2Y9TA

Structural basis of p63a sam domain mutants involved in aec syndrome
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
b'GSYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUMOR PROTEIN 63
publication title Structural Basis of P63Alpha Sam Domain Mutants Involved in Aec Syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2y9tA00
1COKA 1B0XA 2YTUA 1UCVA 2B6GA 1X66A 1WWUA 1PK1B 2DKXA 1V38A 3BS5B 2EAMA 2LMRA 1SV0C 3HILA 2E8PA 3H8MA 3SENA 1X40A 2E8OA 3KKAC 2L5YA 2E8MA 1PK1A 3BS7A 4RQMA 3TACB 2K60A 3BS5A 5J8YA 1SXDA 2LPEA 2EAPA 5KNIA 2Y9UA 1JI7A 2DKZA 3KKAA 2QB0A 2KE7A 3BQ7A 3K1RB 5J8YC 1RG6A 1KW4A 4NL9C 2KSOA 2F8KA 2DL0A 5JRTA 4PZNA 1F0MA 1PK3A 1B4FA 4MHVA 1WWVA 2F3NA 2GLEA 4NL9A 2E8NA 1DXSA 2QARB 4NJ8A 2D8CA 5JU5A 2QKQA 2QB1A 1SGGA 3IDWA 4RQNA 2EANA 5F3XB 2KIVA 2ESEA 2QARA 1X9XA 1OXJA 1LKYB 2KMDA 5JTIA 4PZOA 2ES6A 3TADA 1V85A 2EAOA 3SEIA 2KG5A 2FE9A 2QB0B 4IS7A 5L1MA 2F44A 2JV3A 3TADC 1UQVA 2K4PA 1SV4A 1Z1VA 1SXEA 2KSOB 1LKYA 1OW5A 2D3DA 1SV0A 2Y9TA
chains in the Genus database with same CATH superfamily
4O3QA 2JEFA 1N5WA 4IR1A 5KFJA 2Y1IA 2K89A 3RB6A 3RH4A 4EX6A 3PR5B 1L6NA 4Z6EA 3QXGA 8ICZA 3AN1A 1X40A 1J2NA 1WG8A 1RQLA 1X9SA 2E8MA 1QQ5A 3VC8A 4RQMA 3TACB 5ALGA 4UAYA 2GH1A 2KVSA 5DG9A 1RM6C 5HMMA 2NRWA 2W7PA 3QUTA 4RQ2A 4Q45A 2VJ5A 5BPCA 1N62A 4J9NA 4JK1A 3ONNA 4DSFA 4DSJA 2F8KA 2KTQA 3RRGA 1F0MA 2B21A 2EH9A 5ALUA 4DWIA 3RAQA 4O0IA 4YXJA 4UAWA 2F3NA 1NZBA 5KT2A 4DQPA 3BZKA 5C5JA 4UB3A 4EYHB 9ICEA 2IOFA 4RT3A 3AEVA 3TKAA 3A0HU 4YR2A 3CYMA 4DL5A 1QQ7A 2UVUA 4EELA 2ISPA 3HX0A 4BWJA 4YD1A 4DL2A 1X9XA 1OXJA 3AMZA 5AKXA 4KLFA 4F3OA 3O0FA 4HYKA 2PMZF 3UXOA 4I2FA 4FZNA 1SKRA 2QB0B 4IS7A 2DUYA 4KLEA 2ASLA 2HBLA 3RH6A 3TADC 4MF8A 1HJPA 2JHDA 1QH9A 2BDUA 2Y9TA 2ZTDA 4Y2VA 3V72A 4G9BA 5ALTA 1HIWA 3BS5B 4BGDA 5IIMA 3LWLA 5ALKA 3D2QA 4YCXA 3KD3A 2MUTA 1T7PA 9ICBA 3H8MA 9ICNA 9ICIA 4RNNA 4EBEA 4QZAA 2KHQA 3T5LA 1IIPA 5AI4A 1O08A 5L1JA 3RTVA 5J2EA 1JALA 2Y1JA 1SKWA 5D49A 3N4MB 1BPDA 4C8LA 4OJLA 9ICQA 5J2AA 2BQUA 1KW4A 3T5KA 2WF6A 1TE2A 1ZD4A 4HAIA 4DL3A 4QWAA 1ZQZA 4JV0A 4RT2A 3RF9A 2JRZA 4M47A 1AROP 5DBAA 9ICHA 2HBMA 4M2YA 4DF4A 1URJA 5AI0A 3MGHA 4XQ8A 2GO7A 1TKDA 3QUQA 4M6WA 4EZ9A 1S8OA 2MRLA 5AKYA 3MFHA 4Y2JA 2W9CB 1T3NA 4FBTA 1U4BA 1IG6A 2ZIUB 2FPLA 2ZIVB 3LYSA 2P6RA 5KFWA 2LM1A 2RQ5A 5EOZA 5JUMA 5ALMA 1TAMA 4QWEA 7ICSA 3WKAA 4C7ZA 5AKLA 2OCEA 4RU9A 5HR6A 1COKA 1B0XA 2UVWA 5ALEA 2B6GA 4Y2TA 4CCHA 2Q0ZX 7ICUA 2MU2A 2FMQA 1MC8A 5ALLA 4Q43A 3OPXA 9ICGA 5KFGA 2LMRA 2G09A 3Q8PB 2XVTA 2WHEA 3GFKB 3MR2A 3JPQA 1SL1A 2HHUA 3ISCA 5AIAA 3RRHA 3RJKA 2K60A 4IL6U 5ALWA 8ICFA 3BQTA 2JZBB 4Y2RA 4PHAA 2UVRA 3EZ5A 3KZIU 4ED1A 4KLHA 2KE7A 1Z00B 4BXOA 2C2DA 2BPCA 4NL9C 2KSOA 4O3RA 4CF3A 3SV3A 1XNSA 1PK3A 4M9JA 2LYAA 4PGYA 2K4IA 1L3TA 5J2BA 4FO6A 2CN1A 4QIWC 3F2CA 1LVHA 4I28A 1RDFA 5KFDA 5J2GA 5D46A 4WJ3B 4Y2SA 2ZIXB 2WF9A 1MQ3A 3E2EA 1PVRA 4QZHA 3LDAA 1NI3A 4KMUA 4UB6U 3L4PA 2KKVA 1KLNA 3M7DA 4DFJA 7ICVA 4O5KA 1ZQOA 4O5EA 5J2HA 5DBCA 2BQRA 4K4IA 4KLGA 1IXRA 5EE3A 4KX3A 2KZZA 2QARA 3ALRA 1LKYB 5JTIA 3I76A 3PSIA 2BCVA 2DWQA 4O5CA 2KG5A 2FE9A 4UARA 4BWMA 5KFZA 5L1MA 8ICMA 4E0DA 2ZJ5A 1KTQA 4OD0A 4TUPA 4ED0A 4UB2A 2HW3A 2C28A 4BJQA 1WWUA 4F5NA 3I28A 2GWSA 4R66A 5KFLA 1KL9A 4IRCA 1Q3UA 5J2KA 7ICIA 2W9MA 1D8BA 2XGPA 1KEJA 5FP0A 8ICQA 1ZQLA 2PI5A 1SXDA 2AQ0A 4NM2A 1K1QA 4US9A 1L7PA 4J9RA 5KFXA 4P0QA 2MA1A 3HP6A 2FLPA 1QSSA 8ICGA 2FLNA 1KDHA 3ISDA 1YT3A 2R8JA 2G5HB 2AXTU 4J9OA 3RH5A 5ALFA 5ALYA 3QE9Y 2JH1A 2PKEA 3BDPA 4PPXA 1JROA 1X6IA 4Z6DA 4B9NA 4P4PA 2ZXHA 4ICAA 5J0UA 4FFDA 5KFFA 4B9TA 2YX8A 3M9MB 3IG8A 3QUCA 4QZFA 1CEZA 2NRZA 5KFMA 1JXEA 8ICYA 4C8MA 4RQ3A 1XC9A 1T3QA 2A1JA 1DGJA 2PFQA 1TVAA 1CUKA 3AU2A 1V85A 2GOLA 3F2BA 2AGOA 2YB1A 2HVIA 2WF8A 2DGZA 2H5XA 2HDOA 5ALIA 2KZ3A 2BCQA 2OXOA 4R65A 5EWEA 1HUOA 2EZXA 3H4DA 1S5LU 3LWMA 1ZQBA 1ZETA 2KIWA 8ICLA 5HR7A 3RJJA 1U9LA 1PUZA 7ICRA 5J2JA 3WK5A 4DFMA 4M9NA 4EENA 3T79A 3OHBA 2H3IA 1ZQFA 5DDMA 3M9NB 5AK6A 4ECSA 1ZQNA 5KT7A 2E8OA 1JN3A 3GV5B 2D6FC 