2Y9GA

High-resolution structural insights on the sugar-recognition and fusion tag properties of a versatile b-trefoil lectin domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
DIYIPPEGLYFRLLGFASRQVIFARNSPSPDVGLSPVNDQATDQYFSLIYGTGEHAGLYAIKSKATGKVLFSRRPAEPYVGQIDGDGRYPDNWFKIEPGKTYLSKYFRLVQPSTGTALVSRTHLQPYFWNHPQTEVFDDQYFTFLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMOLYTIC LECTIN LSLA
publication title High-Resolution Structural Insights on the Sugar-Recognition and Fusion Tag Properties of a Versatile Beta-Trefoil Lectin Domain from the Mushroom Laetiporus Sulphureus.
pubmed doi rcsb
source organism Laetiporus sulphureus
molecule tags Sugar binding protein
total genus 31
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2y9gA00
1MD6A 4ENDA 5FZYA 4I6IA 4LO1A 3A22A 4USPA 1NZKA 3Q7WA 4P6AA 1EYLA 4G9NA 2IHOA 1CVSA 1T4QA 1ISXA 4LO0C 3AJ6A 3ZXGA 1J0SA 1PC8B 2P39A 2AQZA 2Y9GA 1FN0A 3BADA 4WBCA 4CJMA 4J23B 4QKRA 3IM5A 9ILBA 2E4MA 3P53A 3ZC8A 2RSTA 2XOAA 1S0DA 4I7IA 1V6UA 1HCEA 4XKIA 3T8SA 4L4HA 5G00A 2YUGA 3N7KA 3H6SE 3LTQA 3AKGA 3HN1A 4JAWA 1N4KA 3VEQA 4DEPA 3OGFA 4KEJA 1DZDA 1AVUA 2KKIA 4G9MA 3BAVA 3N7JA 4ISQA 1AVWB 1AFCA 1G9AA 1TWEA 1SZ6B 4Q9PA 1W3GA 3H6RB 4HA2A 3IM7A 3AZWA 3BAGA 4QD2B 4LO2A 3RMYA 1VCLA 4OWJA 4ZA3B 2FFUA 3UD9A 1HKNA 2Q3NB 1L2HA 3HMYA 4QALA 5I1BA 1RMLA 4GAIA 1KNMA 3BRDA 2Q9XA 2AFGA 3F1RA 2MIBA 2BEAA 3V0AB 2VUAA 4ZFYB 2L5XA 4ZFUB 4II0A 1Q04A 1ONKB 1HIBA 1S0LA 3VSZA 3W9TA 4KEKA 5DZUA 3BA7A 3I29B 3WINC 3HALA 1BA7A 5F8WA 2Y9FA 3AKHA 3FJIA 1HCDA 2AAIB 3V0AA 2F2FC 2Y9WC 3A07A 1G9CA 3JRRA 3O4BA 2FFVA 1F31A 2MLLB 3I2AA 2ESUA 3PUBA 4I0YA 4GOVA 4EFRA 1HWMB 3WA1A 1ISYA 1DFCA 1M2TB 5BP5C 3O4OA 3KMVA 4Z9WB 3RMXA 1K5VA 3MALA 4I4UA 1FWVA 1I1BA 4I3NA 3AH2A 3FJ8A 4EKXB 2ET2A 3FJ9A 3POKA 3UDAA 3VT1A 3UD8A 4G6MA 1BLAA 4X39A 4LO7C 3V0BB 4ZBVB 1ISZA 3OJVA 3O49A 3O4AA 3CA0A 3IM6A 4DCKC 3AH1A 1PUMB 4OW4A 2VXTI 2NP0A 5BQUC 2P23A 5FNXA 4I96A 4OEFA 4Q91A 2DRZA 3UJ4A 2D7RA 2DRYA 3P6IA 1D0HA 3ILAA 1P63A 1DIWA 4TLPA 2KLLA 3BTAA 1TP0A 3WMUA 3ZC9A 3AKFA 2X2TA 2VLCA 3N0KA 4H04A 4AN7B 2DREA 1S0GA 1R8NA 4LO8B 1HWOB 3BAHA 1IRAX 3CA1A 2LIEA 3R4UA 4GOYA 1M16A 4ZOTA 5B2HA 3FGMA 3NBNA 4ISRA 2KH2A 4J2KA 3WO4A 5DVHA 3R4SA 4A7YA 1EPWA 3CRIA 21BIA 4LO1C 3SNVA 3V79C 4DENA 3BAQA 4PC4A 1TTUA 1WD3A 3NJ5A 1XHBA 5FZUA 1ISWA 1WBCA 1JT3A 4GP3A 1I1EA 5D63A 5E24E 3VUOA 1TFMB 4X3AA 4IYBA 2HZ9A 2ERMA 3FUOA 1XZZA 5GAQA 4OEEA 3CRHA 2E4MC 4I8MA 2K43A 4JPZA 2VSEA 1PUUB 6I1BA 3EF2A 4R6UB 1BASA 1OQLB 3AZVA 1G9BA 3BA5A 4I4XA 3O3QA 2KI6B 3O44A 1JLYA 3FJKA 4OWKA 2GZBA 2FDBM 1WD4A 4Q9GA 3BRFA 3H6RA 2I1BA 3FJEA 1FWUA 1Q03A 3CRGA 4GP0A 4QBVA 4IY9A 1S0FA 1DZCA 3VT2A 3N7LA 4J2SA 7I1BA 3IAGC 1QQKA 4XFSA 1RG8A 4LO2C 2KI4A 1SR4A 2NZ9A 3CAHA 1FMZA 4JRAA 1CE7B 2X2SA 1BFBA 1BARA 3A23A 4LO3A 4OUJA 4FVVA 3OBRA 1IRPA 4I4YA 3RTJB 4D8HA 5JLVA 4IZEA 3WO3A 4JKXB 4IY8A 3WO2A 1ISVA 1A8DA 2ZR1B 3D7WB 5D61A 3I2XA 4QD2C 1JLXA 3Q7XA 5BXSA 1BFCA 2DS0A 3FJHA 3QYDA 4YOLA 5EC5A 3TC2A 4I1BA 2K4AB 5JMCA 4QBCA 1V6VA 2NTDA 2M49A 1TOOA 1TWMA 4I4VA 3FFZA 3FJAA 3PHZA 1RY7A 4H9WA 3P6JA 4KC3A 4ZLBB 2D22A 2D20A 1JT7A 3VWCA 3HOMA 4I2SA 2WRYA 3V0BA 3ZXDA 3C9ZA 3OBTA 3ZX7A 4KBBA 1DJSB 3AKIA 1S0BA 4IQPA 1HWNB 5D62A 4F83A 1V6XA 1AXMA 3BB2A 3MPPG 1NUNA 4I4QA 4IHZA 4QKSA 4J2XA 4LO0A 2NM1A 4XFTA 4Z8SB 4JQ0A 4A7ZA 2FO1A 1YTOA 3K1XA 4KEIA 1Q1UA 2VU9A 4J2YA 2HWAA 1IT0A 1V6WA 3Q7YA 3FJFA 3CA6A 2BEBA 1BLDA 4G1RA 3VT0A 3JUTA 1WBAA 1XG6A 4I4PA 3WMVA 1MC9A 3O4CA 1ILR1 4OWLA 1IJTA 4P0KA 3F62B 4G6JA 3LLPA 8I1BA 3CQAA 3CA3A 4X37A 5F90A 3UJ0A 2HWMA 2VXRA 1YYNA 5HPZA 1FMMS 3AJ5A 4ZKTB 3E8LC 3RTIB 1XYFA 1YF8B 3CA5A 1E0OA 1PWAA 2UUSA 5FNWA 3BRGC 4USOA 1IILA 3FUQA 1JT4A 3FJBA 3OJ2A 4HJJA 4GAFA 1JTCA 1QXMA 5BOWA 1FQ9A 4XFUA 2FGFA 3NBCA 2HW9A 4I37A 4EEEB 4QC4A 3N7MA 3OJMA 1DQGA 4F34A 1II4A 1JY0A 3IIRA 3WINA 5EHAA 1DLLA 