2Y9TA

Structural basis of p63a sam domain mutants involved in aec syndrome
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
GSYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUMOR PROTEIN 63
publication title Structural Basis of P63Alpha Sam Domain Mutants Involved in Aec Syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2y9tA00
1OXJA 1B0XA 4MHVA 4NL9A 1SV0A 4RQMA 2JV3A 5J8YA 3TACB 1LKYB 3KKAA 3H8MA 5JRTA 2L5YA 2K4PA 3KKAC 2D8CA 2EAMA 2E8OA 1KW4A 1PK1A 2E8NA 1DXSA 1PK1B 1LKYA 5JU5A 2KMDA 1X9XA 2ESEA 1UQVA 2GLEA 3SENA 2F44A 2F8KA 4PZNA 1V85A 3SEIA 2K60A 1SGGA 3BS5B 1SV4A 2DKXA 3IDWA 2DL0A 1PK3A 2Y9UA 2KSOA 2LPEA 3BS7A 3TADC 3HILA 2F3NA 2LMRA 2E8PA 1UCVA 2KSOB 3K1RB 5JTIA 2E8MA 1WWUA 5L1MA 2QARB 2D3DA 2ES6A 3BS5A 4PZOA 1Z1VA 1X40A 1RG6A 5KNIA 1B4FA 2EANA 5F3XB 3TADA 2B6GA 2FE9A 2QB0A 2QB1A 1F0MA 2QARA 2Y9TA 4RQNA 4NL9C 1SV0C 2QB0B 2EAPA 4IS7A 4NJ8A 2KG5A 1SXEA 2DKZA 5J8YC 2QKQA 2KE7A 1WWVA 1JI7A 1COKA 1SXDA 2KIVA 2EAOA 1V38A 1X66A 2YTUA 1OW5A 3BQ7A
chains in the Genus database with same CATH superfamily
2D6FC 4J9SA 3IN5A 1MSWD 4QW9A 1A6SA 2W04A 3K75D 3KZIU 5AIBA 3KKAA 4MFCA 2W55A 4UBCA 3LVWA 4EBEA 1ZXIA 9ICQA 1ZQNA 3MGVA 3KOOA 3C2LA 5J0UA 2E8NA 1ZQWA 4O3QA 4YP3A 2G09A 3T3FA 4F4WA 1PK1B 3LWLA 3HKZC 2VA2A 3AM9A 1ZJMA 5AKZA 4IQWA 3D6JA 2AXTU 4BWJA 4NLZA 1V85A 2W9BB 4MFFA 2H3QA 3JPPA 1KFTA 3GIMA 3PSPA 8ICIA 2UVRA 1SL1A 4M2YA 3V7LA 2Y9UA 4C7YA 5DLFA 3UQ0A 5FP0A 2ZXIA 2UVUA 4I29A 1UCVA 5ALXA 3SAFA 5J0WA 1S9FA 4Y2TA 3G6YA 4Y2JA 4I2AA 2ASDA 4UB4A 1ZQAA 2KHVA 3GFKB 2XY7A 3D2QA 5KNIA 1N2XA 3LVVA 1TFRA 1ECWA 5ALDA 3C29A 2AJQA 2YY6A 5HP4A 3MFIA 3LDAA 2LHTA 1SV0C 3NVWA 3N4MB 2KN7A 4YG2A 4DSIA 5J2FA 3JPOA 3H8WA 3UXOA 3GZFA 8ICNA 4GIBA 2RRDA 9ICOA 2LKYA 4O3NA 4FZNA 1X9SA 4PGYA 4O3MA 9ICVA 4XUSA 5AIAA 4QNLA 4EX6A 1N48A 2QLTA 1N5WA 3V6HA 4CNQA 4U6PA 4KLQA 3RB0A 2JGAA 5AKKA 2ZIVB 9ICGA 4RUCA 3GV7B 2HI0A 3GU3A 2KJ5A 3PSIA 3A0HU 3RBDA 2KP7A 7ICMA 2RHFA 2HOIA 2YMMA 4AP9A 5J29A 1RQNA 4IQVA 4C4SA 2BPFA 7ICKA 2HHUA 3RJHA 2LM1A 4F92B 4QIWC 1XO0A 5ALRA 2JEGA 5IIIA 2A1JB 4C8OA 2V4QA 1XO1A 5KFOA 1K1QA 3M9NB 1B22A 3PW4A 2J6UA 3NS1A 3PO5A 3MGIA 1CEZA 2BQRA 3ZD9A 4PH5A 4ECVA 1HUOA 2XY6A 3BS5A 2MU2A 4UAZA 5KG6A 2R8HA 4ED6A 1QSYA 9ICAA 3ZI4A 2OWOA 1BVSA 3K4GA 5AK4A 1SKRA 5AI0A 5DQHA 3K1ZA 5L1KA 2LYAA 1KFDA 3GIJA 4B9SA 2OHFA 2Y9TA 1T4GA 2KVSA 2WTFA 1D9FA 5KFMA 2QKQA 4DEZA 4FO6A 5E79U 2BQUA 2PMZC 2KIVA 1WUDA 2YTUA 1OW5A 3A0BU 1URJA 4YXJA 4MEXA 5DDMA 5J2JA 1DGJA 5J8YA 1HEKA 3PSTA 3RRGA 3HJEA 3ISCA 4M6WA 3OHBA 4QWAA 2ZUCA 4R8UA 3VC8A 3GDXA 1KEJA 2HBMA 4UAWA 4B9MA 1PK1A 1PVRA 2VKQA 1OUQA 3RR7A 4PPXA 4QZCA 5JU5A 1UT5A 1Q3VA 1TK5A 4RQ2A 2KKVA 3OGUA 5HMMA 5AM3A 3N7RC 4KLIA 4JK1A 9ICKA 3SQIA 3WKEA 2FPLA 3C5FA 3IP4B 3M6ZA 3N28A 3M9MB 3WKCA 5ALFA 4YD2A 4Z6DA 1ZQUA 4RPXA 3IDWA 4R63A 2KKPA 1ZQMA 4IQTA 3RJKA 2W3SA 1NK8A 5TISU 2HMXA 5JTIA 4F2RA 3ALRA 2XC9A 4F5PA 9ICNA 4UB5A 2AU0A 1TE2A 4C7ZA 1XC9A 2W8KA 3QU9A 5AKXA 5B66U 8ICLA 5AM1A 2HBLA 2KEYA 4PGQA 4NLGA 4F5RA 4YXMA 2ZTCA 1SL0A 2WB1F 2O6KA 5KFYA 3EZ5A 2EAPA 4Q8EA 4EEYA 1SXEA 2WF8A 5B5EU 4M9LA 1TV9A 1ZD2P 4GLXA 3TANA 1XWLA 1NK9A 1JXLA 5ALSA 2KZ3A 1ED1A 2E1EA 3HT3A 1NZBA 2N1RA 4EENA 1A0PA 4LVSA 4DSJA 1KN5A 3DDHA 3ED5A 4TUSA 2BDUA 3GIIA 1ZETA 1KFSA 2IHNA 2LM4A 2ZIVA 1NOMA 4NM1A 1S5LU 2CXYA 4BJQA 3U26A 2JXJA 4GC6A 9ICFA 3QE9Y 5KT5A 2EAMA 3RJFA 4M04A 4B9VA 4PHEA 4DQRA 1ZQIA 4DQQA 3H0MB 4OO1J 4F4ZA 4QZAA 1ZQDA 1DOQA 3RAXA 1YZ7A 1XSNA 4QWDA 2WFAA 5KT2A 3E2EA 4F4XA 5DG7A 1QTMA 4UBBA 3F2BA 1H38A 4IRCA 4RQ7A 2I1QA 1L7MA 2WF7A 3TAPA 3PX6A 4CCHA 3HILA 2F3NA 3Q8MA 2E8PA 2CPRA 1QCKA 5ALEA 5L1MA 2ZJ5A 4KLOA 1S0MA 4Y2XA 4DL6A 4NLNA 4G3IA 4M9JA 3L3FX 8ICYA 1B4FA 2KVCA 4BXOB 5EE3A 2MAXA 4EELA 3M8RA 4F3OA 1TAQA 2PI5A 2QARA 1JRPA 4TURA 2C2EA 4JV1A 4NL9C 3WK6A 4IS7A 2W9CB 4K4IA 5KG2A 2Z7JA 2RDJA 4DSLA 3SI8A 4B9TA 4KN7A 5HNKA 2YQEA 3I28A 3B0XA 3C1ZA 2XGPA 2K4IA 3OSPA 3HW8A 5D4BA 4UATA 2F8LA 2VJ5A 3PVXA 2AHOB 5EOZA 4HYKA 2R18A 2W11A 4CDGA 1CI4A 1SZPA 4CRXA 5ALGA 1LVHA 5KFTA 