1Z4OA 3I1YA 5KFHA 4C8NA 3M1YA 3C1YA 4OJOA 4KLJA 2BCSA 4DLGA 2YMMA 3S6JA 2W9AA 4FBUA 8ICWA 3IHQB 3KKAA 1D9FA 2DBYA 4DF8A 4ECQA 4RQ1A 1HEKA 2I9GA 1NZPA 2ZIWA 1VDVA 1LB2B 1ZQDA 4JMUA 1UA1A 4I2HA 1NJZA 5KAFU 5F9NA 4Y2XA 4CGZA 4DOCA 2K8CB 4QWBA 1NJWA 1H38A 1S97A 1DXSA 8ICRA 2PFNA 3C29A 4U6PA 2W7OA 1UT8A 4ED2A 3AM9A 3OGUA 4ZOHC 3IDWA 5ALJA 5DQIA 3PMLA 4KLIA 3WK9A 5J0WA 2EANA 1SWVA 4P0PB 1QQ6A 4DLEA 4AYBF 1ZQAA 3BZCA 2F76X 2K8BB 9ICVA 2JEIA 3QYPA 2YY6A 2G0AA 5KFAA 2ZTCA 4I2EA 3HKZC 2KNJA 2JEJA 4ACOA 3PR4A 3H0MB 7ICOA 4RQ4A 2F2AB 2JV3A 2FMSA 2AHOB 4RPXA 5D4BA 4IQUA 1SXEA 2KSOB 3ZI4A 4JWNA 4I2BA 4EEYA 5KG1A 4PGQA 2G07A 4QZEA 5CA7A 4EEKA 1XO0A 9ICOA 3PW4A 5L9XA 4EBDA 2I1QA 2A1AA 4ECZA 2BCUA 5KFYA 2AH5A 3QU2A 1YZ6A 4DOAA 3C2KA 1P7DA 4TUQA 4X5VA 2RP5A 1ZQSA 4DEZA 3H0RB 3GIKA 4DL6A 1YZ7A 3F53A 3UM9A 2F1JA 3IRUA 2LBOA 5HHHA 4J9SA 5AKHA 4GC6A 7ICJA 4ZH4A 2DL0A 2BPGA 5J0RA 8ICUA 5KFVA 3OSNA 5AI5A 5AKKA 5ALQA 5CHGA 2NYVA 3K4GA 4RPZA 3PX6A 3F5EA 4IRKA 1IV8A 1SB3C 4EX7A 4RNMA 3GV8B 4DL7A 2R8GA 3RJIA 4F5QA 2DF4B 3ZDEA 3VCBA 3KHHA 1BNPA 5J0OA 5DB8A 3QX7A 5ALZA 4I27A 2OH2A 5CEHA 3TADA 4RQ0A 5KG3A 4RZRA 2W55A 3T5HA 3UXNA 4QZ9A 4YR0A 3THVA 3HKZF 4OJ5A 1D9DA 2DQNB 1NJYA 1S0NA 2ZJAA 3TARA 1L7MA 3JPPA 1S10A 4ELVA 3WKBA 4PHEA 4ECXA 3PW0A 1SKSA 4YMMA 2E8PA 9ICKA 2PFOA 1ECWA 5ALNA 8ICPA 3L3FX 2ATLA 4MFAA 2RHFA 4LZDA 2HMXA 4ECYA 5KFUA 3G6XA 4UAZA 4F72A 5KFPA 3M6KA 1U49A 2ASDA 2W03A 3PV8A 1MSWD 4F93B 2KICA 4M0AA 3D2SA 4UBBA 2BQ3A 4YMOA 1VLBA 5J8YC 4RQ5A 3SZ2A 5AM0A 3C23A 3Q8RB 3FC4A 3RJEA 2PI4A 2IA6A 5J2FA 1ZQQA 3JPNA 4ECWA 5AIBA 9ICLA 2M0NA 3OJSA 5KFKA 2KN7A 1N48A 1CRXA 2W54A 3V6KA 1L3UA 4Q44A 5DDYA 3MR3A 1DRGA 4J9LA 5IIJA 5ALOA 2QKQA 4YR3A 1TAUA 1TAQA 3Q8LA 4B9MA 4I2CA 3MGVA 5L1IA 4Y2PA 2H3QA 2KIVA 4I2AA 1NKCA 8ICOA 3WK8A 2OWOA 3CNHA 1KFTA 3H4BA 2R18A 2KFNA 5KTQA 1Z4NA 2F44A 2AU0A 3QU5A 5KG4A 1IM4A 5AKZA 3F2DA 2W3RA 4MEXA 4NLGA 3NRWA 4RUCA 9ICXA 2K8AA 2EQYA 4B9UA 4C8KA 5KFEA 2KJ8A 4KN4A 4KMOB 4O3MA 3A0BU 1S77D 8ICCA 3NVYA 1TK5A 2VA2A 9ICRA 5AM3A 1C20A 3QUBA 8ICIA 1L8LA 4KLSA 2R8HA 1XSLA 1PK1A 2VA3A 2A19A 3BQ0A 2EAPA 1NOMA 1V9PA 4P4MA 4QZDA 1JI7A 2DKZA 3MABA 3SD7A 3B9JA 4F2RA 1ZQHA 4YD2A 1JRPA 5AK4A 3HWTA 2HVHA 3SAHA 5KT3A 3SAGA 3EUB2 2KZMA 7ICGA 4PZNA 4EBCA 3RBDA 4DFPA 5IIOA 3UXPA 3GV7B 3PW7A 4ELTA 4DSIA 4ECVA 2V4QA 2E8NA 3ICXA 3IM1A 2HBKA 1MA7A 3WK7A 4M9GA 3KTQA 1A0PA 1X6JA 5IIIA 4KLMA 5AI6A 3TFSA 3C21A 5AI9A 4KN7A 1D8LA 4TURA 8ICVA 3AL0B 4DO9A 4PHPA 4PGXA 1PZNA 2ASJA 1FO4A 1ZXIA 2CPRA 1U45A 3D6JA 2H3ZA 5B66U 2NV3A 2YMQA 4DOBA 4ELUA 3QZ7A 3EYZA 5C0YA 1BPBA 5AICA 3KHLA 4IQTA 3UMBA 3J81j 5DLGA 4JV1A 3TANA 5KFBA 4K4HA 5KFRA 5AK5A 3TAPA 3RBEA 3EPGA 1TK8A 1SV0C 4C4RA 1VJ5A 3QU4A 1XWLA 3SENA 9ICTA 4DSLA 5KL8B 2NRVA 1ZQUA 2JR5A 2B0CA 1XSPA 4GIBA 4JUZA 2ZUBA 3KFUF 5KFTA 4ECTA 4IRDA 5DKWA 2IHNA 4F4WA 4JV2A 3M6ZA 2MSNA 4O3OA 3FAHA 3K1RB 4UB8U 1U48A 1WYGA 2EDUA 2XY7A 5J0XA 2VANA 4UB5A 1ZQJA 3ED5A 2HBJA 1T4GA 3ZDDA 4MFCA 3UMCA 2RDJA 3PNCA 2WF5A 3R9KA 1ZJNA 1WCNA 3JPTA 3U26A 1L7OA 3RFAA 2KOBA 1WWVA 5B5EU 1XSNA 4F5OA 1WUDA 4ECUA 2XCPA 1S0VA 3PSFA 2JH7A 1RXVA 4Y2QA 4BUGA 1XU4A 1BPZA 4NLNA 1SGGA 2W8KA 2NO4A 4RQNA 1Z3EB 1JX4A 4J9KA 5KG0A 1UA0A 4QNLA 5F3XB 1ZQIA 3SQIA 2PXIA 5EWFA 3NUQA 2G5IB 3LK9A 1PVPA 4LVSA 4DQSA 1LV5A 3OSPA 4AYBC 3WKCA 3ZD8A 2H3VA 2MUTB 2W9BA 5KG6A 2KJ9A 5EE1A 4DFKA 4MF2A 1ZQVA 4PJ0U 1KRPA 1ZQKA 2JXJA 8ICSA 4MFFA 4CRXA 4F5RA 2FPKA 3ZD9A 3T5JA 7ICQA 2VKQA 2KK0A 2P6UA 3N7RC 2BCRA 4IC9A 4B6JA 4R63A 4PH5A 3BS5A 1S0OA 2J6SA 4NV0A 4KTQA 3V7JA 4YFKA 5DB7A 1ZQWA 3PO4A 3C2LA 4NM1A 1KFDA 2N1RA 3GIMA 4IQVA 3QU9A 1BVSA 3TI0A 5KT4A 5KFCA 1J97A 1HUZA 4Z6CA 4M6WB 4UASA 3SR6A 3PW5A 2C22A 4ED6A 2GLEA 1MQ2A 1ZOLA 3TQ1A 2HHTA 7ICHA 5T14A 3KZXA 3HT3A 5AM2A 5KFOA 2I6XA 1Q46A 5EE9A 1ZQYA 1X9MA 1L3SA 4GLXA 1N61A 4F2SA 5H2FU 2KMDA 3Q8QB 4NY8A 3UPQA 3C2MA 3C5GA 1S0MA 3M9OB 2BZFA 4P4OA 2KFZA 8ICJA 2HOIA 2YB4A 4PL1A 2W9CA 1C7YA 2ZIUA 2ZIVA 2DFLA 1TFRA 3M8SA 4A8EA 4GXKA 1ZQMA 2EAMA 1NK6A 4IQWA 4R64A 1Q3VA 5TISU 5DG7A 4BXOB 