2Y9GA

High-resolution structural insights on the sugar-recognition and fusion tag properties of a versatile b-trefoil lectin domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
b'DIYIPPEGLYFRLLGFASRQVIFARNSPSPDVGLSPVNDQATDQYFSLIYGTGEHAGLYAIKSKATGKVLFSRRPAEPYVGQIDGDGRYPDNWFKIEPGKTYLSKYFRLVQPSTGTALVSRTHLQPYFWNHPQTEVFDDQYFTFLFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMOLYTIC LECTIN LSLA
publication title High-Resolution Structural Insights on the Sugar-Recognition and Fusion Tag Properties of a Versatile Beta-Trefoil Lectin Domain from the Mushroom Laetiporus Sulphureus.
pubmed doi rcsb
source organism Laetiporus sulphureus
molecule tags Sugar binding protein
total genus 31
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2011-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2y9gA00
3I2XA 4OW4A 4XFUA 3RTIB 1FMZA 4ZFWB 2D22A 3CA3A 2VSEA 2GO2A 3OGFA 4Q9PA 3EF2A 5DZUA 3BRDA 2FO1A 4GP3A 2DRYA 2Y9FA 3ZX7A 4EKXB 1D0HA 4LO8B 4QKRA 4Z9WB 4HJJA 1S0BA 1Q1UA 3V0AB 2I1BA 3RMXA 3CA4A 4TLPA 1R8NA 4AN7B 4GOYA 1DIWA 3WINC 3CA0A 1A8DA 3WMUA 4JKXB 1IHKA 3BX1C 1ILR1 3Q7WA 4J2SA 2Z48A 4F83A 2BEAA 3VT1A 4X38A 4Q91A 4ZKTB 2FFUA 3VEQA 1S0GA 2Y9GA 3HALA 1Z0HA 3CU1B 1ISVA 3NJ5A 2D7RA 3F1RA 4F34A 1BA7A 5FNWA 3O3QA 3P6IA 5B2HA 2E4MA 4KEJA 2AXMA 3CA1A 3IM7A 1TTUA 5BXTA 3FJKA 2FDBM 1R8OA 3AKFA 4IQPA 3OGGA 2QN4A 4A7YA 4I4RA 4JQ0A 1MC9A 4ISQA 3BAVA 3V0BB 4H9WA 1PUUB 3N7MA 4I1BA 4JRAA 5DUYA 1TWMA 4I3NA 5JMCA 2ESUA 3FJAA 3QYDA 4ZGRB 3N7KA 3VT2A 1EVTA 4GP0A 1FV2A 3WMVA 1PUMB 1DJSB 3AJ6A 3O4CA 4L4HA 1II4A 4P0KA 1AVXB 4OWKA 4QALA 2Y9WC 3AH4A 3FJHA 4USPA 2FGFA 2K43A 1SZ6B 2YUGA 3PUBA 4Q9GA 5G00A 1FQ9A 3O4AA 3AZVA 3SNVA 2VUAA 3HOMA 3JRRA 4OEFA 4Z8SB 3UD9A 4G1RA 3BRFA 4I1EA 3BADA 1IOBA 4ZFUB 3BA4A 4JP0A 5BXPA 3A22A 4KBBA 2P23A 3FFZA 1ITBA 3UJ4A 4LO1A 2E4MC 1YBIA 4H04A 4DEPA 5FZYA 5FZZA 4IONA 1S0FA 2KI4A 2FFVA 1Q03A 1ISYA 4CJMA 2RSTA 4I8MA 2D23A 3O4DA 4LO3A 3V0BA 3IIRA 4I0YA 2KI6B 1W3FA 3BAUA 1S0CA 1V6VA 3VT0A 5EC5A 4FGFA 2D20A 3FJIA 4QBVA 4A7ZA 1JQZA 1SR4A 4IY8A 1G9CA 3WO2A 1HWNB 1M16A 1DLLA 5DSSB 1BARA 1FMMS 4G6JA 1IILA 3HSMA 1EPWA 4IHZA 1BASA 1IRPA 4I4UA 1K5UA 1T9FA 4GAFA 4J2YA 3UDAA 1QQKA 4I4QA 3KMVA 4X3AA 1DZCA 2MLLB 1AVWB 3PG0A 3IM6A 2ERMA 4G9NA 4LO1C 1ABRB 4GOVA 3UJ0A 3HMYA 3OJMA 3FJFA 3S8JA 4XFSA 4JAWA 3ZC8A 1JT7A 2VU9A 3AKGA 2HW9A 1JY0A 1DFQA 1EYLA 4I4PA 3BA5A 4OWLA 1WD4A 4LO3C 4P0LA 4ZA3B 2F2FA 5D61A 4XKIA 3WO3A 3IM5A 4I4OA 1XHBA 2D44A 1FV3A 2HWAA 1BFCA 5FNXA 2NYYA 2LIEA 1SR4C 3BAQA 1DFCA 4LO2A 5JLVA 3O4BA 1PZZA 4P6AA 4LO0A 5EG6C 3FJEA 1AXMA 4OWJA 4D8HA 2Q3NB 2Z49A 2RG9B 2ZQNA 3IAGC 3C9ZA 4ENDA 3A21A 1BFBA 1K5VA 3AZWA 3CRIA 4ZOTA 2NM1A 2DRZA 1Z4SA 3HN1A 4X37A 4D0TA 1HWOB 2D1ZA 3Q7XA 3H6QA 5BP5A 3WO4A 5F90A 3CRHA 3VWCA 5DVHA 1IRAX 2AQZA 4G6MA 3BTAA 1M2TB 3OBRA 3RMYA 2D7IA 3MPPG 4ZFYB 2ZQOA 4I4SA 5F8WA 1S0DA 4I7IA 3O49A 1IT0A 3H6SE 4IZXA 4JKQA 2NP0A 4KEIA 4P0JA 1BLAA 1QXMA 4USOA 4I4VA 1N4KA 4EFRA 1HCDA 2D24A 2F2FC 1PC8B 1TIEA 5BQUC 1AFCA 4OEEA 3ZXDA 1S0LA 5BXSA 2NVHA 1NUNA 4A7KA 3FJBA 4LO2C 1V6WA 2P39A 4I6IA 4LO0C 4II0A 3UD8A 1V6UA 2M49A 2XOAA 5F8SA 1AVAC 3O4OA 3VUOA 1RG8A 4PC4A 3CRGA 1AVUA 4OUJA 4I96A 3W9TA 1W3AA 1E0OA 3A23A 3K1XA 3BAOA 3AJ5A 9ILBA 31BIA 3I2AA 4QD2B 3ILAA 5BP5C 3POKA 7I1BA 4DCKC 1TP0A 1Z2VA 3NBEA 1YTOA 5F8YA 1NZKA 1VCLA 2RQ9A 2VXTI 4WBCA 1TWEA 1DQGA 3F62B 1Q04A 2IWTB 21BIA 2VXRA 4EFQA 3VSFA 4I4YA 4ZBVB 3RTJB 3NBNA 4G9MA 1J0SA 3FUQA 1WBCA 3I29B 4LO7C 2X2SA 1S0EA 1G9BA 3N7JA 1TOOA 4XFTA 3BAHA 1BFFA 4R6UB 4KC3A 1HWMB 3LLPA 1CE7B 2NZ9A 3LTQA 1YYNA 5D63A 2Y9XE 2DREA 3VSZA 1GGPB 1RY7A 1EV2A 5I1BA 3P6JA 4LO7B 3R4SA 1PWAA 2HZ9A 1W3GA 5BQUA 1F31A 1YF8B 1V6XA 1T4QA 3CQAA 1ONKB 2KLLA 3HBWA 2L5XA 1UPSA 2NTDA 1BFGA 1HCEA 2KH2A 2ET2A 4IYBA 3TC2A 1RMLA 1XG6A 2AFGA 3AKHA 3AH1A 2R9KB 3PHZA 1OQLB 1XYFA 3QR5A 4I2SA 4L4IA 1G82A 4QC4A 1HIBA 