;  2M0G B;  1VQ7 S;  1URR A;  3NXZ A;  2MKI A;  2ZH9 A;  3QRR A;  1O5J A;  2LDY A;  3RRH A;  3GR0 A;  4KTQ A;  3KUE A;  2WRM A;  3R7S B;  4FXD A;  4L3N A;  4I4B A;  2EFQ A;  5HO4 A;  3C8Y A;  4L74 A;  3BYR A;  2OTL S;  4NOH A;  4W4M A;  2ZHA A;  5E3R A;  3KJQ B;  2ZD1 B;  2ROG A;  2FGO A;  2BAC A;  3EXY A;  2RDJ A;  2D3Z A;  3NEK A;  2VG6 A;  4OJG A;  1SJQ A;  2ZBP A;  3D6T B;  3FFI A;  4AE5 A;  2VG7 B;  3H8Y A;  2GNK A;  3D1H A;  1KTV A;  1WG1 A;  1WSR A;  2B6A B;  2P9C A;  1R8B A;  2AYM A;  2W2P P;  1QVF R;  1XNR F;  1B70 B;  3HHL D;  2I38 A;  3AD9 C;  4OHV A;  3DXS X;  1GX5 A;  4OMF G;  3KLG A;  4DFJ A;  2M3D A;  3M2U B;  2VB6 A;  4CLP A;  5DLG A;  1NKB A;  2ZWP A;  1U48 A;  3MTK A;  4OV6 A;  4KGK A;  2JOQ A;  3UVJ B;  1VK8 A;  1CPZ A;  4P7T A;  1RDR A;  1Y3K A;  1RU2 A;  2ZFH A;  2YNI B;  3CME S;  4QZV B;  4WWS A;  5IM0 A;  3BSO A;  2W25 A;  3VAL A;  2VD3 A;  3E8O A;  2KH9 A;  2ZNZ A;  5IC4 B;  2H4Y B;  2WK4 A;  4OZN A;  2PO4 A;  1S1W A;  3D0H E;  2BE2 A;  3GG1 A;  2IBO A;  1IM4 A;  3KXD A;  3RU0 A;  4I1T A;  1LWE B;  4RW4 A;  1JLG A;  1Q7Y T;  4EBD A;  3OL6 A;  3HK2 A;  1X4H A;  1ZAW A;  4K4W A;  2KFN A;  4NLY A;  2POK A;  3TNV A;  3TJ9 A;  4ZP6 A;  1DBD A;  1N0V C;  5L1K A;  2C28 A;  4PXE A;  2BV3 A;  2V2K A;  1SH0 A;  5EX3 A;  3EGW B;  3ENV A;  3EE3 A;  4DS5 A;  3FK4 A;  2GV1 A;  4WCE Q;  2ZVS A;  7FD1 A;  3AQO A;  3GV7 B;  2Q6C A;  5H9F K;  4RKU C;  3KLF B;  5CYQ B;  3UPF A;  4WTY A;  3ZZY A;  3RB4 A;  2LKZ A;  2V9W A;  4IG3 A;  4TLR A;  1VC0 A;  3GFZ A;  1JMT A;  3IMQ J;  4DQQ A;  4EEY A;  1C2P A;  1W26 A;  3MPY A;  2WHO A;  2F4F A;  4N8O A;  4DV5 F;  3PV8 A;  3CJ4 A;  3EDR B;  2HQC A;  4L73 A;  2BR0 A;  1HNI B;  4F0M A;  4USW A;  5IWA J;  1FNM A;  2E1A A;  1LOU A;  4DZ6 A;  2H1Y A;  4XK8 C;  3M8Y A;  1BQM B;  1CC7 A;  3PFE A;  3X3U A;  3U1M A;  1NJY A;  3G4S S;  5B7W A;  3QT7 A;  1GAO A;  4M1K A;  1WF0 A;  2E44 A;  3VAK A;  1RWW B;  2HHW A;  2FTR A;  2G13 A;  4LF7 J;  2F9J A;  2GMJ A;  3MMC A;  5ETK A;  4C11 A;  2JLF A;  3OR1 B;  1HQU B;  3KDN A;  3JTP A;  4K59 A;  1IWA A;  2GIR A;  1AT1 B;  2KHC A;  3KYL A;  4WZM A;  3C2P A;  1Y3J A;  2KYX A;  2OEL A;  1B3T A;  5KFM A;  1AB8 A;  3C6T B;  5G0R A;  4FPR A;  1X5P A;  4PWW A;  3KDO A;  2AWZ A;  4RW8 A;  2CJA A;  1N5V A;  4O3Q A;  2CG4 A;  5M2P A;  1FFW B;  3BBB A;  4RW7 A;  2CQ0 A;  1T05 A;  2DIV A;  1GX6 A;  1SL0 A;  3G86 A;  2ZDP A;  1JLE A;  4OLP A;  1NCL A;  1YJ7 A;  2YNH B;  1T03 B;  1RAJ A;  5K8M A;  1YRT A;  4ZVU B;  3OW2 R;  1HI1 A;  3C14 A;  1SPB P;  4USK A;  1RBA A;  2RB7 A;  2XMW A;  1PC5 A;  1KLM A;  2M8D B;  1TUG B;  3TZW A;  3US5 A;  1N8R T;  1RZM A;  5KT3 A;  4MIW A;  1C0T B;  2R7X A;  3W5X A;  3T1Y J;  4ZPT R;  5DG7 A;  5F8H A;  4X66 F;  3BZQ A;  3THV A;  1D9D A;  1UKU A;  5KG5 A;  2XHC A;  1WG5 A;  5HJY A;  2QV6 A;  2HQF A;  1RUS A;  3AJ1 A;  3GWC A;  4A8X A;  5LSL A;  4CP5 A;  1TKZ B;  2ZIT A;  4NLQ A;  5MAO A;  1WTF A;  4PQA A;  5LOQ A;  1GMV A;  3CJ0 A;  1LWC A;  1Q8K A;  3QZ8 A;  3MF5 A;  2CAJ A;  5LXR A;  4HLB A;  2HFU A;  5F8N A;  3PG9 A;  2VFS A;  1JLC B;  1I94 J;  1H98 A;  1EP4 B;  3WIU A;  3EPI A;  4LF5 J;  2APO A;  4EZ9 A;  1IQZ A;  4G1Q B;  3RW7 A;  2DXD A;  3IO1 A;  1B4S A;  3FQL A;  3CGI A;  4OZ5 A;  2AYE A;  2QYC A;  1J5E J;  3QFW A;  2LYV A;  5DDQ C;  4DL5 A;  5A8R A;  1JJ2 R;  3B54 A;  2XO6 