2Y9UA

Structural basis of p63a sam domain mutants involved in aec syndrome
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
67
structure length
67
Chain Sequence
TDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUMOR PROTEIN 63
publication title Structural Basis of P63Alpha Sam Domain Mutants Involved in Aec Syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 26
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2y9uA00
2Y9TA 1UQVA 3BQ7A 2QB1A 1UCVA 2F8KA 3H8MA 2YTUA 2QARA 5JRTA 1B4FA 2ES6A 1F0MA 2KSOB 2DL0A 1SXDA 1SXEA 1X40A 2DKXA 3KKAA 2ESEA 2K60A 3BS5B 3TACB 1SV0A 2EANA 1PK3A 1V85A 3HILA 3KKAC 2FE9A 1PK1A 2D8CA 2K4PA 5J8YA 2QKQA 1KW4A 1SV0C 1LKYB 2E8OA 1OW5A 4NL9A 5JTIA 3K1RB 3BS7A 2QB0B 1SV4A 2D3DA 1WWVA 2QARB 4RQNA 1V38A 2B6GA 4IS7A 5J8YC 1OXJA 3SENA 2F44A 1DXSA 2EAMA 3SEIA 2KMDA 2KSOA 2KE7A 2L5YA 2Y9UA 4PZOA 1X9XA 4RQMA 1RG6A 1COKA 3BS5A 5F3XB 5JU5A 4MHVA 2E8MA 2LPEA 2E8PA 2LMRA 5L1MA 4PZNA 1LKYA 1SGGA 1X66A 3IDWA 2GLEA 1Z1VA 4NL9C 2QB0A 2JV3A 3TADA 2KIVA 1WWUA 1B0XA 4NJ8A 1PK1B 1JI7A 2DKZA 3TADC 5KNIA 2EAOA 2EAPA 2E8NA 2KG5A 2F3NA
chains in the Genus database with same CATH superfamily
2VJ5A 3OTQA 4EYIB 1QSSA 3PV8A 2IOHA 3EPGA 1QQ5A 1YT3A 5AM1A 4QZHA 2I5HA 4F2RA 2KKVA 4UB4A 3C28A 1SXEA 3TKAA 4CCHA 2K8BB 4O3MA 1HEKA 2K60A 4FO6A 5KT4A 5DB6A 1S0MA 2HHQA 3BZKA 3JPRA 4Q8FA 3AMZA 5AM0A 4IRDA 2W3SA 2UVWA 1Z00A 1KTQA 5L1KA 4DO9A 4BXOB 2QLTA 4C8NA 1T94A 3AU2A 2ZIWB 4CF5A 3K1RB 1ZQUA 2W9BB 5AI6A 4PH5A 2EZYA 5DGBA 4CF3A 2PI4A 1U45A 3PX4A 3SEIA 4ICAA 3BQTA 3O0FA 4CE6A 4FS1A 4QW8A 1RXWA 5F3XB 2BDUA 3G6YA 5H2FU 5GTIU 4ED8A 2E8PA 3LYSA 5AM4A 4BDPA 4KLUA 4JWMA 2CN1A 2MU2A 9ICXA 2MUTA 1QSYA 2KZZA 9ICPA 2E5SA 1L3UA 3MABA 1H38A 1A77A 1ZQYA 1WWUA 1S5LU 3QU4A 1D9FA 3T5KA 1VJ5A 2Y1IA 2J6UA 1D8BA 3WK6A 1COOA 4CF4A 2F8KA 5J0UA 2ZIXB 2ODGA 2ZTCA 4OJOA 2N1RA 2O6KA 1BVSA 4JWNA 9ICOA 4YVZA 2A19A 1BPEA 1NNLA 4RUCA 1L7PA 3GILA 1JXEA 1ZQXA 5KT6A 4J9QA 5EE3A 1RM6C 1FO4A 4TQSA 4AYBC 2DBYA 1UT8A 1NKEA 5AKEA 2VKQA 2WAQC 4IL6U 2XY7A 2WFAA 2D3DA 5EWFA 1HUZA 4Q45A 3TFRA 3ETRA 4EX7A 1Z3EB 3KHHA 1D9DA 1WCNA 4UB6U 4U7CA 1XC9A 5KG3A 1NK6A 2MA1A 3KZXA 9ICNA 3D2NA 5KL1B 3RF9A 2AH5A 2IMWP 2HHUA 2BPCA 2HVIA 2JEJA 2R8KA 2JR5A 5DG9A 4B9MA 4ED7A 5ALEA 3PMLA 2C28A 3U26A 4RQ2A 5KFGA 3M7DA 3WK8A 2DPJA 5KFDA 1FFUA 2KVCA 4C4TA 5ALUA 3IDWA 1KBUA 1AQ6A 1X2IA 4PHAA 2PMZC 7ICVA 3TAQA 2NRXA 3C23A 1ZXIA 2ZJ8A 4KX3A 4DQIA 2P66A 1X6IA 4ELVA 4YN4A 5DDMA 2ASDA 1KQQA 2RQ5A 2A1JB 3ZDEA 4KLDA 2YX8A 3ETLA 2KG5A 3FDSA 4Z6DA 3GDXA 2ISPA 5BOLA 2FLLA 4C0ZA 5HR7A 2XO7A 5KFIA 1ZQFA 4NLZA 2W8KA 4X5VA 3B9JA 4ECZA 2EH9A 5K4LA 5DQIA 5B66U 3A0BU 2XIDA 3DV9A 1ZQAA 4NLCA 4ECVA 2EANA 4OJLA 3SD7A 4O5EA 3HILA 4UB3A 5IIMA 5AK5A 4I2CA 9ICGA 1RDFA 3RJFA 4FFDA 4O3SA 2ALZA 3C2MA 3M1YA 5KFVA 1HIWA 1SV4A 5KFFA 3NVVA 4BUGA 3JPPA 2JEFA 4FZMA 2ZIVB 2LYHA 2NYVA 2F8LA 5J2IA 4KLJA 1NK0A 4UB1A 1ZOLA 4HAIA 3AUOA 7ICIA 3CYMA 9ICKA 3OHBA 5GTHU 7ICQA 3KOOA 1JX4A 1UT5A 4C4RA 4UQGA 3GZFA 4BXOA 4MFCA 8ICNA 4J9RA 1J2NA 3M8SA 2ZIWA 2AJQA 5KFOA 1Z1VA 3MC1A 2W9BA 1X9WA 5DDYA 4F4ZA 4GLXA 4YMOA 1ZQRA 1X9MA 3H8WA 2LBOA 3H0MB 5CA7A 2BPGA 1T3NA 3RRGA 3QU7A 5AIBA 2JMGA 7ICRA 5J2GA 3TQ1A 1ZQMA 5ALJA 2HI0A 2WAQF 2I6XA 2AQ4A 5KG1A 4J03A 3VCBA 5J0WA 4LZDA 5J2JA 4J9KA 4F2SA 2BHNA 2QB1A 3H0LB 1PVPA 4XQ8A 1YZ7A 2ES6A 2FLNA 2DL0A 3H4DA 4UAWA 2EZXA 1DK3A 2KHVA 8ICTA 2HW3A 1PUZA 4B9LA 5TZVA 1Q3VA 2NV3A 1XWLA 1PK3A 4DS4A 2AGOA 3CRXA 4IQTA 5G5HA 1B43A 5T14A 4LVSA 1ZQOA 4NLGA 1NJXA 3KTQA 1LB2B 3JPTA 5HR6A 2ZIXA 1ZQJA 4QWEA 3SENA 2BR0A 1BNPA 2KMDA 5KFQA 1ZQSA 4EEKA 4C8LA 1RQLA 1NOMA 4PZOA 3AU6A 1U48A 3WK7A 4DSFA 3F53A 3RB0A 4ZH4A 5KFEA 4R63A 2H3QA 4IQVA 3AQFA 1NJWA 1TVAA 3TFSA 9ICHA 2HHXA 2JEGA 4YD1A 2FPKA 1L5UA 4BX9C 1Z19A 5KFZA 1TKDA 3PW7A 2DQNB 3MR2A 4YQWA 2DUYA 2HBLA 1DGSA 4ECYA 3WK5A 3ORYA 3FM9A 3VC8A 4PL1A 5KT7A 1Q8KA 2Q0ZX 5BPCA 4NLNA 2NRZA 1Z1BA 2V9WA 4PJ0U 5BOMA 1FIQA 1PVQA 4I2EA 4OJ6A 3KKAA 3NTUA 2ESEA 3AM9A 1ZQEA 3D2SA 4RT2A 5AKZA 3QZ7A 4F5NA 2GOLA 3ZDCA 5AKYA 5FP0A 5AM2A 5ALLA 