1ZRMA 3KKAC 2AQ4A 3KBBA 7ICEA 5AKEA 4KLTA 2ZTEA 4C4TA 2R8IA 2PFPA 2OEHA 4TUSA 5E79U 2W8LA 5ALPA 2OM6A 3C1ZA 1SL2A 2KKPA 2M9NA 2VIXA 3CW2C 4ED8A 3E0FA 9ICCA 4QWDA 3RJFA 3PX4A 2XCAA 4ED3A 2JZBA 3NRZA 3AQFA 5KG7A 3D2NA 2XY6A 4AP9A 3Q8KA 2QARB 9ICWA 2WTFA 4LZGA 1T8EA 1RYSA 4DSKA 9ICUA 5DBBA 4J9QA 7ICKA 3MR5A 2DPJA 2G06A 1TV9A 5K4LA 2ZIXA 4JWMA 5CWRA 4KLQA 2BHNA 4UATA 4O9MA 1Y88A 5G5HA 4RUAA 5GTHU 2XY5A 2YQEA 4ECRA 3N7PD 3PMNA 5J0YA 2HOQA 2K4PA 2WF7A 3IP4B 3WKDA 5DB9A 9ICMA 3RR7A 1LKYA 2WB1F 2LHTA 1TK0A 2YTUA 4OJ6A 1NK7A 2BDPA 3PSTA 3M8RA 1ZRNA 5DB6A 1S76D 1V38A 3JPSA 3ETRA 1N5XA 4C8OA 1X2IA 3HILA 5F9LA 3E58A 4TQSA 4P0QB 2LM4A 4EZ6A 4O3SA 3MFIA 5CP2A 5ALXA 4M04A 5J8YA 1FIQA 5KNIA 4OO1J 1BPXA 1ZYQA 4CF4A 5KFIA 5BOLA 4UQGA 4U7CA 3SI8A 2E1EA 3HW8A 3TFRA 1RG6A 1SZPA 2O6KA 1OUQA 4GXIA 1NK4A 1ZQGA 1RXWA 2HHVA 4Z6FA 4DQQA 1BGXT 3RB0A 3V7KA 4QZIA 3ISBA 2ODGA 3KOOA 2W9BB 1NK9A 1AQ6A 4DQIA 5AKIA 3EPIA 4NLBA 3PY8A 3BJYA 5KT5A 5CJ7A 2A1JB 4RQ8A 3UMGA 3QZ8A 1O03A 1D8YA 4NLZA 2HCFA 2KEYA 2RRDA 2WFAA 4Y2YA 2WAQC 4FS2A 1FFVA 2KD1A 2J6TA 3T3FA 4G3IA 4J03A 3ETLA 1A76A 3FM9A 3JPOA 5KFNA 3SEIA 3ZDBA 1XS9D 3PSPA 4F4KA 2KV2A 4RPYA 2V9WA 2XI9A 2YMPA 1JUDA 1Z1VA 3PO5A 5J0PA 4J9MA 2XGQA 4R8UA 2HHQA 1S9FA 1QLNA 5AKJA 5HNKA 4YP3A 2Y0SC 1UT5A 5AM4A 3DEEA 1UPHA 1FFUA 3H8JA 5BOMA 5CB1A 5J2DA 7ICNA 3NTUA 3NVZA 1KFSA 2ZIWB 9ICPA 1K5OA 3V6HA 1QCKA 4Y2UA 3MDAA 2LPEA 4F50A 3LVWA 5L1LA 4YMNA 3C5FA 4I2IA 5DG8A 4QZGA 4I29A 3NGDA 4DSEA 2OHFA 1ZQPA 2FLLA 2P35A 1SL0A 4UAVA 3V6JA 5HHIA 5A0LA 2FMPA 4F8RA 1ZQCA 3GILA 1NNLA 2DPIA 3RB4A 2F8LA 1N63A 4KX5A 2XC9A 2J6UA 3PZPA 2CXYA 3C28A 4TQRA 1UHUA 4NL9A 5J0SA 5J2CA 2W3SA 1B22A 2KHVA 4CE6A 4YN4A 3QNMA 2ZJ8A 1JMSA 5DGBA 2G08A 3GDXA 5KFSA 3HPOA 2ZUDA 4RNOA 1JXLA 2ZG6A 4J9PA 4F91B 2BPFA 1PVQA 1DK2A 5HP4A 1NKEA 1F44A 2BR0A 4UB4A 1SWWA 2IOFK 1KQQA 4M9LA 2WAQF 2W43A 3K75D 2ES6A 2IBKA 4KLUA 1SZHA 1KSPA 2H3FA 5TZVA 8ICTA 8ICNA 4NXZA 3AUOA 2FDRA 2AJQA 1X9WA 7ICMA 3NASA 2NO5A 4QZBA 4P0PA 8ICHA 2W04A 8ICEA 4QWCA 3CRXA 3UQ2A 3AQEA 1SV4A 4B9SA 2KVCA 1N56A 3EW9A 1SV0A 1M6YA 4Q8EA 4BX9C 1XO1A 1UCVA 1X66A 2IOHA 3N28A 2YMLA 2BKEA 4XA5A 1K1SA 3SYZA 3QEBZ 2Y0SF 2LKYA 3MGIA 4UB1A 3FYHA 4C4SA 2QLTA 1Z19A 3MBYA 4F4XA 5KG5A 3V7LA 3WK6A 2L5YA 1NKBA 1L3VA 3CP8A 3PW2A 2Q4TA 5ALRA 5KFQA 8ICKA 2V4RA 5EWGA 1FEZA 1T94A 2UVVA 4C7YA 3BQ7A 3GIIA 4F4YA 4B9VA 2OYYA 4P2HA 4YVZA 2JGAA 5JRTA 3AU6A 4CNQA 4OCZA 4EYIB 4XUSA 4B9LA 5J0TA 2MAXA 3WK4A 1NK5A 8ICBA 3NVWA 4KLLA 7ICPA 1ZD2P 4USAA 3PX0A 8ICAA 2LYBA 4NJ8A 3EWAA 2D8CA 2QB1A 1RYUA 3HJEA 4FE3A 1L8OA 1SIJA 5DLFA 3H40A 1DK3A 2NRXA 3QU7A 4OJPA 5AKGA 7ICTA 1ZD5A 4GC7A 3SMVA 1MN8A 2F1IA 3G6YA 4QW8A 2ESEA 3JPRA 3GQCA 2F1HA 4YQWA 5AI8A 1L7NA 4PZOA 2KJ5A 2JEGA 4NLKA 4BDPA 2VJ4A 1KKXA 3LVVA 3OTQA 4F71A 4RQ7A 2C2RA 3RAXA 1NK8A 4DCCA 2BGWA 5J29A 1UQVA 3KHRA 1EXNA 4F5PA 3GZFA 4K4GA 1OW5A 2D3DA 3MR6A 4C80A 3B0YA 5GTIU 5HMLA 5L1KA 3Q8SB 3WU2U 2K4EA 1WCLA 2IHMA 1BPYA 5AM5A 2XO7A 1BPEA 2HI0A 3G6VA 4O3NA 2E5SA 5KAIU 3IN5A 4QW9A 4KITB 2HHSA 3BS7A 1V97A 1JIHA 1A77A 2W11A 1B43A 2Y9UA 8ICXA 1KN5A 3PVXA 1DOQA 3OHAA 3QEAZ 9ICJA 1ZJMA 1QTMA 2QB0A 4QIWF 4QZ8A 2NRTA 1ED1A 3ORYA 3H8WA 2FI1A 2I5HA 3ZDCA 2YN4A 1KBUA 3KHGA 3GIJA 1ZQXA 3MDCA 1A6SA 2ISOA 3OJUA 3RB3A 1ZQRA 4FZLA 2P66A 1QSYA 1NJXA 1B4FA 3DDHA 3K1ZA 3GU3A 5IINA 1L5UA 4R8UB 5CRXA 2ZXIA 1F5SA 1RQNA 1N2XA 2E1FA 5IIKA 4MEYA 2HOFA 1Q8KA 1ZQ1C 4FS1A 2HHWA 1DGSA 2C2EA 4QJFB 1RZTA 5J2IA 3IV6A 3H0LB 3F5AA 2KP7A 4GXJA 3IG5A 2XIDA 2VA8A 5KL1B 2IMWP 4UW9A 5AHXA 5G5GA 3N97B 1Z1BA 4US8A 5DQHA 3ZDAA 2ZUCA 7ICFA 1CI4A 3L5KA 2F77X 3H7IA 3UQ0A 2XICA 1N60A 3NS1A 4Q8FA 4UAUA 3BQ2A 4DS5A 5DQGA 5IILA 4JB3A 4NWIA 3BQ1A 4F92B 2A3VA 2E3TA 1PK1B 2DKXA 5ALSA 1RYRA 5AM1A 5KT6A 3Q8MA 1ZD3A 5ALVA 3SAFA 4QZCA 2WB1C 4I2GA 2K4HA 3RJHA 1U47A 5AK3A 5DGAA 1BNOA 4DQRA 3MC1A 4XRHA 4I2DA 4RQ6A 2AGPA 4DL4A 2Z7JA 2LYHA 1QSLA 4DFDA 2JMGA 2FPMA 4DS4A 1ZQTA 2RDIA 3DV9A 2AGQA 5ALHA 4KLDA 4KLOA 1RPLA 3FDSA 3WKEA 2R8KA 1COOA 3H8SA 2EZYA 4NLCA 1X42A 4MHVA 9ICFA 4O3PA 9ICAA 4YXMA 1ZQEA 4YG2A 4CF5A 5J0QA 2EZZA 4IR9A 4PHDA 5JU5A 2LI6A 3HRDD 2ALZA 4ED7A 5ALDA 9ICSA 5EE0A 3TAQA 4F4ZA 2PMZC 3N7SC 1GO3F 5CR0A 4UBCA 1Z00A 4GFJA 3NVVA 2EAOA 3RR8A 4C0ZA 1NK0A 7ICLA 4FZMA 2FJ6A 2CRXA 4PL2A 4M9HA 3B0XA 2RLTA 2HHXA 2HSZA 1J2MA 4I2JA 4CDGA 3SV4A 3RJGA 5KG2A 4LJXA