A;  2OPR A;  2A6O A;  3CCQ S;  2A10 A;  3MEC A;  3GSI A;  3T5J A;  4RUC A;  2Y9H A;  1C4A A;  3CJK A;  3MED A;  3W2V A;  3CVK A;  2HK2 A;  2HFZ A;  3KWM A;  1RHJ B;  1MNE A;  1N5Q A;  3HZE A;  2YH0 A;  2GW8 A;  1T9X A;  4KT0 C;  4D3H A;  1P8G A;  4OFZ A;  2QL9 B;  1P1L A;  4DR6 F;  4C4W A;  4P52 A;  2XZD B;  1QLN A;  4UTG A;  2CA9 A;  2E5J A;  3V81 B;  3RW6 A;  4RNF A;  2W4C A;  3RG6 A;  1RYR A;  3OL9 A;  5DQH A;  3IRW P;  2PI5 A;  4YP3 A;  3BSC A;  1Q79 A;  3NBP A;  3D2W A;  1LXJ A;  1SV5 A;  4FVM A;  1FCA A;  1A7G E;  1VLO A;  2MXY A;  4NI2 A;  2VFR A;  1JXV A;  3QFH A;  4ZS6 A;  1IKV B;  2M4M A;  1LK7 A;  3RRG A;  2YX7 A;  2X1A A;  4K4V A;  1MSW D;  2OHD A;  4LF4 F;  2ROP A;  1LWF B;  3TQ1 A;  4B3O A;  4F0H A;  4FF4 A;  4NZ0 A;  4C8K A;  5DLF A;  1RT5 B;  5ADZ A;  3DCA A;  1N5Y A;  1ZOT A;  3GII A;  4DPT A;  1HR0 J;  4NXM J;  2NXE A;  2CG8 A;  4EO6 A;  2UVR A;  4NRU A;  1S7I A;  3A8E A;  4QCL A;  3DRP A;  2XLK A;  1BGX T;  5I3U B;  1MN7 A;  1TAU A;  2XYP B;  2AT1 B;  2YQ3 A;  3GE9 A;  1L3V A;  1WKL A;  2C3P A;  2LEC A;  3IP0 A;  3ITH B;  4JV5 J;  4DPW A;  1CS4 A;  2AU0 A;  4Y6I A;  4ATN A;  5ETR A;  4GC6 A;  2CQP A;  2B9E A;  3M8P B;  1CJT A;  3J7Z 5;  5HQL A;  2DHH A;  2J6S A;  3UDC A;  1YJU A;  4LF5 F;  3DLG A;  1NSQ A;  3BKF A;  1X7V A;  4N76 A;  1YRX A;  1V3S A;  3CUL A;  2X1F A;  2YNG A;  4KKO B;  5HI7 A;  2GVD B;  1NJW A;  3DM2 B;  5K14 B;  5ETV A;  3RAM A;  2FZK B;  1Q16 B;  1HKA A;  3CD5 A;  1Y0H A;  1NH8 A;  2CVE A;  4NAS A;  4WYW A;  3L3C A;  2QZ8 A;  3GB0 A;  4Q0B A;  3R5C A;  4OJ3 A;  4K4U A;  5HP1 A;  2DNZ A;  4UOG A;  1UVJ A;  3V4I A;  3CCS S;  3CE8 A;  1RQ0 A;  1K8A T;  4JI5 F;  1CSJ A;  2RIL A;  1EHW A;  1IJF B;  4F7V A;  4EWT A;  2HAF A;  3IM9 A;  4NYO A;  2R9L A;  2YKM B;  2GHV C;  3CCE S;  2VQE F;  3C15 B;  2BJD A;  3O3L A;  2XWX A;  2FZG B;  3GJS B;  2XSJ A;  4PG4 A;  4B3T F;  4DLG A;  5KFO A;  5A2Q Y;  4RX6 A;  3E01 B;  2HLU A;  1NDL A;  4PXC A;  2AKW B;  3SSQ A;  2LFV A;  3W66 A;  4PWD A;  3MPW A;  1UVM A;  2UUB J;  5KFF A;  3UCG A;  4J9Q A;  3T9N A;  5T7L A;  5GAE I;  1C1B B;  1UMJ A;  1T94 A;  3R5G A;  2IPO B;  2KM8 B;  4QIV A;  3BPS P;  3OTO F;  2BA9 A;  2F4V F;  2QLX A;  4CLT A;  1D1U A;  1JLQ A;  2UUC J;  3MD1 A;  5J2Q B;  2ZVI A;  1RBL A;  2O5D A;  3PYE A;  3MPV A;  4NZ7 A;  2WVD A;  5H9E J;  3BGF A;  2BRK A;  4U67 Q;  2DK2 A;  2V4R A;  1M5K C;  3NS7 B;  4HI1 A;  3DLJ A;  2ILY A;  4OYW A;  1TKD A;  1HR0 F;  4NXM F;  3C66 A;  2DCU B;  2VA2 A;  1UET A;  4DR5 F;  1VBZ A;  5HN0 A;  3MUM P;  1ROF A;  4KH0 B;  4BCA A;  2UXB J;  3B6B A;  3QJL A;  2H4W B;  4DZD A;  2HGM A;  2RDI A;  3Q8U A;  2CIM A;  5CZX A;  1C0U A;  3EZU A;  1TV6 A;  2I1R A;  4OZL A;  2Z58 B;  5KT6 A;  2KJV A;  5KTQ A;  2VJV A;  2LP4 A;  4K7Q A;  1K44 A;  1VQ8 S;  3B82 A;  5JJB A;  2G2Z A;  3TW0 A;  3M1V A;  3NOG A;  3PX0 A;  2HGN A;  2XLJ A;  1TL7 B;  4X4S A;  3HSG A;  4TYB A;  3CCL S;  5F8J A;  3QWP A;  3ZFV A;  1DTT A;  2QLF B;  2YBV A;  3CJ2 A;  4NA1 A;  4FKY A;  3LP2 B;  5IC6 B;  3NAH A;  4R5P A;  4ED2 A;  2VC1 A;  2DR6 A;  1IBM J;  3CCV S;  1OJ4 A;  3A8K A;  1RTZ A;  3JQM A;  4ZN1 A;  3MCO A;  4KGM A;  1YI2 S;  1MWZ A;  3HJV A;  4DR2 J;  4AQY F;  5HVG A;  2JRS A;  4LRD A;  1UZH A;  4NCG B;  2O3D A;  4ZPV R;  2VBW A;  5DM6 Q;  4BWM A;  1LQ9 A;  2OFG X;  1TUW A;  1FDD A;  1KC8 T;  3LP1 