1RZOB 2WBCA 4I37A 2MC2A 2UUSA 1BLDA 3CA5A 1JLXA 3FUOA 6I1BA 3JUTA 4IZEA 5D62A 2WRYA 3H6RA 3O5WB 1JT3A 1MD6A 5FZUA 3AKIA 2MIBA 1YXWA 1P63A 1KNMA 1L2HA 3S8KA 1DQOA 3CA6A 2X2TA 3OJ2A 2DS0A 4IY9A 4EB2B 3FGMA 3AH2A 2BEBA 3FJDA 1WD3A 1ISWA 3Q7YA 2Q9XA 3B9UA 4AN6A 3V0AA 1FWUA 4HR6C 1JT5A 4QKSA 1TFMB 4OEGA 2HWMA 3E8LC 4QD2C 2QYIB 3FJCA 3OBTA 41BIA 4EEEB 5EHAA 3BAGA 2F8XC 5BOWA 2K4AB 1JLYA 3BB2A 1WBAA 1I1BA 4GAIA 3OJVA 1FGAA 3NBCA 3D7WB 8I1BA 1FN0A 1XZZA 3V79C 2KKIA 4FVVA 2D43A 4QBCA 3R4UA 5E24E 1I1EA 3BRGC 2VLCA 3RSJA 4D0ZA 4YOLA 3FJ9A 4QO3A 1G9DA 5HPZA 3PMEA 4J2KA 2VSAA 2AAIB 1CVSA 2IHOA 4J23B 4X39A 4EFPA 3N0KA 3WINA 1JTCA 2J3PA 5GAQA 3WA1A 3CAHA 1HKNA 2GZBA 3O44A 1HWPB 1ISXA 1DZDA 4JPZA 4I4XA 4ISRA 1IJTA 4ZLBB 4HA2A 2BFHA 2K8RA 3FJJA 3UD7A 1AF9A 3P53A 1QQLA 1ISZA 3ZC9A 3N7LA 3FJ8A 3ZXGA 4J2XA 3A07A 3T8SA 5BXRA 3MALA 4KEKA 2LIQA 5BVPI 3NBDA 1FWVA 3BA7A 1G9AA 2ZR1B 1JT4A 4DENA 3H6RB
chains in the Genus database with same CATH superfamily
3I2XA 4OW4A 4XFUA 3RTIB 1FMZA 4ZFWB 2D22A 3CA3A 2VSEA 2GO2A 3OGFA 4Q9PA 3EF2A 5DZUA 3BRDA 2FO1A 4GP3A 2DRYA 2Y9FA 3ZX7A 4EKXB 1D0HA 4LO8B 4QKRA 4Z9WB 4HJJA 1S0BA 1Q1UA 3V0AB 2I1BA 3RMXA 3CA4A 4TLPA 1R8NA 4AN7B 4GOYA 1DIWA 3WINC 3CA0A 1A8DA 3WMUA 4JKXB 1IHKA 3BX1C 1ILR1 3Q7WA 4J2SA 2Z48A 4F83A 2BEAA 3VT1A 4X38A 4Q91A 4ZKTB 2FFUA 3VEQA 1S0GA 2Y9GA 3HALA 1Z0HA 3CU1B 1ISVA 3NJ5A 2D7RA 3F1RA 4F34A 1BA7A 5FNWA 3O3QA 3P6IA 5B2HA 2E4MA 4KEJA 2AXMA 3CA1A 3IM7A 1TTUA 5BXTA 3FJKA 2FDBM 1R8OA 3AKFA 4IQPA 3OGGA 2QN4A 4A7YA 4I4RA 4JQ0A 1MC9A 4ISQA 3BAVA 3V0BB 4H9WA 1PUUB 3N7MA 4I1BA 4JRAA 5DUYA 1TWMA 4I3NA 5JMCA 2ESUA 3FJAA 3QYDA 4ZGRB 3N7KA 3VT2A 1EVTA 4GP0A 1FV2A 3WMVA 1PUMB 1DJSB 3AJ6A 3O4CA 4L4HA 1II4A 4P0KA 1AVXB 4OWKA 4QALA 2Y9WC 3AH4A 3FJHA 4USPA 2FGFA 2K43A 1SZ6B 2YUGA 4MZHA 3PUBA 4Q9GA 5G00A 1FQ9A 3O4AA 3AZVA 3SNVA 2VUAA 3HOMA 3JRRA 4OEFA 4Z8SB 3UD9A 4G1RA 3BRFA 4I1EA 3BADA 1IOBA 4ZFUB 3BA4A 4JP0A 5BXPA 3A22A 4KBBA 2P23A 3FFZA 1ITBA 3UJ4A 4LO1A 2E4MC 1YBIA 4H04A 4DEPA 5FZYA 5FZZA 4UY4A 4IONA 1S0FA 2KI4A 2FFVA 1Q03A 1ISYA 4CJMA 2RSTA 4I8MA 2D23A 3O4DA 4LO3A 3V0BA 3IIRA 4I0YA 2KI6B 1W3FA 3BAUA 1S0CA 1V6VA 3VT0A 5EC5A 4FGFA 2D20A 3FJIA 4QBVA 4A7ZA 1JQZA 1SR4A 4IY8A 1G9CA 3WO2A 1HWNB 1M16A 1DLLA 5DSSB 1BARA 1FMMS 4G6JA 1IILA 3HSMA 1EPWA 4IHZA 1BASA 1IRPA 4I4UA 1K5UA 1T9FA 2NS2A 4GAFA 4J2YA 3UDAA 1QQKA 4I4QA 3KMVA 4X3AA 1DZCA 2MLLB 1AVWB 3PG0A 3IM6A 2ERMA 4H75A 4G9NA 4LO1C 1ABRB 4GOVA 3UJ0A 3HMYA 3OJMA 3FJFA 3S8JA 4XFSA 4JAWA 3ZC8A 1JT7A 2VU9A 3AKGA 2HW9A 1JY0A 1DFQA 1EYLA 4I4PA 3BA5A 4OWLA 1WD4A 4LO3C 4P0LA 4ZA3B 2F2FA 5D61A 4XKIA 3WO3A 3IM5A 4I4OA 1XHBA 2D44A 1FV3A 2HWAA 1BFCA 5FNXA 2NYYA 2LIEA 1SR4C 3BAQA 1DFCA 4LO2A 5JLVA 3O4BA 1PZZA 4P6AA 4LO0A 5EG6C 3FJEA 1AXMA 4OWJA 4D8HA 2Q3NB 2Z49A 2RG9B 2ZQNA 3IAGC 3C9ZA 4ENDA 3A21A 1BFBA 1K5VA 3AZWA 3CRIA 4ZOTA 2NM1A 2DRZA 1Z4SA 3HN1A 4X37A 4D0TA 1HWOB 2D1ZA 3Q7XA 3H6QA 5BP5A 3WO4A 5F90A 3CRHA 3VWCA 5DVHA 1IRAX 2AQZA 4G6MA 3BTAA 1M2TB 3OBRA 3RMYA 2D7IA 3MPPG 4ZFYB 2ZQOA 4I4SA 5F8WA 1S0DA 4I7IA 3O49A 1IT0A 3H6SE 4IZXA 4JKQA 2NP0A 4KEIA 4P0JA 1BLAA 1QXMA 4USOA 4I4VA 1N4KA 4EFRA 1HCDA 2D24A 2F2FC 1PC8B 1TIEA 5BQUC 1AFCA 4OEEA 3ZXDA 1S0LA 5BXSA 2NVHA 1NUNA 4A7KA 3FJBA 4LO2C 1V6WA 2P39A 4I6IA 4LO0C 4II0A 3UD8A 1V6UA 2M49A 2XOAA 5F8SA 1AVAC 3O4OA 3VUOA 1RG8A 4PC4A 3CRGA 1AVUA 4OUJA 4I96A 3W9TA 1W3AA 1E0OA 3A23A 3K1XA 3BAOA 3AJ5A 9ILBA 31BIA 3I2AA 4QD2B 3ILAA 5BP5C 3POKA 7I1BA 4DCKC 1TP0A 1Z2VA 3NBEA 1YTOA 5F8YA 1NZKA 1VCLA 2RQ9A 2VXTI 4WBCA 1TWEA 1DQGA 3F62B 1Q04A 2IWTB 21BIA 2VXRA 4EFQA 3VSFA 4I4YA 4ZBVB 3RTJB 3NBNA 4G9MA 1J0SA 3FUQA 1WBCA 3I29B 4LO7C 2X2SA 1S0EA 1G9BA 3N7JA 1TOOA 4XFTA 3BAHA 1BFFA 4R6UB 4KC3A 1HWMB 3LLPA 1CE7B 2NZ9A 3LTQA 1YYNA 5D63A 2Y9XE 2DREA 3VSZA 1GGPB 1RY7A 1EV2A 5I1BA 3P6JA 4LO7B 3R4SA 1PWAA 2HZ9A 1W3GA 5BQUA 1F31A 1YF8B 1V6XA 1T4QA 3CQAA 1ONKB 2KLLA 