1FV2A 2WBCA 1R8OA 2RQ9A 3BAUA 4JP0A 3BAOA 2D24A 4IZXA 3B9UA 1S0CA 2F2FA 4OEGA 3BA4A 4IONA 2NVHA 4LO7B 3AH4A 1Z0HA 1ITBA 2F8XC 3H6QA 5BXRA 3O5WB 4I4RA 1HWPB 2VSAA 5BP5A 2Z48A 2Y9XE 1BFFA 5BXPA 4D0ZA 2QYIB 3NBEA 1YXWA 1BFGA 2MC2A 1AVAC 3VSFA 41BIA 31BIA 1DQOA 1W3FA 1FGAA 1G82A 3FJCA 3HSMA 2R9KB 3CU1B 4I4OA 1Z4SA 2Z49A 1TIEA 2D23A 2BFHA 5EG6C 1SR4C 1YBIA 2GO2A 4HR6C 4D0TA 1FV3A 1S0EA 1GGPB 4FGFA 4I1EA 4LO3C 1AF9A 4I4SA 1G9DA 3UD7A 2D1ZA 5BQUA 5FZZA 2NYYA 4EFPA 4EFQA 4X38A 3CA4A 2J3PA 1DFQA 1AVXB 4AN6A 5DSSB 3PMEA 1IHKA 2ZQNA 1T9FA 4ZFWB 1K5UA 3S8KA 4QO3A 3A21A 4JKQA 4L4IA 5BVPI 1EVTA 3FJDA 1JT5A 2K8RA 1RZOB 2AXMA 3RSJA 2QN4A 2D7IA 1QQLA 1JQZA 1EV2A 5DUYA 3FJJA 4EB2B 3OGGA 2RG9B 2D43A 5F8SA 3QR5A 3PG0A 4P0JA 1ABRB 3S8JA 4ZGRB 2IWTB 4A7KA 5BXTA 1UPSA 1W3AA 2D44A 2LIQA 3NBDA 4P0LA 5F8YA 3HBWA 3BX1C 1PZZA 2ZQOA 1Z2VA 3O4DA 1IOBA
chains in the Genus database with same CATH superfamily
1MD6A 4ENDA 5FZYA 4I6IA 4LO1A 3A22A 4USPA 1NZKA 3Q7WA 4P6AA 1EYLA 4G9NA 2IHOA 1CVSA 1T4QA 1ISXA 4LO0C 3AJ6A 3ZXGA 1J0SA 1PC8B 2P39A 2AQZA 2Y9GA 1FN0A 3BADA 4WBCA 4CJMA 4J23B 4QKRA 3IM5A 9ILBA 2E4MA 3P53A 3ZC8A 2RSTA 2XOAA 1S0DA 4I7IA 1V6UA 1HCEA 4XKIA 3T8SA 4L4HA 5G00A 2YUGA 3N7KA 3H6SE 3LTQA 3AKGA 3HN1A 4JAWA 1N4KA 3VEQA 4DEPA 3OGFA 4KEJA 1DZDA 1AVUA 2KKIA 4G9MA 3BAVA 3N7JA 4ISQA 1AVWB 1AFCA 1G9AA 1TWEA 1SZ6B 4Q9PA 1W3GA 3H6RB 4HA2A 3IM7A 3AZWA 3BAGA 4QD2B 4LO2A 3RMYA 1VCLA 4OWJA 4ZA3B 2FFUA 3UD9A 1HKNA 2Q3NB 1L2HA 3HMYA 4QALA 5I1BA 1RMLA 4GAIA 1KNMA 3BRDA 2Q9XA 2AFGA 3F1RA 2MIBA 2BEAA 3V0AB 2VUAA 4ZFYB 2L5XA 4ZFUB 4II0A 1Q04A 1ONKB 1HIBA 1S0LA 3VSZA 3W9TA 4KEKA 5DZUA 3BA7A 3I29B 3WINC 3HALA 1BA7A 5F8WA 2Y9FA 3AKHA 3FJIA 1HCDA 2AAIB 3V0AA 2F2FC 2Y9WC 3A07A 1G9CA 3JRRA 3O4BA 2FFVA 1F31A 2MLLB 3I2AA 2ESUA 3PUBA 4I0YA 4GOVA 4EFRA 4H75A 1HWMB 3WA1A 1ISYA 1DFCA 1M2TB 5BP5C 3O4OA 3KMVA 4Z9WB 3RMXA 1K5VA 3MALA 4I4UA 1FWVA 1I1BA 4I3NA 3AH2A 3FJ8A 4EKXB 2ET2A 3FJ9A 3POKA 3UDAA 3VT1A 3UD8A 4G6MA 1BLAA 4X39A 4LO7C 3V0BB 4ZBVB 1ISZA 3OJVA 3O49A 3O4AA 3CA0A 3IM6A 4DCKC 3AH1A 1PUMB 4OW4A 2VXTI 2NP0A 5BQUC 2P23A 5FNXA 4I96A 4OEFA 4Q91A 2DRZA 3UJ4A 2D7RA 4MZFB 2DRYA 3P6IA 1D0HA 3ILAA 1P63A 1DIWA 4TLPA 2KLLA 3BTAA 1TP0A 3WMUA 3ZC9A 3AKFA 2X2TA 2VLCA 3N0KA 4H04A 4AN7B 2DREA 1S0GA 1R8NA 4LO8B 1HWOB 3BAHA 1IRAX 3CA1A 2LIEA 3R4UA 4GOYA 1M16A 4ZOTA 5B2HA 3FGMA 3NBNA 4ISRA 2KH2A 4J2KA 3WO4A 5DVHA 3R4SA 4A7YA 1EPWA 3CRIA 21BIA 4LO1C 3SNVA 3V79C 4DENA 3BAQA 4PC4A 1TTUA 1WD3A 3NJ5A 1XHBA 5FZUA 1ISWA 1WBCA 1JT3A 4GP3A 1I1EA 5D63A 5E24E 3VUOA 1TFMB 4X3AA 4IYBA 2HZ9A 2ERMA 3FUOA 1XZZA 5GAQA 4OEEA 3CRHA 2E4MC 4I8MA 2K43A 4JPZA 2VSEA 1PUUB 6I1BA 3EF2A 4R6UB 1BASA 1OQLB 3AZVA 1G9BA 3BA5A 4I4XA 3O3QA 2KI6B 3O44A 1JLYA 3FJKA 4OWKA 2GZBA 2FDBM 1WD4A 4Q9GA 3BRFA 3H6RA 2I1BA 3FJEA 1FWUA 1Q03A 3CRGA 4GP0A 4QBVA 4IY9A 1S0FA 1DZCA 3VT2A 3N7LA 4J2SA 7I1BA 3IAGC 1QQKA 4XFSA 1RG8A 4LO2C 2KI4A 1SR4A 2NZ9A 3CAHA 1FMZA 4JRAA 1CE7B 2X2SA 1BFBA 1BARA 3A23A 4LO3A 4OUJA 4FVVA 3OBRA 1IRPA 4I4YA 3RTJB 4D8HA 5JLVA 4IZEA 3WO3A 4JKXB 4IY8A 3WO2A 1ISVA 1A8DA 2ZR1B 3D7WB 5D61A 3I2XA 4QD2C 1JLXA 3Q7XA 5BXSA 1BFCA 2DS0A 3FJHA 3QYDA 4YOLA 5EC5A 3TC2A 4I1BA 2K4AB 5JMCA 4QBCA 1V6VA 2NTDA 2M49A 1TOOA 1TWMA 4UY4A 4I4VA 3FFZA 3FJAA 3PHZA 1RY7A 4H9WA 3P6JA 4KC3A 4ZLBB 2D22A 2D20A 1JT7A 4MZHA 3VWCA 3HOMA 4I2SA 2WRYA 3V0BA 3ZXDA 3C9ZA 3OBTA 3ZX7A 4KBBA 1DJSB 3AKIA 1S0BA 4IQPA 1HWNB 5D62A 4F83A 1V6XA 1AXMA 3BB2A 3MPPG 1NUNA 4I4QA 4IHZA 4QKSA 4J2XA 4LO0A 2NM1A 4XFTA 4Z8SB 4JQ0A 4A7ZA 2FO1A 1YTOA 2NS2A 3K1XA 4KEIA 1Q1UA 2VU9A 4J2YA 2HWAA 1IT0A 1V6WA 3Q7YA 3FJFA 3CA6A 2BEBA 1BLDA 4G1RA 3VT0A 3JUTA 1WBAA 1XG6A 4I4PA 3WMVA 1MC9A 3O4CA 1ILR1 4OWLA 1IJTA 4P0KA 3F62B 4G6JA 3LLPA 8I1BA 3CQAA 3CA3A 4X37A 5F90A 3UJ0A 2HWMA 2VXRA 1YYNA 5HPZA 1FMMS 3AJ5A 4ZKTB 3E8LC 3RTIB 1XYFA 1YF8B 3CA5A 1E0OA 1PWAA 2UUSA 5FNWA 3BRGC 4USOA 1IILA 