3PV8A 2IHMA 3PMNA 1MQ3A 1ZQZA 2GH1A 5AKLA 3N7SC 4IR9A 4G9BA 3F2CA 4UARA 3C2KA 2KFNA 2Y0SF 5ALIA 5F9LA 4ELTA 2HBKA 2ESEA 8ICKA 5DBBA 3SENA 4QZGA 4DS4A 3J81j 4PL2A 2F76X 5KG0A 3LK9A 1Z00B 2ISPA 4ED2A 3FAHA 2JR5A 1SGGA 5J2BA 1X6JA 2DKXA 1RXWA 1AQ6A 3TI0A 1P7DA 4YD1A 2E8MA 3QU5A 5ALMA 2MUTA 3SV3A 4ECXA 8ICSA 1NJYA 4Y2VA 2F1HA 4US8A 3ETLA 4Y2YA 1BPZA 5L1LA 3Q8QB 3THVA 5CWRA 4C8KA 3G6XA 1ZQQA 4M9HA 1X2IA 4C80A 3SR6A 3T79A 5KFPA 2RQ5A 2XCPA 2KJ9A 5L1IA 4O3RA 5AM0A 3RJEA 5L1JA 4JUZA 1L3UA 2F1IA 3QZ7A 3NVZA 3QX7A 4O0IA 3KHLA 3RH6A 9ICMA 3Q8LA 2ZIUB 2H5XA 3H7IA 5DQIA 3GV5B 4C0ZA 4ELVA 2E3TA 3HPOA 1JI7A 2R8IA 4I27A 1U9LA 4J9KA 4F5QA 4YR2A 3M1YA 1RYUA 3F5AA 5KG1A 2YB1A 4QZDA 1TAUA 4Q8FA 3ETRA 3PY8A 2BCVA 4KLHA 4KLLA 4QZIA 5CB1A 3H8JA 1DK2A 4J9QA 2YMQA 5ALOA 1ZYQA 4UAYA 1VDVA 1L7NA 1L3SA 2NO5A 4QZHA 4F4KA 2BHNA 4MF8A 4ED0A 1LKYA 2WB1C 7ICIA 1ZQYA 5J2KA 2F44A 3VCBA 4R66A 3G6VA 4DQIA 5HMLA 4B9NA 1C7YA 3BZCA 7ICNA 5KFDA 4I2CA 3RF9A 2F2AB 2ZJ8A 4J9NA 3QUTA 3AU2A 4UB1A 3PNCA 5J0PA 4DOAA 1JMSA 4RNOA 2R8GA 1NKBA 1KDHA 4QZFA 3E58A 2KNJA 4Q45A 3QUQA 4B6JA 4O9MA 8ICZA 4NV0A 1A77A 2HVIA 3AU6A 3QNMA 5HR7A 3S6JA 2XIDA 1UHUA 4JV0A 2B6GA 3BJYA 4UW9A 1A76A 1UA1A 2QB1A 9ICHA 2W9CA 1BPDA 1NJWA 2WHEA 2KG5A 4UB3A 2DKZA 1S10A 1J2MA 1WWVA 1KTQA 9ICWA 2P6RA 5CP2A 2EAOA 3M8SA 4NLCA 4O3OA 3MFHA 4RT2A 4DO9A 4KITB 2DBYA 1V97A 3Q8KA 8ICFA 2ZIXB 2NRVA 1D9DA 3QYPA 1QSSA 2IMWP 4GC7A 3RFAA 2ZTEA 5KG7A 2G07A 3MR3A 4OCZA 1RZTA 2ALZA 5AHXA 5KFVA 5HHIA 3RBEA 1SB3C 2NRXA 1AROP 3AL0B 1NK5A 4AYBF 1HJPA 2PFQA 2XY5A 4YFKA 2W7OA 8ICCA 2MA1A 5KFFA 4UB2A 4UASA 1KL9A 1ZQCA 4BX9C 2V9WA 4NM2A 2ODGA 2VA8A 1X42A 2VA3A 3JPQA 3B0YA 5J2DA 2IOFA 5DB8A 3RB6A 1L8LA 2W3RA 2B0CA 4QWBA 4KN4A 2FDRA 2ZUBA 3OTQA 3R9KA 3QEAZ 1RXVA 2BDPA 2ES6A 4PZOA 1HIWA 2BPGA 3FM9A 5ALYA 3AQEA 1T8EA 2BKEA 4USAA 1ZQOA 1CRXA 5CA7A 4ECQA 2EDUA 1FIQA 2Y0SC 4P0PB 9ICJA 3ZDDA 3IRUA 2AGQA 4NLBA 2WAQC 4DL2A 3QEBZ 4US9A 1U48A 2W03A 1N61A 5DG8A 4YQWA 3MR5A 8ICQA 2AGPA 2DPJA 1OXJA 4QWCA 1B0XA 1BPEA 5DQGA 5D49A 3PR5B 7ICGA 5ALVA 1RQLA 3BQ1A 2G08A 5J0SA 1O03A 1ZQEA 1U47A 1PVPA 4QJFB 1ZD4A 4NXZA 2D8CA 4P0QB 3WK8A 4Y2QA 1F44A 2EZZA 1XS9D 2XICA 2JZBB 5AM5A 2IA6A 5DKWA 3NRWA 1BNPA 3TKAA 1VLBA 2AH5A 4OJOA 5EWEA 5L9XA 4RQ5A 5KL1B 2FJ6A 3H40A 1ZQJA 3JPTA 5J0TA 1JXEA 1BNOA 3DEEA 5DGAA 4E0DA 4MFAA 3TADC 3ISBA 2W9BA 1WWUA 4RNMA 3JPNA 4UB8U 4FS1A 4KTQA 1JIHA 1Z1VA 7ICUA 1J97A 3RAQA 4F71A 5KAIU 4QZBA 3KBBA 5F3XB 5AKIA 5ALWA 2WF5A 3BQ2A 5KFRA 2YMLA 1IM4A 1ZRNA 9ICSA 4DFJA 3V7JA 4C4RA 4NLKA 2QB0B 2E1FA 1N5XA 4Y2SA 3V72A 3TFRA 1U45A 4O3SA 2NRZA 5KFBA 4DSEA 1V9PA 5EWFA 3IM1A 4OJLA 1X66A 4C8NA 7ICRA 4ICAA 5IIMA 1SV0A 2K4HA 3UMBA 2JV3A 2KJ8A 3RTVA 4RT3A 4UB6U 3AEVA 5KTQA 1JROA 1IG6A 2L5YA 3OJUA 2I6XA 3HP6A 1QLNA 4KLMA 1ZQBA 3TFSA 1WCLA 1KW4A 1UPHA 4R64A 5DB9A 3ONNA 5DB7A 3JPSA 1C20A 4C8MA 5A0LA 2J6SA 2RP5A 4ECUA 1UQVA 2GLEA 4BWMA 5CHGA 5KFWA 2WF9A 8ICJA 8ICXA 2XGQA 2EQYA 3PX0A 3PW7A 2KFZA 1TK0A 1T94A 3V6JA 1HUZA 1JX4A 4KLDA 4KLJA 5KFNA 1SWWA 2LPEA 1ZQSA 7ICHA 5AKYA 5IIJA 1XSPA 1NKEA 5HR6A 5KT7A 1SL2A 1RPLA 3IG5A 2ZJAA 5KFQA 4DWIA 1Q3UA 3E0FA 4ZH4A 2HHSA 2A1JA 4Y2UA 8ICOA 2MRLA 4YMMA 2FLNA 2JH7A 3L5KA 2EH9A 4PHAA 4RQ1A 1ZQVA 4FFDA 4LZDA 5DLGA 7ICLA 3AUOA 1COOA 1ZQKA 2HOQA 3I1YA 3LYSA 4DFMA 1SKSA 3C28A 5BOLA 2ASJA 5KFUA 3TARA 2KE7A 4YMOA 4EYIB 4ECWA 4CF5A 4EX7A 4P2HA 3MBYA 2HDOA 2EZYA 5G5HA 2K89A 5J0OA 9ICIA 4O5CA 2H3FA 4NY8A 4ED3A 4GXJA 3JPRA 4U7CA 5AM2A 4P0QA 3UM9A 4KLGA 5AK3A 3MC1A 2YB4A 3EW9A 4ECSA 4F91B 4F72A 5J2EA 2ZTDA 4GXKA 4IRKA 4XQ8A 5AI8A 1MC8A 1K5OA 3MABA 2FLLA 1Q8KA 4CF4A 1NK6A 2K8CB 4F8RA 1L8OA 2OYYA 1QH9A 1BPBA 3DV9A 8ICPA 5TZVA 3QU4A 5ALLA 4RU9A 1IIPA 4F50A 8ICHA 7ICPA 4Z6EA 1Z19A 1NJZA 2I5HA 3RJJA 5AM4A 1S77D 3PZPA 4UAVA 2DQNB 3ORYA 3WK7A 2A19A 4QIWF 4DLGA 3ZDBA 5J2GA 5AI6A 3N97B 9ICBA 2IBKA 1ZQPA 1GO3F 1ZOLA 4J9LA 4M47A 2OEHA 2QB0A 1FO4A 1NK4A 5DBCA 4PGXA 2BCRA 2BR0A 4DSKA 5KFSA 1QQ6A 5DGBA 3ICXA 3OPXA 8ICTA 5KFZA 2A1AA 2NYVA 3OSNA 3T5HA 5KFCA 4WJ3B 5K4LA 4J03A 1ZRMA 2R8KA 3N7PD 