A;  1N36 J;  4JI4 J;  5CXT A;  2GCF A;  2LQ8 A;  3ZTQ A;  3GIJ A;  4UW2 A;  4W90 B;  2KZM A;  1NDC A;  3UNG C;  4ECQ A;  5B0G A;  5ETN A;  4GKJ J;  2VU5 A;  1J27 A;  5IV4 A;  4IQM A;  4J9S A;  3FUY A;  4JB8 B;  5F9L A;  1UVI A;  1QAI A;  3PDN A;  4UT4 A;  2P9G A;  4JI1 J;  5FII A;  1MMD A;  2UUC F;  1V3R A;  2ROE A;  4GRS A;  3IBW A;  1S1U B;  3DLH A;  4CM2 A;  4P10 A;  4DX6 A;  1F5B A;  1RAE B;  4JP8 A;  4Q8E A;  5J2P B;  3RBX A;  3HO1 A;  2AIR B;  2ZBQ A;  2FHK A;  1N33 F;  3LUY A;  3MCM A;  4U7C A;  4O44 A;  2CVI A;  5M2U A;  2H65 B;  3NKY A;  2NXN A;  1VRT B;  3A12 A;  5EX0 A;  2P5V A;  5GAE U;  4OI4 A;  2LEA A;  2F5G A;  5KFG A;  3UI3 A;  4ZN3 A;  1JKH B;  3MAA A;  3HI9 A;  2FVR A;  4X62 F;  1DQA A;  1QUP A;  1PSD A;  4WTO B;  1TKT B;  3GTY X;  1AZS B;  2KRB A;  5ETT A;  2E5H A;  3NAI A;  3MCN A;  4JBC A;  4LF6 F;  2JSX A;  2MZS A;  4RPF A;  1S1T A;  3J7Y I;  4A8S A;  3KG0 A;  2CJY B;  2XY6 A;  4GO5 X;  4P2S A;  2R7Q A;  2J8S A;  4F0K A;  1LEO A;  2QSF A;  2MHN A;  3CJR A;  1CJV A;  2RE1 A;  5A6W A;  2U2F A;  2MGZ B;  2HND B;  3R5J B;  3I0R B;  2FLP A;  2KZZ A;  4DV6 J;  1WEL A;  1TL5 A;  3HCX A;  4CO2 A;  4CQ1 A;  4ES3 A;  1FVQ A;  2ZHB A;  4DR2 F;  1LFP A;  4DUZ F;  4YR0 A;  2UV8 A;  2IC3 B;  3LPE A;  2N7C A;  5IV3 A;  3K89 A;  3WHI A;  3JXO A;  4F4A A;  2CDQ A;  3BQ0 A;  3NWG A;  4TY8 A;  4WFN Q;  3ISN D;  3ET6 B;  1S9E B;  2Y1J A;  2XM3 A;  1H3D A;  4DV2 J;  4O3P A;  5AXN A;  1FD8 A;  4CIO A;  3G8Q A;  4YB6 A;  2X51 A;  3THP A;  1RP5 A;  5BYS A;  1U24 A;  3ZZP A;  2XI2 A;  2YWH A;  4KV8 A;  4J9P A;  1OWX A;  3RB3 A;  2D1C A;  5B0D A;  3R7B B;  4BBY A;  1S6Q A;  2AJQ A;  2D3O 1;  2W4P A;  1P9Q C;  3D6H B;  4CLY A;  4I67 A;  3LAM A;  2PEB A;  4GMK A;  1EB0 A;  3SCK E;  4ZPB A;  1R0A A;  3QIP B;  5EDW A;  1RAI B;  3Q22 A;  4DFK A;  2BJ9 A;  1NB7 A;  1KVJ A;  3FDS A;  2BBE A;  3M9M B;  4KHR A;  4DDF A;  1MML A;  1S0N A;  3DOK B;  1IKY A;  5DS7 A;  1S0M A;  3A13 A;  4O0I A;  4DL7 A;  3IAS 9;  3P8B B;  3DLE B;  3NL0 A;  1U0S A;  7AT1 B;  3QO9 A;  1JLB B;  3W62 A;  3HHK A;  2KI2 A;  3W63 A;  1H0H B;  3O1L A;  3NGT A;  2GA7 A;  2BJ3 A;  1V9O A;  1S9G B;  4IYQ A;  2CPJ A;  3KK1 B;  2XGQ A;  2D74 B;  2E7X A;  2HS3 A;  1F3V A;  2E29 A;  3RUB L;  4TLQ A;  4O0N A;  3TA1 A;  2OMO A;  2DD8 S;  2GAG C;  2K1R A;  1OY9 A;  3OFF A;  3PY8 A;  3UD5 A;  4HTJ A;  2XS2 A;  1T02 A;  2EG1 A;  1RTD A;  1G3O A;  4NLU A;  2ZH5 A;  3MPD A;  4X4N A;  1TVR A;  1VQ9 S;  2LXF A;  2YKQ A;  4BDP A;  2DRA A;  1BXN A;  1SXL A;  4N8N A;  2VG6 B;  3DGV A;  4DBQ A;  4RWX A;  2CZ4 A;  3FFI B;  5A0Y A;  2EFV A;  4LBP A;  1L3S A;  2XTJ P;  3D28 A;  4ZVT B;  1BWE A;  4B3S F;  3R97 A;  2L9W A;  2KB2 A;  4U6P A;  1U47 A;  2XBP A;  2RDD A;  3KLG B;  2KDO A;  5HMY A;  3VQT A;  1VCT A;  2RSQ A;  3RBD A;  1RIS A;  3JQK A;  4MIA A;  4Y34 A;  3R6L B;  2YX4 A;  2QYG A;  1S6P A;  1YIT S;  3P5B P;  4FNH A;  4WP3 A;  2F63 A;  3AJ2 A;  1RAF B;  5IM0 B;  2E7V A;  4LRF A;  1H72 C;  1S1W B;  4X84 A;  2CZ9 A;  2FDN A;  5KT7 A;  1ELO A;  1YX2 A;  2MDA A;  5L1L A;  2G0J A;  3N0V A;  4H4K C;  4TVA B;  3HP6 A;  1M1K T;  4FZV A;  4Q43 A;  2WW8 A;  1Q95 G;  4QOT A;  3L7U A;  2BE2 B;  2XNQ A;  3D9B A;  1NK0 A;  1X4A A;  5DQI A;  3VTI A;  1KQG B;  1VBX A;  4RW4 B;  1JLG B;  3RBE A;  3P96 A;  1KOO A;  1UVK A;  1S77 D;  4NLT A;  3O6Q A;  1G1X