2Y9TA

Structural basis of p63a sam domain mutants involved in aec syndrome
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
GSYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of P63Alpha Sam Domain Mutants Involved in Aec Syndrome.
pubmed doi rcsb
molecule keywords TUMOR PROTEIN 63
molecule tags Apoptosis
source organism Homo sapiens
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2y9tA00
2QB1A 1JI7A 1SV4A 4NL9A 3BS5B 2DL0A 2GLEA 2B6GA 2FE9A 1SV0A 3K1RB 4PZNA 5L1MA 2DKXA 1SXEA 5KNIA 2Y9TA 5J8YC 1Z1VA 1DXSA 2EAPA 2D8CA 5JTIA 2F44A 1SGGA 1LKYA 3SEIA 4IS7A 1UCVA 1WWUA 3TADC 5JU5A 1SXDA 1F0MA 1V85A 2LPEA 3SENA 4MHVA 2ESEA 2YTUA 2KSOA 2QKQA 3KKAA 2F8KA 1LKYB 2EAOA 4NL9C 1SV0C 1PK1A 1B4FA 1X40A 1OW5A 1UQVA 3IDWA 2QARA 3TACB 2K4PA 3KKAC 2E8OA 1B0XA 1V38A 3BS7A 4RQNA 2KSOB 4PZOA 1OXJA 2ES6A 4NJ8A 2QB0A 1WWVA 1PK3A 5JRTA 2KMDA 2E8PA 2E8MA 2EAMA 3BQ7A 1PK1B 1KW4A 5J8YA 3HILA 2Y9UA 2QARB 5F3XB 2DKZA 1X9XA 2EANA 2KE7A 4RQMA 2K60A 2LMRA 2F3NA 3BS5A 1RG6A 2KIVA 1COKA 2QB0B 3TADA 2L5YA 2E8NA 1X66A 2D3DA 3H8MA 2JV3A 2KG5A
chains in the Genus database with same CATH superfamily
4UATA 2IOFK 3ETLA 4CF3A 4JB3A 2WF5A 3OHBA 3PV8A 5B5EU 1XSLA 5FP0A 1X6IA 4DL6A 4PPXA 2VANA 3I76A 8ICNA 3RBDA 2BPFA 3M1YA 3SR6A 1NJZA 3GV5B 2XY5A 4OO1J 5CRXA 1WWUA 2G08A 1T8EA 4J03A 1Q8KA 1COOA 5AICA 2VJ4A 3UQ2A 3MGVA 4EYHB 3RJGA 3V6JA 2XY7A 4Y2QA 2A1JB 4CF4A 2ASLA 1ZQ1C 1Z00B 4O5KA 2WTFA 2J6TA 4P0QA 2HBKA 4FBUA 5D46A 3LWMA 8ICUA 1OW5A 4M0AA 7ICEA 3TAPA 4A8EA 2YB4A 4BWJA 3Q8QB 1S10A 2WB1C 5ALWA 3GQCA 3FAHA 4YR0A 2UVUA 1PK1B 3BQ7A 1ZQPA 2EDUA 3LK9A 4Q45A 3AL0B 4QZHA 3HP6A 2K60A 5KG1A 2J6SA 2MU2A 2W7OA 3PNCA 2I1QA 3M9MB 3HW8A 4K4HA 1NJWA 7ICPA 4XA5A 3HKZF 5KAIU 4YP3A 1PVPA 4EENA 3MBYA 4YD1A 7ICUA 2KICA 4RUCA 2PFOA 1VDVA 3BS5B 3HPOA 4YD2A 4C4RA 3ZD8A 5A0LA 5KFEA 4QZCA 4LZDA 3KZXA 5KG3A 4EZ9A 2YB1A 2D8CA 2AH5A 4DQSA 5AI5A 1KKXA 5GTHU 7ICKA 5AK6A 3MFIA 5DKWA 2PMZF 3H0MB 3RJFA 4HYKA 3RRGA 4I27A 4GXKA 3ZDBA 4KN7A 2B0CA 4OJLA 2VIXA 4B9TA 4EBEA 4BWMA 8ICWA 2LPEA 5ALTA 1Z4OA 5KFOA 2W55A 5KFQA 1K5OA 4RNNA 3SAHA 4RPYA 3V7JA 1A76A 4US8A 1B4FA 1X40A 2KV2A 2R8JA 1DGSA 1ZD2P 1ZRMA 1O08A 3PY8A 3NUQA 3TACB 2ZJ8A 1VJ5A 3HKZC 4IQVA 2C2DA 4QWCA 2J6UA 3V7LA 2YN4A 8ICKA 3VCBA 4DSLA 5AKJA 4PL2A 1L5UA 4P0QB 4DFKA 4B6JA 5J8YA 4JV2A 1KN5A 5CHGA 5J2KA 1SZPA 5KFKA 3LWLA 3OTQA 2BQRA 4RQ4A 4P0PA 4F71A 1N2XA 5KFBA 5AI6A 2HBLA 5ALRA 5BPCA 2XCAA 5IINA 3Q8PB 2FPLA 5HR7A 4QIWF 5ALDA 3C21A 4RT3A 1KL9A 5DLFA 1XU4A 4MFAA 2I9GA 3I1YA 4NL9A 5DLGA 1JROA 4DLEA 2DF4B 2LYAA 4QWAA 3Q8KA 2P6UA 4OD0A 2EZZA 2XIDA 5DB6A 4YR3A 4IQUA 2A19A 5ALVA 4DOBA 3TARA 3WK4A 4DQIA 4RQ1A 2W54A 2KK0A 4CNQA 2HVHA 4F5RA 1D9FA 1ZQUA 3N4MB 3ICXA 2G07A 1L7PA 4Y2RA 2YY6A 4C8LA 2W9BA 4DL5A 3QUCA 3PW0A 2NV3A 1X2IA 4I29A 2KN7A 4J9NA 4F5PA 4NLBA 8ICZA 2KJ9A 5GTIU 2QKQA 3MDCA 2F8KA 4C8OA 5CR0A 3PX6A 4O5CA 1L8LA 4Z6DA 3SAGA 5J0UA 2XI9A 3E58A 1RQNA 4QZIA 1X6JA 3HT3A 4QZAA 5ALHA 2GOLA 2KVCA 2BQ3A 3LVWA 4DQQA 1NK4A 2F76X 1ZOLA 2BDUA 3PMLA 3RTVA 3PW4A 5DG8A 4F3OA 4KX5A 4YXJA 5KFNA 2EAMA 3N7SC 4GC6A 4FS2A 2KKPA 3Q8SB 1N56A 3H0RB 2Y1JA 2LM1A 4YXMA 1TAUA 5ALIA 3MR5A 3FYHA 1COKA 1D8BA 2AQ4A 4U6PA 3BQ0A 1NK9A 2H3VA 3DDHA 4CRXA 3C2LA 2DPJA 1MQ2A 5J2BA 2HHVA 5AM5A 3ZDCA 2IMWP 3T5HA 4ZH4A 4JMUA 4P0PB 4J9RA 5J29A 4I2EA 1S77D 4KITB 2FE9A 2ALZA 4C8MA 3UQ0A 4PH5A 1N60A 9ICBA 1JMSA 1KFDA 4P4PA 2HI0A 1PVRA 2W8LA 1Q3VA 1T3QA 1LKYA 1IXRA 4F4XA 3IRUA 3OGUA 1RPLA 4F2SA 4IC9A 4F2RA 3RB4A 4ECXA 1PVQA 1HEKA 1KRPA 4PHDA 4NM1A 5AM0A 8ICXA 3LYSA 4J9QA 2LKYA 4EX7A 3BQTA 2W9BB 4EZ6A 1BPEA 3C1ZA 5C0YA 3U26A 2RRDA 1NK6A 9ICTA 4PJ0U 5DG7A 3RRHA 4BGDA 1ZQCA 4FS1A 4RQ0A 5IILA 1WG8A 4IR1A 2FLPA 1KTQA 4GC7A 2KMDA 1NKCA 3AN1A 5D4BA 5ALNA 3BJYA 2FPKA 5CB1A 3UMGA 3ISCA 5KG2A 5KT5A 4QWDA 4J9KA 2C28A 5IIKA 3G6XA 1YT3A 4M04A 4RQ8A 4DOAA 4F5NA 4Y2JA 1S76D 1HUZA 1NK5A 5G5HA 1SV4A 2ZTCA 1N5XA 4NLNA 1NZBA 1D8LA 5KFAA 2KZ3A 4FE3A 5D49A 5DQHA 2B6GA 4XUSA 3BDPA 5J0XA 2XY6A 1C20A 3PX0A 4KLJA 1SXEA 2IOHA 5J0PA 8ICAA 3CNHA 2W9AA 2HOFA 