4Z6CA 4F93B 5CR0A 1L7PA 4P4PA 2R8JA 3RH4A 3FC4A 1NZPA 4RPZA 1SKWA 3RH5A 5AKJA 7ICOA 4M9NA 2F1JA 2KOBA 4IL6U 1F5SA 4I2GA 5T14A 4Z6FA 2Q4TA 4PL1A 2K4EA 5J0XA 5EE9A 3D2NA 2BQ3A 4MF2A 5KT6A 2V4RA 3ZDAA 3SV4A 3M6KA 4DSFA 9ICCA 3PW0A 5DB6A 4IQUA 4GXIA 4M0AA 3V7KA 5CRXA 3KZXA 3C1YA 4BUGA 4KLTA 2JHDA 1L3TA 3BS5B 1MQ2A 3H8SA 5C5JA 4IR1A 2XVTA 5C0YA 1K1SA 4ED1A 4DFPA 3BS7A 4IC9A 1ZQTA 4I2BA 2LMRA 3QU7A 3Q8PB 3K1RB 1ZQGA 1KSPA 2DF4B 4RQ6A 4ECTA 4PHDA 5D46A 2YX8A 2HHQA 2PXIA 2LYBA 3ISDA 1S0VA 4LJXA 4QZ8A 4A8EA 4DL7A 3WK4A 2CRXA 2G5IB 1MA7A 1NJXA 1ZQRA 5ALKA 1DGSA 3V6KA 5J8YC 3F2DA 2HHWA 4BXOA 4HAIA 1EXNA 1NNLA 4M6WB 5EWGA 4R8UB 2KZZA 3GQCA 1V38A 3AMZA 2DUYA 5J2AA 3H0LB 4RQ8A 3EWAA 3HRDD 3AN1A 1ZQ1C 4KMOB 4NL9A 4OJ6A 3WKDA 8ICUA 1Q46A 4Q43A 3H4DA 3CYMA 2IOHA 3BZKA 4J9PA 2OXOA 3PW5A 3F5EA 1S8OA 2E8OA 5KG4A 4C8LA 2FLPA 4ACOA 3QXGA 1IXRA 5F9NA 2PFNA 5KFXA 5KAFU 1QSLA 5KG3A 3CNHA 3SAGA 2C22A 4YR3A 2VJ4A 2KMDA 3B9JA 2HHXA 4BGDA 1Z4NA 3WKAA 4KLUA 4ELUA 2NRTA 4KLFA 5KFAA 2W9MA 4RQ0A 1BPXA 2KTQA 5AK5A 2JRZA 2PFPA 3T5LA 2P6UA 2W8LA 1RYRA 4J9MA 4EZ6A 2DFLA 4J9OA 4RPYA 1LB2B 1JUDA 3MGHA 3HWTA 1DRGA 4DL5A 2AGOA 9ICEA 3PMLA 2ISOA 1Z00A 2KICA 1N60A 1NI3A 3RJIA 3IHQB 5DG9A 3GIKA 2K8BB 4LZGA 5HHHA 7ICSA 1N56A 3NASA 3T5JA 2GOLA 2G06A 5AICA 3BDPA 4I28A 1BPYA 1X9MA 5IIOA 4DQSA 2ZG6A 3BQTA 4BDPA 4ECRA 2ZXHA 2LI6A 2FI1A 3IV6A 4I2IA 1N62A 2K8AA 3ZD8A 2W43A 3CW2C 4RQ4A 2VANA 2VIXA 3MR2A 1TAMA 1S0NA 4KLSA 4F2SA 2ZIUA 3TACB 7ICQA 1S97A 2ZIWB 3OHAA 2W54A 2C2RA 2HCFA 4OJPA 4ZOHC 3KHRA 3RR8A 5AKGA 2G0AA 3HX0A 4ED7A 5ALQA 5KFHA 1PZNA 9ICLA 4FS2A 2PFOA 1QQ5A 4DLEA 4EZ9A 5KFKA 2F8KA 2KD1A 4PJ0U 2HOFA 1JALA 2P66A 3SEIA 4P4MA 1TVAA 5AI4A 1D8LA 3SAHA 5H2FU 8ICVA 3QUBA 1L3VA 1PK3A 4EBDA 4KMUA 4DCCA 3UXNA 4QWEA 3M9OB 2KSOB 1VJ5A 3MR6A 4QZ9A 1NK7A 1Y88A 2NO4A 2QARB 2DGZA 2ATLA 2H3IA 2KV2A 2FPKA 2ZUDA 2WF6A 3GV8B 2HSZA 3L4PA 7ICTA 4DOCA 4X5VA 3TAQA 3UQ2A 2NRWA 4MEYA 4NJ8A 5EE0A 4M9GA 4B9UA 4O5KA 1X6IA 2NV3A 3WU2U 3UPQA 5GTIU 7ICJA 1SXDA 2KIWA 1U4BA 3KTQA 7ICFA 2HVHA 2Y1JA 1ZD5A 4MHVA 4DL3A 4DFDA 4F4YA 3NVVA 4EYHB 4P4OA 2AQ0A 1ZQLA 5ALPA 1KBUA 9ICXA 3RRHA 1PVQA 1WYGA 4YR0A 1FFUA 2C2DA 2OM6A 2ZIXA 4J9RA 3PO4A 2LYHA 3FDSA 1SIJA 1T3NA 3SD7A 2Y1IA 4KX5A 4RUAA 2HHVA 5J0YA 3QZ8A 2P35A 1FFVA 4GFJA 3Q8SB 5IILA 2XCAA 5J2HA 2MUTB 4FBUA 1ZQXA 2GWSA 4IRDA 3EPIA 2K60A 4JB3A 1N63A 3M7DA 5JUMA 3KHGA 2JEJA 3LWMA 2F77X 2FMSA 2C28A 2HW3A 1NK0A 4DL4A 4FE3A 5DDYA 3I76A 5KFGA 1S76D 2JMGA 5KFLA 4KX3A 1QQ7A 4PHPA 1ZQFA 3NGDA 4RZRA 2MSNA 1KRPA 3EYZA 4Y2RA 1RDFA 3UMCA 1XU4A 2PKEA 3CP8A 4DF4A 3H4BA 2BPCA 5ALHA 4JV2A 1X40A 1RG6A 4RQ3A 3ZDCA 4FZMA 1T7PA 2OH2A 2XO7A 2BCQA 7ICEA 3NUQA 1TKDA 1ZQHA 1YZ6A 3OJSA 3RJGA 2FPMA 3HKZF 2AQ4A 3MDAA 3NVYA 1FEZA 5J2CA 3UXPA 4O3PA 1DK3A 4DS5A 5AKEA 1CUKA 3WKBA 4TUQA 4FBTA 1B43A 1KKXA 4CGZA 8ICBA 9ICRA 2XI9A 2BZFA 4P0PA 2IOFK 4AYBC 5KG5A 3PW2A 2BGWA 4YN4A 2ASLA 1XSLA 2ZIWA 1SWVA 4YCXA 3F53A 9ICPA 1LKYB 5BOMA 1L7OA 4I2EA 4DFKA 1LV5A 2KHQA 3H8MA 3WK5A 2GO7A 1WCNA 5JRTA 2DPIA 5BPCA 4F5NA 2K4PA 1D8YA 1WG8A 3KKAC 2W9AA 8ICRA 4JWMA 2W7PA 2H3ZA 4UAUA 4TUPA 4B9LA 4KLEA 5AI5A 1YT3A 3O0FA 3BQ0A 1MN8A 2JH1A 1DXSA 5CEHA 4I2DA 4UQGA 1S0OA 3PR4A 1X9WA 1X9XA 2B21A 4R65A 3RB4A 3D2SA 3C5GA 1UT8A 4NWIA 4Y2PA 1PUZA 5GTHU 5AKHA 1D8BA 3T5KA 2M0NA 2UVVA 2H3VA 4YVZA 3ZDEA 4ECZA 2BCSA 2JZBA 1RM6C 2E5SA 4QW8A 1O08A 5G5GA 2RDIA 8ICGA 4ECYA 2KSOA 4K4HA 1L5UA 2J6TA 4O5EA 2OCEA 2A3VA 4JWNA 1L6NA 2KK0A 5ALNA 2D3DA 5AI9A 2YN4A 2M9NA 4FZLA 2I9GA 4K4GA 3C23A 4EBCA 2EANA 3TADA 1U49A 2FMQA 3C21A 5DBAA 2FE9A 2CN1A 1XNSA 1Z4OA 5J2IA 3SMVA 5KFIA 2FMPA 2BCUA 3WK9A 2HBJA 4DOBA 1ZD3A 3SYZA 8ICWA 1COKA 4RNNA 5AK6A 3IG8A 4CE6A 3BQ7A 3RB3A 4I2FA 4Q44A 3C2MA 1RYSA 4F5OA 2PI4A 4RQMA 3KD3A 1ZJNA 1M6YA 1BGXT 2RLTA 5KT4A 4EEKA 2WAQF 3GILA 5ALZA 3EPGA 3EUB2 4DF8A 2LBOA 1SZHA 4XA5A 4I2JA 4OJ5A 4C4TA 4CF3A 4OD0A 7ICVA 8ICEA 1TK8A 2YMPA 2Q0ZX 5J0QA 1UA0A 4PZNA 2KZMA 3QU2A 5IINA 4TQRA 1KQQA 3KFUF 2HHTA 8ICAA 2PMZF 1SV4A 3Q8RB 2DWQA 2JEFA 1IV8A 5EE1A 3CRXA 4JMUA 4TQSA 2DL0A 3TQ1A 1NKCA 5KL8B 1Z1BA 5KFEA 5CJ7A 3PX4A 2G5HB 5KT3A 3QUCA 4DQPA 4QZEA 3KHHA 2EZXA 9ICUA 2JEIA 1JN3A 5ALUA 3AQFA 4ED8A 5ALTA 3H0RB 9ICTA 8ICMA 3NRZA 5J0RA 1F0MA 5ALJA 4I2HA 3PSFA 4RQNA 2UVWA 5IIKA 4YMNA 1T3QA 3MDCA 3NTUA 3SZ2A 3FYHA 1Z3EB 1KLNA 5KFJA 3UMGA 4XRHA 1J2NA