3FUQA 1JT4A 3FJBA 3OJ2A 4HJJA 4GAFA 1JTCA 1QXMA 5BOWA 1FQ9A 4XFUA 2FGFA 3NBCA 2HW9A 4I37A 4EEEB 4QC4A 3N7MA 3OJMA 1DQGA 4F34A 1II4A 1JY0A 3IIRA 3WINA 5EHAA 1DLLA 1FV2A 2WBCA 1R8OA 2RQ9A 3BAUA 4JP0A 3BAOA 2D24A 4IZXA 3B9UA 1S0CA 2F2FA 4OEGA 3BA4A 4IONA 2NVHA 4LO7B 3AH4A 1Z0HA 1ITBA 2F8XC 3H6QA 5BXRA 3O5WB 4I4RA 1HWPB 2VSAA 5BP5A 2Z48A 2Y9XE 1BFFA 5BXPA 4D0ZA 2QYIB 3NBEA 1YXWA 1BFGA 2MC2A 1AVAC 3VSFA 41BIA 31BIA 1DQOA 1W3FA 1FGAA 1G82A 3FJCA 3HSMA 2R9KB 3CU1B 4I4OA 1Z4SA 2Z49A 1TIEA 4MZGB 2D23A 2BFHA 5EG6C 1SR4C 1YBIA 2GO2A 4HR6C 4D0TA 1FV3A 1S0EA 1GGPB 4FGFA 4I1EA 4LO3C 1AF9A 4I4SA 1G9DA 3UD7A 2D1ZA 5BQUA 5FZZA 2NYYA 4EFPA 4EFQA 4X38A 3CA4A 2J3PA 1DFQA 1AVXB 4AN6A 5DSSB 3PMEA 1IHKA 2ZQNA 1T9FA 4ZFWB 1K5UA 3S8KA 4QO3A 3A21A 4JKQA 4L4IA 5BVPI 1EVTA 3FJDA 1JT5A 2K8RA 1RZOB 2AXMA 3RSJA 2QN4A 2D7IA 1QQLA 1JQZA 1EV2A 5DUYA 3FJJA 4EB2B 3OGGA 2RG9B 2D43A 5F8SA 3QR5A 3PG0A 4P0JA 1ABRB 3S8JA 4ZGRB 2IWTB 4A7KA 5BXTA 1UPSA 1W3AA 2D44A 2LIQA 3NBDA 4P0LA 5F8YA 3HBWA 3BX1C 1PZZA 2ZQOA 1Z2VA 3O4DA 1IOBA
chains in the Genus database with same CATH topology
1MD6A 4ENDA 5FZYA 4I6IA 4LO1A 3A22A 4USPA 1NZKA 3Q7WA 4P6AA 1EYLA 4G9NA 2IHOA 1CVSA 1T4QA 1ISXA 4LO0C 3AJ6A 3ZXGA 1J0SA 1PC8B 2P39A 2AQZA 2Y9GA 1FN0A 3BADA 4WBCA 4CJMA 4J23B 4QKRA 3IM5A 9ILBA 2E4MA 3P53A 3ZC8A 2RSTA 2XOAA 1S0DA 4I7IA 1V6UA 1HCEA 4XKIA 3T8SA 4L4HA 5G00A 2YUGA 3N7KA 3H6SE 3LTQA 3AKGA 3HN1A 4JAWA 1N4KA 3VEQA 4DEPA 3OGFA 4KEJA 1DZDA 1AVUA 2KKIA 4G9MA 3BAVA 3N7JA 4ISQA 1AVWB 1AFCA 1G9AA 1TWEA 1SZ6B 4Q9PA 1W3GA 3H6RB 4HA2A 3IM7A 3AZWA 3BAGA 4QD2B 4LO2A 3RMYA 1VCLA 4OWJA 4ZA3B 2FFUA 3UD9A 1HKNA 2Q3NB 1L2HA 3HMYA 4QALA 5I1BA 1RMLA 4GAIA 1KNMA 3BRDA 2Q9XA 2AFGA 3F1RA 2MIBA 2BEAA 3V0AB 2VUAA 4ZFYB 2L5XA 4ZFUB 4II0A 1Q04A 1ONKB 1HIBA 1S0LA 3VSZA 3W9TA 4KEKA 5DZUA 3BA7A 3I29B 3WINC 3HALA 1BA7A 5F8WA 2Y9FA 3AKHA 3FJIA 1HCDA 2AAIB 3V0AA 2F2FC 2Y9WC 3A07A 1G9CA 3JRRA 3O4BA 2FFVA 1F31A 2MLLB 3I2AA 2ESUA 3PUBA 4I0YA 4GOVA 4EFRA 4H75A 1HWMB 3WA1A 1ISYA 1DFCA 1M2TB 5BP5C 3O4OA 3KMVA 4Z9WB 3RMXA 1K5VA 3MALA 4I4UA 1FWVA 1I1BA 4I3NA 3AH2A 3FJ8A 4EKXB 2ET2A 3FJ9A 3POKA 3UDAA 3VT1A 3UD8A 4G6MA 1BLAA 4X39A 4LO7C 3V0BB 4ZBVB 1ISZA 3OJVA 3O49A 3O4AA 3CA0A 3IM6A 4DCKC 3AH1A 1PUMB 4OW4A 2VXTI 2NP0A 5BQUC 2P23A 5FNXA 4I96A 4OEFA 4Q91A 2DRZA 3UJ4A 2D7RA 4MZFB 2DRYA 3P6IA 1D0HA 3ILAA 1P63A 1DIWA 4TLPA 2KLLA 3BTAA 1TP0A 3WMUA 3ZC9A 3AKFA 2X2TA 2VLCA 3N0KA 4H04A 4AN7B 2DREA 1S0GA 1R8NA 4LO8B 1HWOB 3BAHA 1IRAX 3CA1A 2LIEA 3R4UA 4GOYA 1M16A 4ZOTA 5B2HA 3FGMA 3NBNA 4ISRA 2KH2A 4J2KA 3WO4A 5DVHA 3R4SA 4A7YA 1EPWA 3CRIA 21BIA 4LO1C 3SNVA 3V79C 4DENA 3BAQA 4PC4A 1TTUA 1WD3A 3NJ5A 1XHBA 5FZUA 1ISWA 1WBCA 1JT3A 4GP3A 1I1EA 5D63A 5E24E 3VUOA 1TFMB 4X3AA 4IYBA 2HZ9A 2ERMA 3FUOA 1XZZA 5GAQA 4OEEA 3CRHA 2E4MC 4I8MA 2K43A 4JPZA 2VSEA 1PUUB 6I1BA 3EF2A 4R6UB 1BASA 1OQLB 3AZVA 1G9BA 3BA5A 4I4XA 3O3QA 2KI6B 3O44A 1JLYA 3FJKA 4OWKA 2GZBA 2FDBM 1WD4A 4Q9GA 3BRFA 3H6RA 2I1BA 3FJEA 1FWUA 1Q03A 3CRGA 4GP0A 4QBVA 4IY9A 1S0FA 1DZCA 3VT2A 3N7LA 4J2SA 7I1BA 3IAGC 1QQKA 4XFSA 1RG8A 4LO2C 2KI4A 1SR4A 2NZ9A 3CAHA 1FMZA 4JRAA 1CE7B 2X2SA 1BFBA 1BARA 3A23A 4LO3A 4OUJA 4FVVA 3OBRA 1IRPA 4I4YA 3RTJB 4D8HA 5JLVA 4IZEA 3WO3A 4JKXB 4IY8A 3WO2A 1ISVA 1A8DA 2ZR1B 3D7WB 5D61A 3I2XA 4QD2C 1JLXA 3Q7XA 5BXSA 1BFCA 2DS0A 3FJHA 3QYDA 4YOLA 5EC5A 3TC2A 4I1BA 2K4AB 5JMCA 4QBCA 1V6VA 2NTDA 2M49A 1TOOA 1TWMA 4UY4A 4I4VA 3FFZA 3FJAA 3PHZA 1RY7A 4H9WA 3P6JA 4KC3A 4ZLBB 2D22A 2D20A 1JT7A 4MZHA 3VWCA 3HOMA 4I2SA 2WRYA 3V0BA 3ZXDA 3C9ZA 3OBTA 3ZX7A 4KBBA 1DJSB 3AKIA 1S0BA 4IQPA 1HWNB 5D62A 4F83A 1V6XA 1AXMA 3BB2A 3MPPG 1NUNA 4I4QA 4IHZA 4QKSA 4J2XA 4LO0A 2NM1A 4XFTA 4Z8SB 4JQ0A 4A7ZA 2FO1A 1YTOA 2NS2A 3K1XA 4KEIA 1Q1UA 2VU9A 4J2YA 2HWAA 1IT0A 1V6WA 3Q7YA 3FJFA 3CA6A 2BEBA 1BLDA 4G1RA 3VT0A 3JUTA 1WBAA 1XG6A 4I4PA 3WMVA 1MC9A 3O4CA 1ILR1 4OWLA 1IJTA 4P0KA 