3KHLA 5ALDA 5J29A 5CHGA 2A1JA 4CNQA 1CEZA 4Y2TA 5DB9A 1PVRA 5AK6A 4QJFB 5KT3A 3IM1A 3N7SC 4RQ5A 4KMUA 2WF9A 4QZAA 1ZQLA 1N62A 3KHRA 1RQNA 4RNMA 1KDHA 3KZIU 2UVUA 1DXSA 1C7YA 1BNOA 5J0QA 1ZETA 9ICAA 1C20A 4RQ0A 4KLLA 4I2FA 4RQMA 5KFUA 4KLOA 3IHQB 1MN8A 3UMCA 2W9CB 4Z6CA 2JZBB 4F4WA 2E8MA 2RRDA 3OPXA 1XNSA 3UMGA 5KAIU 3PSTA 4QWCA 3EW9A 3KBBA 3PX0A 4EBDA 2G5HB 3SYZA 1XSPA 2H3VA 4C80A 3HW8A 5KFCA 2KIVA 5J2BA 4DL5A 1DRGA 4I2DA 3GV5B 2ZIVA 3H7IA 5AICA 1MQ3A 3GFKB 4DFKA 2ZTDA 4DSIA 1GO3F 5KNIA 2F1HA 2OH2A 4O3OA 3RJEA 3IRUA 8ICFA 4UBCA 1S0NA 3QX7A 3LDAA 3NVZA 4QZEA 5DBBA 2Y9TA 3BQ7A 1ZQ1C 2XGQA 2ZJ5A 1ED1A 1KEJA 5KTQA 2KD1A 3A0HU 3SQIA 2W03A 1F44A 3QEAZ 7ICEA 4Y2UA 2BQ3A 4KLHA 3L5KA 2KNJA 4F5OA 3RAXA 8ICRA 1MQ2A 3F5AA 5J0TA 3DDHA 1KN5A 3ICXA 1ZD3A 3C2KA 1MSWD 4OD0A 3HPOA 3GQCA 3RTVA 4B6JA 5EWEA 4KLQA 2BCVA 5J8YA 3D2QA 2HHSA 1OW5A 7ICFA 2BCQA 2KKPA 3BS7A 3QUTA 4BJQA 4QZIA 1L8LA 3PW0A 3PR5B 2HSZA 2XVTA 1U4BA 4I2BA 4IR9A 5J0XA 4PPXA 1U47A 1HJPA 8ICGA 2WF7A 3ALRA 3PSFA 2BQRA 2F77X 1N2XA 5TISU 8ICHA 4QZDA 2XICA 4ZOHC 4J9PA 1JIHA 1L3TA 5EE0A 3F2BA 1S8OA 4NLBA 3RJGA 4M9HA 4G3IA 7ICLA 4RPYA 1ZQZA 2LMRA 4F5PA 2AHOB 2B0CA 2E3TA 2GLEA 4NL9C 3AL0B 4TQRA 3WK9A 4Q44A 4DSEA 3AN1A 1NI3A 4J9LA 3Q8RB 3RFAA 1QTMA 2KV2A 4UB8U 1VDVA 2KJ8A 2I1QA 2DKZA 3GV7B 4YG2A 5ALSA 4JV0A 3BQ1A 5EE1A 4CRXA 5CRXA 1QCKA 3WKDA 7ICMA 4DL2A 1QSLA 4EZ6A 4Y2VA 1JUDA 2KSOB 4XA5A 4RPZA 2FMSA 4C8KA 2KIWA 2IOFK 2ZUBA 3BS5B 3TACB 4UASA 4AP9A 4J9MA 4O3PA 4RNNA 1OUQA 2YY6A 4OJ5A 1A6SA 3QE9Y 2PFOA 1V97A 1TE2A 3ISCA 2KJ9A 3HX0A 3MGVA 1WG8A 5KFLA 2KTQA 5AI4A 8ICJA 1ECWA 2MSNA 3M6KA 4B9NA 2QB0B 4RNOA 3ZD8A 1K5OA 2JGAA 4IS7A 4O3NA 4DQPA 2YMQA 1UA0A 2EAMA 7ICGA 1X9SA 1SL1A 1MA7A 2BCSA 2NRWA 1COKA 5ALNA 5AKGA 4EYHB 5D49A 3NS1A 1D8LA 4P2HA 3FC4A 7ICHA 3GIJA 5CWRA 2LYAA 1SL0A 2HHVA 5DG8A 4ECXA 3FAHA 5CR0A 2JRZA 2JXJA 2HHTA 5J0RA 4DOCA 1UPHA 9ICVA 8ICSA 3K1ZA 2KHQA 4DQRA 1NK4A 1N48A 5AKLA 1ZD5A 2YMPA 4DFMA 3PSIA 4RZRA 2K4EA 3EUB2 2F3NA 2ZIUA 4DSJA 4RQ8A 2W9CA 3QXGA 3B0XA 4TURA 2JZBA 2P6RA 9ICMA 2KEYA 3MR3A 2WF6A 2QARA 2Y1JA 2V4QA 7ICUA 4QW9A 1TFRA 4HYKA 5J2CA 3Q8QB 1K1SA 3FYHA 5F9LA 3F2CA 3QU9A 1ZQQA 3H8JA 5KFRA 2MRLA 3RB6A 1VLBA 2G06A 5CEHA 3MDAA 3QEBZ 1UA1A 4DOBA 5KG4A 4ED1A 2FE9A 3QUQA 4DSKA 2D8CA 2QKQA 1KL9A 2B21A 2ZJAA 4EELA 3NASA 4QZGA 3UM9A 2R18A 5HMLA 1FFVA 2P35A 2BZFA 2B6GA 2ZXHA 4OCZA 3IV6A 4RQ7A 3PX6A 3OSPA 8ICPA 2L5YA 1HUOA 1CI4A 2W7PA 1ZJMA 3IG5A 3I28A 4KMOB 1SZHA 2HBKA 3BQ0A 2BCUA 5ALGA 9ICJA 4EENA 3SAFA 7ICOA 4PGYA 3EWAA 5E79U 2BQUA 4PZNA 4IRCA 5HHHA 4I2HA 1JMSA 2DF4B 4O0IA 2KFZA 2F1IA 2DWQA 1SWVA 3TADA 1D8YA 1QLNA 5J0SA 5AI5A 4MEYA 4I2JA 4F71A 1L6NA 1X6JA 4DEZA 3BJYA 3KFUF 1JI7A 3WKEA 2EAOA 3V6HA 4M9GA 2OYYA 3WU2U 2KZ3A 2Y0SC 3RAQA 5C0YA 2RLTA 1ZQIA 2ISOA 3JPOA 2XCAA 3H8MA 4BWJA 3WKCA 1ZJNA 2W11A 2BGWA 5IIIA 4YMMA 2XCPA 3SR6A 4KN7A 4F50A 5ALFA 3OJUA 4RQ1A 4P4PA 1S10A 1F5SA 2K4HA 1JROA 4YCXA 9ICCA 1UHUA 1S97A 4NY8A 3MR5A 2VA2A 2VIXA 3PMNA 3V6KA 5KFMA 3AEVA 4Q43A 1NK8A 3V6JA 5IINA 3TARA 2PKEA 3QZ8A 3H40A 2IBKA 5KFWA 4ED2A 2ZTEA 3NRZA 4MF8A 3MR6A 2KSOA 3RR7A 1XSLA 9ICSA 3LK9A 3EYZA 3WKAA 3ISDA 2V4RA 1MC8A 3EPIA 4TUSA 4O9MA 1RG6A 5AKHA 3RJHA 3BS5A 2VJ4A 3HT3A 3M6ZA 5C5JA 5ALZA 1CRXA 4ACOA 1RPLA 3PVXA 4ECSA 3OJSA 2HDOA 2LM4A 2OCEA 1ZQTA 5G5GA 5L1IA 1SGGA 1X66A 4DCCA 2AXTU 4EZ9A 2QB0A 5ALQA 4PHPA 4DFJA 4OJPA 4YMNA 5HHIA 3B0YA 4DLEA 1V9PA 5D4BA 2HOIA 8ICLA 2XI9A 2C2EA 4M9LA 5AI0A 9ICUA 5L1LA 2WHEA 1PK1B 3UXNA 3PR4A 4NM1A 2HVHA 3HWTA 2EAPA 2E8NA 1L7NA 5CJ7A 3ZI4A 3SV3A 2W43A 3PW4A 1O08A 4F8RA 4R8UB 4GC6A 3SAGA 4KLGA 4Y2XA 2IHNA 3PNCA 4F5RA 4NWIA 5KAFU 9ICFA 5KFYA 4US8A 5DBAA 3RH5A 3WK4A 3N28A 3ZDAA 1SV0A 2DPIA 1KFSA 4DWIA 1QQ6A 1V85A 3EZ5A 3KKAC 5DQGA 4KLIA 3CP8A 4IR1A 3N7RC 2E8OA 1S0VA 4M04A 2A1AA 4UAZA 4Y2SA 1QQ7A 3Q8PB 1T3QA 1V38A 4QZ8A 4JUZA 4MFFA 3ED5A 1OXJA 3T5HA 2WTFA 1TAMA 2KN7A 2KE7A 3IG8A 4CDGA 4DFPA 5J2DA 3BQ2A 3BDPA 2Y0SF 4DF8A 1ZRNA 3J81j 5KFNA 3JPSA 9ICBA 3NVYA 2AU0A 2KFNA 2LPEA 9ICLA 2R8JA 4GC7A 5IILA 1ZYQA 3LVWA 5IIOA 4DL6A 