4PGYA 2BDPA 3ZD9A 1S0NA 2IA6A 4UAVA 1S0MA 2FMSA 2F44A 3UM9A 2FLNA 3PSTA 4RQ6A 4JWMA 1S0VA 1IIPA 2G0AA 1TK8A 3EW9A 2O6KA 2KIWA 3SENA 2XO7A 1KSPA 3N7PD 2JR5A 1QCKA 1U9LA 3AQEA 1LKYB 2KKVA 3LVVA 4GLXA 3N97B 3E2EA 3C29A 4DL3A 1ZYQA 5AKYA 1U47A 2AQ0A 5KFCA 1JRPA 2V9WA 3H4BA 3TKAA 9ICSA 4ED8A 1U49A 3SZ2A 3V6HA 4DSFA 2KFNA 4CGZA 2CXYA 1WWVA 3KHHA 5KT6A 8ICOA 2Y9UA 2PKEA 5CWRA 2A3VA 5ALOA 2E5SA 3RAQA 2EANA 3A0HU 3WKAA 1KFTA 1RZTA 4LJXA 4Q43A 1UA0A 3AMZA 3N7RC 4RQ2A 2LM4A 1TK5A 1ZJNA 4OJ5A 2AGQA 4ED3A 2IOFA 1RXWA 4BUGA 4RNOA 3VC8A 2GLEA 7ICMA 1K1SA 1SV0A 2DGZA 2HHXA 1UA1A 9ICHA 2DKXA 4DF8A 4UB4A 4F93B 5J0OA 1Q46A 3IG8A 4QW8A 4US9A 2AGPA 2FMPA 2KFZA 2W9MA 3RH6A 5HHHA 3RR7A 2HHTA 4B9NA 3EPGA 2WB1F 1UCVA 4J9LA 4Z6CA 4IQWA 8ICHA 3TADC 5ALUA 4C4TA 1SXDA 1V85A 2NRTA 4XQ8A 4O3NA 3WK9A 4WJ3B 1V97A 2MSNA 1RXVA 4DQPA 5AI0A 3RB6A 3HX0A 4YMOA 4GFJA 5KTQA 4GXJA 2XCPA 1YZ6A 5KG4A 4UQGA 2BPGA 4DFMA 3FDSA 3Q8LA 9ICOA 3JPPA 3F5AA 4DLGA 4I2IA 7ICJA 4I2BA 1KFSA 2G5HB 7ICRA 1V38A 4YMNA 1TKDA 5KT3A 4R63A 5AKZA 1XSNA 8ICVA 4KLUA 1JALA 3THVA 1HUOA 2GWSA 1TAQA 4M6WA 2P35A 4I2GA 2DBYA 2W9CA 1NK7A 5ALQA 1LV5A 4KN4A 2IBKA 5AI4A 2MUTA 3RFAA 5KT4A 3GILA 5IIIA 3GIJA 8ICBA 3Q8MA 4MF2A 2AHOB 1ZQVA 2GH1A 5AI9A 4OJPA 1ZQZA 2JGAA 4TUPA 7ICSA 4NLGA 4X5VA 9ICIA 3JPRA 4O3PA 2DFLA 3H8SA 3GV7B 3WKEA 3A0BU 2PFNA 2EH9A 3K4GA 3FC4A 3RJHA 2KHQA 4LZGA 4RPZA 5L1JA 4ZOHC 4FO6A 9ICUA 4R66A 3F53A 5HNKA 7ICOA 1RYRA 5AM4A 2KVSA 4RT2A 2XC9A 3D6JA 4UASA 4TUQA 2RHFA 1X42A 3GFKB 1ZQLA 2ZJ5A 1QH9A 2NRZA 3ETRA 2KD1A 4Y2PA 5ALPA 2YMLA 3KHRA 1URJA 2R18A 2E1EA 2KHVA 1ZQKA 1XNSA 8ICEA 2KSOA 3MFHA 4ELVA 5BOLA 5H2FU 4C8NA 3LDAA 1FFVA 3C23A 1ZD4A 2FI1A 7ICHA 4O5EA 2HHQA 1V9PA 4F91B 5L1KA 3QX7A 5EE9A 4GXIA 4DQRA 4UB2A 3QZ7A 1S0OA 2ZTEA 3ZDDA 5KFHA 3GIKA 8ICCA 1ZQMA 3RAXA 2JEJA 5KG5A 4BXOA 5KFJA 3HILA 1DK3A 1NKBA 2E1FA 3JPSA 4J9OA 1A6SA 3M7DA 3WK5A 1BPZA 1QQ7A 1ZQEA 1JUDA 2F3NA 4DSKA 2BKEA 2BCRA 2KIVA 4UARA 5KFWA 3D2NA 1NNLA 3TANA 3OJSA 3ISDA 4M6WB 4DCCA 2W9CB 4M9HA 3NVYA 4Y2SA 1ZQYA 4NM2A 1NJXA 4U7CA 4EEYA 2MUTB 4O0IA 4ECRA 4M9LA 9ICRA 1RM6C 2DUYA 3K1ZA 5EE0A 5AM1A 5AKXA 4PZNA 5KNIA 1TAMA 3QNMA 1MQ3A 1IM4A 1N63A 4FZNA 5AIBA 1ZQSA 4R65A 2ZXHA 1CEZA 4YMMA 2JRZA 2CN1A 5KAFU 4M9JA 2EQYA 3H8JA 4EEKA 2G06A 5ALZA 1ZQGA 5KFYA 2FDRA 4KTQA 4ED7A 3QXGA 9ICAA 1JXEA 5ALLA 2OXOA 4Y2UA 4DO9A 5DB7A 3KOOA 3RJKA 2OYYA 5KG6A 5ALXA 3WK6A 2LHTA 9ICCA 1Z4NA 4OCZA 2ZTDA 5DB9A 2ODGA 2WHEA 2H3IA 1BPYA 4DL7A 4G3IA 4ELTA 2KSOB 4C7ZA 2XGQA 3V7KA 4NJ8A 3L4PA 5KG7A 2ISPA 5JRTA 1T7PA 2H3FA 2E8MA 4JK1A 1QSYA 4YR2A 1SKWA 5IIJA 2G5IB 2PI5A 3PO4A 4RQMA 3R9KA 3CRXA 8ICRA 1ZD3A 3QU4A 2ZUBA 3MR6A 2V4RA 9ICJA 5KT7A 4F8RA 4NV0A 3Q8RB 1X66A 3H8MA 4BXOB 4AYBF 2F77X 1S97A 3WK8A 4DL2A 4E0DA 3IG5A 3H8WA 1TE2A 5AI8A 2QB1A 1QSLA 1TV9A 1ZQTA 1VLBA 3DV9A 3M8RA 3S6JA 9ICLA 1ZRNA 3CW2C 3TQ1A 4UB3A 1B22A 2N1RA 5EWGA 4DWIA 1ZETA 4CCHA 4O3MA 2EAPA 3KZIU 4F4WA 3SV3A 5TZVA 2RDJA 4IS7A 3HRDD 2ZIVA 4ECSA 4C8KA 3HWTA 3SI8A 2V4QA 2F1HA 1TVAA 1JXLA 1ZD5A 4DS5A 3RH5A 5DDMA 2YTUA 2YMPA 4O9MA 1FIQA 5IIMA 2AXTU 2OHFA 2C2RA 5HR6A 4UBCA 5KFXA 1J97A 9ICQA 3PSIA 5IIOA 1ZQRA 4KMUA 1UQVA 2M9NA 2QARA 3CP8A 5EWFA 2ISOA 2PFPA 1JN3A 3UXNA 4AYBC 3V6KA 3B0XA 5L9XA 4RQNA 2BCSA 5AKGA 9ICPA 1ZQIA 2DPIA 2P6RA 4NLKA 1L3SA 2QLTA 4KLGA 1ZJMA 2BZFA 2DKZA 3M6KA 8ICYA 2F1IA 2KE7A 4Y2YA 3KBBA 1SKRA 1HJPA 2YX8A 2BCVA 2ZXIA 1L3VA 3QUQA 5EE3A 3WKDA 5DG9A 3CYMA 1KDHA 1D8YA 2JV3A 3B9JA 4K4IA 4UB6U 1M6YA 5KFUA 4FZMA 1U4BA 4F5QA 1H38A 4RQ5A 4I2AA 1N48A 4Y2XA 3RR8A 2KEYA 7ICIA 4K4GA 3M9OB 1ZQWA 2A1AA 2R8HA 4O3QA 3OSNA 4KLFA 5AKKA 4Z6FA 7ICLA 4KX3A 3BZCA 5ALFA 4ECUA 2XVTA 2FLLA 4C80A 3KHLA 3T5LA 1NJYA 2OEHA 1F0MA 5F9NA 2HHSA 5L1IA 8ICPA 3TFRA 4MHVA 5ALEA 4DEZA 3RJEA 1RQLA 2EAOA 9ICXA 2JH7A 2ZIVB 2UVWA 5J0WA 2R8KA 4EX6A 4F4ZA 2LYBA 5CA7A 4KLMA 4AP9A 5DDYA 5L1LA 4RZRA 2ZIUA 4NXZA 3BS7A 1QSSA 4JV0A 1LB2B 3F2CA 1SZHA 2LYHA 2WAQC 4PHPA 4QWEA 2QARB 4F72A 1FO4A 2MRLA 4JWNA 3RB3A 3H4DA 1QTMA 1UHUA 1MSWD 1T94A 2DWQA 1RG6A 2Y1IA 5AM3A 2AU0A 2K8AA 3AU2A 1QLNA 