3F62B 4G6JA 3LLPA 8I1BA 3CQAA 3CA3A 4X37A 5F90A 3UJ0A 2HWMA 2VXRA 1YYNA 5HPZA 1FMMS 3AJ5A 4ZKTB 3E8LC 3RTIB 1XYFA 1YF8B 3CA5A 1E0OA 1PWAA 2UUSA 5FNWA 3BRGC 4USOA 1IILA 3FUQA 1JT4A 3FJBA 3OJ2A 4HJJA 4GAFA 1JTCA 1QXMA 5BOWA 1FQ9A 4XFUA 2FGFA 3NBCA 2HW9A 4I37A 4EEEB 4QC4A 3N7MA 3OJMA 1DQGA 4F34A 1II4A 1JY0A 3IIRA 3WINA 5EHAA 1DLLA 1FV2A 2WBCA 1R8OA 2RQ9A 3BAUA 4JP0A 3BAOA 2D24A 4IZXA 3B9UA 1S0CA 2F2FA 4OEGA 3BA4A 4IONA 2NVHA 4LO7B 3AH4A 1Z0HA 1ITBA 2F8XC 3H6QA 5BXRA 3O5WB 4I4RA 1HWPB 2VSAA 5BP5A 2Z48A 2Y9XE 1BFFA 5BXPA 4D0ZA 2QYIB 3NBEA 1YXWA 1BFGA 2MC2A 1AVAC 3VSFA 41BIA 31BIA 1DQOA 1W3FA 1FGAA 1G82A 3FJCA 3HSMA 2R9KB 3CU1B 4I4OA 1Z4SA 2Z49A 1TIEA 4MZGB 2D23A 2BFHA 5EG6C 1SR4C 1YBIA 2GO2A 4HR6C 4D0TA 1FV3A 1S0EA 1GGPB 4FGFA 4I1EA 4LO3C 1AF9A 4I4SA 1G9DA 3UD7A 2D1ZA 5BQUA 5FZZA 2NYYA 4EFPA 4EFQA 4X38A 3CA4A 2J3PA 1DFQA 1AVXB 4AN6A 5DSSB 3PMEA 1IHKA 2ZQNA 1T9FA 4ZFWB 1K5UA 3S8KA 4QO3A 3A21A 4JKQA 4L4IA 5BVPI 1EVTA 3FJDA 1JT5A 2K8RA 1RZOB 2AXMA 3RSJA 2QN4A 2D7IA 1QQLA 1JQZA 1EV2A 5DUYA 3FJJA 4EB2B 3OGGA 2RG9B 2D43A 5F8SA 3QR5A 3PG0A 4P0JA 1ABRB 3S8JA 4ZGRB 2IWTB 4A7KA 5BXTA 1UPSA 1W3AA 2D44A 2LIQA 3NBDA 4P0LA 5F8YA 3HBWA 3BX1C 1PZZA 2ZQOA 1Z2VA 3O4DA 1IOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MD6 A;  4END A;  5FZY A;  4I6I A;  4LO1 A;  3A22 A;  4USP A;  1NZK A;  3Q7W A;  4P6A A;  1EYL A;  4G9N A;  2IHO A;  1CVS A;  1T4Q A;  1ISX A;  4LO0 C;  3AJ6 A;  3ZXG A;  1J0S A;  1PC8 B;  2P39 A;  2AQZ A;  2Y9G A;  1FN0 A;  3BAD A;  4WBC A;  4CJM A;  4J23 B;  4QKR A;  3IM5 A;  9ILB A;  2E4M A;  3P53 A;  3ZC8 A;  2RST A;  2XOA A;  1S0D A;  4I7I A;  1V6U A;  1HCE A;  4XKI A;  3T8S A;  4L4H A;  5G00 A;  2YUG A;  3N7K A;  3H6S E;  3LTQ A;  3AKG A;  3HN1 A;  4JAW A;  1N4K A;  3VEQ A;  4DEP A;  3OGF A;  4KEJ A;  1DZD A;  1AVU A;  2KKI A;  4G9M A;  3BAV A;  3N7J A;  4ISQ A;  1AVW B;  1AFC A;  1G9A A;  1TWE A;  1SZ6 B;  4Q9P A;  1W3G A;  3H6R B;  4HA2 A;  3IM7 A;  3AZW A;  3BAG A;  4QD2 B;  4LO2 A;  3RMY A;  1VCL A;  4OWJ A;  4ZA3 B;  2FFU A;  3UD9 A;  1HKN A;  2Q3N B;  1L2H A;  3HMY A;  4QAL A;  5I1B A;  1RML A;  4GAI A;  1KNM A;  3BRD A;  2Q9X A;  2AFG A;  3F1R A;  2MIB A;  2BEA A;  3V0A B;  2VUA A;  4ZFY B;  2L5X A;  4ZFU B;  4II0 A;  1Q04 A;  1ONK B;  1HIB A;  1S0L A;  3VSZ A;  3W9T A;  4KEK A;  5DZU A;  3BA7 A;  3I29 B;  3WIN C;  3HAL A;  1BA7 A;  5F8W A;  2Y9F A;  3AKH A;  3FJI A;  1HCD A;  2AAI B;  3V0A A;  2F2F C;  2Y9W C;  3A07 A;  1G9C A;  3JRR A;  3O4B A;  2FFV A;  1F31 A;  2MLL B;  3I2A A;  2ESU A;  3PUB A;  4I0Y A;  4GOV A;  4EFR A;  1HWM B;  3WA1 A;  1ISY A;  1DFC A;  1M2T B;  5BP5 C;  3O4O A;  3KMV A;  4Z9W B;  3RMX A;  1K5V A;  3MAL A;  4I4U A;  1FWV A;  1I1B A;  4I3N A;  3AH2 A;  3FJ8 A;  4EKX B;  2ET2 A;  3FJ9 A;  3POK A;  3UDA A;  3VT1 A;  3UD8 A;  4G6M A;  1BLA A;  4X39 A;  4LO7 C;  3V0B B;  4ZBV B;  1ISZ A;  3OJV A;  3O49 A;  3O4A A;  3CA0 A;  3IM6 A;  4DCK C;  3AH1 A;  1PUM B;  4OW4 A;  2VXT I;  2NP0 A;  5BQU C;  2P23 A;  5FNX A;  4I96 A;  4OEF A;  4Q91 A;  2DRZ A;  3UJ4 A;  2D7R A;  2DRY A;  3P6I A;  1D0H A;  3ILA A;  1P63 A;  1DIW A;  4TLP A;  2KLL A;  3BTA A;  1TP0 A;  3WMU A;  3ZC9 A;  3AKF A;  2X2T A;  2VLC A;  3N0K A;  4H04 A;  4AN7 B;  2DRE A;  1S0G A;  1R8N A;  4LO8 B;  1HWO B;  3BAH A;  1IRA X;  3CA1 A;  2LIE A;  3R4U A;  4GOY A;  1M16 A;  4ZOT A;  5B2H A;  3FGM A;  3NBN A;  4ISR A;  2KH2 A;  4J2K A;  3WO4 A;  5DVH A;  3R4S A;  4A7Y A;  1EPW A;  3CRI A;  21BI A;  4LO1 C;  3SNV A;  3V79 C;  4DEN A;  3BAQ A;  4PC4 A;  1TTU A;  1WD3 A;  3NJ5 A;  1XHB A;  5FZU A;  1ISW A;  1WBC A;  1JT3 A;  4GP3 A;  1I1E A;  5D63 A;  5E24 E;  3VUO A;  1TFM B;  4X3A A;  4IYB A;  2HZ9 A;  2ERM A;  3FUO A;  1XZZ A;  5GAQ A;  4OEE A;  3CRH A;  2E4M C;  4I8M A;  2K43 A;  4JPZ A;  2VSE A;  1PUU B;  6I1B A;  3EF2 A;  4R6U B;  