A;  1U2C A;  4QU6 A;  5LMU J;  3DRR A;  1NDP A;  1PAE X;  4DV7 F;  3I6P A;  1HNW J;  2A1B A;  2J9D E;  2DNO A;  4IFV A;  3PKY A;  2D9O A;  3IGV A;  2ZBR A;  3K58 A;  3V6D A;  3MM7 A;  4F50 A;  1DLO B;  1K1Q A;  4F3O A;  2N3L A;  1U6F A;  2EKY A;  2QJ3 A;  3MM8 B;  3TA2 A;  1SKS A;  4F36 A;  4JI0 J;  1FWK A;  2VH7 A;  1HD0 A;  2GJI A;  3WBZ A;  4NLV A;  3AOC A;  3AH6 A;  3RTV A;  5LSR A;  2XCP A;  4IG3 B;  3LP0 A;  4USM A;  1FJG J;  3P4U B;  2FC8 A;  4U8Y A;  4RZR A;  1IBK J;  3OXF A;  5BYQ A;  4HL9 A;  3TX0 A;  3EGZ A;  4JI7 J;  1OMS A;  1XJW B;  3FVY A;  2EPI A;  4N56 A;  2ASJ A;  1OIA A;  1DHM A;  2IMO A;  2RML A;  3RBZ A;  2Z57 B;  1Q53 A;  2DNG A;  2ZZT A;  1NUE A;  4ZVE A;  2X1G A;  4AT1 B;  4R0J A;  4M8L A;  1RCO B;  2B51 A;  1ZYQ A;  3L9Z A;  3K57 A;  3MMC B;  1O8B A;  1RT4 A;  4YDX A;  1KVK A;  5JXS A;  4C11 B;  3EVW A;  4M5I A;  2MY7 A;  1WHW A;  2PC6 A;  3A1Y G;  5D4N A;  3BGL A;  1APS A;  3N28 A;  1VQM S;  1MRO A;  4NYP A;  4YUD A;  2XLI A;  5G0R B;  2WAQ D;  2HVD A;  1Q8L A;  4LIR A;  2BUN A;  8ATC B;  4RW8 B;  4PAA A;  2OJ3 A;  4IRD A;  1NK8 A;  4EU0 A;  5ETM A;  1NBE B;  4RW7 B;  4YR3 A;  2F8H A;  1T05 B;  3U1N A;  1TEL A;  3UFC X;  5BXI A;  1JLE B;  3W2W A;  1HBM A;  2N4C A;  3A3N B;  1RLC L;  1UAW A;  2J0S D;  4DV3 J;  1U1L A;  1F2H A;  4J9O A;  4NPO A;  2HFV A;  1REV B;  4NLR A;  2LU2 A;  5F8G A;  3C14 B;  2PN6 A;  4ANC A;  2K3K A;  6FD1 A;  1KOH A;  3UR0 A;  1KLM B;  1R27 B;  1P6T A;  1VC6 A;  3GZ7 A;  2DRD A;  1IN0 A;  3OHB A;  2MYF A;  1YBA A;  1AFI A;  2DEI A;  4Z7Y A;  3D6F B;  4OYI A;  4IR9 A;  3UDE A;  2V8H A;  2D3U A;  1G2E A;  2DXE A;  2QX0 A;  4C0H A;  4M5J A;  4WK1 A;  1YHQ S;  1PBU A;  5I4M A;  1QVG R;  1FRJ A;  1LWE A;  2FJW A;  1WKK A;  1FJG F;  4KC5 A;  5KAK A;  2Q3P A;  2OPP A;  5JVG Q;  1U25 A;  1LWC B;  4O4G A;  4JI3 J;  1V3Z A;  4ZVR B;  4JI7 F;  3W3S A;  1FK9 A;  1NSK L;  2NXU A;  4ZKA A;  1IKW A;  2XB2 D;  3QID A;  5F41 A;  3SMZ A;  4V19 J;  3QNW B;  4LRC A;  2BKP A;  4NLG A;  3D6M B;  2NSB A;  3TEH B;  2I8E A;  4C2M A;  2VBZ A;  3K5L A;  3TI0 A;  2KFY A;  4WFY A;  3CXC R;  4G6V B;  2WBR A;  1NZA A;  2VG5 A;  2PSZ A;  2VJU A;  5A8R B;  2ASY A;  5CCM A;  4AND A;  1LW2 A;  1U1O A;  3CDB A;  4OYM A;  2OPR B;  2HW3 A;  2HFN A;  1SIW B;  2DKO B;  3MEC B;  1HNI A;  3I5A A;  5GAH I;  3K5N A;  3CJK B;  2F40 A;  1QD1 A;  3MED B;  3QPI A;  3GIK A;  4XDD A;  2VOD A;  3W2V B;  1N52 B;  3VZI A;  1SQF A;  3HSJ A;  1TK8 A;  4IH6 A;  3IWL A;  4XPE A;  3OTE A;  2ILZ A;  3CC4 S;  4CLW A;  2LU1 A;  4ECU A;  2QO3 A;  3FKB A;  3D3C J;  3H40 A;  2HK3 A;  5E5N A;  4YY3 F;  4IOC Q;  5F8L A;  3M6W A;  4DN9 A;  3NNC A;  2UVW A;  2MLZ A;  1B7Y B;  2P2C B;  5AT1 B;  1WTB A;  3NBP B;  1SV5 B;  4OL8 A;  2HVZ A;  4C3K A;  4NI2 B;  3RJM B;  4PG8 A;  4A4J A;  2BE9 B;  3NGR A;  3KLH A;  2ZH6 A;  2IM2 A;  4NEZ A;  1GQE A;  4B3O B;  2AGP A;  2VDI A;  2QMX A;  5D0E A;  5CZV A;  1N5Y B;  3CD0 A;  3QJP A;  4OJ1 A;  4K2J A;  1FI4 A;  4LVO P;  1OY8 A;  3D66 A;  5IQ6 A;  4J91 A;  1IR2 A;  3J7A 1;  1KFD A;  3DRP B;  5LMN F;  1IR1 A;  2CPE A;  1FKO A;  2GJF A;  3QGH A;  2FB0 A;  4B3R J;  2CPH A;  3AB4 B;  1CS4 B;  4MKV A;  2ADB A;  2KU7 A;  2IM3 A;  3W7B A;  1CJT B;  1KDN A;  3DLG B;  4FPI A;  2W9C A;  2CNN B;  3EX7 B;  4RL1 A;  1RKJ A;  2HUR A;  3J80 U;  2R7W A;  2YNG B;  1IUJ A;  2K3I