2G0AA 2LM1A 2ZG6A 5KFPA 4YXJA 3OHAA 3WKBA 1WCLA 2EQYA 3CNHA 3UXOA 2XY6A 3RB3A 1BGXT 2CPRA 2HBMA 2D6FC 2UVRA 4I2AA 3UXPA 4ED0A 1NJZA 4NV0A 2NRVA 4OO1J 2Q4TA 4RU9A 4Z6EA 3K4GA 1SIJA 1T7PA 4NLKA 2KICA 1S9FA 4UW9A 4R66A 5J0YA 1XO0A 2J6TA 4LZGA 4Y2JA 5AK4A 1IXRA 2R8IA 2MAXA 2YMLA 5AK3A 3QUCA 2H3ZA 5ALWA 2P6UA 3CW2C 5KFBA 5AKJA 4F92B 2OHFA 2C2DA 5ALPA 3E2EA 4ED6A 2PFPA 2F1JA 1KW4A 5JUMA 1LKYB 2CRXA 4YR3A 1ZRMA 8ICCA 2AGQA 4USAA 1XSNA 5KT2A 2FLPA 3BZCA 5J8YC 4KLFA 4C8OA 4A8EA 1ZQNA 4DSLA 4YFKA 4YR0A 5J0OA 4B9UA 9ICQA 2KVSA 4TUPA 4IQWA 4RPXA 3PO5A 1EXNA 2LYBA 1TK8A 4QWAA 5JU5A 1J97A 2BKEA 4ECWA 4MHVA 2FPMA 5ALIA 4B9TA 4M9NA 2PFNA 1BPXA 3NVWA 4KLTA 3LWLA 2F76X 3SV4A 4UAYA 1IV8A 1L7OA 4O3QA 4PHDA 1LV5A 2G07A 3T5JA 4F91B 4DF4A 2G08A 3C29A 4NJ8A 3GIMA 3NRWA 8ICXA 5KG5A 2DGZA 3ISBA 3QYPA 1A0PA 1WUDA 2G5IB 1DK2A 1SWWA 4DL4A 4ELTA 4KX5A 2XGPA 5J0PA 3I1YA 1K1QA 2BCRA 3V7LA 2C2RA 4US9A 2FJ6A 5EE9A 3Q8MA 1QH9A 4PHEA 4P0QB 7ICPA 1BPDA 1NKBA 2E1EA 2K89A 1KLNA 3HKZC 3T5LA 3THVA 2K8CB 2YB4A 3GIKA 1U9LA 2ASJA 4JMUA 2YMMA 2G09A 5DLGA 4F4XA 1RXVA 4O5CA 2KOBA 1L8OA 3QU5A 5D46A 1PK1A 3TAPA 2IOFA 5ALHA 4JV1A 4DLGA 2RDJA 1N56A 3RH4A 3JPNA 1NK5A 4BWMA 2R8GA 4NL9A 4QZCA 1WWVA 5L1JA 2GWSA 3RH6A 4ELUA 3N7PD 3ONNA 1ZQKA 4RQ4A 4R8UA 2HBJA 3PY8A 4B9SA 1WYGA 5KG7A 4JK1A 3QUBA 5HMMA 3G6VA 2J6SA 4IRKA 4I2IA 3RRHA 3ZDDA 2UVVA 5IIKA 2GH1A 5AM3A 4UB5A 1S77D 1Z4OA 5AI8A 8ICIA 1KFTA 3TI0A 2OEHA 4DQQA 2YN4A 4FBTA 1J2MA 2JHDA 2HHWA 5ALRA 2CXYA 3OSNA 2OXOA 3DEEA 1JRPA 1T4GA 7ICKA 4ED3A 2EZZA 4GXJA 8ICUA 1B22A 3HRDD 4DL3A 1ZD2P 4M6WB 2I9GA 4Q8EA 2W8LA 2R8HA 2OM6A 2KK0A 4O5KA 1A76A 4WJ3B 2HCFA 3D6JA 3G6XA 3M9MB 4TUQA 3V7JA 2E1FA 4EBEA 4Y2YA 3QU2A 4ECTA 3K75D 4JB3A 8ICAA 8ICVA 4PGXA 4M9JA 1B4FA 1SKRA 4RQ6A 1SXDA 4KN4A 1N5XA 4BGDA 4Z6FA 1T8EA 1ZQGA 5DGAA 5CB1A 1S76D 5AI9A 4B9VA 3MGIA 3H0RB 4DFDA 4YR2A 8ICKA 2GO7A 5EOZA 2FMQA 4QNLA 4F5QA 3C5GA 4GIBA 3E58A 3E0FA 2KP7A 1ZQPA 9ICTA 8ICZA 2HOQA 5AM5A 1N61A 4M47A 5B5EU 5JTIA 1IG6A 3HP6A 2LI6A 4MFAA 1ZQHA 3RJJA 1AROP 2VA8A 4I2GA 3Q8SB 3UPQA 2F44A 4FZNA 4R65A 2FPLA 2PXIA 1FEZA 8ICOA 5J2HA 2OWOA 1N63A 2KJ5A 5J2KA 2H3FA 8ICYA 1Y88A 2ZXIA 1XS9D 5DG7A 3LWMA 2YB1A 3RBEA 4ECRA 4F72A 5KFSA 3NUQA 3HKZF 1LKYA 4QWDA 5L9XA 1RYUA 1N5WA 8ICBA 2AGPA 4FBUA 4Y2RA 4I28A 8ICEA 3MBYA 1BPZA 4GXKA 4QIWC 4UATA 3Q8KA 4C7ZA 3GV8B 1RZTA 2PFQA 3TADC 2IHMA 2H3IA 3LVVA 2NO4A 5ALVA 5DQHA 5KFAA 4UARA 3KHGA 2JH1A 5KG0A 5ALYA 1UCVA 1SB3C 3KD3A 3C21A 1CUKA 2H5XA 5KT5A 1F0MA 5ALTA 4UBBA 4IQUA 2VANA 4YXMA 7ICSA 2K8AA 5ALXA 4F93B 3SZ2A 5J2AA 5ALMA 1SKWA 4QZ9A 3Q8LA 2IA6A 4DS5A 3T3FA 4K4HA 3L3FX 1X42A 4XRHA 3RJIA 2M9NA 3UQ0A 4Y2QA 1NJYA 5CP2A 4MF2A 4P0PB 3GIIA 1DGJA 4MEXA 1TK0A 3N4MB 3T79A 3IP4B 2KZMA 4J9SA 5IIJA 3H4BA 2ATLA 2JH7A 4I29A 2XC9A 4P0QA 3PO4A 5ALOA 2FMPA 3IN5A 1X9XA 4P4OA 2XY5A 4C4SA 3C1ZA 3M9NB 4AYBF 5KFXA 2RHFA 1RYSA 9ICWA 4O3RA 3S6JA 3MFHA 1BPBA 2WB1C 2VA3A 3UMBA 2C22A 1NZPA 2JEIA 4RUAA 4I27A 1JN3A 8ICWA 3L4PA 2BDPA 1S0OA 4M0AA 2RP5A 4QZBA 4YD2A 1B0XA 1Z00B 4UAUA 2W3RA 3RBDA 5KFJA 4K4IA 4RQ3A 4QZFA 1ZQWA 4PL2A 4C7YA 1UQVA 1ZD4A 5J2EA 1XU4A 4NXZA 1SL2A 1ZQDA 5KG6A 2YTUA 4FE3A 2EDUA 3R9KA 4ECUA 5DBCA 3F5EA 2PMZF 1Q46A 5HP4A 1JXLA 5KL8B 5ALKA 1X40A 2Z7JA 2DKXA 3JPQA 4UAVA 2DFLA 4JV2A 5DLFA 4ECQA 2YQEA 1O03A 1NK9A 8ICMA 3MFIA 4M6WA 1TAQA 3H8SA 3MGHA 2W7OA 4M2YA 1IM4A 3C1YA 4KTQA 1TAUA 3M9OB 2NO5A 4F4YA 4J9OA 1SV0C 2MUTB 2ZUCA 5KFHA 4RQNA 1BPYA 2K4IA 4QIWF 3M8RA 2LKYA 5J2FA 4K4GA 3V72A 3OGUA 5AKIA 4Y2PA 1ZQCA 4QWBA 1DOQA 5KG2A 4GFJA 2W9MA 3HJEA 5AHXA 1Z4NA 4XUSA 3F2DA 3SMVA 5EWGA 5DKWA 1XO1A 5L1MA 9ICIA 1TV9A 2W9AA 3GU3A 4FZLA 2FI1A 2JV3A 4R64A 3NGDA 3PZPA 1M6YA 3TANA 4KLSA 3RJKA 3N97B 4KLMA 1ZQBA 4U6PA 5KFKA 1YZ6A 1TK5A 2F2AB 1JALA 3ZD9A 1NZBA 1Q3UA 3RB4A 1KKXA 8ICQA 4IC9A 1P7DA 5JRTA 3SI8A 2WF8A 2ZUDA 4C8MA 2FDRA 5KFTA 1NK7A 3V7KA 4J9NA 1PZNA 2AQ0A 4UB2A 4FS2A 1KRPA 5F9NA 2HMXA 3QNMA 2WB1F 9ICEA 4PGQA 3C2LA 2W55A 4F3OA 4KLEA 1LVHA 1N60A 1SZPA 4NM2A 2ZIUB 4RT3A 4EBCA 2HOFA 2K4PA 4YP3A 1SKSA 5AIAA 4EX6A 9ICRA 2QARB 7ICTA 3C5FA 2RDIA 3I76A 1ZQVA 3PSPA 4E0DA 2M0NA 3PW2A 5A0LA 2W04A 2Y9UA 7ICJA 2WF5A 5DB8A 1NKCA 3RR8A 1KFDA 2LHTA 2NRTA 3PW5A 5AKXA 2BPFA 1L3SA 1KSPA 5DB7A 5AKKA 1IIPA 4G9BA 3ZDBA 4DOAA 1URJA 4EEYA 2PI5A 4DL7A 2ASLA 1U49A 4GXIA 2W54A 1L7MA 4KITB 4P0PA 3AQEA 3MDCA 4DQSA 2A3VA 5HNKA 4CGZA 3UQ2A 3SAHA 4P4MA 7ICNA 4F4KA 1L3VA 1RYRA 4LJXA