4QW9A 3GU3A 7ICVA 4F4KA 1N62A 5J2IA 4I2FA 5AM2A 3PO5A 5HHIA 2K4HA 5JUMA 3TI0A 2P66A 2HOIA 1F44A 3ISBA 2KJ5A 5DBBA 4QZBA 3UMBA 3M9NB 1N5WA 2Q0ZX 2C22A 5CP2A 2Y9TA 1DOQA 2NO4A 5J8YC 1BNOA 1DXSA 4IL6U 5KG0A 1LVHA 2NRWA 3UMCA 4FZLA 3EYZA 2EZXA 2WF6A 4KLSA 3PX4A 5ALSA 9ICKA 3NS1A 1NOMA 4RQ7A 1ZQXA 1Z3EB 2JHDA 4KLHA 2BHNA 4NL9C 3ZDAA 3PW2A 2FMQA 4DSJA 2WFAA 3KD3A 3H0LB 3MGIA 4PHAA 4Z6EA 1L6NA 3QU2A 3C2KA 1Z19A 1Z1BA 3PMNA 3WK7A 3EPIA 3MR2A 2MA1A 1BNPA 4KLIA 5DBCA 1ZQBA 1CUKA 2K8BB 2H5XA 3EUB2 4ECYA 1ED1A 3NVZA 2HOQA 2EZYA 4YFKA 2HDOA 5KFMA 4P4MA 1WUDA 1ZXIA 4F5OA 1SWVA 3E0FA 2W3RA 5J2FA 4KLEA 2E3TA 2CRXA 2Y0SC 3WU2U 4USAA 4MF8A 5ALMA 2ZIUB 2YQEA 1DRGA 1BPDA 5BOMA 3MC1A 1AQ6A 2WF9A 2NRVA 1S8OA 2L5YA 2ZG6A 4TUSA 2F2AB 1KLNA 2KTQA 5KFZA 4ECQA 4Q8EA 5DQIA 3ALRA 2HBJA 1IV8A 4JUZA 5EE1A 2BR0A 2JEIA 3PW7A 3IP4B 5ALKA 9ICMA 1XWLA 2BCUA 1XO1A 1SL2A 4TURA 5KFDA 2D6FC 1NKEA 2W7PA 1Z1VA 3QUBA 7ICTA 1SWWA 3K75D 2B21A 3H7IA 7ICNA 1RYUA 1OUQA 9ICGA 2OH2A 4QJFB 3AU6A 4DSIA 1UT5A 4B9LA 4OJ6A 3O0FA 2WF8A 4QNLA 3OJUA 1S9FA 3T5KA 4Q44A 1DGJA 4C7YA 2NO5A 1KQQA 1FEZA 4UB8U 1PUZA 2Q4TA 5KFPA 3V72A 5TISU 9ICVA 3KKAA 2K4IA 4CE6A 1ZQAA 3SQIA 4IQTA 3F2DA 1L8OA 5J2CA 4QZDA 4DFPA 2BQUA 2AJQA 3IDWA 1WCNA 3ZDEA 2JXJA 2C2EA 4ICAA 2JMGA 1S5LU 3L5KA 3M6ZA 3G6VA 8ICJA 2ES6A 2ZIWA 2NRXA 5J0RA 5J0SA 4YN4A 2OWOA 3SAFA 5HP4A 2QB0A 4FBTA 1ZQNA 5KFGA 1HIWA 2M0NA 3PW5A 3OSPA 5KFSA 4DF4A 5KFVA 4DSEA 4O3RA 3C2MA 1X9XA 3AQFA 2HCFA 3C1YA 4DOCA 1X9MA 3AUOA 2PFQA 4M9GA 3MGHA 4QZGA 1IG6A 2I6XA 4I2DA 3QU7A 3D2QA 2DQNB 2FPMA 5ALJA 7ICGA 5AIAA 3GDXA 4RNMA 5AKLA 2RDIA 4UW9A 1GO3F 2RLTA 5K4LA 3RB0A 5J0YA 5L1MA 1X9WA 1ZQHA 4J9MA 4FFDA 3QU5A 3NVVA 2GO7A 4EBCA 2I5HA 4LVSA 3NASA 2BPCA 3QU9A 1AROP 2KNJA 4BX9C 2IHNA 1SGGA 3IV6A 1ZQDA 2WF7A 3SEIA 3IN5A 4ECZA 4ED6A 5DGAA 3OPXA 3NTUA 3SV4A 1J2NA 1A77A 4O3OA 3NRWA 2UVRA 4YQWA 1JX4A 4RPXA 3AM9A 1K1QA 1NK8A 8ICQA 2HMXA 2ESEA 4ACOA 5AKEA 5KL1B 3EWAA 2KP7A 3D2SA 4UB1A 3ED5A 4GIBA 2RQ5A 5B66U 3RF9A 2H3ZA 2PXIA 1XO0A 3B0YA 5ALGA 4B9MA 3QE9Y 4PZOA 4CF5A 5HMLA 4PGXA 2ZJAA 2PMZC 3ORYA 1C7YA 2BGWA 4Q8FA 3J81j 4BJQA 5KFRA 3RJIA 4QZEA 4C4SA 2ASDA 8ICSA 5J2AA 1BGXT 2FJ6A 1WYGA 4XRHA 5AK5A 5F3XB 2PI4A 4TQRA 4ECVA 4ELUA 3JPQA 4PL1A 7ICFA 1U45A 2ZIWB 7ICQA 3JPOA 3UPQA 3DEEA 2QB0B 3TADA 4M47A 2LBOA 2E8NA 2W11A 1Y88A 4ED0A 2D3DA 1XC9A 2KZZA 4PHEA 2KG5A 4F4YA 1U48A 1F5SA 4IRCA 2JEGA 1RDFA 3GIMA 2ASJA 4QZ9A 1JI7A 3WKBA 8ICTA 3QZ8A 5F9LA 2DL0A 3BQ1A 5G5GA 2OCEA 4YVZA 1X9SA 5T14A 2ZIXA 3PSPA 3IM1A 3PZPA 4NWIA 1UPHA 5KL8B 3KTQA 2BCQA 3GV8B 5J2DA 1SL1A 2HVIA 4RU9A 4NLCA 4QZ8A 4QIWC 5JU5A 4IRKA 2VJ5A 1NZPA 2HSZA 4J9SA 4BDPA 3SMVA 3EZ5A 1PZNA 1YZ7A 1A0PA 2W8KA 1BPBA 1SV0C 1SIJA 5AK4A 1MN8A 4F92B 3OHAA 2W03A 4KMOB 9ICNA 2MAXA 2YMMA 3RJJA 2E8OA 1CI4A 1B0XA 2IHMA 3MDAA 9ICWA 2ATLA 1ZQJA 3L3FX 5AK3A 4UBBA 1PK3A 4P4OA 1Q3UA 3I28A 2CPRA 4YCXA 5AKIA 1QQ6A 3HJEA 4DFJA 4R8UA 2JZBA 1BPXA 3NVWA 3ZI4A 3RBEA 5J2JA 1MA7A 2VA3A 2HHWA 4ECWA 3PR5B 3F5EA 5J2GA 3UXPA 2R8GA 1WCLA 4UAWA 3GIIA 1ECWA 4RUAA 3T79A 4PGQA 4F50A 5KFLA 2W3SA 4ED1A 4TQSA 2KOBA 2ZUCA 3K1RB 2HHUA 4B9SA 1DK2A 3C5GA 1XSPA 8ICLA 3SYZA 5KFTA 2XICA 3QYPA 1EXNA 3PR4A 2W43A 4UAZA 3NGDA 4P2HA 4UAYA 1L3UA 4Y2TA 2HBMA 1FFUA 2WAQF 5EOZA 2ZIXB 4KLQA 3JPNA 1NK0A 3NRZA 5E79U 3H40A 1QQ5A 2ZUDA 1SB3C 3QEBZ 3F2BA 4IRDA 5J0TA 4C0ZA 4EBDA 1T4GA 2RP5A 5DQGA 3IHQB 1BVSA 1TK0A 3TFSA 2K4PA 3KKAC 4J9PA 5DBAA 3UXOA 4MEXA 3N28A 2AGOA 2JH1A 4EELA 5HMMA 3KHGA 2NYVA 3C28A 3ONNA 2H3QA 1O03A 1SKSA 4NLZA 2XGPA 2KZMA 3MR3A 1P7DA 2G09A 4CDGA 4M9NA 5AHXA 2K8CB 1B43A 3T5JA 3G6YA 4HAIA 2LMRA 3PSFA 1ZQOA 3C5FA 2LI6A 2Z7JA 1CRXA 4KLLA 5J2EA 4KLTA 2K4EA 4OJOA 5KT2A 4ED2A 1JIHA 4MFCA 1XS9D 4R8UB 2JZBB 3SD7A 4RQ3A 5ALYA 8ICIA 2R8IA 1ZQQA 4I2CA 4M2YA 2KJ8A 1L7NA 5C5JA 3QUTA 2VA8A 3PVXA 5JTIA 1SL0A 2K89A 4I28A 2A1JA 4DFDA 1Z00A 3WKCA 5DB8A 4ECTA 2F8LA 2VA2A 4KLOA 3GZFA 4KLDA 3BQ2A 5CEHA 4DS4A 4I2JA 3RH4A 2HW3A 3AEVA 2Y0SF 9ICFA 3KFUF 4IR9A 3T3FA 3FM9A 1L7OA 3QEAZ 1L7MA 2YMQA 2OM6A 2F1JA 4NY8A 3BZKA 1PK1A 1N61A 4EYIB 4G9BA 4UAUA 2UVVA 5AKHA 3TAQA 4JV1A 4MEYA 1T3NA 1L3TA 4DL4A 4R64A 5J2HA 1TFRA 1OXJA 2W04A 4I2HA 3M8SA 9ICEA 4UB5A 1ZQFA 1KEJA 2E8PA 8ICFA 4QZFA 1KW4A 5J0QA 5CJ7A 3MABA 1UT8A 1NI3A 5EWEA 4O3SA 8ICMA 1RYSA 3BS5A 4YG2A 2VKQA 2JEFA 5KFIA 4MFFA 8ICGA 4B9UA 4B9VA 5KFFA 1KBUA 1D9DA 4QWBA 1J2MA 1MC8A 4Y2VA 5DGBA 3JPTA
