2Y9TA

Structural basis of p63a sam domain mutants involved in aec syndrome
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
GSYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of P63Alpha Sam Domain Mutants Involved in Aec Syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords TUMOR PROTEIN 63
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2y9tA00
5KNIA 2LMRA 1WWVA 2Y9UA 1DXSA 1V38A 4PZNA 1SV0A 2ESEA 1SV4A 1KW4A 2E8OA 2LPEA 2F8KA 2KIVA 1PK1B 1COKA 4PZOA 4RQNA 3KKAC 1SGGA 1F0MA 2JV3A 3K1RB 2QB1A 2EANA 1JI7A 2K60A 5J8YC 3BQ7A 3TACB 1X9XA 5JRTA 1SXEA 3IDWA 5JTIA 5JU5A 3BS7A 2YTUA 4NL9A 1B0XA 2D8CA 2QB0A 3KKAA 1OXJA 2DKZA 2EAMA 4RQMA 1X40A 5J8YA 1OW5A 2KSOA 1UQVA 2FE9A 2E8MA 3SEIA 2EAPA 1X66A 2L5YA 2QKQA 2DL0A 2Y9TA 3HILA 2KSOB 2E8NA 3BS5A 1B4FA 5F3XB 2B6GA 1LKYB 1SV0C 1WWUA 2QARA 4IS7A 2KE7A 1RG6A 4MHVA 1UCVA 2DKXA 1LKYA 2F3NA 2D3DA 2QARB 4NL9C 2GLEA 1Z1VA 5L1MA 2ES6A 2KMDA 3TADC 3SENA 3H8MA 2E8PA 1V85A 1PK3A 1SXDA 3TADA 2EAOA 4NJ8A 2KG5A 2K4PA 3BS5B 2F44A 1PK1A 2QB0B
chains in the Genus database with same CATH superfamily
1JN3A 1HIWA 3RJIA 3NUQA 4QZHA 2W7OA 2OYYA 3F5EA 3CYMA 2HCFA 2LMRA 2Y9UA 3RH6A 1KBUA 3Q8PB 2AHOB 3JPOA 3RJJA 5KFEA 2KP7A 3PMLA 5KL1B 2R8KA 3MBYA 4ZH4A 4Z6EA 3KZIU 3K1RB 1L5UA 4EX7A 3TKAA 3NVYA 3H40A 1JI7A 2K60A 5KFKA 2PKEA 1ZQVA 5HP4A 1XSLA 3SR6A 1QSLA 5FP0A 1RXWA 5ALJA 3MGIA 1LV5A 3MC1A 4WJ3B 3UXNA 2NRZA 4PHAA 4UBCA 2DKZA 4CE6A 1N60A 4J9OA 3PR5B 2Q4TA 3BQ0A 3PR4A 2EZXA 5L1LA 1ZJMA 1SL0A 2E8MA 4GC7A 2XGPA 2RDIA 3IP4B 4RQ7A 4BUGA 2CXYA 2H3ZA 3RB6A 2ZXIA 2ZG6A 3KD3A 2F3NA 2OH2A 1SKWA 2HVHA 2LKYA 5L1IA 2ES6A 2BCVA 2YB4A 5KFSA 3GZFA 2JXJA 2YB1A 4OCZA 3MABA 5BOMA 1JRPA 3NS1A 3N4MB 1RDFA 1ZQUA 2WF6A 8ICMA 3FYHA 4DSKA 3RR8A 2KJ9A 3UMBA 2KVCA 1L7NA 3Q8LA 2D6FC 4O9MA 4DS4A 5F9LA 1V38A 4ED2A 5DBCA 5TISU 7ICTA 8ICJA 2LHTA 1SGGA 4MFAA 2UVVA 4P0PB 4DQSA 2R8JA 3SD7A 2PMZC 3SI8A 5H2FU 2ZIWA 3B9JA 2NYVA 1D9DA 1X9MA 3THVA 4C0ZA 4ELVA 3IN5A 1DRGA 8ICRA 5AK4A 3G6YA 4I2BA 1S77D 1ZQMA 5ALEA 1O08A 4J9MA 7ICLA 2BHNA 4FZMA 5J2EA 2VIXA 2DPIA 1ZYQA 3MFIA 8ICEA 3C21A 5EWFA 1WG8A 4M9JA 3SEIA 3RH5A 9ICIA 3H4BA 2LI6A 3CW2C 5DKWA 2GO7A 4YMOA 1HEKA 4R64A 5TZVA 3T79A 2ZIXB 2G0AA 4P4PA 2PI4A 1SV0C 1NNLA 4Q45A 5AKIA 2QARA 1S0VA 4DLEA 3M9NB 5KFJA 7ICKA 4ED1A 1Z19A 4NLNA 1NK7A 5CA7A 4BWJA 3N7SC 2IHNA 1Q3UA 1Z1VA 5CP2A 2Y0SF 8ICNA 3PZPA 4NV0A 2WB1C 1BPZA 5AI4A 5D46A 3RAQA 2WF5A 4QW8A 4JV1A 4J9QA 3ICXA 2ATLA 3AU2A 1U48A 3PSFA 2G06A 5EE1A 2ZIUB 4JV0A 3OTQA 5HNKA 9ICWA 3N28A 2DBYA 2JH7A 4QW9A 3AEVA 1Z00A 4O3QA 4R66A 4UB1A 4C80A 4QJFB 1XSNA 5KG1A 1Q8KA 5ALRA 3OHBA 3H0LB 1T4GA 4QNLA 5ALMA 3RJHA 4C8KA 3T5LA 8ICLA 4RPXA 1X9XA 1U49A 1NKCA 2HHWA 2MU2A 1ZQCA 8ICWA 2VJ5A 3AL0B 2K8BB 3CRXA 3MR3A 3T5KA 4DFJA 1NK0A 2R8GA 5J2IA 5CRXA 1IIPA 8ICKA 3HWTA 5ALZA 1TKDA 5J2CA 5EOZA 5AICA 1BGXT 2ZTCA 1X66A 2RLTA 9ICMA 3AQEA 3HILA 1L7MA 2LYBA 2BQRA 4C4RA 2W11A 4UB4A 4YMNA 4MHVA 5AI9A 5GTIU 4F5NA 3WK5A 5J2GA 2B0CA 5DLGA 4YR3A 3MGHA 1ZXIA 4F72A 4Q44A 2F2AB 2DUYA 7ICJA 2ZUCA 8ICTA 4TUPA 4P0QA 4ED6A 1L3VA 1ZQAA 4O0IA 3EYZA 5KFNA 3NASA 2BQUA 1F44A 1UHUA 1NJYA 1N61A 3L4PA 4PGYA 2OWOA 3UXOA 5KG5A 2VANA 4US9A 8ICXA 4UAYA 2BQ3A 5KFRA 1N48A 1GO3F 3FM9A 1BPEA 4QZDA 4F2RA 3V6KA 1F0MA 3WKAA 5KFTA 2YN4A 4YXJA 5ALKA 3NVWA 1HUOA 1XWLA 1BNPA 2KVSA 3Q8SB 2KFNA 5DQGA 2W3SA 4ED0A 1B0XA 3T3FA 5DQHA 5KG2A 3UMCA 1DOQA 8ICUA 4KMOB 1JXLA 2A1JB 3PW4A 1A77A 2YMLA 4FS2A 4FO6A 4QWDA 3QUQA 4QZAA 2XVTA 2W9BA 2KJ8A 4M9HA 5AI8A 2DL0A 2RRDA 4PHEA 7ICOA 2ZIVB 9ICAA 4LJXA 5F3XB 3QU9A 1ZQDA 1IG6A 1X6JA 2R8HA 1U4BA 5IIIA 4YXMA 3MR5A 4G3IA 3PX6A 3FAHA 2BDUA 5CB1A 1JUDA 1ZQPA 3E0FA 4I2EA 3EPGA 1COOA 5L1JA 1T94A 3AM9A 4GFJA 4M9GA 4I2AA 1ZQTA 5KG4A 5AM4A 4UAZA 3V6JA 4ACOA 5EE9A 4P2HA 3GIIA 2XC9A 3KHGA 5KFIA 5J2JA 3IG8A 3HX0A 2HHQA 1PK1B 2W9CA 4Z6FA 5KG0A 4QZ8A 5KFXA 1DK3A 4B9TA 3M8SA 4XQ8A 5G5GA 1RZTA 4MFFA 1VJ5A 1ZQZA 1N5XA 2JRZA 2KKPA 4QZIA 3G6VA 3LVWA 3HPOA 3T5HA 4DL7A 4NM1A 4ECYA 1OUQA 3IDWA 2E5SA 1KFDA 4KLHA 5L9XA 1ED1A 5DG8A 4M9NA 1DK2A 