chains in the Genus database with same CATH topology
1OXJA 1B0XA 4MHVA 4NL9A 1SV0A 4RQMA 2JV3A 5J8YA 3TACB 1LKYB 3KKAA 3H8MA 5JRTA 2L5YA 2K4PA 3KKAC 2D8CA 2EAMA 2E8OA 1KW4A 1PK1A 2E8NA 1DXSA 1PK1B 1LKYA 5JU5A 2KMDA 1X9XA 2ESEA 1UQVA 2GLEA 3SENA 2F44A 2F8KA 4PZNA 1V85A 3SEIA 2K60A 1SGGA 3BS5B 1SV4A 2DKXA 3IDWA 2DL0A 1PK3A 2Y9UA 2KSOA 2LPEA 3BS7A 3TADC 3HILA 2F3NA 2LMRA 2E8PA 1UCVA 2KSOB 3K1RB 5JTIA 2E8MA 1WWUA 5L1MA 2QARB 2D3DA 2ES6A 3BS5A 4PZOA 1Z1VA 1X40A 1RG6A 5KNIA 1B4FA 2EANA 5F3XB 3TADA 2B6GA 2FE9A 2QB0A 2QB1A 1F0MA 2QARA 2Y9TA 4RQNA 4NL9C 1SV0C 2QB0B 2EAPA 4IS7A 4NJ8A 2KG5A 1SXEA 2DKZA 5J8YC 2QKQA 2KE7A 1WWVA 1JI7A 1COKA 1SXDA 2KIVA 2EAOA 1V38A 1X66A 2YTUA 1OW5A 3BQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXJ A;  1B0X A;  4MHV A;  4NL9 A;  1SV0 A;  4RQM A;  2JV3 A;  5J8Y A;  3TAC B;  1LKY B;  3KKA A;  3H8M A;  5JRT A;  2L5Y A;  2K4P A;  3KKA C;  2D8C A;  2EAM A;  2E8O A;  1KW4 A;  1PK1 A;  2E8N A;  1DXS A;  1PK1 B;  1LKY A;  5JU5 A;  2KMD A;  1X9X A;  2ESE A;  1UQV A;  2GLE A;  3SEN A;  2F44 A;  2F8K A;  4PZN A;  1V85 A;  3SEI A;  2K60 A;  1SGG A;  3BS5 B;  1SV4 A;  2DKX A;  3IDW A;  2DL0 A;  1PK3 A;  2Y9U A;  2KSO A;  2LPE A;  3BS7 A;  3TAD C;  3HIL A;  2F3N A;  2LMR A;  2E8P A;  1UCV A;  2KSO B;  3K1R B;  5JTI A;  2E8M A;  1WWU A;  5L1M A;  2QAR B;  2D3D A;  2ES6 A;  3BS5 A;  4PZO A;  1Z1V A;  1X40 A;  1RG6 A;  5KNI A;  1B4F A;  2EAN A;  5F3X B;  3TAD A;  2B6G A;  2FE9 A;  2QB0 A;  2QB1 A;  1F0M A;  2QAR A;  2Y9T A;  4RQN A;  4NL9 C;  1SV0 C;  2QB0 B;  2EAP A;  4IS7 A;  4NJ8 A;  2KG5 A;  1SXE A;  2DKZ A;  5J8Y C;  2QKQ A;  2KE7 A;  1WWV A;  1JI7 A;  1COK A;  1SXD A;  2KIV A;  2EAO A;  1V38 A;  1X66 A;  2YTU A;  1OW5 A;  3BQ7 A; 
#chains in the Genus database with same CATH topology
 2D6F C;  4J9S A;  3IN5 A;  1MSW D;  4QW9 A;  1A6S A;  2W04 A;  3K75 D;  3KZI U;  5AIB A;  3KKA A;  4MFC A;  2W55 A;  4UBC A;  3LVW A;  4EBE A;  1ZXI A;  9ICQ A;  1ZQN A;  3MGV A;  3KOO A;  3C2L A;  5J0U A;  2E8N A;  1ZQW A;  4O3Q A;  4YP3 A;  2G09 A;  3T3F A;  4F4W A;  1PK1 B;  3LWL A;  3HKZ C;  2VA2 A;  3AM9 A;  1ZJM A;  5AKZ A;  4IQW A;  3D6J A;  2AXT U;  4BWJ A;  4NLZ A;  1V85 A;  2W9B B;  4MFF A;  2H3Q A;  3JPP A;  1KFT A;  3GIM A;  3PSP A;  8ICI A;  2UVR A;  1SL1 A;  4M2Y A;  3V7L A;  2Y9U A;  4C7Y A;  5DLF A;  3UQ0 A;  5FP0 A;  2ZXI A;  2UVU A;  4I29 A;  1UCV A;  5ALX A;  3SAF A;  5J0W A;  1S9F A;  4Y2T A;  3G6Y A;  4Y2J A;  4I2A A;  2ASD A;  4UB4 A;  1ZQA A;  2KHV A;  3GFK B;  2XY7 A;  3D2Q A;  5KNI A;  1N2X A;  3LVV A;  1TFR A;  1ECW A;  5ALD A;  3C29 A;  2AJQ A;  2YY6 A;  5HP4 A;  3MFI A;  3LDA A;  2LHT A;  1SV0 C;  3NVW A;  3N4M B;  2KN7 A;  4YG2 A;  4DSI A;  5J2F A;  3JPO A;  3H8W A;  3UXO A;  3GZF A;  8ICN A;  4GIB A;  2RRD A;  9ICO A;  2LKY A;  4O3N A;  4FZN A;  1X9S A;  4PGY A;  4O3M A;  9ICV A;  4XUS A;  5AIA A;  4QNL A;  4EX6 A;  1N48 A;  2QLT A;  1N5W A;  3V6H A;  4CNQ A;  4U6P A;  4KLQ A;  3RB0 A;  2JGA A;  5AKK A;  2ZIV B;  9ICG A;  4RUC A;  3GV7 B;  2HI0 A;  3GU3 A;  2KJ5 A;  3PSI A;  3A0H U;  3RBD A;  2KP7 A;  7ICM A;  2RHF A;  2HOI A;  2YMM A;  4AP9 A;  5J29 A;  1RQN A;  4IQV A;  4C4S A;  2BPF A;  7ICK A;  2HHU A;  3RJH A;  2LM1 A;  4F92 B;  4QIW C;  1XO0 A;  5ALR A;  2JEG A;  5III A;  2A1J B;  4C8O A;  2V4Q A;  1XO1 A;  5KFO A;  1K1Q A;  3M9N B;  1B22 A;  3PW4 A;  2J6U A;  3NS1 A;  3PO5 A;  3MGI A;  1CEZ A;  2BQR A;  3ZD9 A;  4PH5 A;  4ECV A;  1HUO A;  2XY6 A;  3BS5 A;  2MU2 A;  4UAZ A;  5KG6 A;  2R8H A;  4ED6 A;  1QSY A;  9ICA A;  3ZI4 A;  2OWO A;  1BVS A;  3K4G A;  5AK4 A;  1SKR A;  5AI0 A;  5DQH A;  3K1Z A;  5L1K A;  2LYA A;  1KFD A;  3GIJ A;  4B9S A;  2OHF A;  2Y9T A;  1T4G A;  