chains in the Genus database with same CATH topology
2QB1A 1JI7A 1SV4A 4NL9A 3BS5B 2DL0A 2GLEA 2B6GA 2FE9A 1SV0A 3K1RB 4PZNA 5L1MA 2DKXA 1SXEA 5KNIA 2Y9TA 5J8YC 1Z1VA 1DXSA 2EAPA 2D8CA 5JTIA 2F44A 1SGGA 1LKYA 3SEIA 4IS7A 1UCVA 1WWUA 3TADC 5JU5A 1SXDA 1F0MA 1V85A 2LPEA 3SENA 4MHVA 2ESEA 2YTUA 2KSOA 2QKQA 3KKAA 2F8KA 1LKYB 2EAOA 4NL9C 1SV0C 1PK1A 1B4FA 1X40A 1OW5A 1UQVA 3IDWA 2QARA 3TACB 2K4PA 3KKAC 2E8OA 1B0XA 1V38A 3BS7A 4RQNA 2KSOB 4PZOA 1OXJA 2ES6A 4NJ8A 2QB0A 1WWVA 1PK3A 5JRTA 2KMDA 2E8PA 2E8MA 2EAMA 3BQ7A 1PK1B 1KW4A 5J8YA 3HILA 2Y9UA 2QARB 5F3XB 2DKZA 1X9XA 2EANA 2KE7A 4RQMA 2K60A 2LMRA 2F3NA 3BS5A 1RG6A 2KIVA 1COKA 2QB0B 3TADA 2L5YA 2E8NA 1X66A 2D3DA 3H8MA 2JV3A 2KG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB1 A;  1JI7 A;  1SV4 A;  4NL9 A;  3BS5 B;  2DL0 A;  2GLE A;  2B6G A;  2FE9 A;  1SV0 A;  3K1R B;  4PZN A;  5L1M A;  2DKX A;  1SXE A;  5KNI A;  2Y9T A;  5J8Y C;  1Z1V A;  1DXS A;  2EAP A;  2D8C A;  5JTI A;  2F44 A;  1SGG A;  1LKY A;  3SEI A;  4IS7 A;  1UCV A;  1WWU A;  3TAD C;  5JU5 A;  1SXD A;  1F0M A;  1V85 A;  2LPE A;  3SEN A;  4MHV A;  2ESE A;  2YTU A;  2KSO A;  2QKQ A;  3KKA A;  2F8K A;  1LKY B;  2EAO A;  4NL9 C;  1SV0 C;  1PK1 A;  1B4F A;  1X40 A;  1OW5 A;  1UQV A;  3IDW A;  2QAR A;  3TAC B;  2K4P A;  3KKA C;  2E8O A;  1B0X A;  1V38 A;  3BS7 A;  4RQN A;  2KSO B;  4PZO A;  1OXJ A;  2ES6 A;  4NJ8 A;  2QB0 A;  1WWV A;  1PK3 A;  5JRT A;  2KMD A;  2E8P A;  2E8M A;  2EAM A;  3BQ7 A;  1PK1 B;  1KW4 A;  5J8Y A;  3HIL A;  2Y9U A;  2QAR B;  5F3X B;  2DKZ A;  1X9X A;  2EAN A;  2KE7 A;  4RQM A;  2K60 A;  2LMR A;  2F3N A;  3BS5 A;  1RG6 A;  2KIV A;  1COK A;  2QB0 B;  3TAD A;  2L5Y A;  2E8N A;  1X66 A;  2D3D A;  3H8M A;  2JV3 A;  2KG5 A; 
#chains in the Genus database with same CATH topology
 4UAT A;  2IOF K;  3ETL A;  4CF3 A;  4JB3 A;  2WF5 A;  3OHB A;  3PV8 A;  5B5E U;  1XSL A;  5FP0 A;  1X6I A;  4DL6 A;  4PPX A;  2VAN A;  3I76 A;  8ICN A;  3RBD A;  2BPF A;  3M1Y A;  3SR6 A;  1NJZ A;  3GV5 B;  2XY5 A;  4OO1 J;  5CRX A;  1WWU A;  2G08 A;  1T8E A;  4J03 A;  1Q8K A;  1COO A;  5AIC A;  2VJ4 A;  3UQ2 A;  3MGV A;  4EYH B;  3RJG A;  3V6J A;  2XY7 A;  4Y2Q A;  2A1J B;  4CF4 A;  2ASL A;  1ZQ1 C;  1Z00 B;  4O5K A;  2WTF A;  2J6T A;  4P0Q A;  2HBK A;  4FBU A;  5D46 A;  3LWM A;  8ICU A;  1OW5 A;  4M0A A;  7ICE A;  3TAP A;  4A8E A;  2YB4 A;  4BWJ A;  3Q8Q B;  1S10 A;  2WB1 C;  5ALW A;  3GQC A;  3FAH A;  4YR0 A;  2UVU A;  1PK1 B;  3BQ7 A;  1ZQP A;  2EDU A;  3LK9 A;  4Q45 A;  3AL0 B;  4QZH A;  3HP6 A;  2K60 A;  5KG1 A;  2J6S A;  2MU2 A;  2W7O A;  3PNC A;  2I1Q A;  3M9M B;  3HW8 A;  4K4H A;  1NJW A;  7ICP A;  4XA5 A;  3HKZ F;  5KAI U;  4YP3 A;  1PVP A;  4EEN A;  3MBY A;  4YD1 A;  7ICU A;  2KIC A;  4RUC A;  2PFO A;  1VDV A;  3BS5 B;  3HPO A;  4YD2 A;  4C4R A;  3ZD8 A;  5A0L A;  5KFE A;  4QZC A;  4LZD A;  3KZX A;  5KG3 A;  4EZ9 A;  2YB1 A;  2D8C A;  2AH5 A;  4DQS A;  5AI5 A;  1KKX A;  5GTH U;  7ICK A;  5AK6 A;  3MFI A;  5DKW A;  2PMZ F;  3H0M B;  3RJF A;  4HYK A;  3RRG A;  4I27 A;  4GXK A;  3ZDB A;  4KN7 A;  2B0C A;  4OJL A;  2VIX A;  4B9T A;  4EBE A;  4BWM A;  8ICW A;  2LPE A;  5ALT A;  1Z4O A;  5KFO A;  2W55 A;  5KFQ A;  1K5O A;  4RNN A;  3SAH A;  4RPY A;  3V7J A;  1A76 A;  4US8 A;  1B4F A;  1X40 A;  2KV2 A;  2R8J A;  1DGS A;  1ZD2 P;  1ZRM A;  1O08 A;  3PY8 A;  3NUQ A;  3TAC B;  2ZJ8 A;  1VJ5 A;  3HKZ C;  4IQV A;  2C2D A;  4QWC A;  2J6U A;  3V7L A;  2YN4 A;  8ICK A;  3VCB A;  4DSL A;  5AKJ A;  4PL2 A;  1L5U A;  4P0Q B;  4DFK A;  4B6J A;  5J8Y A;  4JV2 A;  1KN5 A;  5CHG A;  5J2K A;  1SZP A;  5KFK A;  3LWL A;  3OTQ A;  2BQR A;  4RQ4 A;  4P0P A;  4F71 A;  1N2X A;  5KFB A;  5AI6 