5HHHA 3QYPA 4YD1A 3SMVA 1C20A 4O3RA 4DQPA 2C28A 1J2MA 5AIBA 3ZI4A 4DFKA 4QZBA 1SL1A 1DGSA 4JMUA 5ALUA 9ICEA 3N7PD 1CI4A 4G9BA 4XA5A 3NRWA 9ICLA 3MGVA 4QZGA 1TVAA 1XO0A 1WWUA 9ICOA 2H3FA 5DLFA 1S10A 5J0RA 4PPXA 1FEZA 3QU7A 2WF9A 2BPCA 3K4GA 3UMGA 4MFCA 4J9PA 2ZXHA 3TAPA 1NKBA 4KN7A 2I6XA 5K4LA 2XCAA 2VA8A 5KAIU 3S6JA 3SAGA 2XGQA 3ZDCA 5KAFU 2E1EA 1ZQSA 3SZ2A 2WF8A 4NXZA 4B6JA 4M47A 1D9FA 1S5LU 4IQWA 2BPGA 4PL1A 1JALA 1L6NA 2V4RA 4QWBA 2QB0B 1SKRA 2G5IB 4ELTA 2XIDA 7ICMA 4BWMA 4AYBF 4EBEA 2HHXA 3ZDBA 2HMXA 1AQ6A 5J2KA 2P66A 2FJ6A 5ALXA 2RHFA 2W03A 4IR9A 3MDAA 1S76D 2YMQA 2CPRA 4Z6DA 4I2CA 5JRTA 2A1JA 5CHGA 3K75D 4KLJA 4DL6A 2JZBA 1BNOA 5JU5A 2FLLA 4NL9A 3EUB2 1QLNA 1QSYA 4RQMA 2I5HA 4A8EA 4DSIA 1OW5A 4KLGA 4M6WA 3C28A 5J0XA 3PMNA 3UM9A 4HYKA 1RYSA 1T7PA 1UQVA 4I28A 3HJEA 5KFUA 5KFBA 5AM3A 4QZ9A 2VA3A 3IG5A 2FMSA 2P6RA 4QZFA 2KFZA 2AQ0A 3BS5A 5L1KA 4YR2A 3B0XA 3TAQA 3KTQA 4R63A 5KTQA 3QEAZ 4YMMA 4O5EA 4FE3A 2K4HA 4Y2SA 3C2LA 4YR0A 3G6XA 3CNHA 1KRPA 2KZZA 1LKYA 5HMLA 3GV8B 2KIWA 4CF5A 3SAHA 3M7DA 4NL9C 3ZDAA 5AKJA 1PUZA 4KLFA 4M0AA 3N7RC 3RH4A 3RRHA 4JUZA 3NTUA 3QUTA 5J0QA 4OD0A 1NK5A 4C4SA 4EYIB 2NRXA 3R9KA 2K4PA 5EE3A 2F44A 1KSPA 2XCPA 4PHDA 1PK1A 2W9CB 1L7OA 4RQ3A 3QZ8A 4QWCA 4F4XA 2BKEA 2FPLA 4DQQA 7ICSA 4IQTA 3TFSA 4FBUA 1KW4A 2KIVA 2NV3A 3V7LA 5EWEA 1A0PA 4DSFA 4OO1J 4J9SA 2JV3A 9ICCA 5DQIA 3BJYA 3D2SA 1ZD3A 4KN4A 3L5KA 2EDUA 2KTQA 3UQ0A 2IBKA 4GXKA 2KHVA 7ICFA 5HMMA 3RB4A 4F4ZA 2AGPA 1N5WA 1MA7A 2PFNA 2IOHA 1RYRA 3PVXA 4K4IA 3PY8A 5IIMA 2CRXA 2KZ3A 4UASA 2ZTEA 4LZDA 4FBTA 4I2DA 2FDRA 4R8UA 4ECSA 9ICGA 4ZOHC 3CP8A 1KFSA 3C5GA 2VKQA 2L5YA 4OJOA 3PO4A 1QCKA 2G5HB 3O0FA 4KMUA 3WK9A 1FFVA 2I9GA 3GV7B 1KN5A 1T3NA 5KT3A 4IQVA 3Q8MA 4UB3A 4QIWF 4QWEA 5T14A 5KG7A 4TQRA 4F4WA 5AI0A 1Q46A 4PH5A 4OJLA 5ALYA 4RT2A 3BQ2A 1B22A 4KLOA 4JV2A 3M8RA 3C2KA 1FIQA 4ECUA 1ZQIA 2EAOA 3ISCA 4IQUA 2GOLA 2E3TA 4IR1A 2KG5A 7ICIA 3ISDA 1PVRA 4DL5A 3Q8KA 2LYAA 2GWSA 1V97A 4UBBA 1ZQOA 2W9MA 4TUSA 3RJGA 4BXOB 2KJ5A 2HI0A 4F2SA 3PW5A 2G08A 1KLNA 2NO4A 5CWRA 2E8OA 4K4GA 1O03A 7ICPA 5ALDA 4J9NA 5D4BA 2ZJ5A 1QTMA 5KFPA 1H38A 3AQFA 5ALWA 4CGZA 4EX6A 1ZETA 1RQLA 4MEYA 4O3OA 2XY7A 4DLGA 5CJ7A 4US8A 5ALTA 2EAMA 2KKVA 3DV9A 3VCBA 1ZD2P 2BGWA 2OHFA 5EWGA 1C7YA 3U26A 2BZFA 3QEBZ 4PL2A 3H0RB 8ICCA 1S97A 1P7DA 1Y88A 4YN4A 1BPDA 1NJXA 5DBBA 1LKYB 4CF4A 1UT8A 2MUTA 1D8BA 4NLGA 3GILA 2KEYA 1L3TA 1UCVA 1ZD4A 5J0TA 1ZQHA 4I2JA 1Z4NA 1LVHA 3OHAA 2DFLA 4DWIA 1ZQYA 2HOQA 2GLEA 3WKEA 1DGJA 3IHQB 4FFDA 4RQ1A 2HOFA 2WF7A 3SENA 1Z3EB 4RZRA 2XICA 2ZIUA 1SIJA 4KITB 2C2DA 2K4EA 3IV6A 1Z00B 2HHVA 2JH1A 5AKHA 4C7YA 2JMGA 9ICRA 2HBLA 4PZNA 2K8AA 4KLLA 3C5FA 2XY5A 4F5RA 3AN1A 2ZJ8A 4Z6CA 5J2FA 3RTVA 4ED7A 1S0MA 2MA1A 5KT2A 3QUCA 1ZQRA 1ZRMA 3BQ7A 1KEJA 3AMZA 3HRDD 5AKEA 3GFKB 4KX5A 1KKXA 4O3MA 5AM2A 1FO4A 3KKAA 5J2BA 2EQYA 2LM1A 2P6UA 2LBOA 5J0YA 1YZ7A 5AIAA 2LM4A 1WYGA 5BOLA 1T8EA 1TK0A 5ALPA 3GIMA 3IM1A 2HBJA 4RNNA 2Y9TA 4UAUA 3SYZA 2W04A 3FC4A 4QZCA 1SB3C 2R8IA 1UPHA 3T5JA 3DDHA 2B21A 4IRCA 1NK9A 1AROP 8ICOA 4RQ4A 4KLSA 2YY6A 3GV5B 1X9SA 5KG3A 4DQIA 2AU0A 1SKSA 4YQWA 2DKXA 1U9LA 3M9OB 2C22A 5KFHA 2J6SA 1TAQA 3F2BA 4JWNA 4BDPA 5KL8B 3TANA 2HHSA 1BVSA 3H7IA 3F2DA 3RJFA 2ZJAA 1UT5A 1SXDA 3JPSA 4RNOA 4BGDA 2DQNB 1TK8A 3NVZA 1XU4A 3BS5B 4O3PA 3QE9Y 2AGQA 4LZGA 2Y1IA 4I2IA 5ALVA 3PSTA 3C1ZA 4B9NA 3QXGA 1SV4A 2F8KA 2LPEA 2NO5A 2K89A 1B43A 2W54A 4X5VA 4C4TA 2UVRA 3ETRA 4Y2RA 3WK4A 2EANA 4UB2A 1D8LA 2VA2A 4J9RA 2FMPA 2EH9A 2F8LA 3UPQA 4PHPA 4RT3A 4F50A 4EBCA 5AI6A 3PV8A 4JWMA 2IOFA 5AI5A 2WAQF 2D8CA 4B9LA 2W9BB 4DOCA 3QU2A 5KFDA 1YZ6A 5B66U 3EZ5A 3D2NA 1NK6A 2K4IA 2PI5A 2HHTA 2WFAA 1IV8A 4IRDA 3I76A 5HHIA 9ICTA 4DEZA 2ALZA 2KSOB 5AKKA 4OJPA 2V4QA 4RUAA 3HKZF 4NLZA 1NKEA 2H3IA 3KZXA 4PGXA 3RB3A 2KE7A 1RG6A 2HBKA 3LVVA 5KFGA 4KLEA 1A6SA 1BPBA 3AU6A 3MFHA 2D3DA 4EELA 4KTQA 1ZQQA 9ICHA 2ZTDA 1ZQFA 1MSWD 3H8MA 4DOBA 1CUKA 2AGOA 3OSNA 4CDGA 2ZIWB 1N62A 4KX3A 4F93B 9ICQA 4Y2JA 3NGDA 5EE0A 5ALIA 1MN8A 1ZQXA 1IXRA 3QU4A 3J81j 1ZQBA 1L3UA 1JROA 1SV0A 