3HBWA 2L5XA 1UPSA 2NTDA 1BFGA 1HCEA 2KH2A 2ET2A 4IYBA 3TC2A 1RMLA 1XG6A 2AFGA 3AKHA 3AH1A 2R9KB 3PHZA 1OQLB 1XYFA 3QR5A 4I2SA 4L4IA 1G82A 4QC4A 1HIBA 1RZOB 2WBCA 4I37A 2MC2A 2UUSA 1BLDA 3CA5A 1JLXA 3FUOA 6I1BA 3JUTA 4IZEA 5D62A 2WRYA 3H6RA 3O5WB 1JT3A 1MD6A 5FZUA 3AKIA 2MIBA 1YXWA 1P63A 1KNMA 1L2HA 3S8KA 1DQOA 3CA6A 2X2TA 3OJ2A 2DS0A 4IY9A 4EB2B 3FGMA 3AH2A 2BEBA 3FJDA 1WD3A 1ISWA 3Q7YA 2Q9XA 3B9UA 4AN6A 4MZGB 3V0AA 1FWUA 4HR6C 1JT5A 4QKSA 1TFMB 4OEGA 2HWMA 3E8LC 4QD2C 2QYIB 3FJCA 3OBTA 41BIA 4EEEB 5EHAA 3BAGA 2F8XC 5BOWA 2K4AB 1JLYA 3BB2A 1WBAA 1I1BA 4GAIA 3OJVA 1FGAA 3NBCA 3D7WB 8I1BA 1FN0A 1XZZA 3V79C 2KKIA 4FVVA 2D43A 4QBCA 3R4UA 5E24E 1I1EA 3BRGC 2VLCA 3RSJA 4D0ZA 4YOLA 3FJ9A 4QO3A 1G9DA 5HPZA 3PMEA 4J2KA 2VSAA 2AAIB 1CVSA 2IHOA 4J23B 4X39A 4EFPA 3N0KA 3WINA 1JTCA 2J3PA 5GAQA 3WA1A 3CAHA 1HKNA 2GZBA 3O44A 1HWPB 1ISXA 1DZDA 4JPZA 4I4XA 4ISRA 1IJTA 4ZLBB 4HA2A 2BFHA 2K8RA 3FJJA 3UD7A 1AF9A 3P53A 1QQLA 4MZFB 1ISZA 3ZC9A 3N7LA 3FJ8A 3ZXGA 4J2XA 3A07A 3T8SA 5BXRA 3MALA 4KEKA 2LIQA 5BVPI 3NBDA 1FWVA 3BA7A 1G9AA 2ZR1B 1JT4A 4DENA 3H6RB
chains in the Genus database with same CATH topology
3I2XA 4OW4A 4XFUA 3RTIB 1FMZA 4ZFWB 2D22A 3CA3A 2VSEA 2GO2A 3OGFA 4Q9PA 3EF2A 5DZUA 3BRDA 2FO1A 4GP3A 2DRYA 2Y9FA 3ZX7A 4EKXB 1D0HA 4LO8B 4QKRA 4Z9WB 4HJJA 1S0BA 1Q1UA 3V0AB 2I1BA 3RMXA 3CA4A 4TLPA 1R8NA 4AN7B 4GOYA 1DIWA 3WINC 3CA0A 1A8DA 3WMUA 4JKXB 1IHKA 3BX1C 1ILR1 3Q7WA 4J2SA 2Z48A 4F83A 2BEAA 3VT1A 4X38A 4Q91A 4ZKTB 2FFUA 3VEQA 1S0GA 2Y9GA 3HALA 1Z0HA 3CU1B 1ISVA 3NJ5A 2D7RA 3F1RA 4F34A 1BA7A 5FNWA 3O3QA 3P6IA 5B2HA 2E4MA 4KEJA 2AXMA 3CA1A 3IM7A 1TTUA 5BXTA 3FJKA 2FDBM 1R8OA 3AKFA 4IQPA 3OGGA 2QN4A 4A7YA 4I4RA 4JQ0A 1MC9A 4ISQA 3BAVA 3V0BB 4H9WA 1PUUB 3N7MA 4I1BA 4JRAA 5DUYA 1TWMA 4I3NA 5JMCA 2ESUA 3FJAA 3QYDA 4ZGRB 3N7KA 3VT2A 1EVTA 4GP0A 1FV2A 3WMVA 1PUMB 1DJSB 3AJ6A 3O4CA 4L4HA 1II4A 4P0KA 1AVXB 4OWKA 4QALA 2Y9WC 3AH4A 3FJHA 4USPA 2FGFA 2K43A 1SZ6B 2YUGA 4MZHA 3PUBA 4Q9GA 5G00A 1FQ9A 3O4AA 3AZVA 3SNVA 2VUAA 3HOMA 3JRRA 4OEFA 4Z8SB 3UD9A 4G1RA 3BRFA 4I1EA 3BADA 1IOBA 4ZFUB 3BA4A 4JP0A 5BXPA 3A22A 4KBBA 2P23A 3FFZA 1ITBA 3UJ4A 4LO1A 2E4MC 1YBIA 4H04A 4DEPA 5FZYA 5FZZA 4UY4A 4IONA 1S0FA 2KI4A 2FFVA 1Q03A 1ISYA 4CJMA 2RSTA 4I8MA 2D23A 3O4DA 4LO3A 3V0BA 3IIRA 4I0YA 2KI6B 1W3FA 3BAUA 1S0CA 1V6VA 3VT0A 5EC5A 4FGFA 2D20A 3FJIA 4QBVA 4A7ZA 1JQZA 1SR4A 4IY8A 1G9CA 3WO2A 1HWNB 1M16A 1DLLA 5DSSB 1BARA 1FMMS 4G6JA 1IILA 3HSMA 1EPWA 4IHZA 1BASA 1IRPA 4I4UA 1K5UA 1T9FA 2NS2A 4GAFA 4J2YA 3UDAA 1QQKA 4I4QA 3KMVA 4X3AA 1DZCA 2MLLB 1AVWB 3PG0A 3IM6A 2ERMA 4H75A 4G9NA 4LO1C 1ABRB 4GOVA 3UJ0A 3HMYA 3OJMA 3FJFA 3S8JA 4XFSA 4JAWA 3ZC8A 1JT7A 2VU9A 3AKGA 2HW9A 1JY0A 1DFQA 1EYLA 4I4PA 3BA5A 4OWLA 1WD4A 4LO3C 4P0LA 4ZA3B 2F2FA 5D61A 4XKIA 3WO3A 3IM5A 4I4OA 1XHBA 2D44A 1FV3A 2HWAA 1BFCA 5FNXA 2NYYA 2LIEA 1SR4C 3BAQA 1DFCA 4LO2A 5JLVA 3O4BA 1PZZA 4P6AA 4LO0A 5EG6C 3FJEA 1AXMA 4OWJA 4D8HA 2Q3NB 2Z49A 2RG9B 2ZQNA 3IAGC 3C9ZA 4ENDA 3A21A 1BFBA 1K5VA 3AZWA 3CRIA 4ZOTA 2NM1A 2DRZA 1Z4SA 3HN1A 4X37A 4D0TA 1HWOB 2D1ZA 3Q7XA 3H6QA 5BP5A 3WO4A 5F90A 3CRHA 3VWCA 5DVHA 1IRAX 2AQZA 4G6MA 3BTAA 1M2TB 3OBRA 3RMYA 2D7IA 3MPPG 4ZFYB 2ZQOA 4I4SA 5F8WA 1S0DA 4I7IA 3O49A 1IT0A 3H6SE 4IZXA 4JKQA 2NP0A 4KEIA 4P0JA 1BLAA 1QXMA 4USOA 4I4VA 1N4KA 4EFRA 1HCDA 2D24A 2F2FC 1PC8B 1TIEA 5BQUC 1AFCA 4OEEA 3ZXDA 1S0LA 5BXSA 2NVHA 1NUNA 4A7KA 3FJBA 4LO2C 1V6WA 2P39A 4I6IA 4LO0C 4II0A 3UD8A 1V6UA 2M49A 2XOAA 5F8SA 1AVAC 3O4OA 3VUOA 1RG8A 4PC4A 3CRGA 1AVUA 4OUJA 4I96A 3W9TA 1W3AA 1E0OA 3A23A 3K1XA 3BAOA 3AJ5A 9ILBA 31BIA 3I2AA 4QD2B 3ILAA 5BP5C 3POKA 7I1BA 4DCKC 1TP0A 1Z2VA 3NBEA 1YTOA 5F8YA 1NZKA 1VCLA 2RQ9A 2VXTI 4WBCA 1TWEA 1DQGA 3F62B 1Q04A 2IWTB 21BIA 2VXRA 4EFQA 3VSFA 4I4YA 4ZBVB 3RTJB 3NBNA 4G9MA 1J0SA 3FUQA 1WBCA 3I29B 4LO7C 2X2SA 1S0EA 1G9BA 3N7JA 1TOOA 4XFTA 3BAHA 1BFFA 4R6UB 4KC3A 1HWMB 