A;  2HBL A;  5ALR A;  5BPC A;  2XCA A;  5IIN A;  3Q8P B;  2FPL A;  5HR7 A;  4QIW F;  5ALD A;  3C21 A;  4RT3 A;  1KL9 A;  5DLF A;  1XU4 A;  4MFA A;  2I9G A;  3I1Y A;  4NL9 A;  5DLG A;  1JRO A;  4DLE A;  2DF4 B;  2LYA A;  4QWA A;  3Q8K A;  2P6U A;  4OD0 A;  2EZZ A;  2XID A;  5DB6 A;  4YR3 A;  4IQU A;  2A19 A;  5ALV A;  4DOB A;  3TAR A;  3WK4 A;  4DQI A;  4RQ1 A;  2W54 A;  2KK0 A;  4CNQ A;  2HVH A;  4F5R A;  1D9F A;  1ZQU A;  3N4M B;  3ICX A;  2G07 A;  1L7P A;  4Y2R A;  2YY6 A;  4C8L A;  2W9B A;  4DL5 A;  3QUC A;  3PW0 A;  2NV3 A;  1X2I A;  4I29 A;  2KN7 A;  4J9N A;  4F5P A;  4NLB A;  8ICZ A;  2KJ9 A;  5GTI U;  2QKQ A;  3MDC A;  2F8K A;  4C8O A;  5CR0 A;  3PX6 A;  4O5C A;  1L8L A;  4Z6D A;  3SAG A;  5J0U A;  2XI9 A;  3E58 A;  1RQN A;  4QZI A;  1X6J A;  3HT3 A;  4QZA A;  5ALH A;  2GOL A;  2KVC A;  2BQ3 A;  3LVW A;  4DQQ A;  1NK4 A;  2F76 X;  1ZOL A;  2BDU A;  3PML A;  3RTV A;  3PW4 A;  5DG8 A;  4F3O A;  4KX5 A;  4YXJ A;  5KFN A;  2EAM A;  3N7S C;  4GC6 A;  4FS2 A;  2KKP A;  3Q8S B;  1N56 A;  3H0R B;  2Y1J A;  2LM1 A;  4YXM A;  1TAU A;  5ALI A;  3MR5 A;  3FYH A;  1COK A;  1D8B A;  2AQ4 A;  4U6P A;  3BQ0 A;  1NK9 A;  2H3V A;  3DDH A;  4CRX A;  3C2L A;  2DPJ A;  1MQ2 A;  5J2B A;  2HHV A;  5AM5 A;  3ZDC A;  2IMW P;  3T5H A;  4ZH4 A;  4JMU A;  4P0P B;  4J9R A;  5J29 A;  4I2E A;  1S77 D;  4KIT B;  2FE9 A;  2ALZ A;  4C8M A;  3UQ0 A;  4PH5 A;  1N60 A;  9ICB A;  1JMS A;  1KFD A;  4P4P A;  2HI0 A;  1PVR A;  2W8L A;  1Q3V A;  1T3Q A;  1LKY A;  1IXR A;  4F4X A;  3IRU A;  3OGU A;  1RPL A;  4F2S A;  4IC9 A;  4F2R A;  3RB4 A;  4ECX A;  1PVQ A;  1HEK A;  1KRP A;  4PHD A;  4NM1 A;  5AM0 A;  8ICX A;  3LYS A;  4J9Q A;  2LKY A;  4EX7 A;  3BQT A;  2W9B B;  4EZ6 A;  1BPE A;  3C1Z A;  5C0Y A;  3U26 A;  2RRD A;  1NK6 A;  9ICT A;  4PJ0 U;  5DG7 A;  3RRH A;  4BGD A;  1ZQC A;  4FS1 A;  4RQ0 A;  5IIL A;  1WG8 A;  4IR1 A;  2FLP A;  1KTQ A;  4GC7 A;  2KMD A;  1NKC A;  3AN1 A;  5D4B A;  5ALN A;  3BJY A;  2FPK A;  5CB1 A;  3UMG A;  3ISC A;  5KG2 A;  5KT5 A;  4QWD A;  4J9K A;  2C28 A;  5IIK A;  3G6X A;  1YT3 A;  4M04 A;  4RQ8 A;  4DOA A;  4F5N A;  4Y2J A;  1S76 D;  1HUZ A;  1NK5 A;  5G5H A;  1SV4 A;  2ZTC A;  1N5X A;  4NLN A;  1NZB A;  1D8L A;  5KFA A;  2KZ3 A;  4FE3 A;  5D49 A;  5DQH A;  2B6G A;  4XUS A;  3BDP A;  5J0X A;  2XY6 A;  1C20 A;  3PX0 A;  4KLJ A;  1SXE A;  2IOH A;  5J0P A;  8ICA A;  3CNH A;  2W9A A;  2HOF A;  4PGY A;  2BDP A;  3ZD9 A;  1S0N A;  2IA6 A;  4UAV A;  1S0M A;  2FMS A;  2F44 A;  3UM9 A;  2FLN A;  3PST A;  4RQ6 A;  4JWM A;  1S0V A;  1IIP A;  2G0A A;  1TK8 A;  3EW9 A;  2O6K A;  2KIW A;  3SEN A;  2XO7 A;  1KSP A;  3N7P D;  2JR5 A;  1QCK A;  1U9L A;  3AQE A;  1LKY B;  2KKV A;  3LVV A;  4GLX A;  3N97 B;  3E2E A;  3C29 A;  4DL3 A;  1ZYQ A;  5AKY A;  1U47 A;  2AQ0 A;  5KFC A;  1JRP A;  2V9W A;  3H4B A;  3TKA A;  9ICS A;  4ED8 A;  1U49 A;  3SZ2 A;  3V6H A;  4DSF A;  2KFN A;  4CGZ A;  2CXY A;  1WWV A;  3KHH A;  5KT6 A;  8ICO A;  2Y9U A;  2PKE A;  5CWR A;  2A3V A;  5ALO A;  2E5S A;  3RAQ A;  2EAN A;  3A0H U;  3WKA A;  1KFT A;  1RZT A;  4LJX A;  4Q43 A;  1UA0 A;  3AMZ A;  3N7R C;  4RQ2 A;  2LM4 A;  1TK5 A;  1ZJN A;  4OJ5 A;  2AGQ A;  4ED3 A;  2IOF A;  1RXW A;  4BUG A;  4RNO A;  3VC8 A;  2GLE A;  7ICM A;  1K1S A;  1SV0 A;  2DGZ A;  2HHX A;  1UA1 A;  9ICH A;  2DKX A;  4DF8 A;  4UB4 A;  4F93 B;  5J0O A;  1Q46 A;  3IG8 A;  4QW8 A;  4US9 A;  2AGP A;  2FMP A;  2KFZ A;  2W9M A;  3RH6 A;  5HHH A;  3RR7 A;  2HHT A;  4B9N A;  3EPG A;  2WB1 F;  1UCV A;  4J9L A;  4Z6C A;  4IQW A;  8ICH A;  3TAD C;  5ALU A;  4C4T A;  1SXD A;  1V85 A;  2NRT A;  4XQ8 A;  4O3N A;  3WK9 A;  4WJ3 B;  1V97 A;  2MSN A;  1RXV A;  4DQP A;  5AI0 A;  3RB6 A;  3HX0 A;  4YMO A;  4GFJ A;  5KTQ A;  4GXJ A;  2XCP A;  1YZ6 A;  5KG4 A;  4UQG A;  2BPG A;  4DFM A;  3FDS A;  3Q8L A;  9ICO A;  3JPP A;  3F5A A;  4DLG A;  4I2I A;  7ICJ A;  4I2B A;  1KFS A;  2G5H B;  7ICR A;  1V38 A;  4YMN A;  1TKD A;  5KT3 A;  4R63 A;  5AKZ A;  1XSN A;  8ICV A;  4KLU A;  1JAL