2KVS A;  2WTF A;  1D9F A;  5KFM A;  2QKQ A;  4DEZ A;  4FO6 A;  5E79 U;  2BQU A;  2PMZ C;  2KIV A;  1WUD A;  2YTU A;  1OW5 A;  3A0B U;  1URJ A;  4YXJ A;  4MEX A;  5DDM A;  5J2J A;  1DGJ A;  5J8Y A;  1HEK A;  3PST A;  3RRG A;  3HJE A;  3ISC A;  4M6W A;  3OHB A;  4QWA A;  2ZUC A;  4R8U A;  3VC8 A;  3GDX A;  1KEJ A;  2HBM A;  4UAW A;  4B9M A;  1PK1 A;  1PVR A;  2VKQ A;  1OUQ A;  3RR7 A;  4PPX A;  4QZC A;  5JU5 A;  1UT5 A;  1Q3V A;  1TK5 A;  4RQ2 A;  2KKV A;  3OGU A;  5HMM A;  5AM3 A;  3N7R C;  4KLI A;  4JK1 A;  9ICK A;  3SQI A;  3WKE A;  2FPL A;  3C5F A;  3IP4 B;  3M6Z A;  3N28 A;  3M9M B;  3WKC A;  5ALF A;  4YD2 A;  4Z6D A;  1ZQU A;  4RPX A;  3IDW A;  4R63 A;  2KKP A;  1ZQM A;  4IQT A;  3RJK A;  2W3S A;  1NK8 A;  5TIS U;  2HMX A;  5JTI A;  4F2R A;  3ALR A;  2XC9 A;  4F5P A;  9ICN A;  4UB5 A;  2AU0 A;  1TE2 A;  4C7Z A;  1XC9 A;  2W8K A;  3QU9 A;  5AKX A;  5B66 U;  8ICL A;  5AM1 A;  2HBL A;  2KEY A;  4PGQ A;  4NLG A;  4F5R A;  4YXM A;  2ZTC A;  1SL0 A;  2WB1 F;  2O6K A;  5KFY A;  3EZ5 A;  2EAP A;  4Q8E A;  4EEY A;  1SXE A;  2WF8 A;  5B5E U;  4M9L A;  1TV9 A;  1ZD2 P;  4GLX A;  3TAN A;  1XWL A;  1NK9 A;  1JXL A;  5ALS A;  2KZ3 A;  1ED1 A;  2E1E A;  3HT3 A;  1NZB A;  2N1R A;  4EEN A;  1A0P A;  4LVS A;  4DSJ A;  1KN5 A;  3DDH A;  3ED5 A;  4TUS A;  2BDU A;  3GII A;  1ZET A;  1KFS A;  2IHN A;  2LM4 A;  2ZIV A;  1NOM A;  4NM1 A;  1S5L U;  2CXY A;  4BJQ A;  3U26 A;  2JXJ A;  4GC6 A;  9ICF A;  3QE9 Y;  5KT5 A;  2EAM A;  3RJF A;  4M04 A;  4B9V A;  4PHE A;  4DQR A;  1ZQI A;  4DQQ A;  3H0M B;  4OO1 J;  4F4Z A;  4QZA A;  1ZQD A;  1DOQ A;  3RAX A;  1YZ7 A;  1XSN A;  4QWD A;  2WFA A;  5KT2 A;  3E2E A;  4F4X A;  5DG7 A;  1QTM A;  4UBB A;  3F2B A;  1H38 A;  4IRC A;  4RQ7 A;  2I1Q A;  1L7M A;  2WF7 A;  3TAP A;  3PX6 A;  4CCH A;  3HIL A;  2F3N A;  3Q8M A;  2E8P A;  2CPR A;  1QCK A;  5ALE A;  5L1M A;  2ZJ5 A;  4KLO A;  1S0M A;  4Y2X A;  4DL6 A;  4NLN A;  4G3I A;  4M9J A;  3L3F X;  8ICY A;  1B4F A;  2KVC A;  4BXO B;  5EE3 A;  2MAX A;  4EEL A;  3M8R A;  4F3O A;  1TAQ A;  2PI5 A;  2QAR A;  1JRP A;  4TUR A;  2C2E A;  4JV1 A;  4NL9 C;  3WK6 A;  4IS7 A;  2W9C B;  4K4I A;  5KG2 A;  2Z7J A;  2RDJ A;  4DSL A;  3SI8 A;  4B9T A;  4KN7 A;  5HNK A;  2YQE A;  3I28 A;  3B0X A;  3C1Z A;  2XGP A;  2K4I A;  3OSP A;  3HW8 A;  5D4B A;  4UAT A;  2F8L A;  2VJ5 A;  3PVX A;  2AHO B;  5EOZ A;  4HYK A;  2R18 A;  2W11 A;  4CDG A;  1CI4 A;  1SZP A;  4CRX A;  5ALG A;  1LVH A;  5KFT A;  3PV8 A;  2IHM A;  3PMN A;  1MQ3 A;  1ZQZ A;  2GH1 A;  5AKL A;  3N7S C;  4IR9 A;  4G9B A;  3F2C A;  4UAR A;  3C2K A;  2KFN A;  2Y0S F;  5ALI A;  5F9L A;  4ELT A;  2HBK A;  2ESE A;  8ICK A;  5DBB A;  3SEN A;  4QZG A;  4DS4 A;  3J81 j;  4PL2 A;  2F76 X;  5KG0 A;  3LK9 A;  1Z00 B;  2ISP A;  4ED2 A;  3FAH A;  2JR5 A;  1SGG A;  5J2B A;  1X6J A;  2DKX A;  1RXW A;  1AQ6 A;  3TI0 A;  1P7D A;  4YD1 A;  2E8M A;  3QU5 A;  5ALM A;  2MUT A;  3SV3 A;  4ECX A;  8ICS A;  1NJY A;  4Y2V A;  2F1H A;  4US8 A;  3ETL A;  4Y2Y A;  1BPZ A;  5L1L A;  3Q8Q B;  3THV A;  5CWR A;  4C8K A;  3G6X A;  1ZQQ A;  4M9H A;  1X2I A;  4C80 A;  3SR6 A;  3T79 A;  5KFP A;  2RQ5 A;  2XCP A;  2KJ9 A;  5L1I A;  4O3R A;  5AM0 A;  3RJE A;  5L1J A;  4JUZ A;  1L3U A;  2F1I A;  3QZ7 A;  3NVZ A;  3QX7 A;  4O0I A;  3KHL A;  3RH6 A;  9ICM A;  3Q8L A;  2ZIU B;  2H5X A;  3H7I A;  5DQI A;  3GV5 B;  4C0Z A;  4ELV A;  2E3T A;  3HPO A;  1JI7 A;  2R8I A;  4I27 A;  1U9L A;  4J9K A;  4F5Q A;  4YR2 A;  3M1Y A;  1RYU A;  3F5A A;  5KG1 A;  2YB1 A;  4QZD A;  1TAU A;  4Q8F A;  3ETR A;  3PY8 A;  2BCV A;  4KLH A;  4KLL A;  4QZI A;  5CB1 A;  3H8J A;  1DK2 A;  4J9Q A;  2YMQ A;  5ALO A;  1ZYQ A;  4UAY A;  1VDV A;  1L7N A;  1L3S A;  2NO5 A;  4QZH A;  4F4K A;  2BHN A;  4MF8 A;  4ED0 A;  1LKY A;  2WB1 C;  7ICI A;  1ZQY A;  5J2K A;  2F44 A;  3VCB A;  4R66 A;  3G6V A;  4DQI A;  5HML A;  4B9N A;  1C7Y A;  3BZC A;  7ICN A;  5KFD A;  4I2C A;  3RF9 A;  2F2A B;  2ZJ8 A;  4J9N A;  3QUT A;  3AU2 A;  4UB1 A;  3PNC A;  5J0P A;  