A;  1NJX A;  3FCV A;  1MWY A;  1RBO B;  3OBI A;  3SXL A;  2LA4 A;  2EBE A;  5D4P A;  4OIX A;  4JOU A;  3MMJ A;  1VIX A;  1VFJ A;  5B0B A;  2OAU A;  2RHQ B;  2R7R A;  4IRK A;  4Q0B B;  2SXL A;  4YB1 P;  2FHM A;  1FE4 A;  1S6U A;  4QYZ K;  5HP1 B;  4PXD A;  1LKZ A;  3V4I B;  1HNZ F;  4KBI A;  4F25 A;  4Q44 A;  2MZJ A;  4DWI A;  2ZDO A;  2ABY A;  3M6X A;  2BJE A;  4R8U A;  1IBL J;  2LQB A;  2HHT A;  3IG1 A;  1S48 A;  3CJ5 A;  5K20 B;  1KD1 T;  4ED4 A;  2XSJ B;  1CQM A;  1UEK A;  5C2G A;  4LFA F;  4Q2M A;  2JX2 A;  4CWB A;  2NPI A;  1SQE A;  2G2O A;  4QWC A;  2IVM A;  4ZVS B;  4HHJ A;  3MR5 A;  4PWD B;  1X4B A;  3H90 A;  3TAQ A;  4Y28 C;  3OFH A;  4GC7 A;  5AXK A;  5T7L B;  3JAM Y;  2XC9 A;  3R1H A;  1ZET A;  2U1A A;  2ZOG A;  2VKZ G;  2F65 A;  1T3O A;  1JLQ B;  3BBC A;  3P6Y C;  3FEZ A;  3H2U B;  1M5H A;  2NYI A;  5A76 A;  3QT6 A;  3MI7 X;  1QSS A;  2B9X A;  2PMW A;  1T8E A;  1PO6 A;  3KTQ A;  4JV0 A;  4UZB A;  3BS9 A;  1S1V A;  4DSI A;  3ICL A;  4TY9 A;  4E2F B;  3AA9 A;  3CSK A;  1RHU B;  1JK9 B;  3ENQ A;  3HFZ B;  4KHM A;  2FVS A;  1VBK A;  3KLE A;  4JI6 F;  3P5T L;  1RAG B;  1C0U B;  1U49 A;  3OUY A;  1TV6 B;  3HLU A;  4B3M F;  3IR7 B;  4G3I A;  1XMQ J;  3L09 A;  5L46 A;  1TUV A;  2GQQ A;  3H98 A;  1WI8 A;  3HMJ G;  2R2U A;  4ES2 A;  3GJR B;  3M1V B;  5BR8 F;  4S0M A;  4X65 F;  4M5M A;  1RWN B;  2BX6 A;  2O1P A;  4J90 A;  3TJA A;  3F44 A;  4OYX A;  5IT9 Y;  1NU4 A;  1DTT B;  2XYG B;  1D8Z A;  4C7Q A;  3O44 A;  3IM8 A;  3SDE A;  4USV A;  2ZBC A;  1VQK S;  3J7A N;  3V6H A;  4DFM A;  1OSD A;  5DGB A;  4R5P B;  1ULR A;  5U47 A;  3MCS A;  4QYZ J;  3D7S B;  3GU0 A;  2EEY A;  4CT8 A;  2VPX B;  1JB0 C;  2OD4 A;  1GTE A;  3EZO A;  2JNJ A;  1VS3 A;  1RB0 A;  1Z1Z A;  1WEZ A;  2EFO A;  3ZXW A;  3QAE A;  2KM8 C;  2W2O P;  1ZPW X;  1HFE L;  4KRW A;  2G9O A;  1YJV A;  4I64 A;  3AOD A;  3K0J A;  4RUB A;  2W8K A;  2KT3 A;  3IR6 B;  3LP1 B;  2FVC A;  3JTO A;  4NLO A;  3QSY B;  3PTW A;  1LK5 A;  1FXD A;  5D3G B;  2BMB A;  2DY1 A;  2CNO B;  4PG7 A;  2RQC A;  2RH3 A;  3UN5 A;  3DN9 A;  2DY9 A;  3BDP A;  1MW7 A;  1TL3 A;  2RQ4 A;  2AX0 A;  1RWV B;  4PPD A;  1CG2 A;  3LGH A;  2HHH J;  1ZTT A;  4HHU A;  4ZLL A;  2RUG A;  4KQZ A;  2XI3 A;  4O3O A;  4KPY A;  2QE5 A;  3ETM A;  3D68 A;  1NJZ A;  4ZVG A;  4TQR A;  1REG X;  1S1X A;  3ZZZ A;  2UUA F;  1KON A;  4XAK A;  1VC5 A;  2DYA A;  4C8M A;  2E66 A;  4O44 B;  5FJ4 A;  1UWB A;  2AJF E;  2MQL A;  2VDH A;  3LPY A;  2B7C B;  4J9V A;  1X5T A;  4DV1 J;  3Q8V A;  4P7V A;  4WKR A;  1SC3 B;  2VHG A;  3MAA B;  2HNY A;  3VZH A;  2IHR 1;  2WTF A;  1PYS B;  3IRX A;  4NMX A;  2GJ2 A;  4F3M A;  2AGO A;  5EGY A;  4DXL A;  3PR5 B;  1SC1 B;  2AF6 A;  4ZCM A;  4ZIV A;  4TU7 A;  1S1T B;  3TAR A;  4UOH A;  3A8I A;  4CH1 A;  2BOP A;  3N01 A;  4OYP A;  2HKE A;  1LW0 A;  4HT5 A;  2V9K A;  1CJV B;  4I69 A;  3TAM A;  1URN A;  1S10 A;  1S6O A;  4ZK7 M;  2GO8 A;  1SC4 B;  2LQJ A;  1Y9O A;  4AL6 A;  4USJ C;  4W98 A;  2B9Y A;  2IDE A;  2J9D A;  1KLN A;  1QTM A;  2C2E A;  4DR4 J;  4ED3 A;  4P2M A;  1S97 A;  1U1Q A;  2WSF C;  1NHV A;  2IVF B;  1C1C A;  1GH8 A;  3G82 A;  4TY8 B;  1VGY A;  3LA0 A;  2Y1I A;  2HS0 A;  1UFL A;  2OSQ A;  3H4D A;  3BN7 A;  3BR8 A;  4B9U A;  1CJU A;  3FMW A;  5AJ3 J;  4DPO A;  4D3G A;  3JAM U;  1BE4 A;  3OFE A;  1VK3 A;  1QM9 A;  2R8H A;  4RNN A;  4B02 A;  1NHK