3LLPA 1CE7B 2NZ9A 3LTQA 1YYNA 5D63A 2Y9XE 2DREA 3VSZA 1GGPB 1RY7A 1EV2A 5I1BA 3P6JA 4LO7B 3R4SA 1PWAA 2HZ9A 1W3GA 5BQUA 1F31A 1YF8B 1V6XA 1T4QA 3CQAA 1ONKB 2KLLA 3HBWA 2L5XA 1UPSA 2NTDA 1BFGA 1HCEA 2KH2A 2ET2A 4IYBA 3TC2A 1RMLA 1XG6A 2AFGA 3AKHA 3AH1A 2R9KB 3PHZA 1OQLB 1XYFA 3QR5A 4I2SA 4L4IA 1G82A 4QC4A 1HIBA 1RZOB 2WBCA 4I37A 2MC2A 2UUSA 1BLDA 3CA5A 1JLXA 3FUOA 6I1BA 3JUTA 4IZEA 5D62A 2WRYA 3H6RA 3O5WB 1JT3A 1MD6A 5FZUA 3AKIA 2MIBA 1YXWA 1P63A 1KNMA 1L2HA 3S8KA 1DQOA 3CA6A 2X2TA 3OJ2A 2DS0A 4IY9A 4EB2B 3FGMA 3AH2A 2BEBA 3FJDA 1WD3A 1ISWA 3Q7YA 2Q9XA 3B9UA 4AN6A 4MZGB 3V0AA 1FWUA 4HR6C 1JT5A 4QKSA 1TFMB 4OEGA 2HWMA 3E8LC 4QD2C 2QYIB 3FJCA 3OBTA 41BIA 4EEEB 5EHAA 3BAGA 2F8XC 5BOWA 2K4AB 1JLYA 3BB2A 1WBAA 1I1BA 4GAIA 3OJVA 1FGAA 3NBCA 3D7WB 8I1BA 1FN0A 1XZZA 3V79C 2KKIA 4FVVA 2D43A 4QBCA 3R4UA 5E24E 1I1EA 3BRGC 2VLCA 3RSJA 4D0ZA 4YOLA 3FJ9A 4QO3A 1G9DA 5HPZA 3PMEA 4J2KA 2VSAA 2AAIB 1CVSA 2IHOA 4J23B 4X39A 4EFPA 3N0KA 3WINA 1JTCA 2J3PA 5GAQA 3WA1A 3CAHA 1HKNA 2GZBA 3O44A 1HWPB 1ISXA 1DZDA 4JPZA 4I4XA 4ISRA 1IJTA 4ZLBB 4HA2A 2BFHA 2K8RA 3FJJA 3UD7A 1AF9A 3P53A 1QQLA 4MZFB 1ISZA 3ZC9A 3N7LA 3FJ8A 3ZXGA 4J2XA 3A07A 3T8SA 5BXRA 3MALA 4KEKA 2LIQA 5BVPI 3NBDA 1FWVA 3BA7A 1G9AA 2ZR1B 1JT4A 4DENA 3H6RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I2X A;  4OW4 A;  4XFU A;  3RTI B;  1FMZ A;  4ZFW B;  2D22 A;  3CA3 A;  2VSE A;  2GO2 A;  3OGF A;  4Q9P A;  3EF2 A;  5DZU A;  3BRD A;  2FO1 A;  4GP3 A;  2DRY A;  2Y9F A;  3ZX7 A;  4EKX B;  1D0H A;  4LO8 B;  4QKR A;  4Z9W B;  4HJJ A;  1S0B A;  1Q1U A;  3V0A B;  2I1B A;  3RMX A;  3CA4 A;  4TLP A;  1R8N A;  4AN7 B;  4GOY A;  1DIW A;  3WIN C;  3CA0 A;  1A8D A;  3WMU A;  4JKX B;  1IHK A;  3BX1 C;  1ILR 1;  3Q7W A;  4J2S A;  2Z48 A;  4F83 A;  2BEA A;  3VT1 A;  4X38 A;  4Q91 A;  4ZKT B;  2FFU A;  3VEQ A;  1S0G A;  2Y9G A;  3HAL A;  1Z0H A;  3CU1 B;  1ISV A;  3NJ5 A;  2D7R A;  3F1R A;  4F34 A;  1BA7 A;  5FNW A;  3O3Q A;  3P6I A;  5B2H A;  2E4M A;  4KEJ A;  2AXM A;  3CA1 A;  3IM7 A;  1TTU A;  5BXT A;  3FJK A;  2FDB M;  1R8O A;  3AKF A;  4IQP A;  3OGG A;  2QN4 A;  4A7Y A;  4I4R A;  4JQ0 A;  1MC9 A;  4ISQ A;  3BAV A;  3V0B B;  4H9W A;  1PUU B;  3N7M A;  4I1B A;  4JRA A;  5DUY A;  1TWM A;  4I3N A;  5JMC A;  2ESU A;  3FJA A;  3QYD A;  4ZGR B;  3N7K A;  3VT2 A;  1EVT A;  4GP0 A;  1FV2 A;  3WMV A;  1PUM B;  1DJS B;  3AJ6 A;  3O4C A;  4L4H A;  1II4 A;  4P0K A;  1AVX B;  4OWK A;  4QAL A;  2Y9W C;  3AH4 A;  3FJH A;  4USP A;  2FGF A;  2K43 A;  1SZ6 B;  2YUG A;  3PUB A;  4Q9G A;  5G00 A;  1FQ9 A;  3O4A A;  3AZV A;  3SNV A;  2VUA A;  3HOM A;  3JRR A;  4OEF A;  4Z8S B;  3UD9 A;  4G1R A;  3BRF A;  4I1E A;  3BAD A;  1IOB A;  4ZFU B;  3BA4 A;  4JP0 A;  5BXP A;  3A22 A;  4KBB A;  2P23 A;  3FFZ A;  1ITB A;  3UJ4 A;  4LO1 A;  2E4M C;  1YBI A;  4H04 A;  4DEP A;  5FZY A;  5FZZ A;  4ION A;  1S0F A;  2KI4 A;  2FFV A;  1Q03 A;  1ISY A;  4CJM A;  2RST A;  4I8M A;  2D23 A;  3O4D A;  4LO3 A;  3V0B A;  3IIR A;  4I0Y A;  2KI6 B;  1W3F A;  3BAU A;  1S0C A;  1V6V A;  3VT0 A;  5EC5 A;  4FGF A;  2D20 A;  3FJI A;  4QBV A;  4A7Z A;  1JQZ A;  1SR4 A;  4IY8 A;  1G9C A;  3WO2 A;  1HWN B;  1M16 A;  1DLL A;  5DSS B;  1BAR A;  1FMM S;  4G6J A;  1IIL A;  3HSM A;  1EPW A;  4IHZ A;  1BAS A;  1IRP A;  4I4U A;  1K5U A;  1T9F A;  4GAF A;  4J2Y A;  3UDA A;  1QQK A;  4I4Q A;  3KMV A;  4X3A A;  1DZC A;  2MLL B;  1AVW B;  3PG0 A;  3IM6 A;  2ERM A;  4G9N A;  4LO1 C;  1ABR B;  4GOV A;  3UJ0 A;  3HMY A;  3OJM A;  3FJF A;  3S8J A;  4XFS A;  4JAW A;  3ZC8 A;  1JT7 A;  2VU9 A;  3AKG A;  2HW9 A;  1JY0 A;  1DFQ A;  1EYL A;  4I4P A;  3BA5 A;  4OWL A;  1WD4 A;  4LO3 C;  4P0L A;  4ZA3 B;  2F2F A;  5D61 A;  4XKI A;  3WO3 A;  3IM5 A;  4I4O A;  1XHB A;  2D44 A;  1FV3 A;  2HWA A;  1BFC A;  5FNX A;  2NYY A;  2LIE A;  1SR4 C;  3BAQ A;  1DFC A;  4LO2 A;  5JLV A;  3O4B