chains in the Genus database with same CATH topology
1COKA 1B0XA 2YTUA 1UCVA 2B6GA 1X66A 1WWUA 1PK1B 2DKXA 1V38A 3BS5B 2EAMA 2LMRA 1SV0C 3HILA 2E8PA 3H8MA 3SENA 1X40A 2E8OA 3KKAC 2L5YA 2E8MA 1PK1A 3BS7A 4RQMA 3TACB 2K60A 3BS5A 5J8YA 1SXDA 2LPEA 2EAPA 5KNIA 2Y9UA 1JI7A 2DKZA 3KKAA 2QB0A 2KE7A 3BQ7A 3K1RB 5J8YC 1RG6A 1KW4A 4NL9C 2KSOA 2F8KA 2DL0A 5JRTA 4PZNA 1F0MA 1PK3A 1B4FA 4MHVA 1WWVA 2F3NA 2GLEA 4NL9A 2E8NA 1DXSA 2QARB 4NJ8A 2D8CA 5JU5A 2QKQA 2QB1A 1SGGA 3IDWA 4RQNA 2EANA 5F3XB 2KIVA 2ESEA 2QARA 1X9XA 1OXJA 1LKYB 2KMDA 5JTIA 4PZOA 2ES6A 3TADA 1V85A 2EAOA 3SEIA 2KG5A 2FE9A 2QB0B 4IS7A 5L1MA 2F44A 2JV3A 3TADC 1UQVA 2K4PA 1SV4A 1Z1VA 1SXEA 2KSOB 1LKYA 1OW5A 2D3DA 1SV0A 2Y9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COK A;  1B0X A;  2YTU A;  1UCV A;  2B6G A;  1X66 A;  1WWU A;  1PK1 B;  2DKX A;  1V38 A;  3BS5 B;  2EAM A;  2LMR A;  1SV0 C;  3HIL A;  2E8P A;  3H8M A;  3SEN A;  1X40 A;  2E8O A;  3KKA C;  2L5Y A;  2E8M A;  1PK1 A;  3BS7 A;  4RQM A;  3TAC B;  2K60 A;  3BS5 A;  5J8Y A;  1SXD A;  2LPE A;  2EAP A;  5KNI A;  2Y9U A;  1JI7 A;  2DKZ A;  3KKA A;  2QB0 A;  2KE7 A;  3BQ7 A;  3K1R B;  5J8Y C;  1RG6 A;  1KW4 A;  4NL9 C;  2KSO A;  2F8K A;  2DL0 A;  5JRT A;  4PZN A;  1F0M A;  1PK3 A;  1B4F A;  4MHV A;  1WWV A;  2F3N A;  2GLE A;  4NL9 A;  2E8N A;  1DXS A;  2QAR B;  4NJ8 A;  2D8C A;  5JU5 A;  2QKQ A;  2QB1 A;  1SGG A;  3IDW A;  4RQN A;  2EAN A;  5F3X B;  2KIV A;  2ESE A;  2QAR A;  1X9X A;  1OXJ A;  1LKY B;  2KMD A;  5JTI A;  4PZO A;  2ES6 A;  3TAD A;  1V85 A;  2EAO A;  3SEI A;  2KG5 A;  2FE9 A;  2QB0 B;  4IS7 A;  5L1M A;  2F44 A;  2JV3 A;  3TAD C;  1UQV A;  2K4P A;  1SV4 A;  1Z1V A;  1SXE A;  2KSO B;  1LKY A;  1OW5 A;  2D3D A;  1SV0 A;  2Y9T A; 
#chains in the Genus database with same CATH topology
 4O3Q A;  2JEF A;  1N5W A;  4IR1 A;  5KFJ A;  2Y1I A;  2K89 A;  3RB6 A;  3RH4 A;  4EX6 A;  3PR5 B;  1L6N A;  4Z6E A;  3QXG A;  8ICZ A;  3AN1 A;  1X40 A;  1J2N A;  1WG8 A;  1RQL A;  1X9S A;  2E8M A;  1QQ5 A;  3VC8 A;  4RQM A;  3TAC B;  5ALG A;  4UAY A;  2GH1 A;  2KVS A;  5DG9 A;  1RM6 C;  5HMM A;  2NRW A;  2W7P A;  3QUT A;  4RQ2 A;  4Q45 A;  2VJ5 A;  5BPC A;  1N62 A;  4J9N A;  4JK1 A;  3ONN A;  4DSF A;  4DSJ A;  2F8K A;  2KTQ A;  3RRG A;  1F0M A;  2B21 A;  2EH9 A;  5ALU A;  4DWI A;  3RAQ A;  4O0I A;  4YXJ A;  4UAW A;  2F3N A;  1NZB A;  5KT2 A;  4DQP A;  3BZK A;  5C5J A;  4UB3 A;  4EYH B;  9ICE A;  2IOF A;  4RT3 A;  3AEV A;  3TKA A;  3A0H U;  4YR2 A;  3CYM A;  4DL5 A;  1QQ7 A;  2UVU A;  4EEL A;  2ISP A;  3HX0 A;  4BWJ A;  4YD1 A;  4DL2 A;  1X9X A;  1OXJ A;  3AMZ A;  5AKX A;  4KLF A;  4F3O A;  3O0F A;  4HYK A;  2PMZ F;  3UXO A;  4I2F A;  4FZN A;  1SKR A;  2QB0 B;  4IS7 A;  2DUY A;  4KLE A;  2ASL A;  2HBL A;  3RH6 A;  3TAD C;  4MF8 A;  1HJP A;  2JHD A;  1QH9 A;  2BDU A;  2Y9T A;  2ZTD A;  4Y2V A;  3V72 A;  4G9B A;  5ALT A;  1HIW A;  3BS5 B;  4BGD A;  5IIM A;  3LWL A;  5ALK A;  3D2Q A;  4YCX A;  3KD3 A;  2MUT A;  1T7P A;  9ICB A;  3H8M A;  9ICN A;  9ICI A;  4RNN A;  4EBE A;  4QZA A;  2KHQ A;  3T5L A;  1IIP A;  5AI4 A;  1O08 A;  5L1J A;  3RTV A;  5J2E A;  1JAL A;  2Y1J A;  1SKW A;  5D49 A;  3N4M B;  1BPD A;  4C8L A;  4OJL A;  9ICQ A;  5J2A A;  2BQU A;  1KW4 A;  3T5K A;  2WF6 A;  1TE2 A;  1ZD4 A;  4HAI A;  4DL3 A;  4QWA A;  1ZQZ A;  4JV0 A;  4RT2 A;  3RF9 A;  2JRZ A;  4M47 A;  1ARO P;  5DBA A;  9ICH A;  2HBM A;  4M2Y A;  4DF4 A;  1URJ A;  5AI0 A;  3MGH A;  4XQ8 A;  2GO7 A;  1TKD A;  3QUQ A;  4M6W A;  4EZ9 A;  1S8O A;  2MRL A;  5AKY A;  3MFH A;  4Y2J A;  2W9C B;  1T3N A;  4FBT A;  1U4B A;  1IG6 A;  2ZIU B;  2FPL A;  2ZIV B;  3LYS A;  2P6R A;  5KFW A;  2LM1 A;  2RQ5 A;  5EOZ A;  5JUM A;  5ALM A;  1TAM A;  4QWE