2KHQA 1V9PA 3PX4A 2MRLA 5KFOA 1JXEA 4UARA 3KKAC 1TE2A 1ECWA 3V7JA 3RBDA 1XC9A 4QIWC 3ED5A 4Q8FA 4JK1A 4ECQA 2ZIXA 2A19A 1KFTA 3DEEA 2KK0A 1IM4A 5KT4A 5GTHU 5DG9A 1UA0A 1MQ3A 3N97B 2BCUA 4I2FA 2ASLA 2FMQA 4Y2XA 1X40A 9ICFA 4KLIA 1RM6C 3C23A 3HP6A 1K5OA 2PFPA 2FE9A 2W8KA 4EBDA 3NRZA 2KD1A 4B9MA 4GXJA 4YG2A 4UAVA 3Q8QB 1ZJNA 2FLPA 2PFOA 5DBAA 3RJEA 5J0PA 1QQ6A 2VJ4A 5KFAA 2C2RA 5ALSA 5J2HA 3PSPA 2IOFK 4C8OA 5CR0A 5KG6A 3OJSA 4UB6U 4F5OA 2JEIA 3TARA 3C29A 3MR2A 4O3NA 4F71A 4BX9C 5KT6A 2CN1A 2E8PA 4F5QA 1ZQEA 1RXVA 4KLUA 4EENA 2F77X 3RRGA 2BPFA 4CCHA 4NJ8A 4RQ6A 3SAFA 4F3OA 8ICBA 3KHHA 1ZRNA 3UXPA 1QH9A 5KT5A 4I29A 4UAWA 4DF4A 2HDOA 2F1IA 2WB1F 1SZHA 1ZQWA 9ICBA 2Y0SC 4E0DA 3WK6A 4EEYA 2J6UA 1SWWA 3GU3A 3ZDEA 4RU9A 3QUBA 4P4MA 5AM5A 5DB8A 2PXIA 3E58A 4ECXA 3TI0A 7ICEA 2OM6A 1SZPA 4C8MA 3B0YA 3WKCA 5A0LA 1N56A 1SL2A 3I28A 4RPZA 2ODGA 5J8YA 4TUQA 2FI1A 2HW3A 5IINA 5AK3A 9ICUA 7ICHA 4P0QB 4J9LA 5G5HA 3OJUA 2EAPA 1ZQLA 2QKQA 4Y2VA 3QX7A 4IL6U 5DB6A 4UB5A 3SV4A 3PX0A 2E8NA 3HT3A 3IRUA 3A0BU 3ETLA 8ICGA 2B6GA 4Y2TA 2AH5A 3BZKA 4MF8A 3TFRA 3H8WA 4NWIA 2E1FA 3K1ZA 2KZMA 4O5KA 1U47A 3WK7A 2R18A 4ED3A 2F76X 1NI3A 2H5XA 3RR7A 3UQ2A 1S0NA 1U45A 4F4KA 2AXTU 4DL4A 3JPNA 2O6KA 4P4OA 4DS5A 4C8NA 2W7PA 1D8YA 4FS1A 1V85A 5IIJA 3EW9A 2JHDA 2A3VA 8ICVA 4ECWA 5AHXA 3PNCA 5DB9A 3KOOA 2ISPA 4CNQA 2P35A 2JR5A 5DDYA 3RFAA 2KOBA 3F53A 1ZOLA 2Y1JA 5KNIA 4UB8U 4YCXA 3F2CA 1XS9D 2DPJA 4EZ9A 4F8RA 2ESEA 2KICA 5C0YA 2BDPA 1COKA 4M9LA 4PZOA 4M2YA 4RQ8A 8ICIA 4ECVA 2FPKA 1F5SA 2F1JA 4EZ6A 2ZIVA 1ZQ1C 4DSJA 3EPIA 2WTFA 3TQ1A 1S0OA 1T3QA 1MQ2A 4DSLA 2HVIA 1SWVA 5J0OA 4IRKA 1SXEA 4RQ2A 3FDSA 5JUMA 3NVVA 3PSIA 2QB0A 1EXNA 4C7ZA 5AK5A 2AQ4A 1NK4A 5E79U 3WK8A 3M6KA 5DDMA 4Q8EA 4B9UA 8ICFA 8ICSA 3GIKA 1ZQKA 2FLNA 4UQGA 2GH1A 4OJ5A 5C5JA 1Z4OA 2W3RA 2YMPA 2QLTA 1YT3A 3V72A 2YX8A 3I1YA 2G07A 1JMSA 2M0NA 3ZD8A 9ICXA 3SQIA 3ZDDA 4TQSA 5KFQA 4NY8A 2OCEA 3PO5A 5ALQA 4YFKA 2A1AA 1CRXA 4TURA 4YP3A 5ALHA 3OSPA 2WHEA 1FFUA 3ZD9A 2RP5A 7ICRA 3M1YA 5DB7A 5KT7A 3KBBA 2ZUBA 9ICVA 2XO7A 3RJKA 4FZLA 3H4DA 3D6JA 4QZEA 5J0UA 2RDJA 1PVPA 2H3VA 2Q0ZX 1PK3A 4F5PA 8ICZA 2M9NA 3LYSA 4PGQA 2Z7JA 3V6HA 4O3SA 2W55A 4NLBA 4AYBC 2LYHA 3L3FX 9ICPA 1TFRA 3F5AA 5IIOA 4USAA 2NRVA 1WWVA 4RQ5A 3ISBA 3AUOA 1NJWA 3H8JA 2AJQA 3LK9A 5J2AA 4RQNA 4DL3A 2PMZF 5CEHA 4UATA 2JEJA 2BCSA 2IHMA 1JX4A 1L3SA 4I2HA 1QQ7A 4DSEA 9ICKA 2YMMA 4JB3A 5KFMA 4YD2A 5J0WA 2RQ5A 1VLBA 4B9VA 1X42A 5ALLA 3HKZC 3ALRA 2KNJA 1ZQNA 3H0MB 2KV2A 4ELUA 1XSPA 4B9SA 5ALOA 5KFCA 5J29A 3A0HU 3SV3A 2MAXA 7ICVA 5BPCA 4DO9A 1PZNA 1KTQA 2ISOA 3MR6A 1L8LA 3BQTA 4QWAA 1RPLA 1L7PA 2HSZA 2UVWA 1WCNA 5DGBA 1B4FA 9ICSA 1L8OA 2HOIA 1NOMA 1JIHA 4F92B 2OEHA 4R65A 3KFUF 1RQNA 8ICQA 2EZYA 2H3QA 4O5CA 3KHLA 5DGAA 1TV9A 3BZCA 2XI9A 3TADC 3Q8RB 4DFDA 5KFFA 4KLDA 2W43A 5ALGA 4NM2A 5D49A 1ZQJA 4GLXA 3TADA 4DCCA 2JGAA 4RUCA 1NZPA 4RQ0A 1Q3VA 3BDPA 4GXIA 3PW2A 1NZBA 4M6WB 4ECRA 1DXSA 5KFVA 2C2EA 4EYHB 2NRWA 5F9NA 2XY6A 4DL2A 2BCRA 4PJ0U 2K8CB 3C1YA 2EZZA 8ICAA 1BPXA 2JEFA 3D2QA 5KFLA 4KLQA 5J8YC 1ZQGA 1URJA 1TAMA 2W9AA 4EEKA 9ICJA 4UW9A 3BS7A 2YTUA 2V9WA 1A76A 4C8LA 4Y2UA 1WUDA 3WKBA 4YVZA 4BXOA 5AKXA 3EWAA 3QNMA 1ZD5A 1WCLA 3GDXA 4IC9A 5HR7A 5J2DA 5KFYA 2FPMA 1X2IA 4NLKA 4Y2PA 4GC6A 3ONNA 1QSSA 5AKGA 5DG7A 3OPXA 1J2NA 5AKLA 1NJZA 1J97A 3MDCA 3GIJA 1K1SA 3RF9A 4ED8A 4K4HA 5IILA 2BCQA 2UVUA 4IS7A 3ORYA 3HW8A 7ICNA 4CF3A 5ALNA 3V7KA 3E2EA 1QQ5A 2MSNA 4KLTA 3BQ1A 1HJPA 2WAQC 5L1MA 4DOAA 1LB2B 4HAIA 4I27A 5AKYA 1S9FA 2N1RA 3JPQA 4DQRA 4XRHA 4ECTA 2G09A 2KN7A 2OXOA 1CEZA 5J0SA 3VC8A 1M6YA 2MUTB 1N63A 4RPYA 3H8SA 4DF8A 1X9WA 5AM1A 5AKZA 4NLCA 1K1QA 2ZUDA 4R8UB 3RBEA 3KHRA 1PVQA 3WU2U 2DF4B 2BR0A 2DWQA 4RNMA 5ALFA 2QB1A 4MEXA 1MC8A 7ICGA 3QU5A 3TACB 2DGZA 1TK5A 4CRXA 1UA1A 4ECZA 5AM0A 2ASJA 5KFWA 3C2MA 5JTIA 4GIBA 2YQEA 4F4YA 5AK6A 4KLMA 4P0PA 3LDAA 1XO1A 1OXJA 4XUSA 1TAUA 2ASDA 4J9KA 1HUZA 3GQCA 1N2XA 4ICAA 2KSOA 5IIKA 4Q43A 4M04A 2W8LA 2JZBB 4J03A 7ICUA 5HR6A 2NRTA 2F1HA 3JPPA 4LVSA 2PFQA 4Y2YA 3QZ7A 4DFMA 2IA6A 3PW7A 7ICQA 3RB0A 1XNSA 4DFPA 1KL9A 8ICYA 9ICNA 5KFZA 3PW0A 2J6TA 4F91B 3JPRA 1NK8A 3M9MB 4OJ6A 3WKDA 2QARB 1S8OA 4FZNA 2KMDA 1Z1BA 1BPYA 3LWLA 1KDHA 4AP9A 1VDVA 4BJQA 4MF2A 1X6IA 2HHUA 3M6ZA 5B5EU 3RAXA 4I2GA 1RYUA 4Y2QA 4U6PA 1KQQA 2IMWP 2JEGA 3LWMA 8ICPA 3JPTA 2HBMA 8ICHA 4U7CA 3OGUA 2I1QA