chains in the Genus database with same CATH topology
2Y9TA 1UQVA 3BQ7A 2QB1A 1UCVA 2F8KA 3H8MA 2YTUA 2QARA 5JRTA 1B4FA 2ES6A 1F0MA 2KSOB 2DL0A 1SXDA 1SXEA 1X40A 2DKXA 3KKAA 2ESEA 2K60A 3BS5B 3TACB 1SV0A 2EANA 1PK3A 1V85A 3HILA 3KKAC 2FE9A 1PK1A 2D8CA 2K4PA 5J8YA 2QKQA 1KW4A 1SV0C 1LKYB 2E8OA 1OW5A 4NL9A 5JTIA 3K1RB 3BS7A 2QB0B 1SV4A 2D3DA 1WWVA 2QARB 4RQNA 1V38A 2B6GA 4IS7A 5J8YC 1OXJA 3SENA 2F44A 1DXSA 2EAMA 3SEIA 2KMDA 2KSOA 2KE7A 2L5YA 2Y9UA 4PZOA 1X9XA 4RQMA 1RG6A 1COKA 3BS5A 5F3XB 5JU5A 4MHVA 2E8MA 2LPEA 2E8PA 2LMRA 5L1MA 4PZNA 1LKYA 1SGGA 1X66A 3IDWA 2GLEA 1Z1VA 4NL9C 2QB0A 2JV3A 3TADA 2KIVA 1WWUA 1B0XA 4NJ8A 1PK1B 1JI7A 2DKZA 3TADC 5KNIA 2EAOA 2EAPA 2E8NA 2KG5A 2F3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y9T A;  1UQV A;  3BQ7 A;  2QB1 A;  1UCV A;  2F8K A;  3H8M A;  2YTU A;  2QAR A;  5JRT A;  1B4F A;  2ES6 A;  1F0M A;  2KSO B;  2DL0 A;  1SXD A;  1SXE A;  1X40 A;  2DKX A;  3KKA A;  2ESE A;  2K60 A;  3BS5 B;  3TAC B;  1SV0 A;  2EAN A;  1PK3 A;  1V85 A;  3HIL A;  3KKA C;  2FE9 A;  1PK1 A;  2D8C A;  2K4P A;  5J8Y A;  2QKQ A;  1KW4 A;  1SV0 C;  1LKY B;  2E8O A;  1OW5 A;  4NL9 A;  5JTI A;  3K1R B;  3BS7 A;  2QB0 B;  1SV4 A;  2D3D A;  1WWV A;  2QAR B;  4RQN A;  1V38 A;  2B6G A;  4IS7 A;  5J8Y C;  1OXJ A;  3SEN A;  2F44 A;  1DXS A;  2EAM A;  3SEI A;  2KMD A;  2KSO A;  2KE7 A;  2L5Y A;  2Y9U A;  4PZO A;  1X9X A;  4RQM A;  1RG6 A;  1COK A;  3BS5 A;  5F3X B;  5JU5 A;  4MHV A;  2E8M A;  2LPE A;  2E8P A;  2LMR A;  5L1M A;  4PZN A;  1LKY A;  1SGG A;  1X66 A;  3IDW A;  2GLE A;  1Z1V A;  4NL9 C;  2QB0 A;  2JV3 A;  3TAD A;  2KIV A;  1WWU A;  1B0X A;  4NJ8 A;  1PK1 B;  1JI7 A;  2DKZ A;  3TAD C;  5KNI A;  2EAO A;  2EAP A;  2E8N A;  2KG5 A;  2F3N A; 
#chains in the Genus database with same CATH topology
 2VJ5 A;  3OTQ A;  4EYI B;  1QSS A;  3PV8 A;  2IOH A;  3EPG A;  1QQ5 A;  1YT3 A;  5AM1 A;  4QZH A;  2I5H A;  4F2R A;  2KKV A;  4UB4 A;  3C28 A;  1SXE A;  3TKA A;  4CCH A;  2K8B B;  4O3M A;  1HEK A;  2K60 A;  4FO6 A;  5KT4 A;  5DB6 A;  1S0M A;  2HHQ A;  3BZK A;  3JPR A;  4Q8F A;  3AMZ A;  5AM0 A;  4IRD A;  2W3S A;  2UVW A;  1Z00 A;  1KTQ A;  5L1K A;  4DO9 A;  4BXO B;  2QLT A;  4C8N A;  1T94 A;  3AU2 A;  2ZIW B;  4CF5 A;  3K1R B;  1ZQU A;  2W9B B;  5AI6 A;  4PH5 A;  2EZY A;  5DGB A;  4CF3 A;  2PI4 A;  1U45 A;  3PX4 A;  3SEI A;  4ICA A;  3BQT A;  3O0F A;  4CE6 A;  4FS1 A;  4QW8 A;  1RXW A;  5F3X B;  2BDU A;  3G6Y A;  5H2F U;  5GTI U;  4ED8 A;  2E8P A;  3LYS A;  5AM4 A;  4BDP A;  4KLU A;  4JWM A;  2CN1 A;  2MU2 A;  9ICX A;  2MUT A;  1QSY A;  2KZZ A;  9ICP A;  2E5S A;  1L3U A;  3MAB A;  1H38 A;  1A77 A;  1ZQY A;  1WWU A;  1S5L U;  3QU4 A;  1D9F A;  3T5K A;  1VJ5 A;  2Y1I A;  2J6U A;  1D8B A;  3WK6 A;  1COO A;  4CF4 A;  2F8K A;  5J0U A;  2ZIX B;  2ODG A;  2ZTC A;  4OJO A;  2N1R A;  2O6K A;  1BVS A;  4JWN A;  9ICO A;  4YVZ A;  2A19 A;  1BPE A;  1NNL A;  4RUC A;  1L7P A;  3GIL A;  1JXE A;  1ZQX A;  5KT6 A;  4J9Q A;  5EE3 A;  1RM6 C;  1FO4 A;  4TQS A;  4AYB C;  2DBY A;  1UT8 A;  1NKE A;  5AKE A;  2VKQ A;  2WAQ C;  4IL6 U;  2XY7 A;  2WFA A;  2D3D A;  5EWF A;  1HUZ A;  4Q45 A;  3TFR A;  3ETR A;  4EX7 A;  1Z3E B;  3KHH A;  1D9D A;  1WCN A;  4UB6 U;  4U7C A;  1XC9 A;  5KG3 A;  1NK6 A;  2MA1 A;  3KZX A;  9ICN A;  3D2N A;  5KL1 B;  3RF9 A;  2AH5 A;  2IMW P;  2HHU A;  2BPC A;  2HVI A;  2JEJ A;  2R8K A;  2JR5 A;  5DG9 A;  4B9M A;  4ED7 A;  5ALE A;  3PML A;  2C28 A;  3U26 A;  4RQ2 A;  5KFG A;  3M7D A;  3WK8 A;  2DPJ A;  5KFD A;  1FFU A;  2KVC A;  4C4T A;  5ALU A;  3IDW A;  1KBU A;  1AQ6 A;  1X2I A;  4PHA A;  2PMZ C;  7ICV A;  3TAQ A;  2NRX A;  3C23 A;  1ZXI A;  2ZJ8 A;  4KX3 