A;  3THV A;  1HUO A;  2GWS A;  1TAQ A;  4M6W A;  2P35 A;  4I2G A;  2DBY A;  2W9C A;  1NK7 A;  5ALQ A;  1LV5 A;  4KN4 A;  2IBK A;  5AI4 A;  2MUT A;  3RFA A;  5KT4 A;  3GIL A;  5III A;  3GIJ A;  8ICB A;  3Q8M A;  4MF2 A;  2AHO B;  1ZQV A;  2GH1 A;  5AI9 A;  4OJP A;  1ZQZ A;  2JGA A;  4TUP A;  7ICS A;  4NLG A;  4X5V A;  9ICI A;  3JPR A;  4O3P A;  2DFL A;  3H8S A;  3GV7 B;  3WKE A;  3A0B U;  2PFN A;  2EH9 A;  3K4G A;  3FC4 A;  3RJH A;  2KHQ A;  4LZG A;  4RPZ A;  5L1J A;  4ZOH C;  4FO6 A;  9ICU A;  4R66 A;  3F53 A;  5HNK A;  7ICO A;  1RYR A;  5AM4 A;  2KVS A;  4RT2 A;  2XC9 A;  3D6J A;  4UAS A;  4TUQ A;  2RHF A;  1X42 A;  3GFK B;  1ZQL A;  2ZJ5 A;  1QH9 A;  2NRZ A;  3ETR A;  2KD1 A;  4Y2P A;  5ALP A;  2YML A;  3KHR A;  1URJ A;  2R18 A;  2E1E A;  2KHV A;  1ZQK A;  1XNS A;  8ICE A;  2KSO A;  3MFH A;  4ELV A;  5BOL A;  5H2F U;  4C8N A;  3LDA A;  1FFV A;  3C23 A;  1ZD4 A;  2FI1 A;  7ICH A;  4O5E A;  2HHQ A;  1V9P A;  4F91 B;  5L1K A;  3QX7 A;  5EE9 A;  4GXI A;  4DQR A;  4UB2 A;  3QZ7 A;  1S0O A;  2ZTE A;  3ZDD A;  5KFH A;  3GIK A;  8ICC A;  1ZQM A;  3RAX A;  2JEJ A;  5KG5 A;  4BXO A;  5KFJ A;  3HIL A;  1DK3 A;  1NKB A;  2E1F A;  3JPS A;  4J9O A;  1A6S A;  3M7D A;  3WK5 A;  1BPZ A;  1QQ7 A;  1ZQE A;  1JUD A;  2F3N A;  4DSK A;  2BKE A;  2BCR A;  2KIV A;  4UAR A;  5KFW A;  3D2N A;  1NNL A;  3TAN A;  3OJS A;  3ISD A;  4M6W B;  4DCC A;  2W9C B;  4M9H A;  3NVY A;  4Y2S A;  1ZQY A;  4NM2 A;  1NJX A;  4U7C A;  4EEY A;  2MUT B;  4O0I A;  4ECR A;  4M9L A;  9ICR A;  1RM6 C;  2DUY A;  3K1Z A;  5EE0 A;  5AM1 A;  5AKX A;  4PZN A;  5KNI A;  1TAM A;  3QNM A;  1MQ3 A;  1IM4 A;  1N63 A;  4FZN A;  5AIB A;  1ZQS A;  4R65 A;  2ZXH A;  1CEZ A;  4YMM A;  2JRZ A;  2CN1 A;  5KAF U;  4M9J A;  2EQY A;  3H8J A;  4EEK A;  2G06 A;  5ALZ A;  1ZQG A;  5KFY A;  2FDR A;  4KTQ A;  4ED7 A;  3QXG A;  9ICA A;  1JXE A;  5ALL A;  2OXO A;  4Y2U A;  4DO9 A;  5DB7 A;  3KOO A;  3RJK A;  2OYY A;  5KG6 A;  5ALX A;  3WK6 A;  2LHT A;  9ICC A;  1Z4N A;  4OCZ A;  2ZTD A;  5DB9 A;  2ODG A;  2WHE A;  2H3I A;  1BPY A;  4DL7 A;  4G3I A;  4ELT A;  2KSO B;  4C7Z A;  2XGQ A;  3V7K A;  4NJ8 A;  3L4P A;  5KG7 A;  2ISP A;  5JRT A;  1T7P A;  2H3F A;  2E8M A;  4JK1 A;  1QSY A;  4YR2 A;  1SKW A;  5IIJ A;  2G5I B;  2PI5 A;  3PO4 A;  4RQM A;  3R9K A;  3CRX A;  8ICR A;  1ZD3 A;  3QU4 A;  2ZUB A;  3MR6 A;  2V4R A;  9ICJ A;  5KT7 A;  4F8R A;  4NV0 A;  3Q8R B;  1X66 A;  3H8M A;  4BXO B;  4AYB F;  2F77 X;  1S97 A;  3WK8 A;  4DL2 A;  4E0D A;  3IG5 A;  3H8W A;  1TE2 A;  5AI8 A;  2QB1 A;  1QSL A;  1TV9 A;  1ZQT A;  1VLB A;  3DV9 A;  3M8R A;  3S6J A;  9ICL A;  1ZRN A;  3CW2 C;  3TQ1 A;  4UB3 A;  1B22 A;  2N1R A;  5EWG A;  4DWI A;  1ZET A;  4CCH A;  4O3M A;  2EAP A;  3KZI U;  4F4W A;  3SV3 A;  5TZV A;  2RDJ A;  4IS7 A;  3HRD D;  2ZIV A;  4ECS A;  4C8K A;  3HWT A;  3SI8 A;  2V4Q A;  2F1H A;  1TVA A;  1JXL A;  1ZD5 A;  4DS5 A;  3RH5 A;  5DDM A;  2YTU A;  2YMP A;  4O9M A;  1FIQ A;  5IIM A;  2AXT U;  2OHF A;  2C2R A;  5HR6 A;  4UBC A;  5KFX A;  1J97 A;  9ICQ A;  3PSI A;  5IIO A;  1ZQR A;  4KMU A;  1UQV A;  2M9N A;  2QAR A;  3CP8 A;  5EWF A;  2ISO A;  2PFP A;  1JN3 A;  3UXN A;  4AYB C;  3V6K A;  3B0X A;  5L9X A;  4RQN A;  2BCS A;  5AKG A;  9ICP A;  1ZQI A;  2DPI A;  2P6R A;  4NLK A;  1L3S A;  2QLT A;  4KLG A;  1ZJM A;  2BZF A;  2DKZ A;  3M6K A;  8ICY A;  2F1I A;  2KE7 A;  4Y2Y A;  3KBB A;  1SKR A;  1HJP A;  2YX8 A;  2BCV A;  2ZXI A;  1L3V A;  3QUQ A;  5EE3 A;  3WKD A;  5DG9 A;  3CYM A;  1KDH A;  1D8Y A;  2JV3 A;  3B9J A;  4K4I A;  4UB6 U;  1M6Y A;  5KFU A;  4FZM A;  1U4B A;  4F5Q A;  1H38 A;  4RQ5 A;  4I2A A;  1N48 A;  4Y2X A;  3RR8 A;  2KEY A;  7ICI A;  4K4G A;  3M9O B;  1ZQW A;  2A1A A;  2R8H A;  4O3Q A;  3OSN A;  4KLF A;  5AKK A;  4Z6F A;  7ICL A;  4KX3 A;  3BZC A;  5ALF A;  4ECU A;  2XVT A;  2FLL A;  4C80 A;  3KHL A;  3T5L A;  1NJY A;  2OEH A;  1F0M A;  5F9N A;  2HHS A;  5L1I A;  8ICP A;  3TFR A;  4MHV A;  5ALE A;  4DEZ A;  3RJE A;  1RQL A;  2EAO A;  9ICX A;  