chains in the Genus database with same CATH topology
5KNIA 2LMRA 1WWVA 2Y9UA 1DXSA 1V38A 4PZNA 1SV0A 2ESEA 1SV4A 1KW4A 2E8OA 2LPEA 2F8KA 2KIVA 1PK1B 1COKA 4PZOA 4RQNA 3KKAC 1SGGA 1F0MA 2JV3A 3K1RB 2QB1A 2EANA 1JI7A 2K60A 5J8YC 3BQ7A 3TACB 1X9XA 5JRTA 1SXEA 3IDWA 5JTIA 5JU5A 3BS7A 2YTUA 4NL9A 1B0XA 2D8CA 2QB0A 3KKAA 1OXJA 2DKZA 2EAMA 4RQMA 1X40A 5J8YA 1OW5A 2KSOA 1UQVA 2FE9A 2E8MA 3SEIA 2EAPA 1X66A 2L5YA 2QKQA 2DL0A 2Y9TA 3HILA 2KSOB 2E8NA 3BS5A 1B4FA 5F3XB 2B6GA 1LKYB 1SV0C 1WWUA 2QARA 4IS7A 2KE7A 1RG6A 4MHVA 1UCVA 2DKXA 1LKYA 2F3NA 2D3DA 2QARB 4NL9C 2GLEA 1Z1VA 5L1MA 2ES6A 2KMDA 3TADC 3SENA 3H8MA 2E8PA 1V85A 1PK3A 1SXDA 3TADA 2EAOA 4NJ8A 2KG5A 2K4PA 3BS5B 2F44A 1PK1A 2QB0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KNI A;  2LMR A;  1WWV A;  2Y9U A;  1DXS A;  1V38 A;  4PZN A;  1SV0 A;  2ESE A;  1SV4 A;  1KW4 A;  2E8O A;  2LPE A;  2F8K A;  2KIV A;  1PK1 B;  1COK A;  4PZO A;  4RQN A;  3KKA C;  1SGG A;  1F0M A;  2JV3 A;  3K1R B;  2QB1 A;  2EAN A;  1JI7 A;  2K60 A;  5J8Y C;  3BQ7 A;  3TAC B;  1X9X A;  5JRT A;  1SXE A;  3IDW A;  5JTI A;  5JU5 A;  3BS7 A;  2YTU A;  4NL9 A;  1B0X A;  2D8C A;  2QB0 A;  3KKA A;  1OXJ A;  2DKZ A;  2EAM A;  4RQM A;  1X40 A;  5J8Y A;  1OW5 A;  2KSO A;  1UQV A;  2FE9 A;  2E8M A;  3SEI A;  2EAP A;  1X66 A;  2L5Y A;  2QKQ A;  2DL0 A;  2Y9T A;  3HIL A;  2KSO B;  2E8N A;  3BS5 A;  1B4F A;  5F3X B;  2B6G A;  1LKY B;  1SV0 C;  1WWU A;  2QAR A;  4IS7 A;  2KE7 A;  1RG6 A;  4MHV A;  1UCV A;  2DKX A;  1LKY A;  2F3N A;  2D3D A;  2QAR B;  4NL9 C;  2GLE A;  1Z1V A;  5L1M A;  2ES6 A;  2KMD A;  3TAD C;  3SEN A;  3H8M A;  2E8P A;  1V85 A;  1PK3 A;  1SXD A;  3TAD A;  2EAO A;  4NJ8 A;  2KG5 A;  2K4P A;  3BS5 B;  2F44 A;  1PK1 A;  2QB0 B; 
#chains in the Genus database with same CATH topology
 1JN3 A;  1HIW A;  3RJI A;  3NUQ A;  4QZH A;  2W7O A;  2OYY A;  3F5E A;  3CYM A;  2HCF A;  2LMR A;  2Y9U A;  3RH6 A;  1KBU A;  3Q8P B;  2AHO B;  3JPO A;  3RJJ A;  5KFE A;  2KP7 A;  3PML A;  5KL1 B;  2R8K A;  3MBY A;  4ZH4 A;  4Z6E A;  3KZI U;  3K1R B;  1L5U A;  4EX7 A;  3TKA A;  3NVY A;  3H40 A;  1JI7 A;  2K60 A;  5KFK A;  2PKE A;  1ZQV A;  5HP4 A;  1XSL A;  3SR6 A;  1QSL A;  5FP0 A;  1RXW A;  5ALJ A;  3MGI A;  1LV5 A;  3MC1 A;  4WJ3 B;  3UXN A;  2NRZ A;  4PHA A;  4UBC A;  2DKZ A;  4CE6 A;  1N60 A;  4J9O A;  3PR5 B;  2Q4T A;  3BQ0 A;  3PR4 A;  2EZX A;  5L1L A;  1ZJM A;  1SL0 A;  2E8M A;  4GC7 A;  2XGP A;  2RDI A;  3IP4 B;  4RQ7 A;  4BUG A;  2CXY A;  2H3Z A;  3RB6 A;  2ZXI A;  2ZG6 A;  3KD3 A;  2F3N A;  2OH2 A;  1SKW A;  2HVH A;  2LKY A;  5L1I A;  2ES6 A;  2BCV A;  2YB4 A;  5KFS A;  3GZF A;  2JXJ A;  2YB1 A;  4OCZ A;  3MAB A;  5BOM A;  1JRP A;  3NS1 A;  3N4M B;  1RDF A;  1ZQU A;  2WF6 A;  8ICM A;  3FYH A;  4DSK A;  3RR8 A;  2KJ9 A;  3UMB A;  2KVC A;  1L7N A;  3Q8L A;  2D6F C;  4O9M A;  4DS4 A;  5F9L A;  1V38 A;  4ED2 A;  5DBC A;  5TIS U;  7ICT A;  8ICJ A;  2LHT A;  1SGG A;  4MFA A;  2UVV A;  4P0P B;  4DQS A;  2R8J A;  3SD7 A;  2PMZ C;  3SI8 A;  5H2F U;  2ZIW A;  3B9J A;  2NYV A;  1D9D A;  1X9M A;  3THV A;  4C0Z A;  4ELV A;  3IN5 A;  1DRG A;  8ICR A;  5AK4 A;  3G6Y A;  4I2B A;  1S77 D;  1ZQM A;  5ALE A;  1O08 A;  4J9M A;  7ICL A;  2BHN A;  4FZM A;  5J2E A;  2VIX A;  2DPI A;  1ZYQ A;  3MFI A;  8ICE A;  3C21 A;  5EWF A;  1WG8 A;  4M9J A;  3SEI A;  3RH5 A;  9ICI A;  3H4B A;  2LI6 A;  3CW2 C;  5DKW A;  2GO7 A;  4YMO A;  1HEK A;  4R64 A;  5TZV A;  3T79 A;  2ZIX B;  2G0A A;  4P4P A;  2PI4 A;  1SV0 C;  1NNL A;  4Q45 A;  5AKI A;  2QAR A;  1S0V A;  4DLE A;  3M9N B;  5KFJ A;  7ICK A;  4ED1 A;  1Z19 A;  4NLN A;  1NK7 A;  5CA7 A;  4BWJ A;  3N7S C;  2IHN A;  1Q3U A;  1Z1V A;  5CP2 A;  2Y0S F;  8ICN A;  3PZP