4DOA A;  1JMS A;  4RNO A;  2R8G A;  1NKB A;  1KDH A;  4QZF A;  3E58 A;  2KNJ A;  4Q45 A;  3QUQ A;  4B6J A;  4O9M A;  8ICZ A;  4NV0 A;  1A77 A;  2HVI A;  3AU6 A;  3QNM A;  5HR7 A;  3S6J A;  2XID A;  1UHU A;  4JV0 A;  2B6G A;  3BJY A;  4UW9 A;  1A76 A;  1UA1 A;  2QB1 A;  9ICH A;  2W9C A;  1BPD A;  1NJW A;  2WHE A;  2KG5 A;  4UB3 A;  2DKZ A;  1S10 A;  1J2M A;  1WWV A;  1KTQ A;  9ICW A;  2P6R A;  5CP2 A;  2EAO A;  3M8S A;  4NLC A;  4O3O A;  3MFH A;  4RT2 A;  4DO9 A;  4KIT B;  2DBY A;  1V97 A;  3Q8K A;  8ICF A;  2ZIX B;  2NRV A;  1D9D A;  3QYP A;  1QSS A;  2IMW P;  4GC7 A;  3RFA A;  2ZTE A;  5KG7 A;  2G07 A;  3MR3 A;  4OCZ A;  1RZT A;  2ALZ A;  5AHX A;  5KFV A;  5HHI A;  3RBE A;  1SB3 C;  2NRX A;  1ARO P;  3AL0 B;  1NK5 A;  4AYB F;  1HJP A;  2PFQ A;  2XY5 A;  4YFK A;  2W7O A;  8ICC A;  2MA1 A;  5KFF A;  4UB2 A;  4UAS A;  1KL9 A;  1ZQC A;  4BX9 C;  2V9W A;  4NM2 A;  2ODG A;  2VA8 A;  1X42 A;  2VA3 A;  3JPQ A;  3B0Y A;  5J2D A;  2IOF A;  5DB8 A;  3RB6 A;  1L8L A;  2W3R A;  2B0C A;  4QWB A;  4KN4 A;  2FDR A;  2ZUB A;  3OTQ A;  3R9K A;  3QEA Z;  1RXV A;  2BDP A;  2ES6 A;  4PZO A;  1HIW A;  2BPG A;  3FM9 A;  5ALY A;  3AQE A;  1T8E A;  2BKE A;  4USA A;  1ZQO A;  1CRX A;  5CA7 A;  4ECQ A;  2EDU A;  1FIQ A;  2Y0S C;  4P0P B;  9ICJ A;  3ZDD A;  3IRU A;  2AGQ A;  4NLB A;  2WAQ C;  4DL2 A;  3QEB Z;  4US9 A;  1U48 A;  2W03 A;  1N61 A;  5DG8 A;  4YQW A;  3MR5 A;  8ICQ A;  2AGP A;  2DPJ A;  1OXJ A;  4QWC A;  1B0X A;  1BPE A;  5DQG A;  5D49 A;  3PR5 B;  7ICG A;  5ALV A;  1RQL A;  3BQ1 A;  2G08 A;  5J0S A;  1O03 A;  1ZQE A;  1U47 A;  1PVP A;  4QJF B;  1ZD4 A;  4NXZ A;  2D8C A;  4P0Q B;  3WK8 A;  4Y2Q A;  1F44 A;  2EZZ A;  1XS9 D;  2XIC A;  2JZB B;  5AM5 A;  2IA6 A;  5DKW A;  3NRW A;  1BNP A;  3TKA A;  1VLB A;  2AH5 A;  4OJO A;  5EWE A;  5L9X A;  4RQ5 A;  5KL1 B;  2FJ6 A;  3H40 A;  1ZQJ A;  3JPT A;  5J0T A;  1JXE A;  1BNO A;  3DEE A;  5DGA A;  4E0D A;  4MFA A;  3TAD C;  3ISB A;  2W9B A;  1WWU A;  4RNM A;  3JPN A;  4UB8 U;  4FS1 A;  4KTQ A;  1JIH A;  1Z1V A;  7ICU A;  1J97 A;  3RAQ A;  4F71 A;  5KAI U;  4QZB A;  3KBB A;  5F3X B;  5AKI A;  5ALW A;  2WF5 A;  3BQ2 A;  5KFR A;  2YML A;  1IM4 A;  1ZRN A;  9ICS A;  4DFJ A;  3V7J A;  4C4R A;  4NLK A;  2QB0 B;  2E1F A;  1N5X A;  4Y2S A;  3V72 A;  3TFR A;  1U45 A;  4O3S A;  2NRZ A;  5KFB A;  4DSE A;  1V9P A;  5EWF A;  3IM1 A;  4OJL A;  1X66 A;  4C8N A;  7ICR A;  4ICA A;  5IIM A;  1SV0 A;  2K4H A;  3UMB A;  2JV3 A;  2KJ8 A;  3RTV A;  4RT3 A;  4UB6 U;  3AEV A;  5KTQ A;  1JRO A;  1IG6 A;  2L5Y A;  3OJU A;  2I6X A;  3HP6 A;  1QLN A;  4KLM A;  1ZQB A;  3TFS A;  1WCL A;  1KW4 A;  1UPH A;  4R64 A;  5DB9 A;  3ONN A;  5DB7 A;  3JPS A;  1C20 A;  4C8M A;  5A0L A;  2J6S A;  2RP5 A;  4ECU A;  1UQV A;  2GLE A;  4BWM A;  5CHG A;  5KFW A;  2WF9 A;  8ICJ A;  8ICX A;  2XGQ A;  2EQY A;  3PX0 A;  3PW7 A;  2KFZ A;  1TK0 A;  1T94 A;  3V6J A;  1HUZ A;  1JX4 A;  4KLD A;  4KLJ A;  5KFN A;  1SWW A;  2LPE A;  1ZQS A;  7ICH A;  5AKY A;  5IIJ A;  1XSP A;  1NKE A;  5HR6 A;  5KT7 A;  1SL2 A;  1RPL A;  3IG5 A;  2ZJA A;  5KFQ A;  4DWI A;  1Q3U A;  3E0F A;  4ZH4 A;  2HHS A;  2A1J A;  4Y2U A;  8ICO A;  2MRL A;  4YMM A;  2FLN A;  2JH7 A;  3L5K A;  2EH9 A;  4PHA A;  4RQ1 A;  1ZQV A;  4FFD A;  4LZD A;  5DLG A;  7ICL A;  3AUO A;  1COO A;  1ZQK A;  2HOQ A;  3I1Y A;  3LYS A;  4DFM A;  1SKS A;  3C28 A;  5BOL A;  2ASJ A;  5KFU A;  3TAR A;  2KE7 A;  4YMO A;  4EYI B;  4ECW A;  4CF5 A;  4EX7 A;  4P2H A;  3MBY A;  2HDO A;  2EZY A;  5G5H A;  2K89 A;  5J0O A;  9ICI A;  4O5C A;  2H3F A;  4NY8 A;  4ED3 A;  4GXJ A;  3JPR A;  4U7C A;  5AM2 A;  4P0Q A;  3UM9 A;  4KLG A;  5AK3 A;  3MC1 A;  2YB4 A;  3EW9 A;  4ECS A;  4F91 B;  4F72 A;  5J2E A;  2ZTD A;  4GXK A;  4IRK A;  4XQ8 A;  5AI8 A;  1MC8 A;  1K5O A;  3MAB A;  2FLL A;  1Q8K A;  4CF4 A;  1NK6 A;  2K8C B;  4F8R A;  1L8O A;  2OYY A;  1QH9 A;  1BPB A;  3DV9 A;  8ICP A;  5TZV A;  3QU4 A;  5ALL A;  4RU9 A;  1IIP A;  4F50 A;  8ICH A;  7ICP A;  4Z6E A;  1Z19 A;  