L;  2C2K B;  4USU A;  4IOB A;  1NM2 A;  4KV8 B;  4QIW D;  5J1P A;  1FNX H;  3C3L A;  2CPF A;  2R8G A;  2V0N A;  2BZ2 A;  1YJR A;  1UA1 A;  4TXS A;  2GMH A;  4UST A;  1R0A B;  2B0G A;  2OIH A;  4IH7 A;  4LVN P;  4NYZ A;  2K2P A;  5HMX A;  4ZHR A;  2VL1 A;  1U1P A;  2E5L F;  2DNH A;  1RT3 A;  5KFB A;  3MXH P;  1HD1 A;  1ZPV A;  4FYV B;  2O01 C;  2XWY A;  2H51 B;  3P3D A;  3TRG A;  3MUT P;  1IKY B;  4DV1 F;  1W25 A;  3DLK A;  1Z4U A;  5KFU A;  5CA5 A;  1V5I B;  3K5M A;  1FTC A;  3OTD A;  4DU7 A;  4CO5 A;  1AFJ A;  3QO9 B;  4DR7 J;  2BM0 A;  2DH8 A;  5CYJ A;  3L7P A;  3FC9 A;  3LTO A;  2JH3 A;  2KVQ E;  2W9A A;  1NND A;  2JEF A;  4YOE A;  1FO1 A;  1EKS A;  5BJR A;  2HQG A;  2GHP A;  4OZ3 A;  5L38 A;  2MQP A;  5IT9 U;  4B9M A;  4C9D A;  3W9J A;  3OSP A;  2CQ1 A;  2K1R B;  3PW4 A;  2C2R A;  1KR4 A;  3NS5 A;  3JTN A;  4J9L A;  4X2B A;  2R2T A;  2KO1 A;  1VQS A;  2I9S A;  2KJW A;  3VAG A;  2LDI A;  3W8G A;  4QIG A;  1FNO A;  4V1A k;  3BGR A;  1WD6 A;  3HF5 A;  4XDC A;  3V5R A;  1RTD B;  4DV0 J;  3MGJ A;  3MMA A;  3OVB A;  1WEX A;  2NSC A;  1N32 F;  3G71 S;  2BQR A;  1TVR B;  3W65 A;  4CLS A;  5D0G A;  3M2V A;  1CVJ A;  4HEA 9;  2H54 B;  1JNZ B;  4F4Z A;  3U7J A;  2DIS A;  4X64 F;  1H73 A;  1FKP A;  3Q83 A;  4JUZ A;  1RTI A;  2B56 A;  4CI0 B;  3CB4 A;  1J5O A;  4PCQ A;  5A0Y B;  5AJ3 F;  5GAD I;  2AZ1 A;  3I0R A;  4WE1 B;  3KMQ A;  2M5Y A;  5KG6 A;  4FS2 A;  4K4S A;  3B4D A;  1RWM B;  3DNC A;  1QSL A;  4ECV A;  4RUH A;  3QSI A;  4ENO A;  1TU0 B;  2EVZ A;  1S6P B;  2CQD A;  3BBF A;  3FMB A;  1PJ7 A;  4I2Q A;  3HKZ D;  5DJB A;  2GO9 A;  3PRD A;  3EZ5 A;  2GVZ A;  1N34 F;  1ARO P;  2W2M P;  3S7R A;  2YKP A;  4Y0F A;  1XNR J;  1P1T A;  1NK6 A;  3CDA A;  2HRT A;  1GNK A;  2VUG A;  5HMZ A;  3DI6 A;  5IT4 A;  4ECX A;  3I4H X;  2DO4 A;  3CCM S;  3L95 X;  2PFF B;  1M90 T;  1FFG B;  1XEZ A;  1VOM A;  2X3G A;  2V5H G;  1WG4 A;  1GFW B;  1F6T A;  2IYG A;  1M1G A;  1WHX A;  1MU2 A;  3IA0 A;  3M8R A;  2OD6 A;  1Q7L B;  1J2V A;  1XR6 A;  5LT5 A;  4LFC J;  3DRR B;  3ELH A;  1HBU A;  1R6V A;  4IFV B;  1BQX A;  3I5C A;  3CCR S;  3V6D B;  3MM7 B;  3PYG A;  5EN1 A;  5KFI A;  4DSL A;  2FJV A;  5KT4 A;  2JWN A;  3TR5 A;  3IWX A;  1WF1 A;  4GVB A;  1Q4R A;  2BKN A;  2DGQ A;  3AB2 B;  2F1F A;  3LP0 B;  8RUC A;  3AQP A;  1WC3 A;  3HKW A;  5F8M A;  1HBN A;  4UOF A;  3BKU A;  1YZ7 A;  1IR0 A;  9ATC B;  2DJW A;  2FJD B;  4DPY A;  2ZUG A;  1DAX A;  1RHM B;  2NRE A;  1XR5 A;  5FDL A;  4ZLP A;  1YBU A;  3TZX A;  3NLC A;  1KQS R;  3CIM A;  1YJ9 S;  3HUL A;  1KS2 A;  4C3L A;  5GAG I;  1F2G A;  2R3V A;  2YTC A;  1H7X A;  2HHP A;  3NMA A;  1RT4 B;  3T19 A;  3VGV A;  3N79 A;  3N5B A;  3AD8 C;  4RW9 B;  4DV5 J;  4DF4 A;  4XPC A;  2VBX A;  4OX9 J;  1D9F A;  4HTI A;  3EXC X;  1MRO B;  2Y3Y A;  5KFK A;  3GON A;  3VQS A;  4CDI A;  1H7W A;  5J2N A;  2RRB A;  5KG3 A;  2UV8 G;  2EI5 A;  4BHQ A;  5KFE A;  2XHW A;  3N6N A;  3DOM A;  4NL5 A;  1S9F A;  2XQC A;  5GVQ A;  3PZP A;  2XGP A;  1UWA A;  1Q1K A;  4NML A;  2FZC B;  4Q5V A;  4CLZ A;  2W9B A;  4YB5 A;  3BPD A;  1JWW A;  4MAK A;  1R8A A;  3W2W B;  1HBM B;  2DNK A;  4RWW A;  2QG9 B;  1N5S A;  3CF5 Q;  4Y2A A;  3C16 A;  4DEZ A;  1DJ0 A;  1NPP A;  1X4F A;  1SKR A;  4M5G A;  2FUG 9;  4CO3 A;  3CD6 S;  1EQ0 A;  1S5Z A;  4LFC F;  3CO9 A;  2X1B A;  1G4C A;  5K8O A;  1XK8 A;  3TUI C;  2ASL