A;  4DQI A;  2P66 A;  1X6I A;  4ELV A;  4YN4 A;  5DDM A;  2ASD A;  1KQQ A;  2RQ5 A;  2A1J B;  3ZDE A;  4KLD A;  2YX8 A;  3ETL A;  2KG5 A;  3FDS A;  4Z6D A;  3GDX A;  2ISP A;  5BOL A;  2FLL A;  4C0Z A;  5HR7 A;  2XO7 A;  5KFI A;  1ZQF A;  4NLZ A;  2W8K A;  4X5V A;  3B9J A;  4ECZ A;  2EH9 A;  5K4L A;  5DQI A;  5B66 U;  3A0B U;  2XID A;  3DV9 A;  1ZQA A;  4NLC A;  4ECV A;  2EAN A;  4OJL A;  3SD7 A;  4O5E A;  3HIL A;  4UB3 A;  5IIM A;  5AK5 A;  4I2C A;  9ICG A;  1RDF A;  3RJF A;  4FFD A;  4O3S A;  2ALZ A;  3C2M A;  3M1Y A;  5KFV A;  1HIW A;  1SV4 A;  5KFF A;  3NVV A;  4BUG A;  3JPP A;  2JEF A;  4FZM A;  2ZIV B;  2LYH A;  2NYV A;  2F8L A;  5J2I A;  4KLJ A;  1NK0 A;  4UB1 A;  1ZOL A;  4HAI A;  3AUO A;  7ICI A;  3CYM A;  9ICK A;  3OHB A;  5GTH U;  7ICQ A;  3KOO A;  1JX4 A;  1UT5 A;  4C4R A;  4UQG A;  3GZF A;  4BXO A;  4MFC A;  8ICN A;  4J9R A;  1J2N A;  3M8S A;  2ZIW A;  2AJQ A;  5KFO A;  1Z1V A;  3MC1 A;  2W9B A;  1X9W A;  5DDY A;  4F4Z A;  4GLX A;  4YMO A;  1ZQR A;  1X9M A;  3H8W A;  2LBO A;  3H0M B;  5CA7 A;  2BPG A;  1T3N A;  3RRG A;  3QU7 A;  5AIB A;  2JMG A;  7ICR A;  5J2G A;  3TQ1 A;  1ZQM A;  5ALJ A;  2HI0 A;  2WAQ F;  2I6X A;  2AQ4 A;  5KG1 A;  4J03 A;  3VCB A;  5J0W A;  4LZD A;  5J2J A;  4J9K A;  4F2S A;  2BHN A;  2QB1 A;  3H0L B;  1PVP A;  4XQ8 A;  1YZ7 A;  2ES6 A;  2FLN A;  2DL0 A;  3H4D A;  4UAW A;  2EZX A;  1DK3 A;  2KHV A;  8ICT A;  2HW3 A;  1PUZ A;  4B9L A;  5TZV A;  1Q3V A;  2NV3 A;  1XWL A;  1PK3 A;  4DS4 A;  2AGO A;  3CRX A;  4IQT A;  5G5H A;  1B43 A;  5T14 A;  4LVS A;  1ZQO A;  4NLG A;  1NJX A;  3KTQ A;  1LB2 B;  3JPT A;  5HR6 A;  2ZIX A;  1ZQJ A;  4QWE A;  3SEN A;  2BR0 A;  1BNP A;  2KMD A;  5KFQ A;  1ZQS A;  4EEK A;  4C8L A;  1RQL A;  1NOM A;  4PZO A;  3AU6 A;  1U48 A;  3WK7 A;  4DSF A;  3F53 A;  3RB0 A;  4ZH4 A;  5KFE A;  4R63 A;  2H3Q A;  4IQV A;  3AQF A;  1NJW A;  1TVA A;  3TFS A;  9ICH A;  2HHX A;  2JEG A;  4YD1 A;  2FPK A;  1L5U A;  4BX9 C;  1Z19 A;  5KFZ A;  1TKD A;  3PW7 A;  2DQN B;  3MR2 A;  4YQW A;  2DUY A;  2HBL A;  1DGS A;  4ECY A;  3WK5 A;  3ORY A;  3FM9 A;  3VC8 A;  4PL1 A;  5KT7 A;  1Q8K A;  2Q0Z X;  5BPC A;  4NLN A;  2NRZ A;  1Z1B A;  2V9W A;  4PJ0 U;  5BOM A;  1FIQ A;  1PVQ A;  4I2E A;  4OJ6 A;  3KKA A;  3NTU A;  2ESE A;  3AM9 A;  1ZQE A;  3D2S A;  4RT2 A;  5AKZ A;  3QZ7 A;  4F5N A;  2GOL A;  3ZDC A;  5AKY A;  5FP0 A;  5AM2 A;  5ALL A;  3KHL A;  5ALD A;  5J29 A;  5CHG A;  2A1J A;  4CNQ A;  1CEZ A;  4Y2T A;  5DB9 A;  1PVR A;  5AK6 A;  4QJF B;  5KT3 A;  3IM1 A;  3N7S C;  4RQ5 A;  4KMU A;  2WF9 A;  4QZA A;  1ZQL A;  1N62 A;  3KHR A;  1RQN A;  4RNM A;  1KDH A;  3KZI U;  2UVU A;  1DXS A;  1C7Y A;  1BNO A;  5J0Q A;  1ZET A;  9ICA A;  1C20 A;  4RQ0 A;  4KLL A;  4I2F A;  4RQM A;  5KFU A;  4KLO A;  3IHQ B;  1MN8 A;  3UMC A;  2W9C B;  4Z6C A;  2JZB B;  4F4W A;  2E8M A;  2RRD A;  3OPX A;  1XNS A;  3UMG A;  5KAI U;  3PST A;  4QWC A;  3EW9 A;  3KBB A;  3PX0 A;  4EBD A;  2G5H B;  3SYZ A;  1XSP A;  2H3V A;  4C80 A;  3HW8 A;  5KFC A;  2KIV A;  5J2B A;  4DL5 A;  1DRG A;  4I2D A;  3GV5 B;  2ZIV A;  3H7I A;  5AIC A;  1MQ3 A;  3GFK B;  4DFK A;  2ZTD A;  4DSI A;  1GO3 F;  5KNI A;  2F1H A;  2OH2 A;  4O3O A;  3RJE A;  3IRU A;  8ICF A;  4UBC A;  1S0N A;  3QX7 A;  3LDA A;  3NVZ A;  4QZE A;  5DBB A;  2Y9T A;  3BQ7 A;  1ZQ1 C;  2XGQ A;  2ZJ5 A;  1ED1 A;  1KEJ A;  5KTQ A;  2KD1 A;  3A0H U;  3SQI A;  2W03 A;  1F44 A;  3QEA Z;  7ICE A;  4Y2U A;  2BQ3 A;  4KLH A;  3L5K A;  2KNJ A;  4F5O A;  3RAX A;  8ICR A;  1MQ2 A;  3F5A A;  5J0T A;  3DDH A;  1KN5 A;  3ICX A;  1ZD3 A;  3C2K A;  1MSW D;  4OD0 A;  3HPO A;  3GQC A;  3RTV A;  4B6J A;  5EWE A;  4KLQ A;  2BCV A;  5J8Y A;  3D2Q A;  2HHS A;  1OW5 A;  7ICF A;  2BCQ A;  2KKP A;  3BS7 A;  3QUT A;  4BJQ A;  4QZI A;  1L8L A;  3PW0 A;  3PR5 B;  2HSZ A;  2XVT A;  1U4B A;  4I2B A;  4IR9 A;  5J0X A;  4PPX A;  1U47 A;  1HJP A;  8ICG A;  2WF7 A;  3ALR A;  3PSF A;  2BQR A;  2F77 X;  1N2X A;  5TIS U;  8ICH A;  4QZD A;  2XIC A;  4ZOH C;  4J9P A;  1JIH A;  