1NJZ A;  2I5H A;  3RJJ A;  5AM4 A;  1S77 D;  3PZP A;  4UAV A;  2DQN B;  3ORY A;  3WK7 A;  2A19 A;  4QIW F;  4DLG A;  3ZDB A;  5J2G A;  5AI6 A;  3N97 B;  9ICB A;  2IBK A;  1ZQP A;  1GO3 F;  1ZOL A;  4J9L A;  4M47 A;  2OEH A;  2QB0 A;  1FO4 A;  1NK4 A;  5DBC A;  4PGX A;  2BCR A;  2BR0 A;  4DSK A;  5KFS A;  1QQ6 A;  5DGB A;  3ICX A;  3OPX A;  8ICT A;  5KFZ A;  2A1A A;  2NYV A;  3OSN A;  3T5H A;  5KFC A;  4WJ3 B;  5K4L A;  4J03 A;  1ZRM A;  2R8K A;  3N7P D;  4Z6C A;  4F93 B;  5CR0 A;  1L7P A;  4P4P A;  2R8J A;  3RH4 A;  3FC4 A;  1NZP A;  4RPZ A;  1SKW A;  3RH5 A;  5AKJ A;  7ICO A;  4M9N A;  2F1J A;  2KOB A;  4IL6 U;  1F5S A;  4I2G A;  5T14 A;  4Z6F A;  2Q4T A;  4PL1 A;  2K4E A;  5J0X A;  5EE9 A;  3D2N A;  2BQ3 A;  4MF2 A;  5KT6 A;  2V4R A;  3ZDA A;  3SV4 A;  3M6K A;  4DSF A;  9ICC A;  3PW0 A;  5DB6 A;  4IQU A;  4GXI A;  4M0A A;  3V7K A;  5CRX A;  3KZX A;  3C1Y A;  4BUG A;  4KLT A;  2JHD A;  1L3T A;  3BS5 B;  1MQ2 A;  3H8S A;  5C5J A;  4IR1 A;  2XVT A;  5C0Y A;  1K1S A;  4ED1 A;  4DFP A;  3BS7 A;  4IC9 A;  1ZQT A;  4I2B A;  2LMR A;  3QU7 A;  3Q8P B;  3K1R B;  1ZQG A;  1KSP A;  2DF4 B;  4RQ6 A;  4ECT A;  4PHD A;  5D46 A;  2YX8 A;  2HHQ A;  2PXI A;  2LYB A;  3ISD A;  1S0V A;  4LJX A;  4QZ8 A;  4A8E A;  4DL7 A;  3WK4 A;  2CRX A;  2G5I B;  1MA7 A;  1NJX A;  1ZQR A;  5ALK A;  1DGS A;  3V6K A;  5J8Y C;  3F2D A;  2HHW A;  4BXO A;  4HAI A;  1EXN A;  1NNL A;  4M6W B;  5EWG A;  4R8U B;  2KZZ A;  3GQC A;  1V38 A;  3AMZ A;  2DUY A;  5J2A A;  3H0L B;  4RQ8 A;  3EWA A;  3HRD D;  3AN1 A;  1ZQ1 C;  4KMO B;  4NL9 A;  4OJ6 A;  3WKD A;  8ICU A;  1Q46 A;  4Q43 A;  3H4D A;  3CYM A;  2IOH A;  3BZK A;  4J9P A;  2OXO A;  3PW5 A;  3F5E A;  1S8O A;  2E8O A;  5KG4 A;  4C8L A;  2FLP A;  4ACO A;  3QXG A;  1IXR A;  5F9N A;  2PFN A;  5KFX A;  5KAF U;  1QSL A;  5KG3 A;  3CNH A;  3SAG A;  2C22 A;  4YR3 A;  2VJ4 A;  2KMD A;  3B9J A;  2HHX A;  4BGD A;  1Z4N A;  3WKA A;  4KLU A;  4ELU A;  2NRT A;  4KLF A;  5KFA A;  2W9M A;  4RQ0 A;  1BPX A;  2KTQ A;  5AK5 A;  2JRZ A;  2PFP A;  3T5L A;  2P6U A;  2W8L A;  1RYR A;  4J9M A;  4EZ6 A;  2DFL A;  4J9O A;  4RPY A;  1LB2 B;  1JUD A;  3MGH A;  3HWT A;  1DRG A;  4DL5 A;  2AGO A;  9ICE A;  3PML A;  2ISO A;  1Z00 A;  2KIC A;  1N60 A;  1NI3 A;  3RJI A;  3IHQ B;  5DG9 A;  3GIK A;  2K8B B;  4LZG A;  5HHH A;  7ICS A;  1N56 A;  3NAS A;  3T5J A;  2GOL A;  2G06 A;  5AIC A;  3BDP A;  4I28 A;  1BPY A;  1X9M A;  5IIO A;  4DQS A;  2ZG6 A;  3BQT A;  4BDP A;  4ECR A;  2ZXH A;  2LI6 A;  2FI1 A;  3IV6 A;  4I2I A;  1N62 A;  2K8A A;  3ZD8 A;  2W43 A;  3CW2 C;  4RQ4 A;  2VAN A;  2VIX A;  3MR2 A;  1TAM A;  1S0N A;  4KLS A;  4F2S A;  2ZIU A;  3TAC B;  7ICQ A;  1S97 A;  2ZIW B;  3OHA A;  2W54 A;  2C2R A;  2HCF A;  4OJP A;  4ZOH C;  3KHR A;  3RR8 A;  5AKG A;  2G0A A;  3HX0 A;  4ED7 A;  5ALQ A;  5KFH A;  1PZN A;  9ICL A;  4FS2 A;  2PFO A;  1QQ5 A;  4DLE A;  4EZ9 A;  5KFK A;  2F8K A;  2KD1 A;  4PJ0 U;  2HOF A;  1JAL A;  2P66 A;  3SEI A;  4P4M A;  1TVA A;  5AI4 A;  1D8L A;  3SAH A;  5H2F U;  8ICV A;  3QUB A;  1L3V A;  1PK3 A;  4EBD A;  4KMU A;  4DCC A;  3UXN A;  4QWE A;  3M9O B;  2KSO B;  1VJ5 A;  3MR6 A;  4QZ9 A;  1NK7 A;  1Y88 A;  2NO4 A;  2QAR B;  2DGZ A;  2ATL A;  2H3I A;  2KV2 A;  2FPK A;  2ZUD A;  2WF6 A;  3GV8 B;  2HSZ A;  3L4P A;  7ICT A;  4DOC A;  4X5V A;  3TAQ A;  3UQ2 A;  2NRW A;  4MEY A;  4NJ8 A;  5EE0 A;  4M9G A;  4B9U A;  4O5K A;  1X6I A;  2NV3 A;  3WU2 U;  3UPQ A;  5GTI U;  7ICJ A;  1SXD A;  2KIW A;  1U4B A;  3KTQ A;  7ICF A;  2HVH A;  2Y1J A;  1ZD5 A;  4MHV A;  4DL3 A;  4DFD A;  4F4Y A;  3NVV A;  4EYH B;  4P4O A;  2AQ0 A;  1ZQL A;  5ALP A;  1KBU A;  9ICX A;  3RRH A;  1PVQ A;  1WYG A;  4YR0 A;  1FFU A;  2C2D A;  2OM6 A;  2ZIX A;  4J9R A;  3PO4 A;  2LYH A;  3FDS A;  1SIJ A;  1T3N A;  3SD7 A;  2Y1I A;  4KX5 A;  4RUA A;  2HHV A;  5J0Y A;  3QZ8 A;  2P35 A;  1FFV A;  4GFJ A;  3Q8S B;  5IIL A;  2XCA A;  5J2H A;  2MUT B;  4FBU A;  1ZQX A;  2GWS A;  4IRD A;  3EPI A;  2K60 A;  4JB3 A;  1N63 