A;  7ICS A;  3WKA A;  4C7Z A;  5AKL A;  2OCE A;  4RU9 A;  5HR6 A;  1COK A;  1B0X A;  2UVW A;  5ALE A;  2B6G A;  4Y2T A;  4CCH A;  2Q0Z X;  7ICU A;  2MU2 A;  2FMQ A;  1MC8 A;  5ALL A;  4Q43 A;  3OPX A;  9ICG A;  5KFG A;  2LMR A;  2G09 A;  3Q8P B;  2XVT A;  2WHE A;  3GFK B;  3MR2 A;  3JPQ A;  1SL1 A;  2HHU A;  3ISC A;  5AIA A;  3RRH A;  3RJK A;  2K60 A;  4IL6 U;  5ALW A;  8ICF A;  3BQT A;  2JZB B;  4Y2R A;  4PHA A;  2UVR A;  3EZ5 A;  3KZI U;  4ED1 A;  4KLH A;  2KE7 A;  1Z00 B;  4BXO A;  2C2D A;  2BPC A;  4NL9 C;  2KSO A;  4O3R A;  4CF3 A;  3SV3 A;  1XNS A;  1PK3 A;  4M9J A;  2LYA A;  4PGY A;  2K4I A;  1L3T A;  5J2B A;  4FO6 A;  2CN1 A;  4QIW C;  3F2C A;  1LVH A;  4I28 A;  1RDF A;  5KFD A;  5J2G A;  5D46 A;  4WJ3 B;  4Y2S A;  2ZIX B;  2WF9 A;  1MQ3 A;  3E2E A;  1PVR A;  4QZH A;  3LDA A;  1NI3 A;  4KMU A;  4UB6 U;  3L4P A;  2KKV A;  1KLN A;  3M7D A;  4DFJ A;  7ICV A;  4O5K A;  1ZQO A;  4O5E A;  5J2H A;  5DBC A;  2BQR A;  4K4I A;  4KLG A;  1IXR A;  5EE3 A;  4KX3 A;  2KZZ A;  2QAR A;  3ALR A;  1LKY B;  5JTI A;  3I76 A;  3PSI A;  2BCV A;  2DWQ A;  4O5C A;  2KG5 A;  2FE9 A;  4UAR A;  4BWM A;  5KFZ A;  5L1M A;  8ICM A;  4E0D A;  2ZJ5 A;  1KTQ A;  4OD0 A;  4TUP A;  4ED0 A;  4UB2 A;  2HW3 A;  2C28 A;  4BJQ A;  1WWU A;  4F5N A;  3I28 A;  2GWS A;  4R66 A;  5KFL A;  1KL9 A;  4IRC A;  1Q3U A;  5J2K A;  7ICI A;  2W9M A;  1D8B A;  2XGP A;  1KEJ A;  5FP0 A;  8ICQ A;  1ZQL A;  2PI5 A;  1SXD A;  2AQ0 A;  4NM2 A;  1K1Q A;  4US9 A;  1L7P A;  4J9R A;  5KFX A;  4P0Q A;  2MA1 A;  3HP6 A;  2FLP A;  1QSS A;  8ICG A;  2FLN A;  1KDH A;  3ISD A;  1YT3 A;  2R8J A;  2G5H B;  2AXT U;  4J9O A;  3RH5 A;  5ALF A;  5ALY A;  3QE9 Y;  2JH1 A;  2PKE A;  3BDP A;  4PPX A;  1JRO A;  1X6I A;  4Z6D A;  4B9N A;  4P4P A;  2ZXH A;  4ICA A;  5J0U A;  4FFD A;  5KFF A;  4B9T A;  2YX8 A;  3M9M B;  3IG8 A;  3QUC A;  4QZF A;  1CEZ A;  2NRZ A;  5KFM A;  1JXE A;  8ICY A;  4C8M A;  4RQ3 A;  1XC9 A;  1T3Q A;  2A1J A;  1DGJ A;  2PFQ A;  1TVA A;  1CUK A;  3AU2 A;  1V85 A;  2GOL A;  3F2B A;  2AGO A;  2YB1 A;  2HVI A;  2WF8 A;  2DGZ A;  2H5X A;  2HDO A;  5ALI A;  2KZ3 A;  2BCQ A;  2OXO A;  4R65 A;  5EWE A;  1HUO A;  2EZX A;  3H4D A;  1S5L U;  3LWM A;  1ZQB A;  1ZET A;  2KIW A;  8ICL A;  5HR7 A;  3RJJ A;  1U9L A;  1PUZ A;  7ICR A;  5J2J A;  3WK5 A;  4DFM A;  4M9N A;  4EEN A;  3T79 A;  3OHB A;  2H3I A;  1ZQF A;  5DDM A;  3M9N B;  5AK6 A;  4ECS A;  1ZQN A;  5KT7 A;  2E8O A;  1JN3 A;  3GV5 B;  2D6F C;  1Z4O A;  3I1Y A;  5KFH A;  4C8N A;  3M1Y A;  3C1Y A;  4OJO A;  4KLJ A;  2BCS A;  4DLG A;  2YMM A;  3S6J A;  2W9A A;  4FBU A;  8ICW A;  3IHQ B;  3KKA A;  1D9F A;  2DBY A;  4DF8 A;  4ECQ A;  4RQ1 A;  1HEK A;  2I9G A;  1NZP A;  2ZIW A;  1VDV A;  1LB2 B;  1ZQD A;  4JMU A;  1UA1 A;  4I2H A;  1NJZ A;  5KAF U;  5F9N A;  4Y2X A;  4CGZ A;  4DOC A;  2K8C B;  4QWB A;  1NJW A;  1H38 A;  1S97 A;  1DXS A;  8ICR A;  2PFN A;  3C29 A;  4U6P A;  2W7O A;  1UT8 A;  4ED2 A;  3AM9 A;  3OGU A;  4ZOH C;  3IDW A;  5ALJ A;  5DQI A;  3PML A;  4KLI A;  3WK9 A;  5J0W A;  2EAN A;  1SWV A;  4P0P B;  1QQ6 A;  4DLE A;  4AYB F;  1ZQA A;  3BZC A;  2F76 X;  2K8B B;  9ICV A;  2JEI A;  3QYP A;  2YY6 A;  2G0A A;  5KFA A;  2ZTC A;  4I2E A;  3HKZ C;  2KNJ A;  2JEJ A;  4ACO A;  3PR4 A;  3H0M B;  7ICO A;  4RQ4 A;  2F2A B;  2JV3 A;  2FMS A;  2AHO B;  4RPX A;  5D4B A;  4IQU A;  1SXE A;  2KSO B;  3ZI4 A;  4JWN A;  4I2B A;  4EEY A;  5KG1 A;  4PGQ A;  2G07 A;  4QZE A;  5CA7 A;  4EEK A;  1XO0 A;  9ICO A;  3PW4 A;  5L9X A;  4EBD A;  2I1Q A;  2A1A A;  4ECZ A;  2BCU A;  5KFY A;  2AH5 A;  3QU2 A;  1YZ6 A;  4DOA A;  3C2K A;  1P7D A;  4TUQ A;  4X5V A;  2RP5 A;  1ZQS A;  4DEZ A;  3H0R B;  3GIK A;  4DL6 A;  1YZ7 A;  3F53 A;  3UM9 A;  2F1J A;  3IRU A;  2LBO A;  5HHH A;  4J9S A;  5AKH A;  4GC6 A;  7ICJ A;  4ZH4 A;  2DL0 A;  2BPG A;  5J0R A;  8ICU A;  5KFV A;  3OSN A;  5AI5 A;  5AKK A;  5ALQ A;  5CHG A;  2NYV A;  3K4G A;  4RPZ A;  3PX6 A;  3F5E A;  4IRK A;  1IV8 A;  1SB3 C;  4EX7 A;  4RNM A;  3GV8 