1L3T A;  5EE0 A;  3F2B A;  1S8O A;  4NLB A;  3RJG A;  4M9H A;  4G3I A;  7ICL A;  4RPY A;  1ZQZ A;  2LMR A;  4F5P A;  2AHO B;  2B0C A;  2E3T A;  2GLE A;  4NL9 C;  3AL0 B;  4TQR A;  3WK9 A;  4Q44 A;  4DSE A;  3AN1 A;  1NI3 A;  4J9L A;  3Q8R B;  3RFA A;  1QTM A;  2KV2 A;  4UB8 U;  1VDV A;  2KJ8 A;  2I1Q A;  2DKZ A;  3GV7 B;  4YG2 A;  5ALS A;  4JV0 A;  3BQ1 A;  5EE1 A;  4CRX A;  5CRX A;  1QCK A;  3WKD A;  7ICM A;  4DL2 A;  1QSL A;  4EZ6 A;  4Y2V A;  1JUD A;  2KSO B;  4XA5 A;  4RPZ A;  2FMS A;  4C8K A;  2KIW A;  2IOF K;  2ZUB A;  3BS5 B;  3TAC B;  4UAS A;  4AP9 A;  4J9M A;  4O3P A;  4RNN A;  1OUQ A;  2YY6 A;  4OJ5 A;  1A6S A;  3QE9 Y;  2PFO A;  1V97 A;  1TE2 A;  3ISC A;  2KJ9 A;  3HX0 A;  3MGV A;  1WG8 A;  5KFL A;  2KTQ A;  5AI4 A;  8ICJ A;  1ECW A;  2MSN A;  3M6K A;  4B9N A;  2QB0 B;  4RNO A;  3ZD8 A;  1K5O A;  2JGA A;  4IS7 A;  4O3N A;  4DQP A;  2YMQ A;  1UA0 A;  2EAM A;  7ICG A;  1X9S A;  1SL1 A;  1MA7 A;  2BCS A;  2NRW A;  1COK A;  5ALN A;  5AKG A;  4EYH B;  5D49 A;  3NS1 A;  1D8L A;  4P2H A;  3FC4 A;  7ICH A;  3GIJ A;  5CWR A;  2LYA A;  1SL0 A;  2HHV A;  5DG8 A;  4ECX A;  3FAH A;  5CR0 A;  2JRZ A;  2JXJ A;  2HHT A;  5J0R A;  4DOC A;  1UPH A;  9ICV A;  8ICS A;  3K1Z A;  2KHQ A;  4DQR A;  1NK4 A;  1N48 A;  5AKL A;  1ZD5 A;  2YMP A;  4DFM A;  3PSI A;  4RZR A;  2K4E A;  3EUB 2;  2F3N A;  2ZIU A;  4DSJ A;  4RQ8 A;  2W9C A;  3QXG A;  3B0X A;  4TUR A;  2JZB A;  2P6R A;  9ICM A;  2KEY A;  3MR3 A;  2WF6 A;  2QAR A;  2Y1J A;  2V4Q A;  7ICU A;  4QW9 A;  1TFR A;  4HYK A;  5J2C A;  3Q8Q B;  1K1S A;  3FYH A;  5F9L A;  3F2C A;  3QU9 A;  1ZQQ A;  3H8J A;  5KFR A;  2MRL A;  3RB6 A;  1VLB A;  2G06 A;  5CEH A;  3MDA A;  3QEB Z;  1UA1 A;  4DOB A;  5KG4 A;  4ED1 A;  2FE9 A;  3QUQ A;  4DSK A;  2D8C A;  2QKQ A;  1KL9 A;  2B21 A;  2ZJA A;  4EEL A;  3NAS A;  4QZG A;  3UM9 A;  2R18 A;  5HML A;  1FFV A;  2P35 A;  2BZF A;  2B6G A;  2ZXH A;  4OCZ A;  3IV6 A;  4RQ7 A;  3PX6 A;  3OSP A;  8ICP A;  2L5Y A;  1HUO A;  1CI4 A;  2W7P A;  1ZJM A;  3IG5 A;  3I28 A;  4KMO B;  1SZH A;  2HBK A;  3BQ0 A;  2BCU A;  5ALG A;  9ICJ A;  4EEN A;  3SAF A;  7ICO A;  4PGY A;  3EWA A;  5E79 U;  2BQU A;  4PZN A;  4IRC A;  5HHH A;  4I2H A;  1JMS A;  2DF4 B;  4O0I A;  2KFZ A;  2F1I A;  2DWQ A;  1SWV A;  3TAD A;  1D8Y A;  1QLN A;  5J0S A;  5AI5 A;  4MEY A;  4I2J A;  4F71 A;  1L6N A;  1X6J A;  4DEZ A;  3BJY A;  3KFU F;  1JI7 A;  3WKE A;  2EAO A;  3V6H A;  4M9G A;  2OYY A;  3WU2 U;  2KZ3 A;  2Y0S C;  3RAQ A;  5C0Y A;  2RLT A;  1ZQI A;  2ISO A;  3JPO A;  2XCA A;  3H8M A;  4BWJ A;  3WKC A;  1ZJN A;  2W11 A;  2BGW A;  5III A;  4YMM A;  2XCP A;  3SR6 A;  4KN7 A;  4F50 A;  5ALF A;  3OJU A;  4RQ1 A;  4P4P A;  1S10 A;  1F5S A;  2K4H A;  1JRO A;  4YCX A;  9ICC A;  1UHU A;  1S97 A;  4NY8 A;  3MR5 A;  2VA2 A;  2VIX A;  3PMN A;  3V6K A;  5KFM A;  3AEV A;  4Q43 A;  1NK8 A;  3V6J A;  5IIN A;  3TAR A;  2PKE A;  3QZ8 A;  3H40 A;  2IBK A;  5KFW A;  4ED2 A;  2ZTE A;  3NRZ A;  4MF8 A;  3MR6 A;  2KSO A;  3RR7 A;  1XSL A;  9ICS A;  3LK9 A;  3EYZ A;  3WKA A;  3ISD A;  2V4R A;  1MC8 A;  3EPI A;  4TUS A;  4O9M A;  1RG6 A;  5AKH A;  3RJH A;  3BS5 A;  2VJ4 A;  3HT3 A;  3M6Z A;  5C5J A;  5ALZ A;  1CRX A;  4ACO A;  1RPL A;  3PVX A;  4ECS A;  3OJS A;  2HDO A;  2LM4 A;  2OCE A;  1ZQT A;  5G5G A;  5L1I A;  1SGG A;  1X66 A;  4DCC A;  2AXT U;  4EZ9 A;  2QB0 A;  5ALQ A;  4PHP A;  4DFJ A;  4OJP A;  4YMN A;  5HHI A;  3B0Y A;  4DLE A;  1V9P A;  5D4B A;  2HOI A;  8ICL A;  2XI9 A;  2C2E A;  4M9L A;  5AI0 A;  9ICU A;  5L1L A;  2WHE A;  1PK1 B;  3UXN A;  3PR4 A;  4NM1 A;  2HVH A;  3HWT A;  2EAP A;  2E8N A;  1L7N A;  5CJ7 A;  3ZI4 A;  3SV3 A;  2W43 A;  3PW4 A;  1O08 A;  4F8R A;  4R8U B;  4GC6 A;  3SAG A;  4KLG A;  4Y2X A;  2IHN A;  3PNC A;  4F5R A;  4NWI A;  5KAF U;  9ICF A;  5KFY A;  4US8 A;  5DBA A;  3RH5 A;  3WK4 A;  3N28 A;  3ZDA A;  1SV0 A;  2DPI A;  1KFS A;  4DWI A;  1QQ6 A;  1V85 A;  3EZ5 A;  3KKA C;  5DQG A;  4KLI A;  3CP8 A;  4IR1 A;  3N7R C;  2E8O A;  1S0V A;  4M04 A;  