A;  1U02 A;  1HWK A;  3PEH A;  2J76 E;  2ZH1 A;  1SJ4 P;  1B0V A;  4MKY A;  4ELV A;  2Z30 B;  4OHY A;  1UJ4 A;  1VQ5 S;  1RAC B;  4DCO B;  2KXN B;  2AEJ A;  3M30 A;  1Y4Z B;  3M6U A;  1YQH A;  2OPP B;  1KHW A;  4O4G B;  4B9S A;  2XY5 A;  4YFU A;  4LSN A;  1FK9 B;  4ID8 A;  5FLX Y;  4M63 A;  2IJF A;  1UW9 A;  2A2D A;  1OQ6 A;  2YWG A;  1DLO A;  5I42 A;  3PYF A;  1IKW B;  4CLF A;  3FNN A;  4X66 J;  3MM8 A;  2MKS A;  4DR3 F;  1QJH A;  1SB6 A;  1KEK A;  4HDH A;  2ZUA A;  2F3J A;  1V5V A;  1TK0 A;  1S0V A;  1GXL A;  4DL3 A;  4QR0 A;  1JLF A;  3MMB A;  5GME A;  2VG5 B;  3DRX A;  2XO7 A;  5F9N A;  2DBB A;  1NSP A;  5THW A;  3QJJ A;  3BM7 A;  1LW2 B;  5K5M A;  4DPU A;  2WW4 A;  3ZTP A;  2V2V A;  2J9E A;  1HWI A;  1HPZ A;  1Z2L A;  2GZO A;  3PJW A;  4PG6 A;  4OX9 F;  1FA0 A;  1ZZN A;  1RT1 A;  4C8Y A;  3OD2 A;  2QIF A;  2AJ1 A;  1PJ6 A;  1SBR A;  3X1L B;  2UZA A;  1XNQ F;  3WZ0 A;  4OYA A;  4UQG A;  1UZD A;  3NCP A;  1K0V A;  3H4B A;  2E1P A;  4IO9 Q;  4LF9 F;  3IBC B;  5B0F A;  3SQG A;  5HQM A;  5HRO A;  1RCX B;  5A8K A;  5J2M A;  4EYH B;  1SJ1 A;  2MKH A;  4OZ2 A;  3BKT A;  1R3N A;  2HWH A;  1ZA1 B;  4PEO A;  5GAG U;  3SZ2 A;  2OEJ A;  1T9T A;  2R7T A;  5IOL A;  1SIZ A;  2P6T A;  5E41 A;  3LH2 S;  4OHZ A;  4EZ6 A;  1MLA A;  2YY3 A;  4X4R A;  1RGV A;  4EO8 A;  3EGV A;  2V69 A;  4AXJ A;  4QW8 A;  3HPO A;  4F4Y A;  2HEK A;  1H6K X;  5D0R A;  3HSZ A;  2F9D A;  4ECW A;  3LGM A;  2PFD A;  4ZCK A;  3PW5 A;  1YG0 A;  4CLU A;  1HHT P;  4RR5 A;  3I0S A;  1TL1 A;  2KYZ A;  4AL7 A;  3KLH B;  1YLX A;  4RBU A;  1M5P C;  3W60 A;  2D69 A;  1TTH B;  1ZM4 A;  4QJV A;  3J81 j;  1VLY A;  4ED7 A;  2YWF A;  4NLD A;  4DR6 J;  4RO0 A;  2KVI A;  3JQJ A;  5DDP C;  4CTA A;  4CYU A;  2L9D A;  4QWE A;  1UA0 A;  2BEF A;  1REV A;  2AJ0 A;  2E1C A;  1EET A;  2HVE A;  1FKO B;  4LSL A;  4EMD A;  5GMK a;  2G0I A;  3OJS A;  1N6Q A;  2CWX A;  3IN5 A;  2FD2 A;  2MKJ A;  1BWV A;  1R89 A;  2KXH A;  4IRC A;  5IQQ A;  3JSY A;  2W9C B;  4LF4 J;  3AOA A;  1W7W A;  4QPT A;  2BVZ A;  1EKR A;  3OV7 A;  2DR8 A;  2WB1 D;  3UE2 A;  3PW2 A;  5AE3 A;  4PYA A;  3GFY A;  2JJ4 D;  3N9U C;  3OR2 A;  2ACY A;  4MMO A;  4YN3 B;  4RNO A;  1GMW A;  2AYG A;  3W61 A;  3IC1 A;  2I0X A;  4URQ U;  5B0C A;  4EYI B;  4FYX B;  2KXF A;  5DRK A;  1FJE B;  1S12 A;  1E6V A;  4IFY A;  2ZJQ Q;  1JLA A;  3R7N B;  2CPZ A;  1HI0 P;  2R2S A;  5HVF A;  5K9F A;  4P2X A;  4KO0 B;  2E1M C;  1ZTW A;  4GKK F;  2HNZ A;  4R8U B;  4AUK A;  4K4X A;  2C3O A;  3IG1 B;  4OYB A;  5KG4 A;  1HL6 A;  3TUZ C;  4IR1 A;  1XMO F;  4RBV A;  5C24 A;  2VFU A;  3UCU P;  4LR9 A;  3CWJ A;  5EUH A;  5SZT A;  5K8P A;  1NSA A;  3PM9 A;  2GFF A;  4DV4 F;  2JEG A;  3LGN A;  2FGC A;  4KHP F;  1NK9 A;  2OH2 A;  4IKA A;  1YJT A;  3JSB A;  4N41 A;  5DDR C;  1DZ5 A;  3FRY A;  4M5K A;  2IRX A;  4JI5 J;  4JV1 A;  1KKH A;  1HW8 A;  2HRU A;  3DGP A;  4QWB A;  1NPR A;  2MJN A;  3GYG A;  4CLK A;  1IWG A;  2VQE J;  4C98 A;  1HI8 A;  3UN3 A;  3GIR A;  4UZC A;  3D4J A;  2PEH A;  2C1E B;  1QSY A;  4PKD B;  4B3T J;  2J7U A;  4A47 A;  5KFL A;  4DCP B;  2W8L A;  2BE7 D;  2B8Q A;  1S0O A;  2DNM A;  1TP7 A;  4CO0 A;  4IH5 A;  1BMQ B;  1S1V B;  4QWA A;  1RHK B;  4I6A A;  1F1B B;  2DR7 A;  3BSN A;  2YVS A;  1RAO A;  3ONQ A;  5FLX U;  2B4O A;  2VFT A;  2CXE A;  2XMM A;  2EFG A;  4FP9 A;  4ID5 A;  1F9F A;  4H4M A;  1BY9 