A;  4NV0 A;  2WB1 C;  1BPZ A;  5AI4 A;  5D46 A;  3RAQ A;  2WF5 A;  4QW8 A;  4JV1 A;  4J9Q A;  3ICX A;  2ATL A;  3AU2 A;  1U48 A;  3PSF A;  2G06 A;  5EE1 A;  2ZIU B;  4JV0 A;  3OTQ A;  5HNK A;  9ICW A;  3N28 A;  2DBY A;  2JH7 A;  4QW9 A;  3AEV A;  1Z00 A;  4O3Q A;  4R66 A;  4UB1 A;  4C80 A;  4QJF B;  1XSN A;  5KG1 A;  1Q8K A;  5ALR A;  3OHB A;  3H0L B;  1T4G A;  4QNL A;  5ALM A;  3RJH A;  4C8K A;  3T5L A;  8ICL A;  4RPX A;  1X9X A;  1U49 A;  1NKC A;  2HHW A;  2MU2 A;  1ZQC A;  8ICW A;  2VJ5 A;  3AL0 B;  2K8B B;  3CRX A;  3MR3 A;  3T5K A;  4DFJ A;  1NK0 A;  2R8G A;  5J2I A;  5CRX A;  1IIP A;  8ICK A;  3HWT A;  5ALZ A;  1TKD A;  5J2C A;  5EOZ A;  5AIC A;  1BGX T;  2ZTC A;  1X66 A;  2RLT A;  9ICM A;  3AQE A;  3HIL A;  1L7M A;  2LYB A;  2BQR A;  4C4R A;  2W11 A;  4UB4 A;  4YMN A;  4MHV A;  5AI9 A;  5GTI U;  4F5N A;  3WK5 A;  5J2G A;  2B0C A;  5DLG A;  4YR3 A;  3MGH A;  1ZXI A;  4F72 A;  4Q44 A;  2F2A B;  2DUY A;  7ICJ A;  2ZUC A;  8ICT A;  4TUP A;  4P0Q A;  4ED6 A;  1L3V A;  1ZQA A;  4O0I A;  3EYZ A;  5KFN A;  3NAS A;  2BQU A;  1F44 A;  1UHU A;  1NJY A;  1N61 A;  3L4P A;  4PGY A;  2OWO A;  3UXO A;  5KG5 A;  2VAN A;  4US9 A;  8ICX A;  4UAY A;  2BQ3 A;  5KFR A;  1N48 A;  1GO3 F;  3FM9 A;  1BPE A;  4QZD A;  4F2R A;  3V6K A;  1F0M A;  3WKA A;  5KFT A;  2YN4 A;  4YXJ A;  5ALK A;  3NVW A;  1HUO A;  1XWL A;  1BNP A;  2KVS A;  3Q8S B;  2KFN A;  5DQG A;  2W3S A;  4ED0 A;  1B0X A;  3T3F A;  5DQH A;  5KG2 A;  3UMC A;  1DOQ A;  8ICU A;  4KMO B;  1JXL A;  2A1J B;  3PW4 A;  1A77 A;  2YML A;  4FS2 A;  4FO6 A;  4QWD A;  3QUQ A;  4QZA A;  2XVT A;  2W9B A;  2KJ8 A;  4M9H A;  5AI8 A;  2DL0 A;  2RRD A;  4PHE A;  7ICO A;  2ZIV B;  9ICA A;  4LJX A;  5F3X B;  3QU9 A;  1ZQD A;  1IG6 A;  1X6J A;  2R8H A;  1U4B A;  5III A;  4YXM A;  3MR5 A;  4G3I A;  3PX6 A;  3FAH A;  2BDU A;  5CB1 A;  1JUD A;  1ZQP A;  3E0F A;  4I2E A;  3EPG A;  1COO A;  5L1J A;  1T94 A;  3AM9 A;  4GFJ A;  4M9G A;  4I2A A;  1ZQT A;  5KG4 A;  5AM4 A;  4UAZ A;  3V6J A;  4ACO A;  5EE9 A;  4P2H A;  3GII A;  2XC9 A;  3KHG A;  5KFI A;  5J2J A;  3IG8 A;  3HX0 A;  2HHQ A;  1PK1 B;  2W9C A;  4Z6F A;  5KG0 A;  4QZ8 A;  5KFX A;  1DK3 A;  4B9T A;  3M8S A;  4XQ8 A;  5G5G A;  1RZT A;  4MFF A;  1VJ5 A;  1ZQZ A;  1N5X A;  2JRZ A;  2KKP A;  4QZI A;  3G6V A;  3LVW A;  3HPO A;  3T5H A;  4DL7 A;  4NM1 A;  4ECY A;  1OUQ A;  3IDW A;  2E5S A;  1KFD A;  4KLH A;  5L9X A;  1ED1 A;  5DG8 A;  4M9N A;  1DK2 A;  5HHH A;  3QYP A;  4YD1 A;  3SMV A;  1C20 A;  4O3R A;  4DQP A;  2C28 A;  1J2M A;  5AIB A;  3ZI4 A;  4DFK A;  4QZB A;  1SL1 A;  1DGS A;  4JMU A;  5ALU A;  9ICE A;  3N7P D;  1CI4 A;  4G9B A;  4XA5 A;  3NRW A;  9ICL A;  3MGV A;  4QZG A;  1TVA A;  1XO0 A;  1WWU A;  9ICO A;  2H3F A;  5DLF A;  1S10 A;  5J0R A;  4PPX A;  1FEZ A;  3QU7 A;  2WF9 A;  2BPC A;  3K4G A;  3UMG A;  4MFC A;  4J9P A;  2ZXH A;  3TAP A;  1NKB A;  4KN7 A;  2I6X A;  5K4L A;  2XCA A;  2VA8 A;  5KAI U;  3S6J A;  3SAG A;  2XGQ A;  3ZDC A;  5KAF U;  2E1E A;  1ZQS A;  3SZ2 A;  2WF8 A;  4NXZ A;  4B6J A;  4M47 A;  1D9F A;  1S5L U;  4IQW A;  2BPG A;  4PL1 A;  1JAL A;  1L6N A;  2V4R A;  4QWB A;  2QB0 B;  1SKR A;  2G5I B;  4ELT A;  2XID A;  7ICM A;  4BWM A;  4AYB F;  4EBE A;  2HHX A;  3ZDB A;  2HMX A;  1AQ6 A;  5J2K A;  2P66 A;  2FJ6 A;  5ALX A;  2RHF A;  2W03 A;  4IR9 A;  3MDA A;  1S76 D;  2YMQ A;  2CPR A;  4Z6D A;  4I2C A;  5JRT A;  2A1J A;  5CHG A;  3K75 D;  4KLJ A;  4DL6 A;  2JZB A;  1BNO A;  5JU5 A;  2FLL A;  4NL9 A;  3EUB 2;  1QLN A;  1QSY A;  4RQM A;  2I5H A;  4A8E A;  4DSI A;  1OW5 A;  4KLG A;  4M6W A;  3C28 A;  5J0X A;  3PMN A;  3UM9 A;  4HYK A;  1RYS A;  1T7P A;  1UQV A;  4I28 A;  3HJE A;  5KFU A;  5KFB A;  5AM3 A;  4QZ9 A;  2VA3 A;  3IG5 A;  2FMS A;  2P6R A;  4QZF A;  2KFZ A;  2AQ0 A;  3BS5 A;  5L1K A;  4YR2 A;  3B0X A;  3TAQ A;  3KTQ A;  4R63 A;  5KTQ A;  3QEA Z;  4YMM A;  4O5E A;  4FE3 A;  2K4H A;  4Y2S A;  3C2L A;  4YR0 A;  3G6X A;  3CNH A;  1KRP A;  2KZZ A;  1LKY A;  5HML A;  3GV8 B;  2KIW A;  