A;  3M7D A;  5JUM A;  3KHG A;  2JEJ A;  3LWM A;  2F77 X;  2FMS A;  2C28 A;  2HW3 A;  1NK0 A;  4DL4 A;  4FE3 A;  5DDY A;  3I76 A;  5KFG A;  1S76 D;  2JMG A;  5KFL A;  4KX3 A;  1QQ7 A;  4PHP A;  1ZQF A;  3NGD A;  4RZR A;  2MSN A;  1KRP A;  3EYZ A;  4Y2R A;  1RDF A;  3UMC A;  1XU4 A;  2PKE A;  3CP8 A;  4DF4 A;  3H4B A;  2BPC A;  5ALH A;  4JV2 A;  1X40 A;  1RG6 A;  4RQ3 A;  3ZDC A;  4FZM A;  1T7P A;  2OH2 A;  2XO7 A;  2BCQ A;  7ICE A;  3NUQ A;  1TKD A;  1ZQH A;  1YZ6 A;  3OJS A;  3RJG A;  2FPM A;  3HKZ F;  2AQ4 A;  3MDA A;  3NVY A;  1FEZ A;  5J2C A;  3UXP A;  4O3P A;  1DK3 A;  4DS5 A;  5AKE A;  1CUK A;  3WKB A;  4TUQ A;  4FBT A;  1B43 A;  1KKX A;  4CGZ A;  8ICB A;  9ICR A;  2XI9 A;  2BZF A;  4P0P A;  2IOF K;  4AYB C;  5KG5 A;  3PW2 A;  2BGW A;  4YN4 A;  2ASL A;  1XSL A;  2ZIW A;  1SWV A;  4YCX A;  3F53 A;  9ICP A;  1LKY B;  5BOM A;  1L7O A;  4I2E A;  4DFK A;  1LV5 A;  2KHQ A;  3H8M A;  3WK5 A;  2GO7 A;  1WCN A;  5JRT A;  2DPI A;  5BPC A;  4F5N A;  2K4P A;  1D8Y A;  1WG8 A;  3KKA C;  2W9A A;  8ICR A;  4JWM A;  2W7P A;  2H3Z A;  4UAU A;  4TUP A;  4B9L A;  4KLE A;  5AI5 A;  1YT3 A;  3O0F A;  3BQ0 A;  1MN8 A;  2JH1 A;  1DXS A;  5CEH A;  4I2D A;  4UQG A;  1S0O A;  3PR4 A;  1X9W A;  1X9X A;  2B21 A;  4R65 A;  3RB4 A;  3D2S A;  3C5G A;  1UT8 A;  4NWI A;  4Y2P A;  1PUZ A;  5GTH U;  5AKH A;  1D8B A;  3T5K A;  2M0N A;  2UVV A;  2H3V A;  4YVZ A;  3ZDE A;  4ECZ A;  2BCS A;  2JZB A;  1RM6 C;  2E5S A;  4QW8 A;  1O08 A;  5G5G A;  2RDI A;  8ICG A;  4ECY A;  2KSO A;  4K4H A;  1L5U A;  2J6T A;  4O5E A;  2OCE A;  2A3V A;  4JWN A;  1L6N A;  2KK0 A;  5ALN A;  2D3D A;  5AI9 A;  2YN4 A;  2M9N A;  4FZL A;  2I9G A;  4K4G A;  3C23 A;  4EBC A;  2EAN A;  3TAD A;  1U49 A;  2FMQ A;  3C21 A;  5DBA A;  2FE9 A;  2CN1 A;  1XNS A;  1Z4O A;  5J2I A;  3SMV A;  5KFI A;  2FMP A;  2BCU A;  3WK9 A;  2HBJ A;  4DOB A;  1ZD3 A;  3SYZ A;  8ICW A;  1COK A;  4RNN A;  5AK6 A;  3IG8 A;  4CE6 A;  3BQ7 A;  3RB3 A;  4I2F A;  4Q44 A;  3C2M A;  1RYS A;  4F5O A;  2PI4 A;  4RQM A;  3KD3 A;  1ZJN A;  1M6Y A;  1BGX T;  2RLT A;  5KT4 A;  4EEK A;  2WAQ F;  3GIL A;  5ALZ A;  3EPG A;  3EUB 2;  4DF8 A;  2LBO A;  1SZH A;  4XA5 A;  4I2J A;  4OJ5 A;  4C4T A;  4CF3 A;  4OD0 A;  7ICV A;  8ICE A;  1TK8 A;  2YMP A;  2Q0Z X;  5J0Q A;  1UA0 A;  4PZN A;  2KZM A;  3QU2 A;  5IIN A;  4TQR A;  1KQQ A;  3KFU F;  2HHT A;  8ICA A;  2PMZ F;  1SV4 A;  3Q8R B;  2DWQ A;  2JEF A;  1IV8 A;  5EE1 A;  3CRX A;  4JMU A;  4TQS A;  2DL0 A;  3TQ1 A;  1NKC A;  5KL8 B;  1Z1B A;  5KFE A;  5CJ7 A;  3PX4 A;  2G5H B;  5KT3 A;  3QUC A;  4DQP A;  4QZE A;  3KHH A;  2EZX A;  9ICU A;  2JEI A;  1JN3 A;  5ALU A;  3AQF A;  4ED8 A;  5ALT A;  3H0R B;  9ICT A;  8ICM A;  3NRZ A;  5J0R A;  1F0M A;  5ALJ A;  4I2H A;  3PSF A;  4RQN A;  2UVW A;  5IIK A;  4YMN A;  1T3Q A;  3MDC A;  3NTU A;  3SZ2 A;  3FYH A;  1Z3E B;  1KLN A;  5KFJ A;  3UMG A;  4XRH A;  1J2N A; 
#chains in the Genus database with same CATH homology
 1OXJ A;  1B0X A;  4MHV A;  4NL9 A;  1SV0 A;  4RQM A;  2JV3 A;  5J8Y A;  3TAC B;  1LKY B;  3KKA A;  3H8M A;  5JRT A;  2L5Y A;  2K4P A;  3KKA C;  2D8C A;  2EAM A;  2E8O A;  1KW4 A;  1PK1 A;  2E8N A;  1DXS A;  1PK1 B;  1LKY A;  5JU5 A;  2KMD A;  1X9X A;  2ESE A;  1UQV A;  2GLE A;  3SEN A;  2F44 A;  2F8K A;  4PZN A;  1V85 A;  3SEI A;  2K60 A;  1SGG A;  3BS5 B;  1SV4 A;  2DKX A;  3IDW A;  2DL0 A;  1PK3 A;  2Y9U A;  2KSO A;  2LPE A;  3BS7 A;  3TAD C;  3HIL A;  2F3N A;  2LMR A;  2E8P A;  1UCV A;  2KSO B;  3K1R B;  5JTI A;  2E8M A;  1WWU A;  5L1M A;  2QAR B;  2D3D A;  2ES6 A;  3BS5 A;  4PZO A;  1Z1V A;  1X40 A;  1RG6 A;  5KNI A;  1B4F A;  2EAN A;  5F3X B;  3TAD A;  2B6G A;  2FE9 A;  2QB0 A;  2QB1 A;  1F0M A;  2QAR A;  2Y9T A;  4RQN A;  4NL9 C;  1SV0 C;  2QB0 B;  2EAP A;  4IS7 A;  4NJ8 A;  2KG5 A;  1SXE A;  2DKZ A;  5J8Y C;  2QKQ A;  2KE7 A;  1WWV A;  1JI7 A;  1COK A;  1SXD A;  2KIV A;  2EAO A;  1V38 A;  1X66 A;  2YTU A;  1OW5 A;  3BQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...