B;  4DL7 A;  2R8G A;  3RJI A;  4F5Q A;  2DF4 B;  3ZDE A;  3VCB A;  3KHH A;  1BNP A;  5J0O A;  5DB8 A;  3QX7 A;  5ALZ A;  4I27 A;  2OH2 A;  5CEH A;  3TAD A;  4RQ0 A;  5KG3 A;  4RZR A;  2W55 A;  3T5H A;  3UXN A;  4QZ9 A;  4YR0 A;  3THV A;  3HKZ F;  4OJ5 A;  1D9D A;  2DQN B;  1NJY A;  1S0N A;  2ZJA A;  3TAR A;  1L7M A;  3JPP A;  1S10 A;  4ELV A;  3WKB A;  4PHE A;  4ECX A;  3PW0 A;  1SKS A;  4YMM A;  2E8P A;  9ICK A;  2PFO A;  1ECW A;  5ALN A;  8ICP A;  3L3F X;  2ATL A;  4MFA A;  2RHF A;  4LZD A;  2HMX A;  4ECY A;  5KFU A;  3G6X A;  4UAZ A;  4F72 A;  5KFP A;  3M6K A;  1U49 A;  2ASD A;  2W03 A;  3PV8 A;  1MSW D;  4F93 B;  2KIC A;  4M0A A;  3D2S A;  4UBB A;  2BQ3 A;  4YMO A;  1VLB A;  5J8Y C;  4RQ5 A;  3SZ2 A;  5AM0 A;  3C23 A;  3Q8R B;  3FC4 A;  3RJE A;  2PI4 A;  2IA6 A;  5J2F A;  1ZQQ A;  3JPN A;  4ECW A;  5AIB A;  9ICL A;  2M0N A;  3OJS A;  5KFK A;  2KN7 A;  1N48 A;  1CRX A;  2W54 A;  3V6K A;  1L3U A;  4Q44 A;  5DDY A;  3MR3 A;  1DRG A;  4J9L A;  5IIJ A;  5ALO A;  2QKQ A;  4YR3 A;  1TAU A;  1TAQ A;  3Q8L A;  4B9M A;  4I2C A;  3MGV A;  5L1I A;  4Y2P A;  2H3Q A;  2KIV A;  4I2A A;  1NKC A;  8ICO A;  3WK8 A;  2OWO A;  3CNH A;  1KFT A;  3H4B A;  2R18 A;  2KFN A;  5KTQ A;  1Z4N A;  2F44 A;  2AU0 A;  3QU5 A;  5KG4 A;  1IM4 A;  5AKZ A;  3F2D A;  2W3R A;  4MEX A;  4NLG A;  3NRW A;  4RUC A;  9ICX A;  2K8A A;  2EQY A;  4B9U A;  4C8K A;  5KFE A;  2KJ8 A;  4KN4 A;  4KMO B;  4O3M A;  3A0B U;  1S77 D;  8ICC A;  3NVY A;  1TK5 A;  2VA2 A;  9ICR A;  5AM3 A;  1C20 A;  3QUB A;  8ICI A;  1L8L A;  4KLS A;  2R8H A;  1XSL A;  1PK1 A;  2VA3 A;  2A19 A;  3BQ0 A;  2EAP A;  1NOM A;  1V9P A;  4P4M A;  4QZD A;  1JI7 A;  2DKZ A;  3MAB A;  3SD7 A;  3B9J A;  4F2R A;  1ZQH A;  4YD2 A;  1JRP A;  5AK4 A;  3HWT A;  2HVH A;  3SAH A;  5KT3 A;  3SAG A;  3EUB 2;  2KZM A;  7ICG A;  4PZN A;  4EBC A;  3RBD A;  4DFP A;  5IIO A;  3UXP A;  3GV7 B;  3PW7 A;  4ELT A;  4DSI A;  4ECV A;  2V4Q A;  2E8N A;  3ICX A;  3IM1 A;  2HBK A;  1MA7 A;  3WK7 A;  4M9G A;  3KTQ A;  1A0P A;  1X6J A;  5III A;  4KLM A;  5AI6 A;  3TFS A;  3C21 A;  5AI9 A;  4KN7 A;  1D8L A;  4TUR A;  8ICV A;  3AL0 B;  4DO9 A;  4PHP A;  4PGX A;  1PZN A;  2ASJ A;  1FO4 A;  1ZXI A;  2CPR A;  1U45 A;  3D6J A;  2H3Z A;  5B66 U;  2NV3 A;  2YMQ A;  4DOB A;  4ELU A;  3QZ7 A;  3EYZ A;  5C0Y A;  1BPB A;  5AIC A;  3KHL A;  4IQT A;  3UMB A;  3J81 j;  5DLG A;  4JV1 A;  3TAN A;  5KFB A;  4K4H A;  5KFR A;  5AK5 A;  3TAP A;  3RBE A;  3EPG A;  1TK8 A;  1SV0 C;  4C4R A;  1VJ5 A;  3QU4 A;  1XWL A;  3SEN A;  9ICT A;  4DSL A;  5KL8 B;  2NRV A;  1ZQU A;  2JR5 A;  2B0C A;  1XSP A;  4GIB A;  4JUZ A;  2ZUB A;  3KFU F;  5KFT A;  4ECT A;  4IRD A;  5DKW A;  2IHN A;  4F4W A;  4JV2 A;  3M6Z A;  2MSN A;  4O3O A;  3FAH A;  3K1R B;  4UB8 U;  1U48 A;  1WYG A;  2EDU A;  2XY7 A;  5J0X A;  2VAN A;  4UB5 A;  1ZQJ A;  3ED5 A;  2HBJ A;  1T4G A;  3ZDD A;  4MFC A;  3UMC A;  2RDJ A;  3PNC A;  2WF5 A;  3R9K A;  1ZJN A;  1WCN A;  3JPT A;  3U26 A;  1L7O A;  3RFA A;  2KOB A;  1WWV A;  5B5E U;  1XSN A;  4F5O A;  1WUD A;  4ECU A;  2XCP A;  1S0V A;  3PSF A;  2JH7 A;  1RXV A;  4Y2Q A;  4BUG A;  1XU4 A;  1BPZ A;  4NLN A;  1SGG A;  2W8K A;  2NO4 A;  4RQN A;  1Z3E B;  1JX4 A;  4J9K A;  5KG0 A;  1UA0 A;  4QNL A;  5F3X B;  1ZQI A;  3SQI A;  2PXI A;  5EWF A;  3NUQ A;  2G5I B;  3LK9 A;  1PVP A;  4LVS A;  4DQS A;  1LV5 A;  3OSP A;  4AYB C;  3WKC A;  3ZD8 A;  2H3V A;  2MUT B;  2W9B A;  5KG6 A;  2KJ9 A;  5EE1 A;  4DFK A;  4MF2 A;  1ZQV A;  4PJ0 U;  1KRP A;  1ZQK A;  2JXJ A;  8ICS A;  4MFF A;  4CRX A;  4F5R A;  2FPK A;  3ZD9 A;  3T5J A;  7ICQ A;  2VKQ A;  2KK0 A;  2P6U A;  3N7R C;  2BCR A;  4IC9 A;  4B6J A;  4R63 A;  4PH5 A;  3BS5 A;  1S0O A;  2J6S A;  4NV0 A;  4KTQ A;  3V7J A;  4YFK A;  5DB7 A;  1ZQW A;  3PO4 A;  3C2L A;  4NM1 A;  1KFD A;  2N1R A;  3GIM A;  4IQV A;  3QU9 A;  1BVS A;  3TI0 A;  5KT4 A;  5KFC A;  1J97 A;  1HUZ A;  4Z6C A;  4M6W B;  4UAS A;  3SR6 A;  3PW5 A;  2C22 A;  4ED6 A;  2GLE A;  1MQ2 A;  1ZOL A;  3TQ1 