4CF5 A;  3SAH A;  3M7D A;  4NL9 C;  3ZDA A;  5AKJ A;  1PUZ A;  4KLF A;  4M0A A;  3N7R C;  3RH4 A;  3RRH A;  4JUZ A;  3NTU A;  3QUT A;  5J0Q A;  4OD0 A;  1NK5 A;  4C4S A;  4EYI B;  2NRX A;  3R9K A;  2K4P A;  5EE3 A;  2F44 A;  1KSP A;  2XCP A;  4PHD A;  1PK1 A;  2W9C B;  1L7O A;  4RQ3 A;  3QZ8 A;  4QWC A;  4F4X A;  2BKE A;  2FPL A;  4DQQ A;  7ICS A;  4IQT A;  3TFS A;  4FBU A;  1KW4 A;  2KIV A;  2NV3 A;  3V7L A;  5EWE A;  1A0P A;  4DSF A;  4OO1 J;  4J9S A;  2JV3 A;  9ICC A;  5DQI A;  3BJY A;  3D2S A;  1ZD3 A;  4KN4 A;  3L5K A;  2EDU A;  2KTQ A;  3UQ0 A;  2IBK A;  4GXK A;  2KHV A;  7ICF A;  5HMM A;  3RB4 A;  4F4Z A;  2AGP A;  1N5W A;  1MA7 A;  2PFN A;  2IOH A;  1RYR A;  3PVX A;  4K4I A;  3PY8 A;  5IIM A;  2CRX A;  2KZ3 A;  4UAS A;  2ZTE A;  4LZD A;  4FBT A;  4I2D A;  2FDR A;  4R8U A;  4ECS A;  9ICG A;  4ZOH C;  3CP8 A;  1KFS A;  3C5G A;  2VKQ A;  2L5Y A;  4OJO A;  3PO4 A;  1QCK A;  2G5H B;  3O0F A;  4KMU A;  3WK9 A;  1FFV A;  2I9G A;  3GV7 B;  1KN5 A;  1T3N A;  5KT3 A;  4IQV A;  3Q8M A;  4UB3 A;  4QIW F;  4QWE A;  5T14 A;  5KG7 A;  4TQR A;  4F4W A;  5AI0 A;  1Q46 A;  4PH5 A;  4OJL A;  5ALY A;  4RT2 A;  3BQ2 A;  1B22 A;  4KLO A;  4JV2 A;  3M8R A;  3C2K A;  1FIQ A;  4ECU A;  1ZQI A;  2EAO A;  3ISC A;  4IQU A;  2GOL A;  2E3T A;  4IR1 A;  2KG5 A;  7ICI A;  3ISD A;  1PVR A;  4DL5 A;  3Q8K A;  2LYA A;  2GWS A;  1V97 A;  4UBB A;  1ZQO A;  2W9M A;  4TUS A;  3RJG A;  4BXO B;  2KJ5 A;  2HI0 A;  4F2S A;  3PW5 A;  2G08 A;  1KLN A;  2NO4 A;  5CWR A;  2E8O A;  4K4G A;  1O03 A;  7ICP A;  5ALD A;  4J9N A;  5D4B A;  2ZJ5 A;  1QTM A;  5KFP A;  1H38 A;  3AQF A;  5ALW A;  4CGZ A;  4EX6 A;  1ZET A;  1RQL A;  4MEY A;  4O3O A;  2XY7 A;  4DLG A;  5CJ7 A;  4US8 A;  5ALT A;  2EAM A;  2KKV A;  3DV9 A;  3VCB A;  1ZD2 P;  2BGW A;  2OHF A;  5EWG A;  1C7Y A;  3U26 A;  2BZF A;  3QEB Z;  4PL2 A;  3H0R B;  8ICC A;  1S97 A;  1P7D A;  1Y88 A;  4YN4 A;  1BPD A;  1NJX A;  5DBB A;  1LKY B;  4CF4 A;  1UT8 A;  2MUT A;  1D8B A;  4NLG A;  3GIL A;  2KEY A;  1L3T A;  1UCV A;  1ZD4 A;  5J0T A;  1ZQH A;  4I2J A;  1Z4N A;  1LVH A;  3OHA A;  2DFL A;  4DWI A;  1ZQY A;  2HOQ A;  2GLE A;  3WKE A;  1DGJ A;  3IHQ B;  4FFD A;  4RQ1 A;  2HOF A;  2WF7 A;  3SEN A;  1Z3E B;  4RZR A;  2XIC A;  2ZIU A;  1SIJ A;  4KIT B;  2C2D A;  2K4E A;  3IV6 A;  1Z00 B;  2HHV A;  2JH1 A;  5AKH A;  4C7Y A;  2JMG A;  9ICR A;  2HBL A;  4PZN A;  2K8A A;  4KLL A;  3C5F A;  2XY5 A;  4F5R A;  3AN1 A;  2ZJ8 A;  4Z6C A;  5J2F A;  3RTV A;  4ED7 A;  1S0M A;  2MA1 A;  5KT2 A;  3QUC A;  1ZQR A;  1ZRM A;  3BQ7 A;  1KEJ A;  3AMZ A;  3HRD D;  5AKE A;  3GFK B;  4KX5 A;  1KKX A;  4O3M A;  5AM2 A;  1FO4 A;  3KKA A;  5J2B A;  2EQY A;  2LM1 A;  2P6U A;  2LBO A;  5J0Y A;  1YZ7 A;  5AIA A;  2LM4 A;  1WYG A;  5BOL A;  1T8E A;  1TK0 A;  5ALP A;  3GIM A;  3IM1 A;  2HBJ A;  4RNN A;  2Y9T A;  4UAU A;  3SYZ A;  2W04 A;  3FC4 A;  4QZC A;  1SB3 C;  2R8I A;  1UPH A;  3T5J A;  3DDH A;  2B21 A;  4IRC A;  1NK9 A;  1ARO P;  8ICO A;  4RQ4 A;  4KLS A;  2YY6 A;  3GV5 B;  1X9S A;  5KG3 A;  4DQI A;  2AU0 A;  1SKS A;  4YQW A;  2DKX A;  1U9L A;  3M9O B;  2C22 A;  5KFH A;  2J6S A;  1TAQ A;  3F2B A;  4JWN A;  4BDP A;  5KL8 B;  3TAN A;  2HHS A;  1BVS A;  3H7I A;  3F2D A;  3RJF A;  2ZJA A;  1UT5 A;  1SXD A;  3JPS A;  4RNO A;  4BGD A;  2DQN B;  1TK8 A;  3NVZ A;  1XU4 A;  3BS5 B;  4O3P A;  3QE9 Y;  2AGQ A;  4LZG A;  2Y1I A;  4I2I A;  5ALV A;  3PST A;  3C1Z A;  4B9N A;  3QXG A;  1SV4 A;  2F8K A;  2LPE A;  2NO5 A;  2K89 A;  1B43 A;  2W54 A;  4X5V A;  4C4T A;  2UVR A;  3ETR A;  4Y2R A;  3WK4 A;  2EAN A;  4UB2 A;  1D8L A;  2VA2 A;  4J9R A;  2FMP A;  2EH9 A;  2F8L A;  3UPQ A;  4PHP A;  4RT3 A;  4F50 A;  4EBC A;  5AI6 A;  3PV8 A;  4JWM A;  2IOF A;  5AI5 A;  2WAQ F;  2D8C A;  4B9L A;  2W9B B;  4DOC A;  3QU2 A;  5KFD A;  1YZ6 A;  5B66 U;  3EZ5 A;  3D2N A;  1NK6 A;  2K4I A;  2PI5 A;  2HHT A;  2WFA A;  1IV8 A;  4IRD A;  3I76 A;  5HHI A;  9ICT A;  4DEZ A;  2ALZ A;  2KSO B;  5AKK A;  4OJP A;  2V4Q A;  4RUA A;  