A;  1PZZ A;  4P6A A;  4LO0 A;  5EG6 C;  3FJE A;  1AXM A;  4OWJ A;  4D8H A;  2Q3N B;  2Z49 A;  2RG9 B;  2ZQN A;  3IAG C;  3C9Z A;  4END A;  3A21 A;  1BFB A;  1K5V A;  3AZW A;  3CRI A;  4ZOT A;  2NM1 A;  2DRZ A;  1Z4S A;  3HN1 A;  4X37 A;  4D0T A;  1HWO B;  2D1Z A;  3Q7X A;  3H6Q A;  5BP5 A;  3WO4 A;  5F90 A;  3CRH A;  3VWC A;  5DVH A;  1IRA X;  2AQZ A;  4G6M A;  3BTA A;  1M2T B;  3OBR A;  3RMY A;  2D7I A;  3MPP G;  4ZFY B;  2ZQO A;  4I4S A;  5F8W A;  1S0D A;  4I7I A;  3O49 A;  1IT0 A;  3H6S E;  4IZX A;  4JKQ A;  2NP0 A;  4KEI A;  4P0J A;  1BLA A;  1QXM A;  4USO A;  4I4V A;  1N4K A;  4EFR A;  1HCD A;  2D24 A;  2F2F C;  1PC8 B;  1TIE A;  5BQU C;  1AFC A;  4OEE A;  3ZXD A;  1S0L A;  5BXS A;  2NVH A;  1NUN A;  4A7K A;  3FJB A;  4LO2 C;  1V6W A;  2P39 A;  4I6I A;  4LO0 C;  4II0 A;  3UD8 A;  1V6U A;  2M49 A;  2XOA A;  5F8S A;  1AVA C;  3O4O A;  3VUO A;  1RG8 A;  4PC4 A;  3CRG A;  1AVU A;  4OUJ A;  4I96 A;  3W9T A;  1W3A A;  1E0O A;  3A23 A;  3K1X A;  3BAO A;  3AJ5 A;  9ILB A;  31BI A;  3I2A A;  4QD2 B;  3ILA A;  5BP5 C;  3POK A;  7I1B A;  4DCK C;  1TP0 A;  1Z2V A;  3NBE A;  1YTO A;  5F8Y A;  1NZK A;  1VCL A;  2RQ9 A;  2VXT I;  4WBC A;  1TWE A;  1DQG A;  3F62 B;  1Q04 A;  2IWT B;  21BI A;  2VXR A;  4EFQ A;  3VSF A;  4I4Y A;  4ZBV B;  3RTJ B;  3NBN A;  4G9M A;  1J0S A;  3FUQ A;  1WBC A;  3I29 B;  4LO7 C;  2X2S A;  1S0E A;  1G9B A;  3N7J A;  1TOO A;  4XFT A;  3BAH A;  1BFF A;  4R6U B;  4KC3 A;  1HWM B;  3LLP A;  1CE7 B;  2NZ9 A;  3LTQ A;  1YYN A;  5D63 A;  2Y9X E;  2DRE A;  3VSZ A;  1GGP B;  1RY7 A;  1EV2 A;  5I1B A;  3P6J A;  4LO7 B;  3R4S A;  1PWA A;  2HZ9 A;  1W3G A;  5BQU A;  1F31 A;  1YF8 B;  1V6X A;  1T4Q A;  3CQA A;  1ONK B;  2KLL A;  3HBW A;  2L5X A;  1UPS A;  2NTD A;  1BFG A;  1HCE A;  2KH2 A;  2ET2 A;  4IYB A;  3TC2 A;  1RML A;  1XG6 A;  2AFG A;  3AKH A;  3AH1 A;  2R9K B;  3PHZ A;  1OQL B;  1XYF A;  3QR5 A;  4I2S A;  4L4I A;  1G82 A;  4QC4 A;  1HIB A;  1RZO B;  2WBC A;  4I37 A;  2MC2 A;  2UUS A;  1BLD A;  3CA5 A;  1JLX A;  3FUO A;  6I1B A;  3JUT A;  4IZE A;  5D62 A;  2WRY A;  3H6R A;  3O5W B;  1JT3 A;  1MD6 A;  5FZU A;  3AKI A;  2MIB A;  1YXW A;  1P63 A;  1KNM A;  1L2H A;  3S8K A;  1DQO A;  3CA6 A;  2X2T A;  3OJ2 A;  2DS0 A;  4IY9 A;  4EB2 B;  3FGM A;  3AH2 A;  2BEB A;  3FJD A;  1WD3 A;  1ISW A;  3Q7Y A;  2Q9X A;  3B9U A;  4AN6 A;  3V0A A;  1FWU A;  4HR6 C;  1JT5 A;  4QKS A;  1TFM B;  4OEG A;  2HWM A;  3E8L C;  4QD2 C;  2QYI B;  3FJC A;  3OBT A;  41BI A;  4EEE B;  5EHA A;  3BAG A;  2F8X C;  5BOW A;  2K4A B;  1JLY A;  3BB2 A;  1WBA A;  1I1B A;  4GAI A;  3OJV A;  1FGA A;  3NBC A;  3D7W B;  8I1B A;  1FN0 A;  1XZZ A;  3V79 C;  2KKI A;  4FVV A;  2D43 A;  4QBC A;  3R4U A;  5E24 E;  1I1E A;  3BRG C;  2VLC A;  3RSJ A;  4D0Z A;  4YOL A;  3FJ9 A;  4QO3 A;  1G9D A;  5HPZ A;  3PME A;  4J2K A;  2VSA A;  2AAI B;  1CVS A;  2IHO A;  4J23 B;  4X39 A;  4EFP A;  3N0K A;  3WIN A;  1JTC A;  2J3P A;  5GAQ A;  3WA1 A;  3CAH A;  1HKN A;  2GZB A;  3O44 A;  1HWP B;  1ISX A;  1DZD A;  4JPZ A;  4I4X A;  4ISR A;  1IJT A;  4ZLB B;  4HA2 A;  2BFH A;  2K8R A;  3FJJ A;  3UD7 A;  1AF9 A;  3P53 A;  1QQL A;  1ISZ A;  3ZC9 A;  3N7L A;  3FJ8 A;  3ZXG A;  4J2X A;  3A07 A;  3T8S A;  5BXR A;  3MAL A;  4KEK A;  2LIQ A;  5BVP I;  3NBD A;  1FWV A;  3BA7 A;  1G9A A;  2ZR1 B;  1JT4 A;  4DEN A;  3H6R B; 
#chains in the Genus database with same CATH topology