2A1A A;  4UAZ A;  4Y2S A;  1QQ7 A;  3Q8P B;  1T3Q A;  1V38 A;  4QZ8 A;  4JUZ A;  4MFF A;  3ED5 A;  1OXJ A;  3T5H A;  2WTF A;  1TAM A;  2KN7 A;  2KE7 A;  3IG8 A;  4CDG A;  4DFP A;  5J2D A;  3BQ2 A;  3BDP A;  2Y0S F;  4DF8 A;  1ZRN A;  3J81 j;  5KFN A;  3JPS A;  9ICB A;  3NVY A;  2AU0 A;  2KFN A;  2LPE A;  9ICL A;  2R8J A;  4GC7 A;  5IIL A;  1ZYQ A;  3LVW A;  5IIO A;  4DL6 A;  2G0A A;  2LM1 A;  2ZG6 A;  5KFP A;  4YXJ A;  3OHA A;  3WKB A;  1WCL A;  2EQY A;  3CNH A;  3UXO A;  2XY6 A;  3RB3 A;  1BGX T;  2CPR A;  2HBM A;  2D6F C;  2UVR A;  4I2A A;  3UXP A;  4ED0 A;  1NJZ A;  4NV0 A;  2NRV A;  4OO1 J;  2Q4T A;  4RU9 A;  4Z6E A;  3K4G A;  1SIJ A;  1T7P A;  4NLK A;  2KIC A;  1S9F A;  4UW9 A;  4R66 A;  5J0Y A;  1XO0 A;  2J6T A;  4LZG A;  4Y2J A;  5AK4 A;  1IXR A;  2R8I A;  2MAX A;  2YML A;  5AK3 A;  3QUC A;  2H3Z A;  5ALW A;  2P6U A;  3CW2 C;  5KFB A;  5AKJ A;  4F92 B;  2OHF A;  2C2D A;  5ALP A;  3E2E A;  4ED6 A;  2PFP A;  2F1J A;  1KW4 A;  5JUM A;  1LKY B;  2CRX A;  4YR3 A;  1ZRM A;  8ICC A;  2AGQ A;  4USA A;  1XSN A;  5KT2 A;  2FLP A;  3BZC A;  5J8Y C;  4KLF A;  4C8O A;  4A8E A;  1ZQN A;  4DSL A;  4YFK A;  4YR0 A;  5J0O A;  4B9U A;  9ICQ A;  2KVS A;  4TUP A;  4IQW A;  4RPX A;  3PO5 A;  1EXN A;  2LYB A;  1TK8 A;  4QWA A;  5JU5 A;  1J97 A;  2BKE A;  4ECW A;  4MHV A;  2FPM A;  5ALI A;  4B9T A;  4M9N A;  2PFN A;  1BPX A;  3NVW A;  4KLT A;  3LWL A;  2F76 X;  3SV4 A;  4UAY A;  1IV8 A;  1L7O A;  4O3Q A;  4PHD A;  1LV5 A;  2G07 A;  3T5J A;  4F91 B;  4DF4 A;  2G08 A;  3C29 A;  4NJ8 A;  3GIM A;  3NRW A;  8ICX A;  5KG5 A;  2DGZ A;  3ISB A;  3QYP A;  1A0P A;  1WUD A;  2G5I B;  1DK2 A;  1SWW A;  4DL4 A;  4ELT A;  4KX5 A;  2XGP A;  5J0P A;  3I1Y A;  1K1Q A;  2BCR A;  3V7L A;  2C2R A;  4US9 A;  2FJ6 A;  5EE9 A;  3Q8M A;  1QH9 A;  4PHE A;  4P0Q B;  7ICP A;  1BPD A;  1NKB A;  2E1E A;  2K89 A;  1KLN A;  3HKZ C;  3T5L A;  3THV A;  2K8C B;  2YB4 A;  3GIK A;  1U9L A;  2ASJ A;  4JMU A;  2YMM A;  2G09 A;  5DLG A;  4F4X A;  1RXV A;  4O5C A;  2KOB A;  1L8O A;  3QU5 A;  5D46 A;  1PK1 A;  3TAP A;  2IOF A;  5ALH A;  4JV1 A;  4DLG A;  2RDJ A;  1N56 A;  3RH4 A;  3JPN A;  1NK5 A;  4BWM A;  2R8G A;  4NL9 A;  4QZC A;  1WWV A;  5L1J A;  2GWS A;  3RH6 A;  4ELU A;  3N7P D;  3ONN A;  1ZQK A;  4RQ4 A;  4R8U A;  2HBJ A;  3PY8 A;  4B9S A;  1WYG A;  5KG7 A;  4JK1 A;  3QUB A;  5HMM A;  3G6V A;  2J6S A;  4IRK A;  4I2I A;  3RRH A;  3ZDD A;  2UVV A;  5IIK A;  2GH1 A;  5AM3 A;  4UB5 A;  1S77 D;  1Z4O A;  5AI8 A;  8ICI A;  1KFT A;  3TI0 A;  2OEH A;  4DQQ A;  2YN4 A;  4FBT A;  1J2M A;  2JHD A;  2HHW A;  5ALR A;  2CXY A;  3OSN A;  2OXO A;  3DEE A;  1JRP A;  1T4G A;  7ICK A;  4ED3 A;  2EZZ A;  4GXJ A;  8ICU A;  1B22 A;  3HRD D;  4DL3 A;  1ZD2 P;  4M6W B;  2I9G A;  4Q8E A;  2W8L A;  2R8H A;  2OM6 A;  2KK0 A;  4O5K A;  1A76 A;  4WJ3 B;  2HCF A;  3D6J A;  3G6X A;  3M9M B;  4TUQ A;  3V7J A;  2E1F A;  4EBE A;  4Y2Y A;  3QU2 A;  4ECT A;  3K75 D;  4JB3 A;  8ICA A;  8ICV A;  4PGX A;  4M9J A;  1B4F A;  1SKR A;  4RQ6 A;  1SXD A;  4KN4 A;  1N5X A;  4BGD A;  4Z6F A;  1T8E A;  1ZQG A;  5DGA A;  5CB1 A;  1S76 D;  5AI9 A;  4B9V A;  3MGI A;  3H0R B;  4DFD A;  4YR2 A;  8ICK A;  2GO7 A;  5EOZ A;  2FMQ A;  4QNL A;  4F5Q A;  3C5G A;  4GIB A;  3E58 A;  3E0F A;  2KP7 A;  1ZQP A;  9ICT A;  8ICZ A;  2HOQ A;  5AM5 A;  1N61 A;  4M47 A;  5B5E U;  5JTI A;  1IG6 A;  3HP6 A;  2LI6 A;  4MFA A;  1ZQH A;  3RJJ A;  1ARO P;  2VA8 A;  4I2G A;  3Q8S B;  3UPQ A;  2F44 A;  4FZN A;  4R65 A;  2FPL A;  2PXI A;  1FEZ A;  8ICO A;  5J2H A;  2OWO A;  1N63 A;  2KJ5 A;  5J2K A;  2H3F A;  8ICY A;  1Y88 A;  2ZXI A;  1XS9 D;  5DG7 A;  3LWM A;  2YB1 A;  3RBE A;  4ECR A;  4F72 A;  5KFS A;  3NUQ A;  3HKZ F;  1LKY A;  4QWD A;  5L9X A;  1RYU A;  1N5W A;  8ICB A;  2AGP A;  4FBU A;  4Y2R A;  4I28 A;  8ICE A;  3MBY A;  1BPZ A;  4GXK A;  4QIW C;  4UAT A;  3Q8K A;  4C7Z A;  3GV8 B;  1RZT A;  2PFQ A;  3TAD C;  2IHM A;  2H3I A;  3LVV A;  2NO4 A;  5ALV A;  5DQH A;  5KFA A;  4UAR A;  3KHG A;  2JH1 A;  5KG0 