3HKZ F;  4NLZ A;  1NKE A;  2H3I A;  3KZX A;  4PGX A;  3RB3 A;  2KE7 A;  1RG6 A;  2HBK A;  3LVV A;  5KFG A;  4KLE A;  1A6S A;  1BPB A;  3AU6 A;  3MFH A;  2D3D A;  4EEL A;  4KTQ A;  1ZQQ A;  9ICH A;  2ZTD A;  1ZQF A;  1MSW D;  3H8M A;  4DOB A;  1CUK A;  2AGO A;  3OSN A;  4CDG A;  2ZIW B;  1N62 A;  4KX3 A;  4F93 B;  9ICQ A;  4Y2J A;  3NGD A;  5EE0 A;  5ALI A;  1MN8 A;  1ZQX A;  1IXR A;  3QU4 A;  3J81 j;  1ZQB A;  1L3U A;  1JRO A;  1SV0 A;  2KHQ A;  1V9P A;  3PX4 A;  2MRL A;  5KFO A;  1JXE A;  4UAR A;  3KKA C;  1TE2 A;  1ECW A;  3V7J A;  3RBD A;  1XC9 A;  4QIW C;  3ED5 A;  4Q8F A;  4JK1 A;  4ECQ A;  2ZIX A;  2A19 A;  1KFT A;  3DEE A;  2KK0 A;  1IM4 A;  5KT4 A;  5GTH U;  5DG9 A;  1UA0 A;  1MQ3 A;  3N97 B;  2BCU A;  4I2F A;  2ASL A;  2FMQ A;  4Y2X A;  1X40 A;  9ICF A;  4KLI A;  1RM6 C;  3C23 A;  3HP6 A;  1K5O A;  2PFP A;  2FE9 A;  2W8K A;  4EBD A;  3NRZ A;  2KD1 A;  4B9M A;  4GXJ A;  4YG2 A;  4UAV A;  3Q8Q B;  1ZJN A;  2FLP A;  2PFO A;  5DBA A;  3RJE A;  5J0P A;  1QQ6 A;  2VJ4 A;  5KFA A;  2C2R A;  5ALS A;  5J2H A;  3PSP A;  2IOF K;  4C8O A;  5CR0 A;  5KG6 A;  3OJS A;  4UB6 U;  4F5O A;  2JEI A;  3TAR A;  3C29 A;  3MR2 A;  4O3N A;  4F71 A;  4BX9 C;  5KT6 A;  2CN1 A;  2E8P A;  4F5Q A;  1ZQE A;  1RXV A;  4KLU A;  4EEN A;  2F77 X;  3RRG A;  2BPF A;  4CCH A;  4NJ8 A;  4RQ6 A;  3SAF A;  4F3O A;  8ICB A;  3KHH A;  1ZRN A;  3UXP A;  1QH9 A;  5KT5 A;  4I29 A;  4UAW A;  4DF4 A;  2HDO A;  2F1I A;  2WB1 F;  1SZH A;  1ZQW A;  9ICB A;  2Y0S C;  4E0D A;  3WK6 A;  4EEY A;  2J6U A;  1SWW A;  3GU3 A;  3ZDE A;  4RU9 A;  3QUB A;  4P4M A;  5AM5 A;  5DB8 A;  2PXI A;  3E58 A;  4ECX A;  3TI0 A;  7ICE A;  2OM6 A;  1SZP A;  4C8M A;  3B0Y A;  3WKC A;  5A0L A;  1N56 A;  1SL2 A;  3I28 A;  4RPZ A;  2ODG A;  5J8Y A;  4TUQ A;  2FI1 A;  2HW3 A;  5IIN A;  5AK3 A;  9ICU A;  7ICH A;  4P0Q B;  4J9L A;  5G5H A;  3OJU A;  2EAP A;  1ZQL A;  2QKQ A;  4Y2V A;  3QX7 A;  4IL6 U;  5DB6 A;  4UB5 A;  3SV4 A;  3PX0 A;  2E8N A;  3HT3 A;  3IRU A;  3A0B U;  3ETL A;  8ICG A;  2B6G A;  4Y2T A;  2AH5 A;  3BZK A;  4MF8 A;  3TFR A;  3H8W A;  4NWI A;  2E1F A;  3K1Z A;  2KZM A;  4O5K A;  1U47 A;  3WK7 A;  2R18 A;  4ED3 A;  2F76 X;  1NI3 A;  2H5X A;  3RR7 A;  3UQ2 A;  1S0N A;  1U45 A;  4F4K A;  2AXT U;  4DL4 A;  3JPN A;  2O6K A;  4P4O A;  4DS5 A;  4C8N A;  2W7P A;  1D8Y A;  4FS1 A;  1V85 A;  5IIJ A;  3EW9 A;  2JHD A;  2A3V A;  8ICV A;  4ECW A;  5AHX A;  3PNC A;  5DB9 A;  3KOO A;  2ISP A;  4CNQ A;  2P35 A;  2JR5 A;  5DDY A;  3RFA A;  2KOB A;  3F53 A;  1ZOL A;  2Y1J A;  5KNI A;  4UB8 U;  4YCX A;  3F2C A;  1XS9 D;  2DPJ A;  4EZ9 A;  4F8R A;  2ESE A;  2KIC A;  5C0Y A;  2BDP A;  1COK A;  4M9L A;  4PZO A;  4M2Y A;  4RQ8 A;  8ICI A;  4ECV A;  2FPK A;  1F5S A;  2F1J A;  4EZ6 A;  2ZIV A;  1ZQ1 C;  4DSJ A;  3EPI A;  2WTF A;  3TQ1 A;  1S0O A;  1T3Q A;  1MQ2 A;  4DSL A;  2HVI A;  1SWV A;  5J0O A;  4IRK A;  1SXE A;  4RQ2 A;  3FDS A;  5JUM A;  3NVV A;  3PSI A;  2QB0 A;  1EXN A;  4C7Z A;  5AK5 A;  2AQ4 A;  1NK4 A;  5E79 U;  3WK8 A;  3M6K A;  5DDM A;  4Q8E A;  4B9U A;  8ICF A;  8ICS A;  3GIK A;  1ZQK A;  2FLN A;  4UQG A;  2GH1 A;  4OJ5 A;  5C5J A;  1Z4O A;  2W3R A;  2YMP A;  2QLT A;  1YT3 A;  3V72 A;  2YX8 A;  3I1Y A;  2G07 A;  1JMS A;  2M0N A;  3ZD8 A;  9ICX A;  3SQI A;  3ZDD A;  4TQS A;  5KFQ A;  4NY8 A;  2OCE A;  3PO5 A;  5ALQ A;  4YFK A;  2A1A A;  1CRX A;  4TUR A;  4YP3 A;  5ALH A;  3OSP A;  2WHE A;  1FFU A;  3ZD9 A;  2RP5 A;  7ICR A;  3M1Y A;  5DB7 A;  5KT7 A;  3KBB A;  2ZUB A;  9ICV A;  2XO7 A;  3RJK A;  4FZL A;  3H4D A;  3D6J A;  4QZE A;  5J0U A;  2RDJ A;  1PVP A;  2H3V A;  2Q0Z X;  1PK3 A;  4F5P A;  8ICZ A;  2M9N A;  3LYS A;  4PGQ A;  2Z7J A;  3V6H A;  4O3S A;  2W55 A;  4NLB A;  4AYB C;  2LYH A;  3L3F X;  9ICP A;  1TFR A;  3F5A A;  5IIO A;  4USA A;  2NRV A;  1WWV A;  4RQ5 A;  3ISB A;  3AUO A;  1NJW A;  3H8J A;  2AJQ A;  3LK9 A;  5J2A A;  4RQN A;  4DL3 A;  2PMZ F;  5CEH A;  4UAT A;  2JEJ A;  2BCS A;  2IHM A;  1JX4 A;  1L3S A;  4I2H A;  1QQ7 A;  4DSE