 3I2X A;  4OW4 A;  4XFU A;  3RTI B;  1FMZ A;  4ZFW B;  2D22 A;  3CA3 A;  2VSE A;  2GO2 A;  3OGF A;  4Q9P A;  3EF2 A;  5DZU A;  3BRD A;  2FO1 A;  4GP3 A;  2DRY A;  2Y9F A;  3ZX7 A;  4EKX B;  1D0H A;  4LO8 B;  4QKR A;  4Z9W B;  4HJJ A;  1S0B A;  1Q1U A;  3V0A B;  2I1B A;  3RMX A;  3CA4 A;  4TLP A;  1R8N A;  4AN7 B;  4GOY A;  1DIW A;  3WIN C;  3CA0 A;  1A8D A;  3WMU A;  4JKX B;  1IHK A;  3BX1 C;  1ILR 1;  3Q7W A;  4J2S A;  2Z48 A;  4F83 A;  2BEA A;  3VT1 A;  4X38 A;  4Q91 A;  4ZKT B;  2FFU A;  3VEQ A;  1S0G A;  2Y9G A;  3HAL A;  1Z0H A;  3CU1 B;  1ISV A;  3NJ5 A;  2D7R A;  3F1R A;  4F34 A;  1BA7 A;  5FNW A;  3O3Q A;  3P6I A;  5B2H A;  2E4M A;  4KEJ A;  2AXM A;  3CA1 A;  3IM7 A;  1TTU A;  5BXT A;  3FJK A;  2FDB M;  1R8O A;  3AKF A;  4IQP A;  3OGG A;  2QN4 A;  4A7Y A;  4I4R A;  4JQ0 A;  1MC9 A;  4ISQ A;  3BAV A;  3V0B B;  4H9W A;  1PUU B;  3N7M A;  4I1B A;  4JRA A;  5DUY A;  1TWM A;  4I3N A;  5JMC A;  2ESU A;  3FJA A;  3QYD A;  4ZGR B;  3N7K A;  3VT2 A;  1EVT A;  4GP0 A;  1FV2 A;  3WMV A;  1PUM B;  1DJS B;  3AJ6 A;  3O4C A;  4L4H A;  1II4 A;  4P0K A;  1AVX B;  4OWK A;  4QAL A;  2Y9W C;  3AH4 A;  3FJH A;  4USP A;  2FGF A;  2K43 A;  1SZ6 B;  2YUG A;  4MZH A;  3PUB A;  4Q9G A;  5G00 A;  1FQ9 A;  3O4A A;  3AZV A;  3SNV A;  2VUA A;  3HOM A;  3JRR A;  4OEF A;  4Z8S B;  3UD9 A;  4G1R A;  3BRF A;  4I1E A;  3BAD A;  1IOB A;  4ZFU B;  3BA4 A;  4JP0 A;  5BXP A;  3A22 A;  4KBB A;  2P23 A;  3FFZ A;  1ITB A;  3UJ4 A;  4LO1 A;  2E4M C;  1YBI A;  4H04 A;  4DEP A;  5FZY A;  5FZZ A;  4UY4 A;  4ION A;  1S0F A;  2KI4 A;  2FFV A;  1Q03 A;  1ISY A;  4CJM A;  2RST A;  4I8M A;  2D23 A;  3O4D A;  4LO3 A;  3V0B A;  3IIR A;  4I0Y A;  2KI6 B;  1W3F A;  3BAU A;  1S0C A;  1V6V A;  3VT0 A;  5EC5 A;  4FGF A;  2D20 A;  3FJI A;  4QBV A;  4A7Z A;  1JQZ A;  1SR4 A;  4IY8 A;  1G9C A;  3WO2 A;  1HWN B;  1M16 A;  1DLL A;  5DSS B;  1BAR A;  1FMM S;  4G6J A;  1IIL A;  3HSM A;  1EPW A;  4IHZ A;  1BAS A;  1IRP A;  4I4U A;  1K5U A;  1T9F A;  2NS2 A;  4GAF A;  4J2Y A;  3UDA A;  1QQK A;  4I4Q A;  3KMV A;  4X3A A;  1DZC A;  2MLL B;  1AVW B;  3PG0 A;  3IM6 A;  2ERM A;  4H75 A;  4G9N A;  4LO1 C;  1ABR B;  4GOV A;  3UJ0 A;  3HMY A;  3OJM A;  3FJF A;  3S8J A;  4XFS A;  4JAW A;  3ZC8 A;  1JT7 A;  2VU9 A;  3AKG A;  2HW9 A;  1JY0 A;  1DFQ A;  1EYL A;  4I4P A;  3BA5 A;  4OWL A;  1WD4 A;  4LO3 C;  4P0L A;  4ZA3 B;  2F2F A;  5D61 A;  4XKI A;  3WO3 A;  3IM5 A;  4I4O A;  1XHB A;  2D44 A;  1FV3 A;  2HWA A;  1BFC A;  5FNX A;  2NYY A;  2LIE A;  1SR4 C;  3BAQ A;  1DFC A;  4LO2 A;  5JLV A;  3O4B A;  1PZZ A;  4P6A A;  4LO0 A;  5EG6 C;  3FJE A;  1AXM A;  4OWJ A;  4D8H A;  2Q3N B;  2Z49 A;  2RG9 B;  2ZQN A;  3IAG C;  3C9Z A;  4END A;  3A21 A;  1BFB A;  1K5V A;  3AZW A;  3CRI A;  4ZOT A;  2NM1 A;  2DRZ A;  1Z4S A;  3HN1 A;  4X37 A;  4D0T A;  1HWO B;  2D1Z A;  3Q7X A;  3H6Q A;  5BP5 A;  3WO4 A;  5F90 A;  3CRH A;  3VWC A;  5DVH A;  1IRA X;  2AQZ A;  4G6M A;  3BTA A;  1M2T B;  3OBR A;  3RMY A;  2D7I A;  3MPP G;  4ZFY B;  2ZQO A;  4I4S A;  5F8W A;  1S0D A;  4I7I A;  3O49 A;  1IT0 A;  3H6S E;  4IZX A;  4JKQ A;  2NP0 A;  4KEI A;  4P0J A;  1BLA A;  1QXM A;  4USO A;  4I4V A;  1N4K A;  4EFR A;  1HCD A;  2D24 A;  2F2F C;  1PC8 B;  1TIE A;  5BQU C;  1AFC A;  4OEE A;  3ZXD A;  1S0L A;  5BXS A;  2NVH A;  1NUN A;  4A7K A;  3FJB A;  4LO2 C;  1V6W A;  2P39 A;  4I6I A;  4LO0 C;  4II0 A;  3UD8 A;  1V6U A;  2M49 A;  2XOA A;  5F8S A;  1AVA C;  3O4O A;  3VUO A;  1RG8 A;  4PC4 A;  3CRG A;  1AVU A;  4OUJ A;  4I96 A;  3W9T A;  1W3A A;  1E0O A;  3A23 A;  3K1X A;  3BAO A;  3AJ5 A;  9ILB A;  31BI A;  3I2A A;  4QD2 B;  3ILA A;  5BP5 C;  3POK A;  7I1B A;  4DCK C;  1TP0 A;  1Z2V A;  3NBE A;  1YTO A;  5F8Y A;  1NZK A;  1VCL A;  2RQ9 A;  2VXT I;  4WBC A;  1TWE A;  1DQG A;  3F62 B;  1Q04 A;  2IWT B;  21BI A;  2VXR A;  4EFQ A;  3VSF A;  4I4Y A;  4ZBV B;  3RTJ B;  3NBN A;  4G9M A;  1J0S A;  3FUQ A;  1WBC A;  3I29 B;  4LO7 C;  2X2S A;  1S0E A;  1G9B A;  3N7J A;  1TOO A;  4XFT A;  3BAH A;  1BFF A;  4R6U B;  4KC3 A;  1HWM B;  3LLP A;  1CE7 B;  2NZ9 A;  3LTQ A;  1YYN A;  5D63 A;  2Y9X E;  2DRE A;  3VSZ A;  1GGP B;  1RY7 A;  1EV2 A;  5I1B A;  3P6J A;  4LO7 B;  3R4S A;  1PWA A;  2HZ9 A;  1W3G A;  5BQU A;  1F31 A;  1YF8 B;  1V6X A;  1T4Q A;  3CQA A;  1ONK B;  