A;  1R8H A;  5EWE A;  3OTO J;  3KLE B;  2F4V J;  1E6Y A;  5E3C A;  1F3F A;  3OUY B;  2R2R A;  2FJE B;  2H5E A;  4JI8 F;  1NHU A;  5H9E K;  2XCA A;  3OXG A;  2BXJ A;  1UTA A;  1T9Y A;  2D41 A;  2ZM6 F;  2XS5 A;  1EQM A;  4LFB F;  2IIH A;  4UUX A;  2QL5 B;  5CHC B;  4A8K A;  2HHX A;  4QR1 A;  2R8I A;  2HWT A;  3HZG A;  4OZJ A;  1T0T V;  2LXI A;  4ZJL A;  3LAL A;  3LF0 A;  3ZZO A;  4R0E A;  2BYC A;  2ALY B;  3K5O A;  2PDA A;  4DR5 J;  4TQS A;  1AUD A;  2LLZ A;  1KBR A;  3SDE B;  2B43 A;  2ZOM A;  3NG8 A;  5HAO A;  2QA4 G;  2OEK A;  3W9I A;  3OVS A;  2UXD F;  2JLG A;  3F56 A;  4M94 A;  3WQP A;  5B0A A;  2V50 A;  1ZA2 B;  2XMA A;  3PKM A;  4KSE B;  2QA1 A;  2BW7 A;  2N3O A;  2Z4P A;  3K5P A;  2DH7 A;  1U1R A;  5C2C A;  2C42 A;  3R2C J;  2AP6 A;  3GSD A;  3OFG A;  4CH0 S;  3QYY A;  1F5A A;  1RAH B;  4WU3 A;  1I51 B;  5D8H B;  4LF1 A;  4DU8 A;  1RK8 A;  3MM5 A;  1NK7 A;  1X0F A;  2B5J B;  1UEV A;  5T41 A;  3CO0 P;  4KR0 B;  2XNR A;  3IXQ A;  1Q78 A;  3D3B J;  1TL3 B;  2RJZ A;  3GR1 A;  1JNR B;  2C2Z B;  4AQY J;  1XR7 A;  3PO4 A;  1B0T A;  3HD1 A;  1OYE A;  3BO3 A;  3TX8 A;  2EFP A;  4E8U A;  5B0E A;  1S1X B;  1BQN A;  2K06 A;  1ITP A;  2DGX A;  2QFI A;  3W5Z A;  3Q23 A;  2JVR A;  2ZEJ A;  1GMU A;  4ZVH A;  3PXG a;  4H54 A;  1UWB B;  3SQO P;  1B7F A;  4J9R A;  5E33 A;  4B9L A;  4DL0 C;  3NGD A;  1FDA A;  2ZE2 A;  3OTC A;  5KFV A;  4Z37 A;  3LW5 C;  2DGW A;  3H7H B;  2NPF A;  3HFV A;  4IG0 A;  3FEY B;  2CNK B;  2HNY B;  3U1L A;  3V4M A;  2IY5 B;  3IRX B;  1SVD A;  1KTQ A;  1K73 T;  2V67 A;  2BOA A;  3BH6 B;  5LL6 d;  1HLW A;  1IM6 A;  1JXE A;  1VRU A;  3L4B C;  2LQ9 A;  2RD5 C;  1U09 A;  4DLE A;  2R8J A;  1IKX A;  2KL8 A;  4EI2 A;  3ISZ A;  3M2R A;  1N33 J;  3T5H A;  2XMJ A;  4JYA F;  4ES1 A;  2V8V A;  1LW0 B;  1VR6 A;  3QAU A;  4BLG A;  2HHS A;  3JB9 k;  3M7V A;  3TAM B;  2JEJ A;  2VZ9 A;  2BM1 A;  2Y0B B;  3VVU A;  3ULH A;  1D0E A;  5KFY A;  3GV5 B;  1X9M A;  4Y2M A;  1FE0 A;  4X62 J;  2MZQ A;  1WC4 A;  2BJ7 A;  5KG2 A;  2MQ8 A;  1ZM9 A;  3H2L A;  5L9X A;  2EC2 A;  4LF6 J;  2OML A;  4A8F A;  2DNP A;  1C1C B;  3G82 B;  3S1T A;  2YH1 A;  3RZA A;  3WC0 A;  3VF0 B;  3M32 A;  2Z2M A;  2M88 A;  2CJX B;  1CJU B;  4Y2K A;  1AXQ A;  4K0K F;  3PAC A;  3CDE A;  3CED A;  4FDF A;  4OJH A;  3AY0 A;  3RB6 A;  2CQ2 A;  4DUZ J;  2CQC A;  4PQU A;  2WBM A;  3KJV A;  2BJ1 A;  4H4O A;  4I2P A;  1NK5 A;  3EMT A;  3PYD A;  4LR7 A;  4P72 A;  3MM6 A;  4DX7 A;  4AL5 A;  4X4U A;  4O3R A;  3G6Y A;  3T1H F;  3Q8Q B;  1X8D A;  4ZHR B;  5C42 A;  3N6M A;  2HHU A;  1NZ8 A;  4KB7 A;  3M8Q A;  2CQI A;  2IBK A;  3HHN B;  1RT3 B;  5D3G A;  2KN4 A;  1X0P A;  4DQI A;  1T95 A;  1IBC B;  4ECY A;  2NZC A;  4WYL A;  5KOX A;  3DLK B;  2DPJ A;  3M4X A;  3BRE A;  2MQQ A;  4ED5 A;  2B9W A;  4QPX A;  3ENW A;  1WOR A;  1U7L A;  5C5J A;  3CJ8 A;  2W01 A;  1U1K A;  4YR2 A;  2B3T B;  1XBW A;  3FEX B;  3B78 A;  5AXM A;  4ZA1 A;  3HVR A;  2M52 A;  4YB7 A;  4MYU A;  2DR9 A;  1K9M T;  4EFA C;  1Q82 T;  2H5J B;  4ALZ A;  4U7U D;  5G4D A;  3T1A A;  3T3F A;  1N88 A;  2V8G A;  1WC5 A;  1T9U A;  1YVF A;  2ERR A;  1K47 A;  4CM0 A; 
#chains in the Genus database with same CATH homology
 4U7U D;  5H9F K;  2Y8W A;  4DZD A;  2Y8Y A;  3QRR A;  5CD4 A;  4QYZ K;  2Y9H A;  3QRQ A;  1WJ9 A;  3QRP A;  5H9E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...