1BAS A;  1OQL B;  3AZV A;  1G9B A;  3BA5 A;  4I4X A;  3O3Q A;  2KI6 B;  3O44 A;  1JLY A;  3FJK A;  4OWK A;  2GZB A;  2FDB M;  1WD4 A;  4Q9G A;  3BRF A;  3H6R A;  2I1B A;  3FJE A;  1FWU A;  1Q03 A;  3CRG A;  4GP0 A;  4QBV A;  4IY9 A;  1S0F A;  1DZC A;  3VT2 A;  3N7L A;  4J2S A;  7I1B A;  3IAG C;  1QQK A;  4XFS A;  1RG8 A;  4LO2 C;  2KI4 A;  1SR4 A;  2NZ9 A;  3CAH A;  1FMZ A;  4JRA A;  1CE7 B;  2X2S A;  1BFB A;  1BAR A;  3A23 A;  4LO3 A;  4OUJ A;  4FVV A;  3OBR A;  1IRP A;  4I4Y A;  3RTJ B;  4D8H A;  5JLV A;  4IZE A;  3WO3 A;  4JKX B;  4IY8 A;  3WO2 A;  1ISV A;  1A8D A;  2ZR1 B;  3D7W B;  5D61 A;  3I2X A;  4QD2 C;  1JLX A;  3Q7X A;  5BXS A;  1BFC A;  2DS0 A;  3FJH A;  3QYD A;  4YOL A;  5EC5 A;  3TC2 A;  4I1B A;  2K4A B;  5JMC A;  4QBC A;  1V6V A;  2NTD A;  2M49 A;  1TOO A;  1TWM A;  4I4V A;  3FFZ A;  3FJA A;  3PHZ A;  1RY7 A;  4H9W A;  3P6J A;  4KC3 A;  4ZLB B;  2D22 A;  2D20 A;  1JT7 A;  3VWC A;  3HOM A;  4I2S A;  2WRY A;  3V0B A;  3ZXD A;  3C9Z A;  3OBT A;  3ZX7 A;  4KBB A;  1DJS B;  3AKI A;  1S0B A;  4IQP A;  1HWN B;  5D62 A;  4F83 A;  1V6X A;  1AXM A;  3BB2 A;  3MPP G;  1NUN A;  4I4Q A;  4IHZ A;  4QKS A;  4J2X A;  4LO0 A;  2NM1 A;  4XFT A;  4Z8S B;  4JQ0 A;  4A7Z A;  2FO1 A;  1YTO A;  3K1X A;  4KEI A;  1Q1U A;  2VU9 A;  4J2Y A;  2HWA A;  1IT0 A;  1V6W A;  3Q7Y A;  3FJF A;  3CA6 A;  2BEB A;  1BLD A;  4G1R A;  3VT0 A;  3JUT A;  1WBA A;  1XG6 A;  4I4P A;  3WMV A;  1MC9 A;  3O4C A;  1ILR 1;  4OWL A;  1IJT A;  4P0K A;  3F62 B;  4G6J A;  3LLP A;  8I1B A;  3CQA A;  3CA3 A;  4X37 A;  5F90 A;  3UJ0 A;  2HWM A;  2VXR A;  1YYN A;  5HPZ A;  1FMM S;  3AJ5 A;  4ZKT B;  3E8L C;  3RTI B;  1XYF A;  1YF8 B;  3CA5 A;  1E0O A;  1PWA A;  2UUS A;  5FNW A;  3BRG C;  4USO A;  1IIL A;  3FUQ A;  1JT4 A;  3FJB A;  3OJ2 A;  4HJJ A;  4GAF A;  1JTC A;  1QXM A;  5BOW A;  1FQ9 A;  4XFU A;  2FGF A;  3NBC A;  2HW9 A;  4I37 A;  4EEE B;  4QC4 A;  3N7M A;  3OJM A;  1DQG A;  4F34 A;  1II4 A;  1JY0 A;  3IIR A;  3WIN A;  5EHA A;  1DLL A;  1FV2 A;  2WBC A;  1R8O A;  2RQ9 A;  3BAU A;  4JP0 A;  3BAO A;  2D24 A;  4IZX A;  3B9U A;  1S0C A;  2F2F A;  4OEG A;  3BA4 A;  4ION A;  2NVH A;  4LO7 B;  3AH4 A;  1Z0H A;  1ITB A;  2F8X C;  3H6Q A;  5BXR A;  3O5W B;  4I4R A;  1HWP B;  2VSA A;  5BP5 A;  2Z48 A;  2Y9X E;  1BFF A;  5BXP A;  4D0Z A;  2QYI B;  3NBE A;  1YXW A;  1BFG A;  2MC2 A;  1AVA C;  3VSF A;  41BI A;  31BI A;  1DQO A;  1W3F A;  1FGA A;  1G82 A;  3FJC A;  3HSM A;  2R9K B;  3CU1 B;  4I4O A;  1Z4S A;  2Z49 A;  1TIE A;  2D23 A;  2BFH A;  5EG6 C;  1SR4 C;  1YBI A;  2GO2 A;  4HR6 C;  4D0T A;  1FV3 A;  1S0E A;  1GGP B;  4FGF A;  4I1E A;  4LO3 C;  1AF9 A;  4I4S A;  1G9D A;  3UD7 A;  2D1Z A;  5BQU A;  5FZZ A;  2NYY A;  4EFP A;  4EFQ A;  4X38 A;  3CA4 A;  2J3P A;  1DFQ A;  1AVX B;  4AN6 A;  5DSS B;  3PME A;  1IHK A;  2ZQN A;  1T9F A;  4ZFW B;  1K5U A;  3S8K A;  4QO3 A;  3A21 A;  4JKQ A;  4L4I A;  5BVP I;  1EVT A;  3FJD A;  1JT5 A;  2K8R A;  1RZO B;  2AXM A;  3RSJ A;  2QN4 A;  2D7I A;  1QQL A;  1JQZ A;  1EV2 A;  5DUY A;  3FJJ A;  4EB2 B;  3OGG A;  2RG9 B;  2D43 A;  5F8S A;  3QR5 A;  3PG0 A;  4P0J A;  1ABR B;  3S8J A;  4ZGR B;  2IWT B;  4A7K A;  5BXT A;  1UPS A;  1W3A A;  2D44 A;  2LIQ A;  3NBD A;  4P0L A;  5F8Y A;  3HBW A;  3BX1 C;  1PZZ A;  2ZQO A;  1Z2V A;  3O4D A;  1IOB A; 
#chains in the Genus database with same CATH topology