A;  5ALY A;  1UCV A;  1SB3 C;  3KD3 A;  3C21 A;  1CUK A;  2H5X A;  5KT5 A;  1F0M A;  5ALT A;  4UBB A;  4IQU A;  2VAN A;  4YXM A;  7ICS A;  2K8A A;  5ALX A;  4F93 B;  3SZ2 A;  5J2A A;  5ALM A;  1SKW A;  4QZ9 A;  3Q8L A;  2IA6 A;  4DS5 A;  3T3F A;  4K4H A;  3L3F X;  1X42 A;  4XRH A;  3RJI A;  2M9N A;  3UQ0 A;  4Y2Q A;  1NJY A;  5CP2 A;  4MF2 A;  4P0P B;  3GII A;  1DGJ A;  4MEX A;  1TK0 A;  3N4M B;  3T79 A;  3IP4 B;  2KZM A;  4J9S A;  5IIJ A;  3H4B A;  2ATL A;  2JH7 A;  4I29 A;  2XC9 A;  4P0Q A;  3PO4 A;  5ALO A;  2FMP A;  3IN5 A;  1X9X A;  4P4O A;  2XY5 A;  4C4S A;  3C1Z A;  3M9N B;  4AYB F;  5KFX A;  2RHF A;  1RYS A;  9ICW A;  4O3R A;  3S6J A;  3MFH A;  1BPB A;  2WB1 C;  2VA3 A;  3UMB A;  2C22 A;  1NZP A;  2JEI A;  4RUA A;  4I27 A;  1JN3 A;  8ICW A;  3L4P A;  2BDP A;  1S0O A;  4M0A A;  2RP5 A;  4QZB A;  4YD2 A;  1B0X A;  1Z00 B;  4UAU A;  2W3R A;  3RBD A;  5KFJ A;  4K4I A;  4RQ3 A;  4QZF A;  1ZQW A;  4PL2 A;  4C7Y A;  1UQV A;  1ZD4 A;  5J2E A;  1XU4 A;  4NXZ A;  1SL2 A;  1ZQD A;  5KG6 A;  2YTU A;  4FE3 A;  2EDU A;  3R9K A;  4ECU A;  5DBC A;  3F5E A;  2PMZ F;  1Q46 A;  5HP4 A;  1JXL A;  5KL8 B;  5ALK A;  1X40 A;  2Z7J A;  2DKX A;  3JPQ A;  4UAV A;  2DFL A;  4JV2 A;  5DLF A;  4ECQ A;  2YQE A;  1O03 A;  1NK9 A;  8ICM A;  3MFI A;  4M6W A;  1TAQ A;  3H8S A;  3MGH A;  2W7O A;  4M2Y A;  1IM4 A;  3C1Y A;  4KTQ A;  1TAU A;  3M9O B;  2NO5 A;  4F4Y A;  4J9O A;  1SV0 C;  2MUT B;  2ZUC A;  5KFH A;  4RQN A;  1BPY A;  2K4I A;  4QIW F;  3M8R A;  2LKY A;  5J2F A;  4K4G A;  3V72 A;  3OGU A;  5AKI A;  4Y2P A;  1ZQC A;  4QWB A;  1DOQ A;  5KG2 A;  4GFJ A;  2W9M A;  3HJE A;  5AHX A;  1Z4N A;  4XUS A;  3F2D A;  3SMV A;  5EWG A;  5DKW A;  1XO1 A;  5L1M A;  9ICI A;  1TV9 A;  2W9A A;  3GU3 A;  4FZL A;  2FI1 A;  2JV3 A;  4R64 A;  3NGD A;  3PZP A;  1M6Y A;  3TAN A;  4KLS A;  3RJK A;  3N97 B;  4KLM A;  1ZQB A;  4U6P A;  5KFK A;  1YZ6 A;  1TK5 A;  2F2A B;  1JAL A;  3ZD9 A;  1NZB A;  1Q3U A;  3RB4 A;  1KKX A;  8ICQ A;  4IC9 A;  1P7D A;  5JRT A;  3SI8 A;  2WF8 A;  2ZUD A;  4C8M A;  2FDR A;  5KFT A;  1NK7 A;  3V7K A;  4J9N A;  1PZN A;  2AQ0 A;  4UB2 A;  4FS2 A;  1KRP A;  5F9N A;  2HMX A;  3QNM A;  2WB1 F;  9ICE A;  4PGQ A;  3C2L A;  2W55 A;  4F3O A;  4KLE A;  1LVH A;  1N60 A;  1SZP A;  4NM2 A;  2ZIU B;  4RT3 A;  4EBC A;  2HOF A;  2K4P A;  4YP3 A;  1SKS A;  5AIA A;  4EX6 A;  9ICR A;  2QAR B;  7ICT A;  3C5F A;  2RDI A;  3I76 A;  1ZQV A;  3PSP A;  4E0D A;  2M0N A;  3PW2 A;  5A0L A;  2W04 A;  2Y9U A;  7ICJ A;  2WF5 A;  5DB8 A;  1NKC A;  3RR8 A;  1KFD A;  2LHT A;  2NRT A;  3PW5 A;  5AKX A;  2BPF A;  1L3S A;  1KSP A;  5DB7 A;  5AKK A;  1IIP A;  4G9B A;  3ZDB A;  4DOA A;  1URJ A;  4EEY A;  2PI5 A;  4DL7 A;  2ASL A;  1U49 A;  4GXI A;  2W54 A;  1L7M A;  4KIT B;  4P0P A;  3AQE A;  3MDC A;  4DQS A;  2A3V A;  5HNK A;  4CGZ A;  3UQ2 A;  3SAH A;  4P4M A;  7ICN A;  4F4K A;  1L3V A;  1RYR A;  4LJX A; 
#chains in the Genus database with same CATH homology
 2Y9T A;  1UQV A;  3BQ7 A;  2QB1 A;  1UCV A;  2F8K A;  3H8M A;  2YTU A;  2QAR A;  5JRT A;  1B4F A;  2ES6 A;  1F0M A;  2KSO B;  2DL0 A;  1SXD A;  1SXE A;  1X40 A;  2DKX A;  3KKA A;  2ESE A;  2K60 A;  3BS5 B;  3TAC B;  1SV0 A;  2EAN A;  1PK3 A;  1V85 A;  3HIL A;  3KKA C;  2FE9 A;  1PK1 A;  2D8C A;  2K4P A;  5J8Y A;  2QKQ A;  1KW4 A;  1SV0 C;  1LKY B;  2E8O A;  1OW5 A;  4NL9 A;  5JTI A;  3K1R B;  3BS7 A;  2QB0 B;  1SV4 A;  2D3D A;  1WWV A;  2QAR B;  4RQN A;  1V38 A;  2B6G A;  4IS7 A;  5J8Y C;  1OXJ A;  3SEN A;  2F44 A;  1DXS A;  2EAM A;  3SEI A;  2KMD A;  2KSO A;  2KE7 A;  2L5Y A;  2Y9U A;  4PZO A;  1X9X A;  4RQM A;  1RG6 A;  1COK A;  3BS5 A;  5F3X B;  5JU5 A;  4MHV A;  2E8M A;  2LPE A;  2E8P A;  2LMR A;  5L1M A;  4PZN A;  1LKY A;  1SGG A;  1X66 A;  3IDW A;  2GLE A;  1Z1V A;  4NL9 C;  2QB0 A;  2JV3 A;  3TAD A;  2KIV A;  1WWU A;  1B0X A;  4NJ8 A;  1PK1 B;  1JI7 A;  2DKZ A;  3TAD C;  5KNI A;  2EAO A;  2EAP A;  2E8N A;  2KG5 A;  2F3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...