A;  9ICK A;  2YMM A;  4JB3 A;  5KFM A;  4YD2 A;  5J0W A;  2RQ5 A;  1VLB A;  4B9V A;  1X42 A;  5ALL A;  3HKZ C;  3ALR A;  2KNJ A;  1ZQN A;  3H0M B;  2KV2 A;  4ELU A;  1XSP A;  4B9S A;  5ALO A;  5KFC A;  5J29 A;  3A0H U;  3SV3 A;  2MAX A;  7ICV A;  5BPC A;  4DO9 A;  1PZN A;  1KTQ A;  2ISO A;  3MR6 A;  1L8L A;  3BQT A;  4QWA A;  1RPL A;  1L7P A;  2HSZ A;  2UVW A;  1WCN A;  5DGB A;  1B4F A;  9ICS A;  1L8O A;  2HOI A;  1NOM A;  1JIH A;  4F92 B;  2OEH A;  4R65 A;  3KFU F;  1RQN A;  8ICQ A;  2EZY A;  2H3Q A;  4O5C A;  3KHL A;  5DGA A;  1TV9 A;  3BZC A;  2XI9 A;  3TAD C;  3Q8R B;  4DFD A;  5KFF A;  4KLD A;  2W43 A;  5ALG A;  4NM2 A;  5D49 A;  1ZQJ A;  4GLX A;  3TAD A;  4DCC A;  2JGA A;  4RUC A;  1NZP A;  4RQ0 A;  1Q3V A;  3BDP A;  4GXI A;  3PW2 A;  1NZB A;  4M6W B;  4ECR A;  1DXS A;  5KFV A;  2C2E A;  4EYH B;  2NRW A;  5F9N A;  2XY6 A;  4DL2 A;  2BCR A;  4PJ0 U;  2K8C B;  3C1Y A;  2EZZ A;  8ICA A;  1BPX A;  2JEF A;  3D2Q A;  5KFL A;  4KLQ A;  5J8Y C;  1ZQG A;  1URJ A;  1TAM A;  2W9A A;  4EEK A;  9ICJ A;  4UW9 A;  3BS7 A;  2YTU A;  2V9W A;  1A76 A;  4C8L A;  4Y2U A;  1WUD A;  3WKB A;  4YVZ A;  4BXO A;  5AKX A;  3EWA A;  3QNM A;  1ZD5 A;  1WCL A;  3GDX A;  4IC9 A;  5HR7 A;  5J2D A;  5KFY A;  2FPM A;  1X2I A;  4NLK A;  4Y2P A;  4GC6 A;  3ONN A;  1QSS A;  5AKG A;  5DG7 A;  3OPX A;  1J2N A;  5AKL A;  1NJZ A;  1J97 A;  3MDC A;  3GIJ A;  1K1S A;  3RF9 A;  4ED8 A;  4K4H A;  5IIL A;  2BCQ A;  2UVU A;  4IS7 A;  3ORY A;  3HW8 A;  7ICN A;  4CF3 A;  5ALN A;  3V7K A;  3E2E A;  1QQ5 A;  2MSN A;  4KLT A;  3BQ1 A;  1HJP A;  2WAQ C;  5L1M A;  4DOA A;  1LB2 B;  4HAI A;  4I27 A;  5AKY A;  1S9F A;  2N1R A;  3JPQ A;  4DQR A;  4XRH A;  4ECT A;  2G09 A;  2KN7 A;  2OXO A;  1CEZ A;  5J0S A;  3VC8 A;  1M6Y A;  2MUT B;  1N63 A;  4RPY A;  3H8S A;  4DF8 A;  1X9W A;  5AM1 A;  5AKZ A;  4NLC A;  1K1Q A;  2ZUD A;  4R8U B;  3RBE A;  3KHR A;  1PVQ A;  3WU2 U;  2DF4 B;  2BR0 A;  2DWQ A;  4RNM A;  5ALF A;  2QB1 A;  4MEX A;  1MC8 A;  7ICG A;  3QU5 A;  3TAC B;  2DGZ A;  1TK5 A;  4CRX A;  1UA1 A;  4ECZ A;  5AM0 A;  2ASJ A;  5KFW A;  3C2M A;  5JTI A;  4GIB A;  2YQE A;  4F4Y A;  5AK6 A;  4KLM A;  4P0P A;  3LDA A;  1XO1 A;  1OXJ A;  4XUS A;  1TAU A;  2ASD A;  4J9K A;  1HUZ A;  3GQC A;  1N2X A;  4ICA A;  2KSO A;  5IIK A;  4Q43 A;  4M04 A;  2W8L A;  2JZB B;  4J03 A;  7ICU A;  5HR6 A;  2NRT A;  2F1H A;  3JPP A;  4LVS A;  2PFQ A;  4Y2Y A;  3QZ7 A;  4DFM A;  2IA6 A;  3PW7 A;  7ICQ A;  3RB0 A;  1XNS A;  4DFP A;  1KL9 A;  8ICY A;  9ICN A;  5KFZ A;  3PW0 A;  2J6T A;  4F91 B;  3JPR A;  1NK8 A;  3M9M B;  4OJ6 A;  3WKD A;  2QAR B;  1S8O A;  4FZN A;  2KMD A;  1Z1B A;  1BPY A;  3LWL A;  1KDH A;  4AP9 A;  1VDV A;  4BJQ A;  4MF2 A;  1X6I A;  2HHU A;  3M6Z A;  5B5E U;  3RAX A;  4I2G A;  1RYU A;  4Y2Q A;  4U6P A;  1KQQ A;  2IMW P;  2JEG A;  3LWM A;  8ICP A;  3JPT A;  2HBM A;  8ICH A;  4U7C A;  3OGU A;  2I1Q A; 
#chains in the Genus database with same CATH homology
 5KNI A;  2LMR A;  1WWV A;  2Y9U A;  1DXS A;  1V38 A;  4PZN A;  1SV0 A;  2ESE A;  1SV4 A;  1KW4 A;  2E8O A;  2LPE A;  2F8K A;  2KIV A;  1PK1 B;  1COK A;  4PZO A;  4RQN A;  3KKA C;  1SGG A;  1F0M A;  2JV3 A;  3K1R B;  2QB1 A;  2EAN A;  1JI7 A;  2K60 A;  5J8Y C;  3BQ7 A;  3TAC B;  1X9X A;  5JRT A;  1SXE A;  3IDW A;  5JTI A;  5JU5 A;  3BS7 A;  2YTU A;  4NL9 A;  1B0X A;  2D8C A;  2QB0 A;  3KKA A;  1OXJ A;  2DKZ A;  2EAM A;  4RQM A;  1X40 A;  5J8Y A;  1OW5 A;  2KSO A;  1UQV A;  2FE9 A;  2E8M A;  3SEI A;  2EAP A;  1X66 A;  2L5Y A;  2QKQ A;  2DL0 A;  2Y9T A;  3HIL A;  2KSO B;  2E8N A;  3BS5 A;  1B4F A;  5F3X B;  2B6G A;  1LKY B;  1SV0 C;  1WWU A;  2QAR A;  4IS7 A;  2KE7 A;  1RG6 A;  4MHV A;  1UCV A;  2DKX A;  1LKY A;  2F3N A;  2D3D A;  2QAR B;  4NL9 C;  2GLE A;  1Z1V A;  5L1M A;  2ES6 A;  2KMD A;  3TAD C;  3SEN A;  3H8M A;  2E8P A;  1V85 A;  1PK3 A;  1SXD A;  3TAD A;  2EAO A;  4NJ8 A;  2KG5 A;  2K4P A;  3BS5 B;  2F44 A;  1PK1 A;  2QB0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...