 1MD6 A;  4END A;  5FZY A;  4I6I A;  4LO1 A;  3A22 A;  4USP A;  1NZK A;  3Q7W A;  4P6A A;  1EYL A;  4G9N A;  2IHO A;  1CVS A;  1T4Q A;  1ISX A;  4LO0 C;  3AJ6 A;  3ZXG A;  1J0S A;  1PC8 B;  2P39 A;  2AQZ A;  2Y9G A;  1FN0 A;  3BAD A;  4WBC A;  4CJM A;  4J23 B;  4QKR A;  3IM5 A;  9ILB A;  2E4M A;  3P53 A;  3ZC8 A;  2RST A;  2XOA A;  1S0D A;  4I7I A;  1V6U A;  1HCE A;  4XKI A;  3T8S A;  4L4H A;  5G00 A;  2YUG A;  3N7K A;  3H6S E;  3LTQ A;  3AKG A;  3HN1 A;  4JAW A;  1N4K A;  3VEQ A;  4DEP A;  3OGF A;  4KEJ A;  1DZD A;  1AVU A;  2KKI A;  4G9M A;  3BAV A;  3N7J A;  4ISQ A;  1AVW B;  1AFC A;  1G9A A;  1TWE A;  1SZ6 B;  4Q9P A;  1W3G A;  3H6R B;  4HA2 A;  3IM7 A;  3AZW A;  3BAG A;  4QD2 B;  4LO2 A;  3RMY A;  1VCL A;  4OWJ A;  4ZA3 B;  2FFU A;  3UD9 A;  1HKN A;  2Q3N B;  1L2H A;  3HMY A;  4QAL A;  5I1B A;  1RML A;  4GAI A;  1KNM A;  3BRD A;  2Q9X A;  2AFG A;  3F1R A;  2MIB A;  2BEA A;  3V0A B;  2VUA A;  4ZFY B;  2L5X A;  4ZFU B;  4II0 A;  1Q04 A;  1ONK B;  1HIB A;  1S0L A;  3VSZ A;  3W9T A;  4KEK A;  5DZU A;  3BA7 A;  3I29 B;  3WIN C;  3HAL A;  1BA7 A;  5F8W A;  2Y9F A;  3AKH A;  3FJI A;  1HCD A;  2AAI B;  3V0A A;  2F2F C;  2Y9W C;  3A07 A;  1G9C A;  3JRR A;  3O4B A;  2FFV A;  1F31 A;  2MLL B;  3I2A A;  2ESU A;  3PUB A;  4I0Y A;  4GOV A;  4EFR A;  4H75 A;  1HWM B;  3WA1 A;  1ISY A;  1DFC A;  1M2T B;  5BP5 C;  3O4O A;  3KMV A;  4Z9W B;  3RMX A;  1K5V A;  3MAL A;  4I4U A;  1FWV A;  1I1B A;  4I3N A;  3AH2 A;  3FJ8 A;  4EKX B;  2ET2 A;  3FJ9 A;  3POK A;  3UDA A;  3VT1 A;  3UD8 A;  4G6M A;  1BLA A;  4X39 A;  4LO7 C;  3V0B B;  4ZBV B;  1ISZ A;  3OJV A;  3O49 A;  3O4A A;  3CA0 A;  3IM6 A;  4DCK C;  3AH1 A;  1PUM B;  4OW4 A;  2VXT I;  2NP0 A;  5BQU C;  2P23 A;  5FNX A;  4I96 A;  4OEF A;  4Q91 A;  2DRZ A;  3UJ4 A;  2D7R A;  4MZF B;  2DRY A;  3P6I A;  1D0H A;  3ILA A;  1P63 A;  1DIW A;  4TLP A;  2KLL A;  3BTA A;  1TP0 A;  3WMU A;  3ZC9 A;  3AKF A;  2X2T A;  2VLC A;  3N0K A;  4H04 A;  4AN7 B;  2DRE A;  1S0G A;  1R8N A;  4LO8 B;  1HWO B;  3BAH A;  1IRA X;  3CA1 A;  2LIE A;  3R4U A;  4GOY A;  1M16 A;  4ZOT A;  5B2H A;  3FGM A;  3NBN A;  4ISR A;  2KH2 A;  4J2K A;  3WO4 A;  5DVH A;  3R4S A;  4A7Y A;  1EPW A;  3CRI A;  21BI A;  4LO1 C;  3SNV A;  3V79 C;  4DEN A;  3BAQ A;  4PC4 A;  1TTU A;  1WD3 A;  3NJ5 A;  1XHB A;  5FZU A;  1ISW A;  1WBC A;  1JT3 A;  4GP3 A;  1I1E A;  5D63 A;  5E24 E;  3VUO A;  1TFM B;  4X3A A;  4IYB A;  2HZ9 A;  2ERM A;  3FUO A;  1XZZ A;  5GAQ A;  4OEE A;  3CRH A;  2E4M C;  4I8M A;  2K43 A;  4JPZ A;  2VSE A;  1PUU B;  6I1B A;  3EF2 A;  4R6U B;  1BAS A;  1OQL B;  3AZV A;  1G9B A;  3BA5 A;  4I4X A;  3O3Q A;  2KI6 B;  3O44 A;  1JLY A;  3FJK A;  4OWK A;  2GZB A;  2FDB M;  1WD4 A;  4Q9G A;  3BRF A;  3H6R A;  2I1B A;  3FJE A;  1FWU A;  1Q03 A;  3CRG A;  4GP0 A;  4QBV A;  4IY9 A;  1S0F A;  1DZC A;  3VT2 A;  3N7L A;  4J2S A;  7I1B A;  3IAG C;  1QQK A;  4XFS A;  1RG8 A;  4LO2 C;  2KI4 A;  1SR4 A;  2NZ9 A;  3CAH A;  1FMZ A;  4JRA A;  1CE7 B;  2X2S A;  1BFB A;  1BAR A;  3A23 A;  4LO3 A;  4OUJ A;  4FVV A;  3OBR A;  1IRP A;  4I4Y A;  3RTJ B;  4D8H A;  5JLV A;  4IZE A;  3WO3 A;  4JKX B;  4IY8 A;  3WO2 A;  1ISV A;  1A8D A;  2ZR1 B;  3D7W B;  5D61 A;  3I2X A;  4QD2 C;  1JLX A;  3Q7X A;  5BXS A;  1BFC A;  2DS0 A;  3FJH A;  3QYD A;  4YOL A;  5EC5 A;  3TC2 A;  4I1B A;  2K4A B;  5JMC A;  4QBC A;  1V6V A;  2NTD A;  2M49 A;  1TOO A;  1TWM A;  4UY4 A;  4I4V A;  3FFZ A;  3FJA A;  3PHZ A;  1RY7 A;  4H9W A;  3P6J A;  4KC3 A;  4ZLB B;  2D22 A;  2D20 A;  1JT7 A;  4MZH A;  3VWC A;  3HOM A;  4I2S A;  2WRY A;  3V0B A;  3ZXD A;  3C9Z A;  3OBT A;  3ZX7 A;  4KBB A;  1DJS B;  3AKI A;  1S0B A;  4IQP A;  1HWN B;  5D62 A;  4F83 A;  1V6X A;  1AXM A;  3BB2 A;  3MPP G;  1NUN A;  4I4Q A;  4IHZ A;  4QKS A;  4J2X A;  4LO0 A;  2NM1 A;  4XFT A;  4Z8S B;  4JQ0 A;  4A7Z A;  2FO1 A;  1YTO A;  2NS2 A;  3K1X A;  4KEI A;  1Q1U A;  2VU9 A;  4J2Y A;  2HWA A;  1IT0 A;  1V6W A;  3Q7Y A;  3FJF A;  3CA6 A;  2BEB A;  1BLD A;  4G1R A;  3VT0 A;  3JUT A;  1WBA A;  1XG6 A;  4I4P A;  3WMV A;  1MC9 A;  3O4C A;  1ILR 1;  4OWL A;  1IJT A;  4P0K A;  3F62 B;  4G6J A;  3LLP A;  8I1B A;  3CQA A;  3CA3 A;  4X37 A;  5F90 A;  3UJ0 A;  2HWM A;  2VXR A;  1YYN A;  5HPZ A;  1FMM S;  3AJ5 A;  4ZKT B;  3E8L C;  3RTI B;  1XYF A;  1YF8 B;  3CA5 A;  