2KLL A;  3HBW A;  2L5X A;  1UPS A;  2NTD A;  1BFG A;  1HCE A;  2KH2 A;  2ET2 A;  4IYB A;  3TC2 A;  1RML A;  1XG6 A;  2AFG A;  3AKH A;  3AH1 A;  2R9K B;  3PHZ A;  1OQL B;  1XYF A;  3QR5 A;  4I2S A;  4L4I A;  1G82 A;  4QC4 A;  1HIB A;  1RZO B;  2WBC A;  4I37 A;  2MC2 A;  2UUS A;  1BLD A;  3CA5 A;  1JLX A;  3FUO A;  6I1B A;  3JUT A;  4IZE A;  5D62 A;  2WRY A;  3H6R A;  3O5W B;  1JT3 A;  1MD6 A;  5FZU A;  3AKI A;  2MIB A;  1YXW A;  1P63 A;  1KNM A;  1L2H A;  3S8K A;  1DQO A;  3CA6 A;  2X2T A;  3OJ2 A;  2DS0 A;  4IY9 A;  4EB2 B;  3FGM A;  3AH2 A;  2BEB A;  3FJD A;  1WD3 A;  1ISW A;  3Q7Y A;  2Q9X A;  3B9U A;  4AN6 A;  4MZG B;  3V0A A;  1FWU A;  4HR6 C;  1JT5 A;  4QKS A;  1TFM B;  4OEG A;  2HWM A;  3E8L C;  4QD2 C;  2QYI B;  3FJC A;  3OBT A;  41BI A;  4EEE B;  5EHA A;  3BAG A;  2F8X C;  5BOW A;  2K4A B;  1JLY A;  3BB2 A;  1WBA A;  1I1B A;  4GAI A;  3OJV A;  1FGA A;  3NBC A;  3D7W B;  8I1B A;  1FN0 A;  1XZZ A;  3V79 C;  2KKI A;  4FVV A;  2D43 A;  4QBC A;  3R4U A;  5E24 E;  1I1E A;  3BRG C;  2VLC A;  3RSJ A;  4D0Z A;  4YOL A;  3FJ9 A;  4QO3 A;  1G9D A;  5HPZ A;  3PME A;  4J2K A;  2VSA A;  2AAI B;  1CVS A;  2IHO A;  4J23 B;  4X39 A;  4EFP A;  3N0K A;  3WIN A;  1JTC A;  2J3P A;  5GAQ A;  3WA1 A;  3CAH A;  1HKN A;  2GZB A;  3O44 A;  1HWP B;  1ISX A;  1DZD A;  4JPZ A;  4I4X A;  4ISR A;  1IJT A;  4ZLB B;  4HA2 A;  2BFH A;  2K8R A;  3FJJ A;  3UD7 A;  1AF9 A;  3P53 A;  1QQL A;  4MZF B;  1ISZ A;  3ZC9 A;  3N7L A;  3FJ8 A;  3ZXG A;  4J2X A;  3A07 A;  3T8S A;  5BXR A;  3MAL A;  4KEK A;  2LIQ A;  5BVP I;  3NBD A;  1FWV A;  3BA7 A;  1G9A A;  2ZR1 B;  1JT4 A;  4DEN A;  3H6R B; 
#chains in the Genus database with same CATH homology
 3I2X A;  4OW4 A;  4XFU A;  3RTI B;  1FMZ A;  4ZFW B;  2D22 A;  3CA3 A;  2VSE A;  2GO2 A;  3OGF A;  4Q9P A;  3EF2 A;  5DZU A;  3BRD A;  2FO1 A;  4GP3 A;  2DRY A;  2Y9F A;  3ZX7 A;  4EKX B;  1D0H A;  4LO8 B;  4QKR A;  4Z9W B;  4HJJ A;  1S0B A;  1Q1U A;  3V0A B;  2I1B A;  3RMX A;  3CA4 A;  4TLP A;  1R8N A;  4AN7 B;  4GOY A;  1DIW A;  3WIN C;  3CA0 A;  1A8D A;  3WMU A;  4JKX B;  1IHK A;  3BX1 C;  1ILR 1;  3Q7W A;  4J2S A;  2Z48 A;  4F83 A;  2BEA A;  3VT1 A;  4X38 A;  4Q91 A;  4ZKT B;  2FFU A;  3VEQ A;  1S0G A;  2Y9G A;  3HAL A;  1Z0H A;  3CU1 B;  1ISV A;  3NJ5 A;  2D7R A;  3F1R A;  4F34 A;  1BA7 A;  5FNW A;  3O3Q A;  3P6I A;  5B2H A;  2E4M A;  4KEJ A;  2AXM A;  3CA1 A;  3IM7 A;  1TTU A;  5BXT A;  3FJK A;  2FDB M;  1R8O A;  3AKF A;  4IQP A;  3OGG A;  2QN4 A;  4A7Y A;  4I4R A;  4JQ0 A;  1MC9 A;  4ISQ A;  3BAV A;  3V0B B;  4H9W A;  1PUU B;  3N7M A;  4I1B A;  4JRA A;  5DUY A;  1TWM A;  4I3N A;  5JMC A;  2ESU A;  3FJA A;  3QYD A;  4ZGR B;  3N7K A;  3VT2 A;  1EVT A;  4GP0 A;  1FV2 A;  3WMV A;  1PUM B;  1DJS B;  3AJ6 A;  3O4C A;  4L4H A;  1II4 A;  4P0K A;  1AVX B;  4OWK A;  4QAL A;  2Y9W C;  3AH4 A;  3FJH A;  4USP A;  2FGF A;  2K43 A;  1SZ6 B;  2YUG A;  4MZH A;  3PUB A;  4Q9G A;  5G00 A;  1FQ9 A;  3O4A A;  3AZV A;  3SNV A;  2VUA A;  3HOM A;  3JRR A;  4OEF A;  4Z8S B;  3UD9 A;  4G1R A;  3BRF A;  4I1E A;  3BAD A;  1IOB A;  4ZFU B;  3BA4 A;  4JP0 A;  5BXP A;  3A22 A;  4KBB A;  2P23 A;  3FFZ A;  1ITB A;  3UJ4 A;  4LO1 A;  2E4M C;  1YBI A;  4H04 A;  4DEP A;  5FZY A;  5FZZ A;  4UY4 A;  4ION A;  1S0F A;  2KI4 A;  2FFV A;  1Q03 A;  1ISY A;  4CJM A;  2RST A;  4I8M A;  2D23 A;  3O4D A;  4LO3 A;  3V0B A;  3IIR A;  4I0Y A;  2KI6 B;  1W3F A;  3BAU A;  1S0C A;  1V6V A;  3VT0 A;  5EC5 A;  4FGF A;  2D20 A;  3FJI A;  4QBV A;  4A7Z A;  1JQZ A;  1SR4 A;  4IY8 A;  1G9C A;  3WO2 A;  1HWN B;  1M16 A;  1DLL A;  5DSS B;  1BAR A;  1FMM S;  4G6J A;  1IIL A;  3HSM A;  1EPW A;  4IHZ A;  1BAS A;  1IRP A;  4I4U A;  1K5U A;  1T9F A;  2NS2 A;  4GAF A;  4J2Y A;  3UDA A;  1QQK A;  4I4Q A;  3KMV A;  4X3A A;  1DZC A;  2MLL B;  1AVW B;  3PG0 A;  3IM6 A;  2ERM A;  4H75 A;  