2JH7 A;  2ZIV B;  2UVW A;  5J0W A;  2R8K A;  4EX6 A;  4F4Z A;  2LYB A;  5CA7 A;  4KLM A;  4AP9 A;  5DDY A;  5L1L A;  4RZR A;  2ZIU A;  4NXZ A;  3BS7 A;  1QSS A;  4JV0 A;  1LB2 B;  3F2C A;  1SZH A;  2LYH A;  2WAQ C;  4PHP A;  4QWE A;  2QAR B;  4F72 A;  1FO4 A;  2MRL A;  4JWN A;  3RB3 A;  3H4D A;  1QTM A;  1UHU A;  1MSW D;  1T94 A;  2DWQ A;  1RG6 A;  2Y1I A;  5AM3 A;  2AU0 A;  2K8A A;  3AU2 A;  1QLN A;  4QW9 A;  3GU3 A;  7ICV A;  4F4K A;  1N62 A;  5J2I A;  4I2F A;  5AM2 A;  3PO5 A;  5HHI A;  2K4H A;  5JUM A;  3TI0 A;  2P66 A;  2HOI A;  1F44 A;  3ISB A;  2KJ5 A;  5DBB A;  4QZB A;  3UMB A;  3M9N B;  1N5W A;  2Q0Z X;  2C22 A;  5CP2 A;  2Y9T A;  1DOQ A;  2NO4 A;  5J8Y C;  1BNO A;  1DXS A;  4IL6 U;  5KG0 A;  1LVH A;  2NRW A;  3UMC A;  4FZL A;  3EYZ A;  2EZX A;  2WF6 A;  4KLS A;  3PX4 A;  5ALS A;  9ICK A;  3NS1 A;  1NOM A;  4RQ7 A;  1ZQX A;  1Z3E B;  2JHD A;  4KLH A;  2BHN A;  4NL9 C;  3ZDA A;  3PW2 A;  2FMQ A;  4DSJ A;  2WFA A;  3KD3 A;  3H0L B;  3MGI A;  4PHA A;  4Z6E A;  1L6N A;  3QU2 A;  3C2K A;  1Z19 A;  1Z1B A;  3PMN A;  3WK7 A;  3EPI A;  3MR2 A;  2MA1 A;  1BNP A;  4KLI A;  5DBC A;  1ZQB A;  1CUK A;  2K8B B;  2H5X A;  3EUB 2;  4ECY A;  1ED1 A;  3NVZ A;  2HOQ A;  2EZY A;  4YFK A;  2HDO A;  5KFM A;  4P4M A;  1WUD A;  1ZXI A;  4F5O A;  1SWV A;  3E0F A;  2W3R A;  5J2F A;  4KLE A;  2E3T A;  2CRX A;  2Y0S C;  3WU2 U;  4USA A;  4MF8 A;  5ALM A;  2ZIU B;  2YQE A;  1DRG A;  1BPD A;  5BOM A;  3MC1 A;  1AQ6 A;  2WF9 A;  2NRV A;  1S8O A;  2L5Y A;  2ZG6 A;  4TUS A;  2F2A B;  1KLN A;  2KTQ A;  5KFZ A;  4ECQ A;  4Q8E A;  5DQI A;  3ALR A;  2HBJ A;  1IV8 A;  4JUZ A;  5EE1 A;  2BR0 A;  2JEI A;  3PW7 A;  3IP4 B;  5ALK A;  9ICM A;  1XWL A;  2BCU A;  1XO1 A;  1SL2 A;  4TUR A;  5KFD A;  2D6F C;  1NKE A;  2W7P A;  1Z1V A;  3QUB A;  7ICT A;  1SWW A;  3K75 D;  2B21 A;  3H7I A;  7ICN A;  1RYU A;  1OUQ A;  9ICG A;  2OH2 A;  4QJF B;  3AU6 A;  4DSI A;  1UT5 A;  4B9L A;  4OJ6 A;  3O0F A;  2WF8 A;  4QNL A;  3OJU A;  1S9F A;  3T5K A;  4Q44 A;  1DGJ A;  4C7Y A;  2NO5 A;  1KQQ A;  1FEZ A;  4UB8 U;  1PUZ A;  2Q4T A;  5KFP A;  3V72 A;  5TIS U;  9ICV A;  3KKA A;  2K4I A;  4CE6 A;  1ZQA A;  3SQI A;  4IQT A;  3F2D A;  1L8O A;  5J2C A;  4QZD A;  4DFP A;  2BQU A;  2AJQ A;  3IDW A;  1WCN A;  3ZDE A;  2JXJ A;  2C2E A;  4ICA A;  2JMG A;  1S5L U;  3L5K A;  3M6Z A;  3G6V A;  8ICJ A;  2ES6 A;  2ZIW A;  2NRX A;  5J0R A;  5J0S A;  4YN4 A;  2OWO A;  3SAF A;  5HP4 A;  2QB0 A;  4FBT A;  1ZQN A;  5KFG A;  1HIW A;  2M0N A;  3PW5 A;  3OSP A;  5KFS A;  4DF4 A;  5KFV A;  4DSE A;  4O3R A;  3C2M A;  1X9X A;  3AQF A;  2HCF A;  3C1Y A;  4DOC A;  1X9M A;  3AUO A;  2PFQ A;  4M9G A;  3MGH A;  4QZG A;  1IG6 A;  2I6X A;  4I2D A;  3QU7 A;  3D2Q A;  2DQN B;  2FPM A;  5ALJ A;  7ICG A;  5AIA A;  3GDX A;  4RNM A;  5AKL A;  2RDI A;  4UW9 A;  1GO3 F;  2RLT A;  5K4L A;  3RB0 A;  5J0Y A;  5L1M A;  1X9W A;  1ZQH A;  4J9M A;  4FFD A;  3QU5 A;  3NVV A;  2GO7 A;  4EBC A;  2I5H A;  4LVS A;  3NAS A;  2BPC A;  3QU9 A;  1ARO P;  2KNJ A;  4BX9 C;  2IHN A;  1SGG A;  3IV6 A;  1ZQD A;  2WF7 A;  3SEI A;  3IN5 A;  4ECZ A;  4ED6 A;  5DGA A;  3OPX A;  3NTU A;  3SV4 A;  1J2N A;  1A77 A;  4O3O A;  3NRW A;  2UVR A;  4YQW A;  1JX4 A;  4RPX A;  3AM9 A;  1K1Q A;  1NK8 A;  8ICQ A;  2HMX A;  2ESE A;  4ACO A;  5AKE A;  5KL1 B;  3EWA A;  2KP7 A;  3D2S A;  4UB1 A;  3ED5 A;  4GIB A;  2RQ5 A;  5B66 U;  3RF9 A;  2H3Z A;  2PXI A;  1XO0 A;  3B0Y A;  5ALG A;  4B9M A;  3QE9 Y;  4PZO A;  4CF5 A;  5HML A;  4PGX A;  2ZJA A;  2PMZ C;  3ORY A;  1C7Y A;  2BGW A;  4Q8F A;  3J81 j;  4BJQ A;  5KFR A;  3RJI A;  4QZE A;  4C4S A;  2ASD A;  8ICS A;  5J2A A;  1BGX T;  2FJ6 A;  1WYG A;  4XRH A;  5AK5 A;  5F3X B;  2PI4 A;  4TQR A;  4ECV A;  4ELU A;  3JPQ A;  4PL1 A;  7ICF A;  1U45 A;  2ZIW B;  7ICQ A;  3JPO A;  3UPQ A;  3DEE A;  2QB0 B;  3TAD A;  4M47 A;  2LBO A;  2E8N A;  2W11 A;  1Y88 A;  4ED0 A;  2D3D A;  1XC9 A;  2KZZ A;  4PHE A;  2KG5 A;  4F4Y A;  1U48 A;  1F5S A;  4IRC A;  2JEG A;  1RDF A;  3GIM A;  