1E0O A;  1PWA A;  2UUS A;  5FNW A;  3BRG C;  4USO A;  1IIL A;  3FUQ A;  1JT4 A;  3FJB A;  3OJ2 A;  4HJJ A;  4GAF A;  1JTC A;  1QXM A;  5BOW A;  1FQ9 A;  4XFU A;  2FGF A;  3NBC A;  2HW9 A;  4I37 A;  4EEE B;  4QC4 A;  3N7M A;  3OJM A;  1DQG A;  4F34 A;  1II4 A;  1JY0 A;  3IIR A;  3WIN A;  5EHA A;  1DLL A;  1FV2 A;  2WBC A;  1R8O A;  2RQ9 A;  3BAU A;  4JP0 A;  3BAO A;  2D24 A;  4IZX A;  3B9U A;  1S0C A;  2F2F A;  4OEG A;  3BA4 A;  4ION A;  2NVH A;  4LO7 B;  3AH4 A;  1Z0H A;  1ITB A;  2F8X C;  3H6Q A;  5BXR A;  3O5W B;  4I4R A;  1HWP B;  2VSA A;  5BP5 A;  2Z48 A;  2Y9X E;  1BFF A;  5BXP A;  4D0Z A;  2QYI B;  3NBE A;  1YXW A;  1BFG A;  2MC2 A;  1AVA C;  3VSF A;  41BI A;  31BI A;  1DQO A;  1W3F A;  1FGA A;  1G82 A;  3FJC A;  3HSM A;  2R9K B;  3CU1 B;  4I4O A;  1Z4S A;  2Z49 A;  1TIE A;  4MZG B;  2D23 A;  2BFH A;  5EG6 C;  1SR4 C;  1YBI A;  2GO2 A;  4HR6 C;  4D0T A;  1FV3 A;  1S0E A;  1GGP B;  4FGF A;  4I1E A;  4LO3 C;  1AF9 A;  4I4S A;  1G9D A;  3UD7 A;  2D1Z A;  5BQU A;  5FZZ A;  2NYY A;  4EFP A;  4EFQ A;  4X38 A;  3CA4 A;  2J3P A;  1DFQ A;  1AVX B;  4AN6 A;  5DSS B;  3PME A;  1IHK A;  2ZQN A;  1T9F A;  4ZFW B;  1K5U A;  3S8K A;  4QO3 A;  3A21 A;  4JKQ A;  4L4I A;  5BVP I;  1EVT A;  3FJD A;  1JT5 A;  2K8R A;  1RZO B;  2AXM A;  3RSJ A;  2QN4 A;  2D7I A;  1QQL A;  1JQZ A;  1EV2 A;  5DUY A;  3FJJ A;  4EB2 B;  3OGG A;  2RG9 B;  2D43 A;  5F8S A;  3QR5 A;  3PG0 A;  4P0J A;  1ABR B;  3S8J A;  4ZGR B;  2IWT B;  4A7K A;  5BXT A;  1UPS A;  1W3A A;  2D44 A;  2LIQ A;  3NBD A;  4P0L A;  5F8Y A;  3HBW A;  3BX1 C;  1PZZ A;  2ZQO A;  1Z2V A;  3O4D A;  1IOB A; 
#chains in the Genus database with same CATH homology
 1MD6 A;  4END A;  5FZY A;  4I6I A;  4LO1 A;  3A22 A;  4USP A;  1NZK A;  3Q7W A;  4P6A A;  1EYL A;  4G9N A;  2IHO A;  1CVS A;  1T4Q A;  1ISX A;  4LO0 C;  3AJ6 A;  3ZXG A;  1J0S A;  1PC8 B;  2P39 A;  2AQZ A;  2Y9G A;  1FN0 A;  3BAD A;  4WBC A;  4CJM A;  4J23 B;  4QKR A;  3IM5 A;  9ILB A;  2E4M A;  3P53 A;  3ZC8 A;  2RST A;  2XOA A;  1S0D A;  4I7I A;  1V6U A;  1HCE A;  4XKI A;  3T8S A;  4L4H A;  5G00 A;  2YUG A;  3N7K A;  3H6S E;  3LTQ A;  3AKG A;  3HN1 A;  4JAW A;  1N4K A;  3VEQ A;  4DEP A;  3OGF A;  4KEJ A;  1DZD A;  1AVU A;  2KKI A;  4G9M A;  3BAV A;  3N7J A;  4ISQ A;  1AVW B;  1AFC A;  1G9A A;  1TWE A;  1SZ6 B;  4Q9P A;  1W3G A;  3H6R B;  4HA2 A;  3IM7 A;  3AZW A;  3BAG A;  4QD2 B;  4LO2 A;  3RMY A;  1VCL A;  4OWJ A;  4ZA3 B;  2FFU A;  3UD9 A;  1HKN A;  2Q3N B;  1L2H A;  3HMY A;  4QAL A;  5I1B A;  1RML A;  4GAI A;  1KNM A;  3BRD A;  2Q9X A;  2AFG A;  3F1R A;  2MIB A;  2BEA A;  3V0A B;  2VUA A;  4ZFY B;  2L5X A;  4ZFU B;  4II0 A;  1Q04 A;  1ONK B;  1HIB A;  1S0L A;  3VSZ A;  3W9T A;  4KEK A;  5DZU A;  3BA7 A;  3I29 B;  3WIN C;  3HAL A;  1BA7 A;  5F8W A;  2Y9F A;  3AKH A;  3FJI A;  1HCD A;  2AAI B;  3V0A A;  2F2F C;  2Y9W C;  3A07 A;  1G9C A;  3JRR A;  3O4B A;  2FFV A;  1F31 A;  2MLL B;  3I2A A;  2ESU A;  3PUB A;  4I0Y A;  4GOV A;  4EFR A;  4H75 A;  1HWM B;  3WA1 A;  1ISY A;  1DFC A;  1M2T B;  5BP5 C;  3O4O A;  3KMV A;  4Z9W B;  3RMX A;  1K5V A;  3MAL A;  4I4U A;  1FWV A;  1I1B A;  4I3N A;  3AH2 A;  3FJ8 A;  4EKX B;  2ET2 A;  3FJ9 A;  3POK A;  3UDA A;  3VT1 A;  3UD8 A;  4G6M A;  1BLA A;  4X39 A;  4LO7 C;  3V0B B;  4ZBV B;  1ISZ A;  3OJV A;  3O49 A;  3O4A A;  3CA0 A;  3IM6 A;  4DCK C;  3AH1 A;  1PUM B;  4OW4 A;  2VXT I;  2NP0 A;  5BQU C;  2P23 A;  5FNX A;  4I96 A;  4OEF A;  4Q91 A;  2DRZ A;  3UJ4 A;  2D7R A;  4MZF B;  2DRY A;  3P6I A;  1D0H A;  3ILA A;  1P63 A;  1DIW A;  4TLP A;  2KLL A;  3BTA A;  1TP0 A;  3WMU A;  3ZC9 A;  3AKF A;  2X2T A;  2VLC A;  3N0K A;  4H04 A;  4AN7 B;  2DRE A;  1S0G A;  1R8N A;  4LO8 B;  1HWO B;  3BAH A;  1IRA X;  3CA1 A;  2LIE A;  3R4U A;  4GOY A;  1M16 A;  4ZOT A;  5B2H A;  3FGM A;  3NBN A;  4ISR A;  2KH2 