4G9N A;  4LO1 C;  1ABR B;  4GOV A;  3UJ0 A;  3HMY A;  3OJM A;  3FJF A;  3S8J A;  4XFS A;  4JAW A;  3ZC8 A;  1JT7 A;  2VU9 A;  3AKG A;  2HW9 A;  1JY0 A;  1DFQ A;  1EYL A;  4I4P A;  3BA5 A;  4OWL A;  1WD4 A;  4LO3 C;  4P0L A;  4ZA3 B;  2F2F A;  5D61 A;  4XKI A;  3WO3 A;  3IM5 A;  4I4O A;  1XHB A;  2D44 A;  1FV3 A;  2HWA A;  1BFC A;  5FNX A;  2NYY A;  2LIE A;  1SR4 C;  3BAQ A;  1DFC A;  4LO2 A;  5JLV A;  3O4B A;  1PZZ A;  4P6A A;  4LO0 A;  5EG6 C;  3FJE A;  1AXM A;  4OWJ A;  4D8H A;  2Q3N B;  2Z49 A;  2RG9 B;  2ZQN A;  3IAG C;  3C9Z A;  4END A;  3A21 A;  1BFB A;  1K5V A;  3AZW A;  3CRI A;  4ZOT A;  2NM1 A;  2DRZ A;  1Z4S A;  3HN1 A;  4X37 A;  4D0T A;  1HWO B;  2D1Z A;  3Q7X A;  3H6Q A;  5BP5 A;  3WO4 A;  5F90 A;  3CRH A;  3VWC A;  5DVH A;  1IRA X;  2AQZ A;  4G6M A;  3BTA A;  1M2T B;  3OBR A;  3RMY A;  2D7I A;  3MPP G;  4ZFY B;  2ZQO A;  4I4S A;  5F8W A;  1S0D A;  4I7I A;  3O49 A;  1IT0 A;  3H6S E;  4IZX A;  4JKQ A;  2NP0 A;  4KEI A;  4P0J A;  1BLA A;  1QXM A;  4USO A;  4I4V A;  1N4K A;  4EFR A;  1HCD A;  2D24 A;  2F2F C;  1PC8 B;  1TIE A;  5BQU C;  1AFC A;  4OEE A;  3ZXD A;  1S0L A;  5BXS A;  2NVH A;  1NUN A;  4A7K A;  3FJB A;  4LO2 C;  1V6W A;  2P39 A;  4I6I A;  4LO0 C;  4II0 A;  3UD8 A;  1V6U A;  2M49 A;  2XOA A;  5F8S A;  1AVA C;  3O4O A;  3VUO A;  1RG8 A;  4PC4 A;  3CRG A;  1AVU A;  4OUJ A;  4I96 A;  3W9T A;  1W3A A;  1E0O A;  3A23 A;  3K1X A;  3BAO A;  3AJ5 A;  9ILB A;  31BI A;  3I2A A;  4QD2 B;  3ILA A;  5BP5 C;  3POK A;  7I1B A;  4DCK C;  1TP0 A;  1Z2V A;  3NBE A;  1YTO A;  5F8Y A;  1NZK A;  1VCL A;  2RQ9 A;  2VXT I;  4WBC A;  1TWE A;  1DQG A;  3F62 B;  1Q04 A;  2IWT B;  21BI A;  2VXR A;  4EFQ A;  3VSF A;  4I4Y A;  4ZBV B;  3RTJ B;  3NBN A;  4G9M A;  1J0S A;  3FUQ A;  1WBC A;  3I29 B;  4LO7 C;  2X2S A;  1S0E A;  1G9B A;  3N7J A;  1TOO A;  4XFT A;  3BAH A;  1BFF A;  4R6U B;  4KC3 A;  1HWM B;  3LLP A;  1CE7 B;  2NZ9 A;  3LTQ A;  1YYN A;  5D63 A;  2Y9X E;  2DRE A;  3VSZ A;  1GGP B;  1RY7 A;  1EV2 A;  5I1B A;  3P6J A;  4LO7 B;  3R4S A;  1PWA A;  2HZ9 A;  1W3G A;  5BQU A;  1F31 A;  1YF8 B;  1V6X A;  1T4Q A;  3CQA A;  1ONK B;  2KLL A;  3HBW A;  2L5X A;  1UPS A;  2NTD A;  1BFG A;  1HCE A;  2KH2 A;  2ET2 A;  4IYB A;  3TC2 A;  1RML A;  1XG6 A;  2AFG A;  3AKH A;  3AH1 A;  2R9K B;  3PHZ A;  1OQL B;  1XYF A;  3QR5 A;  4I2S A;  4L4I A;  1G82 A;  4QC4 A;  1HIB A;  1RZO B;  2WBC A;  4I37 A;  2MC2 A;  2UUS A;  1BLD A;  3CA5 A;  1JLX A;  3FUO A;  6I1B A;  3JUT A;  4IZE A;  5D62 A;  2WRY A;  3H6R A;  3O5W B;  1JT3 A;  1MD6 A;  5FZU A;  3AKI A;  2MIB A;  1YXW A;  1P63 A;  1KNM A;  1L2H A;  3S8K A;  1DQO A;  3CA6 A;  2X2T A;  3OJ2 A;  2DS0 A;  4IY9 A;  4EB2 B;  3FGM A;  3AH2 A;  2BEB A;  3FJD A;  1WD3 A;  1ISW A;  3Q7Y A;  2Q9X A;  3B9U A;  4AN6 A;  4MZG B;  3V0A A;  1FWU A;  4HR6 C;  1JT5 A;  4QKS A;  1TFM B;  4OEG A;  2HWM A;  3E8L C;  4QD2 C;  2QYI B;  3FJC A;  3OBT A;  41BI A;  4EEE B;  5EHA A;  3BAG A;  2F8X C;  5BOW A;  2K4A B;  1JLY A;  3BB2 A;  1WBA A;  1I1B A;  4GAI A;  3OJV A;  1FGA A;  3NBC A;  3D7W B;  8I1B A;  1FN0 A;  1XZZ A;  3V79 C;  2KKI A;  4FVV A;  2D43 A;  4QBC A;  3R4U A;  5E24 E;  1I1E A;  3BRG C;  2VLC A;  3RSJ A;  4D0Z A;  4YOL A;  3FJ9 A;  4QO3 A;  1G9D A;  5HPZ A;  3PME A;  4J2K A;  2VSA A;  2AAI B;  1CVS A;  2IHO A;  4J23 B;  4X39 A;  4EFP A;  3N0K A;  3WIN A;  1JTC A;  2J3P A;  5GAQ A;  3WA1 A;  3CAH A;  1HKN A;  2GZB A;  3O44 A;  1HWP B;  1ISX A;  1DZD A;  4JPZ A;  4I4X A;  4ISR A;  1IJT A;  4ZLB B;  4HA2 A;  2BFH A;  2K8R A;  3FJJ A;  3UD7 A;  1AF9 A;  3P53 A;  1QQL A;  4MZF B;  1ISZ A;  3ZC9 A;  3N7L A;  3FJ8 A;  3ZXG A;  4J2X A;  3A07 A;  3T8S A;  5BXR A;  3MAL A;  4KEK A;  2LIQ A;  5BVP I;  3NBD A;  1FWV A;  3BA7 A;  1G9A A;  2ZR1 B;  1JT4 A;  4DEN A;  3H6R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...