2ASJ A;  4QZ9 A;  1JI7 A;  3WKB A;  8ICT A;  3QZ8 A;  5F9L A;  2DL0 A;  3BQ1 A;  5G5G A;  2OCE A;  4YVZ A;  1X9S A;  5T14 A;  2ZIX A;  3PSP A;  3IM1 A;  3PZP A;  4NWI A;  1UPH A;  5KL8 B;  3KTQ A;  2BCQ A;  3GV8 B;  5J2D A;  1SL1 A;  2HVI A;  4RU9 A;  4NLC A;  4QZ8 A;  4QIW C;  5JU5 A;  4IRK A;  2VJ5 A;  1NZP A;  2HSZ A;  4J9S A;  4BDP A;  3SMV A;  3EZ5 A;  1PZN A;  1YZ7 A;  1A0P A;  2W8K A;  1BPB A;  1SV0 C;  1SIJ A;  5AK4 A;  1MN8 A;  4F92 B;  3OHA A;  2W03 A;  4KMO B;  9ICN A;  2MAX A;  2YMM A;  3RJJ A;  2E8O A;  1CI4 A;  1B0X A;  2IHM A;  3MDA A;  9ICW A;  2ATL A;  1ZQJ A;  3L3F X;  5AK3 A;  4UBB A;  1PK3 A;  4P4O A;  1Q3U A;  3I28 A;  2CPR A;  4YCX A;  5AKI A;  1QQ6 A;  3HJE A;  4DFJ A;  4R8U A;  2JZB A;  1BPX A;  3NVW A;  3ZI4 A;  3RBE A;  5J2J A;  1MA7 A;  2VA3 A;  2HHW A;  4ECW A;  3PR5 B;  3F5E A;  5J2G A;  3UXP A;  2R8G A;  1WCL A;  4UAW A;  3GII A;  1ECW A;  4RUA A;  3T79 A;  4PGQ A;  4F50 A;  5KFL A;  2W3S A;  4ED1 A;  4TQS A;  2KOB A;  2ZUC A;  3K1R B;  2HHU A;  4B9S A;  1DK2 A;  3C5G A;  1XSP A;  8ICL A;  3SYZ A;  5KFT A;  2XIC A;  3QYP A;  1EXN A;  3PR4 A;  2W43 A;  4UAZ A;  3NGD A;  4P2H A;  4UAY A;  1L3U A;  4Y2T A;  2HBM A;  1FFU A;  2WAQ F;  5EOZ A;  2ZIX B;  4KLQ A;  3JPN A;  1NK0 A;  3NRZ A;  5E79 U;  3H40 A;  1QQ5 A;  2ZUD A;  1SB3 C;  3QEB Z;  3F2B A;  4IRD A;  5J0T A;  4C0Z A;  4EBD A;  1T4G A;  2RP5 A;  5DQG A;  3IHQ B;  1BVS A;  1TK0 A;  3TFS A;  2K4P A;  3KKA C;  4J9P A;  5DBA A;  3UXO A;  4MEX A;  3N28 A;  2AGO A;  2JH1 A;  4EEL A;  5HMM A;  3KHG A;  2NYV A;  3C28 A;  3ONN A;  2H3Q A;  1O03 A;  1SKS A;  4NLZ A;  2XGP A;  2KZM A;  3MR3 A;  1P7D A;  2G09 A;  4CDG A;  4M9N A;  5AHX A;  2K8C B;  1B43 A;  3T5J A;  3G6Y A;  4HAI A;  2LMR A;  3PSF A;  1ZQO A;  3C5F A;  2LI6 A;  2Z7J A;  1CRX A;  4KLL A;  5J2E A;  4KLT A;  2K4E A;  4OJO A;  5KT2 A;  4ED2 A;  1JIH A;  4MFC A;  1XS9 D;  4R8U B;  2JZB B;  3SD7 A;  4RQ3 A;  5ALY A;  8ICI A;  2R8I A;  1ZQQ A;  4I2C A;  4M2Y A;  2KJ8 A;  1L7N A;  5C5J A;  3QUT A;  2VA8 A;  3PVX A;  5JTI A;  1SL0 A;  2K89 A;  4I28 A;  2A1J A;  4DFD A;  1Z00 A;  3WKC A;  5DB8 A;  4ECT A;  2F8L A;  2VA2 A;  4KLO A;  3GZF A;  4KLD A;  3BQ2 A;  5CEH A;  4DS4 A;  4I2J A;  3RH4 A;  2HW3 A;  3AEV A;  2Y0S F;  9ICF A;  3KFU F;  4IR9 A;  3T3F A;  3FM9 A;  1L7O A;  3QEA Z;  1L7M A;  2YMQ A;  2OM6 A;  2F1J A;  4NY8 A;  3BZK A;  1PK1 A;  1N61 A;  4EYI B;  4G9B A;  4UAU A;  2UVV A;  5AKH A;  3TAQ A;  4JV1 A;  4MEY A;  1T3N A;  1L3T A;  4DL4 A;  4R64 A;  5J2H A;  1TFR A;  1OXJ A;  2W04 A;  4I2H A;  3M8S A;  9ICE A;  4UB5 A;  1ZQF A;  1KEJ A;  2E8P A;  8ICF A;  4QZF A;  1KW4 A;  5J0Q A;  5CJ7 A;  3MAB A;  1UT8 A;  1NI3 A;  5EWE A;  4O3S A;  8ICM A;  1RYS A;  3BS5 A;  4YG2 A;  2VKQ A;  2JEF A;  5KFI A;  4MFF A;  8ICG A;  4B9U A;  4B9V A;  5KFF A;  1KBU A;  1D9D A;  4QWB A;  1J2M A;  1MC8 A;  4Y2V A;  5DGB A;  3JPT A; 
#chains in the Genus database with same CATH homology
 2QB1 A;  1JI7 A;  1SV4 A;  4NL9 A;  3BS5 B;  2DL0 A;  2GLE A;  2B6G A;  2FE9 A;  1SV0 A;  3K1R B;  4PZN A;  5L1M A;  2DKX A;  1SXE A;  5KNI A;  2Y9T A;  5J8Y C;  1Z1V A;  1DXS A;  2EAP A;  2D8C A;  5JTI A;  2F44 A;  1SGG A;  1LKY A;  3SEI A;  4IS7 A;  1UCV A;  1WWU A;  3TAD C;  5JU5 A;  1SXD A;  1F0M A;  1V85 A;  2LPE A;  3SEN A;  4MHV A;  2ESE A;  2YTU A;  2KSO A;  2QKQ A;  3KKA A;  2F8K A;  1LKY B;  2EAO A;  4NL9 C;  1SV0 C;  1PK1 A;  1B4F A;  1X40 A;  1OW5 A;  1UQV A;  3IDW A;  2QAR A;  3TAC B;  2K4P A;  3KKA C;  2E8O A;  1B0X A;  1V38 A;  3BS7 A;  4RQN A;  2KSO B;  4PZO A;  1OXJ A;  2ES6 A;  4NJ8 A;  2QB0 A;  1WWV A;  1PK3 A;  5JRT A;  2KMD A;  2E8P A;  2E8M A;  2EAM A;  3BQ7 A;  1PK1 B;  1KW4 A;  5J8Y A;  3HIL A;  2Y9U A;  2QAR B;  5F3X B;  2DKZ A;  1X9X A;  2EAN A;  2KE7 A;  4RQM A;  2K60 A;  2LMR A;  2F3N A;  3BS5 A;  1RG6 A;  2KIV A;  1COK A;  2QB0 B;  3TAD A;  2L5Y A;  2E8N A;  1X66 A;  2D3D A;  3H8M A;  2JV3 A;  2KG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...