A;  4J2K A;  3WO4 A;  5DVH A;  3R4S A;  4A7Y A;  1EPW A;  3CRI A;  21BI A;  4LO1 C;  3SNV A;  3V79 C;  4DEN A;  3BAQ A;  4PC4 A;  1TTU A;  1WD3 A;  3NJ5 A;  1XHB A;  5FZU A;  1ISW A;  1WBC A;  1JT3 A;  4GP3 A;  1I1E A;  5D63 A;  5E24 E;  3VUO A;  1TFM B;  4X3A A;  4IYB A;  2HZ9 A;  2ERM A;  3FUO A;  1XZZ A;  5GAQ A;  4OEE A;  3CRH A;  2E4M C;  4I8M A;  2K43 A;  4JPZ A;  2VSE A;  1PUU B;  6I1B A;  3EF2 A;  4R6U B;  1BAS A;  1OQL B;  3AZV A;  1G9B A;  3BA5 A;  4I4X A;  3O3Q A;  2KI6 B;  3O44 A;  1JLY A;  3FJK A;  4OWK A;  2GZB A;  2FDB M;  1WD4 A;  4Q9G A;  3BRF A;  3H6R A;  2I1B A;  3FJE A;  1FWU A;  1Q03 A;  3CRG A;  4GP0 A;  4QBV A;  4IY9 A;  1S0F A;  1DZC A;  3VT2 A;  3N7L A;  4J2S A;  7I1B A;  3IAG C;  1QQK A;  4XFS A;  1RG8 A;  4LO2 C;  2KI4 A;  1SR4 A;  2NZ9 A;  3CAH A;  1FMZ A;  4JRA A;  1CE7 B;  2X2S A;  1BFB A;  1BAR A;  3A23 A;  4LO3 A;  4OUJ A;  4FVV A;  3OBR A;  1IRP A;  4I4Y A;  3RTJ B;  4D8H A;  5JLV A;  4IZE A;  3WO3 A;  4JKX B;  4IY8 A;  3WO2 A;  1ISV A;  1A8D A;  2ZR1 B;  3D7W B;  5D61 A;  3I2X A;  4QD2 C;  1JLX A;  3Q7X A;  5BXS A;  1BFC A;  2DS0 A;  3FJH A;  3QYD A;  4YOL A;  5EC5 A;  3TC2 A;  4I1B A;  2K4A B;  5JMC A;  4QBC A;  1V6V A;  2NTD A;  2M49 A;  1TOO A;  1TWM A;  4UY4 A;  4I4V A;  3FFZ A;  3FJA A;  3PHZ A;  1RY7 A;  4H9W A;  3P6J A;  4KC3 A;  4ZLB B;  2D22 A;  2D20 A;  1JT7 A;  4MZH A;  3VWC A;  3HOM A;  4I2S A;  2WRY A;  3V0B A;  3ZXD A;  3C9Z A;  3OBT A;  3ZX7 A;  4KBB A;  1DJS B;  3AKI A;  1S0B A;  4IQP A;  1HWN B;  5D62 A;  4F83 A;  1V6X A;  1AXM A;  3BB2 A;  3MPP G;  1NUN A;  4I4Q A;  4IHZ A;  4QKS A;  4J2X A;  4LO0 A;  2NM1 A;  4XFT A;  4Z8S B;  4JQ0 A;  4A7Z A;  2FO1 A;  1YTO A;  2NS2 A;  3K1X A;  4KEI A;  1Q1U A;  2VU9 A;  4J2Y A;  2HWA A;  1IT0 A;  1V6W A;  3Q7Y A;  3FJF A;  3CA6 A;  2BEB A;  1BLD A;  4G1R A;  3VT0 A;  3JUT A;  1WBA A;  1XG6 A;  4I4P A;  3WMV A;  1MC9 A;  3O4C A;  1ILR 1;  4OWL A;  1IJT A;  4P0K A;  3F62 B;  4G6J A;  3LLP A;  8I1B A;  3CQA A;  3CA3 A;  4X37 A;  5F90 A;  3UJ0 A;  2HWM A;  2VXR A;  1YYN A;  5HPZ A;  1FMM S;  3AJ5 A;  4ZKT B;  3E8L C;  3RTI B;  1XYF A;  1YF8 B;  3CA5 A;  1E0O A;  1PWA A;  2UUS A;  5FNW A;  3BRG C;  4USO A;  1IIL A;  3FUQ A;  1JT4 A;  3FJB A;  3OJ2 A;  4HJJ A;  4GAF A;  1JTC A;  1QXM A;  5BOW A;  1FQ9 A;  4XFU A;  2FGF A;  3NBC A;  2HW9 A;  4I37 A;  4EEE B;  4QC4 A;  3N7M A;  3OJM A;  1DQG A;  4F34 A;  1II4 A;  1JY0 A;  3IIR A;  3WIN A;  5EHA A;  1DLL A;  1FV2 A;  2WBC A;  1R8O A;  2RQ9 A;  3BAU A;  4JP0 A;  3BAO A;  2D24 A;  4IZX A;  3B9U A;  1S0C A;  2F2F A;  4OEG A;  3BA4 A;  4ION A;  2NVH A;  4LO7 B;  3AH4 A;  1Z0H A;  1ITB A;  2F8X C;  3H6Q A;  5BXR A;  3O5W B;  4I4R A;  1HWP B;  2VSA A;  5BP5 A;  2Z48 A;  2Y9X E;  1BFF A;  5BXP A;  4D0Z A;  2QYI B;  3NBE A;  1YXW A;  1BFG A;  2MC2 A;  1AVA C;  3VSF A;  41BI A;  31BI A;  1DQO A;  1W3F A;  1FGA A;  1G82 A;  3FJC A;  3HSM A;  2R9K B;  3CU1 B;  4I4O A;  1Z4S A;  2Z49 A;  1TIE A;  4MZG B;  2D23 A;  2BFH A;  5EG6 C;  1SR4 C;  1YBI A;  2GO2 A;  4HR6 C;  4D0T A;  1FV3 A;  1S0E A;  1GGP B;  4FGF A;  4I1E A;  4LO3 C;  1AF9 A;  4I4S A;  1G9D A;  3UD7 A;  2D1Z A;  5BQU A;  5FZZ A;  2NYY A;  4EFP A;  4EFQ A;  4X38 A;  3CA4 A;  2J3P A;  1DFQ A;  1AVX B;  4AN6 A;  5DSS B;  3PME A;  1IHK A;  2ZQN A;  1T9F A;  4ZFW B;  1K5U A;  3S8K A;  4QO3 A;  3A21 A;  4JKQ A;  4L4I A;  5BVP I;  1EVT A;  3FJD A;  1JT5 A;  2K8R A;  1RZO B;  2AXM A;  3RSJ A;  2QN4 A;  2D7I A;  1QQL A;  1JQZ A;  1EV2 A;  5DUY A;  3FJJ A;  4EB2 B;  3OGG A;  2RG9 B;  2D43 A;  5F8S A;  3QR5 A;  3PG0 A;  4P0J A;  1ABR B;  3S8J A;  4ZGR B;  2IWT B;  4A7K A;  5BXT A;  1UPS A;  1W3A A;  2D44 A;  2LIQ A;  3NBD A;  4P0L A;  5F8Y A;  3HBW A;  3BX1 C;  1PZZ A;  2ZQO A;  1Z2V A;  3O4D A;  1IOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...