A;  2HHT A;  7ICH A;  5T14 A;  3KZX A;  3HT3 A;  5AM2 A;  5KFO A;  2I6X A;  1Q46 A;  5EE9 A;  1ZQY A;  1X9M A;  1L3S A;  4GLX A;  1N61 A;  4F2S A;  5H2F U;  2KMD A;  3Q8Q B;  4NY8 A;  3UPQ A;  3C2M A;  3C5G A;  1S0M A;  3M9O B;  2BZF A;  4P4O A;  2KFZ A;  8ICJ A;  2HOI A;  2YB4 A;  4PL1 A;  2W9C A;  1C7Y A;  2ZIU A;  2ZIV A;  2DFL A;  1TFR A;  3M8S A;  4A8E A;  4GXK A;  1ZQM A;  2EAM A;  1NK6 A;  4IQW A;  4R64 A;  1Q3V A;  5TIS U;  5DG7 A;  4BXO B;  1ZRM A;  3KKA C;  2AQ4 A;  3KBB A;  7ICE A;  5AKE A;  4KLT A;  2ZTE A;  4C4T A;  2R8I A;  2PFP A;  2OEH A;  4TUS A;  5E79 U;  2W8L A;  5ALP A;  2OM6 A;  3C1Z A;  1SL2 A;  2KKP A;  2M9N A;  2VIX A;  3CW2 C;  4ED8 A;  3E0F A;  9ICC A;  4QWD A;  3RJF A;  3PX4 A;  2XCA A;  4ED3 A;  2JZB A;  3NRZ A;  3AQF A;  5KG7 A;  3D2N A;  2XY6 A;  4AP9 A;  3Q8K A;  2QAR B;  9ICW A;  2WTF A;  4LZG A;  1T8E A;  1RYS A;  4DSK A;  9ICU A;  5DBB A;  4J9Q A;  7ICK A;  3MR5 A;  2DPJ A;  2G06 A;  1TV9 A;  5K4L A;  2ZIX A;  4JWM A;  5CWR A;  4KLQ A;  2BHN A;  4UAT A;  4O9M A;  1Y88 A;  5G5H A;  4RUA A;  5GTH U;  2XY5 A;  2YQE A;  4ECR A;  3N7P D;  3PMN A;  5J0Y A;  2HOQ A;  2K4P A;  2WF7 A;  3IP4 B;  3WKD A;  5DB9 A;  9ICM A;  3RR7 A;  1LKY A;  2WB1 F;  2LHT A;  1TK0 A;  2YTU A;  4OJ6 A;  1NK7 A;  2BDP A;  3PST A;  3M8R A;  1ZRN A;  5DB6 A;  1S76 D;  1V38 A;  3JPS A;  3ETR A;  1N5X A;  4C8O A;  1X2I A;  3HIL A;  5F9L A;  3E58 A;  4TQS A;  4P0Q B;  2LM4 A;  4EZ6 A;  4O3S A;  3MFI A;  5CP2 A;  5ALX A;  4M04 A;  5J8Y A;  1FIQ A;  5KNI A;  4OO1 J;  1BPX A;  1ZYQ A;  4CF4 A;  5KFI A;  5BOL A;  4UQG A;  4U7C A;  3SI8 A;  2E1E A;  3HW8 A;  3TFR A;  1RG6 A;  1SZP A;  2O6K A;  1OUQ A;  4GXI A;  1NK4 A;  1ZQG A;  1RXW A;  2HHV A;  4Z6F A;  4DQQ A;  1BGX T;  3RB0 A;  3V7K A;  4QZI A;  3ISB A;  2ODG A;  3KOO A;  2W9B B;  1NK9 A;  1AQ6 A;  4DQI A;  5AKI A;  3EPI A;  4NLB A;  3PY8 A;  3BJY A;  5KT5 A;  5CJ7 A;  2A1J B;  4RQ8 A;  3UMG A;  3QZ8 A;  1O03 A;  1D8Y A;  4NLZ A;  2HCF A;  2KEY A;  2RRD A;  2WFA A;  4Y2Y A;  2WAQ C;  4FS2 A;  1FFV A;  2KD1 A;  2J6T A;  3T3F A;  4G3I A;  4J03 A;  3ETL A;  1A76 A;  3FM9 A;  3JPO A;  5KFN A;  3SEI A;  3ZDB A;  1XS9 D;  3PSP A;  4F4K A;  2KV2 A;  4RPY A;  2V9W A;  2XI9 A;  2YMP A;  1JUD A;  1Z1V A;  3PO5 A;  5J0P A;  4J9M A;  2XGQ A;  4R8U A;  2HHQ A;  1S9F A;  1QLN A;  5AKJ A;  5HNK A;  4YP3 A;  2Y0S C;  1UT5 A;  5AM4 A;  3DEE A;  1UPH A;  1FFU A;  3H8J A;  5BOM A;  5CB1 A;  5J2D A;  7ICN A;  3NTU A;  3NVZ A;  1KFS A;  2ZIW B;  9ICP A;  1K5O A;  3V6H A;  1QCK A;  4Y2U A;  3MDA A;  2LPE A;  4F50 A;  3LVW A;  5L1L A;  4YMN A;  3C5F A;  4I2I A;  5DG8 A;  4QZG A;  4I29 A;  3NGD A;  4DSE A;  2OHF A;  1ZQP A;  2FLL A;  2P35 A;  1SL0 A;  4UAV A;  3V6J A;  5HHI A;  5A0L A;  2FMP A;  4F8R A;  1ZQC A;  3GIL A;  1NNL A;  2DPI A;  3RB4 A;  2F8L A;  1N63 A;  4KX5 A;  2XC9 A;  2J6U A;  3PZP A;  2CXY A;  3C28 A;  4TQR A;  1UHU A;  4NL9 A;  5J0S A;  5J2C A;  2W3S A;  1B22 A;  2KHV A;  4CE6 A;  4YN4 A;  3QNM A;  2ZJ8 A;  1JMS A;  5DGB A;  2G08 A;  3GDX A;  5KFS A;  3HPO A;  2ZUD A;  4RNO A;  1JXL A;  2ZG6 A;  4J9P A;  4F91 B;  2BPF A;  1PVQ A;  1DK2 A;  5HP4 A;  1NKE A;  1F44 A;  2BR0 A;  4UB4 A;  1SWW A;  2IOF K;  1KQQ A;  4M9L A;  2WAQ F;  2W43 A;  3K75 D;  2ES6 A;  2IBK A;  4KLU A;  1SZH A;  1KSP A;  2H3F A;  5TZV A;  8ICT A;  8ICN A;  4NXZ A;  3AUO A;  2FDR A;  2AJQ A;  1X9W A;  7ICM A;  3NAS A;  2NO5 A;  4QZB A;  4P0P A;  8ICH A;  2W04 A;  8ICE A;  4QWC A;  3CRX A;  3UQ2 A;  3AQE A;  1SV4 A;  4B9S A;  2KVC A;  1N56 A;  3EW9 A;  1SV0 A;  1M6Y A;  4Q8E A;  4BX9 C;  1XO1 A;  1UCV A;  1X66 A;  2IOH A;  3N28 A;  2YML A;  2BKE A;  4XA5 A;  1K1S A;  3SYZ A;  3QEB Z;  2Y0S F;  2LKY A;  3MGI A;  4UB1 A;  3FYH A;  4C4S A;  2QLT A;  1Z19 A;  3MBY A;  4F4X A;  5KG5 A;  3V7L A;  3WK6 A;  2L5Y A;  1NKB A;  1L3V A;  3CP8 A;  3PW2 A;  2Q4T A;  5ALR A;  5KFQ A;  8ICK A;  2V4R A;  5EWG A;  1FEZ A;  1T94 A;  2UVV A;  4C7Y A;  3BQ7 A;  3GII A;  4F4Y A;  4B9V A;  2OYY A;  4P2H A;  4YVZ A;  2JGA A;  5JRT A;  3AU6 A;  4CNQ A;  4OCZ A;  4EYI B;  4XUS A;  4B9L A;  5J0T A;  2MAX A;  3WK4 A;  1NK5 A;  8ICB A;  3NVW A;  4KLL A;  7ICP A;  1ZD2 P;  4USA A;  3PX0 A;  8ICA A;  2LYB A;  4NJ8 A;  3EWA A;  2D8C A;  2QB1 A;  1RYU A;  3HJE A;  4FE3 A;  1L8O A;  1SIJ A;  5DLF A;  3H40 A;  1DK3 A;  2NRX A;  3QU7 A;  4OJP A;  5AKG A;  7ICT A;  1ZD5 A;  4GC7 A;  3SMV A;  1MN8 A;  2F1I A;  3G6Y A;  4QW8 A;  2ESE A;  3JPR A;  3GQC A;  2F1H A;  4YQW A;  5AI8 A;  1L7N A;  4PZO A;  2KJ5 A;  2JEG A;  4NLK A;  4BDP A;  2VJ4 A;  1KKX A;  3LVV A;  3OTQ A;  4F71 A;  4RQ7 A;  2C2R A;  3RAX A;  1NK8 A;  4DCC A;  2BGW A;  5J29 A;  1UQV A;  3KHR A;  1EXN A;  4F5P A;  3GZF A;  4K4G A;  1OW5 A;  2D3D A;  3MR6 A;  4C80 A;  3B0Y A;  5GTI U;  5HML A;  5L1K A;  3Q8S B;  3WU2 U;  2K4E A;  1WCL A;  2IHM A;  1BPY A;  5AM5 A;  2XO7 A;  1BPE A;  2HI0 A;  3G6V A;  4O3N A;  2E5S A;  5KAI U;  3IN5 A;  4QW9 A;  4KIT B;  2HHS A;  3BS7 A;  1V97 A;  1JIH A;  1A77 A;  2W11 A;  1B43 A;  2Y9U A;  8ICX A;  1KN5 A;  3PVX A;  1DOQ A;  3OHA A;  3QEA Z;  9ICJ A;  1ZJM A;  1QTM A;  2QB0 A;  4QIW F;  4QZ8 A;  2NRT A;  1ED1 A;  3ORY A;  3H8W A;  2FI1 A;  2I5H A;  3ZDC A;  2YN4 A;  1KBU A;  3KHG A;  3GIJ A;  1ZQX A;  3MDC A;  1A6S A;  2ISO A;  3OJU A;  3RB3 A;  1ZQR A;  4FZL A;  2P66 A;  1QSY A;  1NJX A;  1B4F A;  3DDH A;  3K1Z A;  3GU3 A;  5IIN A;  1L5U A;  4R8U B;  5CRX A;  2ZXI A;  1F5S A;  1RQN A;  1N2X A;  2E1F A;  5IIK A;  4MEY A;  2HOF A;  1Q8K A;  1ZQ1 C;  4FS1 A;  2HHW A;  1DGS A;  2C2E A;  4QJF B;  1RZT A;  5J2I A;  3IV6 A;  3H0L B;  3F5A A;  2KP7 A;  4GXJ A;  3IG5 A;  2XID A;  2VA8 A;  5KL1 B;  2IMW P;  4UW9 A;  5AHX A;  5G5G A;  3N97 B;  1Z1B A;  4US8 A;  5DQH A;  3ZDA A;  2ZUC A;  7ICF A;  1CI4 A;  3L5K A;  2F77 X;  3H7I A;  3UQ0 A;  2XIC A;  1N60 A;  3NS1 A;  4Q8F A;  4UAU A;  3BQ2 A;  4DS5 A;  5DQG A;  5IIL A;  4JB3 A;  4NWI A;  3BQ1 A;  4F92 B;  2A3V A;  2E3T A;  1PK1 B;  2DKX A;  5ALS A;  1RYR A;  5AM1 A;  5KT6 A;  3Q8M A;  1ZD3 A;  5ALV A;  3SAF A;  4QZC A;  2WB1 C;  4I2G A;  2K4H A;  3RJH A;  1U47 A;  5AK3 A;  5DGA A;  1BNO A;  4DQR A;  3MC1 A;  4XRH A;  4I2D A;  4RQ6 A;  2AGP A;  4DL4 A;  2Z7J A;  2LYH A;  1QSL A;  4DFD A;  2JMG A;  2FPM A;  4DS4 A;  1ZQT A;  2RDI A;  3DV9 A;  2AGQ A;  5ALH A;  4KLD A;  4KLO A;  1RPL A;  3FDS A;  3WKE A;  2R8K A;  1COO A;  3H8S A;  2EZY A;  4NLC A;  1X42 A;  4MHV A;  9ICF A;  4O3P A;  9ICA A;  4YXM A;  1ZQE A;  4YG2 A;  4CF5 A;  5J0Q A;  2EZZ A;  4IR9 A;  4PHD A;  5JU5 A;  2LI6 A;  3HRD D;  2ALZ A;  4ED7 A;  5ALD A;  9ICS A;  5EE0 A;  3TAQ A;  4F4Z A;  2PMZ C;  3N7S C;  1GO3 F;  5CR0 A;  4UBC A;  1Z00 A;  4GFJ A;  3NVV A;  2EAO A;  3RR8 A;  4C0Z A;  1NK0 A;  7ICL A;  4FZM A;  2FJ6 A;  2CRX A;  4PL2 A;  4M9H A;  3B0X A;  2RLT A;  2HHX A;  2HSZ A;  1J2M A;  4I2J A;  4CDG A;  3SV4 A;  3RJG A;  5KG2 A;  4LJX A; 
#chains in the Genus database with same CATH homology
 1COK A;  1B0X A;  2YTU A;  1UCV A;  2B6G A;  1X66 A;  1WWU A;  1PK1 B;  2DKX A;  1V38 A;  3BS5 B;  2EAM A;  2LMR A;  1SV0 C;  3HIL A;  2E8P A;  3H8M A;  3SEN A;  1X40 A;  2E8O A;  3KKA C;  2L5Y A;  2E8M A;  1PK1 A;  3BS7 A;  4RQM A;  3TAC B;  2K60 A;  3BS5 A;  5J8Y A;  1SXD A;  2LPE A;  2EAP A;  5KNI A;  2Y9U A;  1JI7 A;  2DKZ A;  3KKA A;  2QB0 A;  2KE7 A;  3BQ7 A;  3K1R B;  5J8Y C;  1RG6 A;  1KW4 A;  4NL9 C;  2KSO A;  2F8K A;  2DL0 A;  5JRT A;  4PZN A;  1F0M A;  1PK3 A;  1B4F A;  4MHV A;  1WWV A;  2F3N A;  2GLE A;  4NL9 A;  2E8N A;  1DXS A;  2QAR B;  4NJ8 A;  2D8C A;  5JU5 A;  2QKQ A;  2QB1 A;  1SGG A;  3IDW A;  4RQN A;  2EAN A;  5F3X B;  2KIV A;  2ESE A;  2QAR A;  1X9X A;  1OXJ A;  1LKY B;  2KMD A;  5JTI A;  4PZO A;  2ES6 A;  3TAD A;  1V85 A;  2EAO A;  3SEI A;  2KG5 A;  2FE9 A;  2QB0 B;  4IS7 A;  5L1M A;  2F44 A;  2JV3 A;  3TAD C;  1UQV A;  2K4P A;  1SV4 A;  1Z1V A;  1SXE A;  2KSO B;  1LKY A;  1OW5 A;  2D3D A;  1SV0 A;  2Y9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...